Sequence alignment for CL0168

PF00024

Q9VCR4_DROME/150-255---------------------------------------CRGR-----LW.....ALTKIP-------------------
Q9VCR4_DROME/265-347---------------------------------------C...-----.......SYELYA-------------------
KLKB1_MOUSE/292-375---------------------------------------C...-----.......HSKIYS-------------------
PLMN_MOUSE/24-98---------------------------------------G...-----........YISTQ-------------------
KLKB1_MOUSE/21-104---------------------------------------C...-----.......MTQLYK-------------------
Q20167_CAEEL/20-106---------------------------------------CS..-----A.PN.ATTYLRSE-------------------
Q20167_CAEEL/304-382---------------------------------------C...-----I.E...ASFELVA-------------------
Q20167_CAEEL/205-297---------------------------------------CK..-----P.EE.TLHWVRTE-------------------
Q20167_CAEEL/113-200---------------------------------------C...-----K.A..PYSFERYP-------------------
Q22815_CAEEL/24-101---------------------------------------C...-----........FERYP-------------------
Q22815_CAEEL/470-555---------------------------------------C...-----......SNFVAFR-------------------
Q22815_CAEEL/375-459---------------------------------------CQ.Q-----DDVDVWIAFENSA-------------------
Q9V9X0_DROME/209-287---------------------------------------C...-----........IDRVQ-------------------
Q9V9X0_DROME/295-376---------------------------------------C...-----.......EFKRIS-------------------
Q18298_CAEEL/226-303---------------------------------------CP..-----N.G..RIEFVVTR-------------------
Q18298_CAEEL/312-390---------------------------------------C...-----N.R..PYSFEKMI-------------------
Q18298_CAEEL/142-219---------------------------------------CE..-----E.S..AYMFDTKK-------------------
Q18298_CAEEL/50-135---------------------------------------T...-----........FIRHI-------------------
Q21782_CAEEL/228-319---------------------------------------CP..-----L.GE.HSRVQIIE-------------------
Q21782_CAEEL/329-416---------------------------------------C...-----..D...DVFRRIP-------------------
O62201_CAEEL/632-720---------------------------------------CP..-----D.GQ.DVIFVRSN-------------------
O62201_CAEEL/729-814---------------------------------------C...-----S.G...GQPIRYR-------------------
HGFL_HUMAN/18-106---------------------------------------GQ..-----R.SP.LNDFQVLR-------------------
PLMN_PIG/20-99---------------------------------------D...-----S.L...DDYVNTQ-------------------
O45277_CAEEL/419-497---------------------------------------C...-----........YRLYN-------------------
O45277_CAEEL/80-160---------------------------------------C...-----........FVLHS-------------------
O45277_CAEEL/320-398---------------------------------------C...-----........FIKTP-------------------
PLMN_MACEU/17-99---------------------------------------GQ..-----G.ES.LENYIKTE-------------------
FA11_HUMAN/110-193---------------------------------------C...-----..N...K..DIYV-------------------
KLKB1_HUMAN/111-194---------------------------------------C...-----.......HRDIYK-------------------
Q9XUE5_CAEEL/21-112---------------------------------------CS..-----S.HE.TTAFVRIP-------------------
Q13208_HUMAN/5-81---------------------------------------CS..-----G.A..QS.YLLH.-------------------
Q94248_CAEEL/576-659---------------------------------------C...-----........YVELN-------------------
Q9VAG2_DROME/113-197---------------------------------------CN..-----P.E..LVGFEIVT-------------------
Q9U966_EIMTE/637-707---------------------------------------C...-----........FRQGV-------------------
O61834_CAEEL/108-192---------------------------------------CL..-----K.R..SFAFEKFP-------------------
Q9V9X1_DROME/320-401---------------------------------------C...-----.......EFKRVA-------------------
Q9W5Z0_DROME/15-98---------------------------------------C...-----H.R..PWSFERVP-------------------
Q9V9X1_DROME/145-223---------------------------------------G...-----........FELIT-------------------
KLKB1_RAT/111-194---------------------------------------C...-----.......HQDIYE-------------------
Q9U966_EIMTE/182-254---------------------------------------C...-----..........FSQ-------------------
Y2913_ARATH/341-418---------------------------------------CS..-----R.GD.INQFFRLP-------------------
FA11_HUMAN/200-283---------------------------------------C...-----.......IRDIFP-------------------
Q22902_CAEEL/114-194---------------------------------------C...-----........FTSTP-------------------
Q9XUE5_CAEEL/212-295---------------------------------------GP..-----S.GG.NLVFVKTT-------------------
Q9U966_EIMTE/263-337---------------------------------------C...-----...........TL-------------------
KLKB1_HUMAN/201-284---------------------------------------C...-----.......HMNIFQ-------------------
Q9VAG2_DROME/203-286---------------------------------------C...-----S.R..AWYVDRVQ-------------------
PLMN_ERIEU/17-99---------------------------------------GH..-----G.IP.LDDYVTTQ-------------------
Q91691_XENLA/29-114---------------------------------------AH..-----R.SA.LNDYQRSK-------------------
SD31_ARATH/332-413---------------------------------------C...-----K.S..GFNMVKFK-------------------
KLKB1_HUMAN/21-104---------------------------------------C...-----.......LTQLYE-------------------
Q9U966_EIMTE/421-490---------------------------------------C...-----..........AVR-------------------
B9PXJ3_TOXGV/141-214---------------------------------------C...-----........FEQH.-------------------
Q23328_CAEEL/311-391---------------------------------------CQ..-----N.D..EI.FILHV-------------------
Q91402_9PIPI/27-111---------------------------------------D...-----.......DYKKTA-------------------
MIA1_SARMU/112-181---------------------------------------C...-----......FPHDKNI-------------------
Q94248_CAEEL/448-532---------------------------------------C...-----........FEVID-------------------
KLKB1_RAT/201-284---------------------------------------C...-----......P.MDIFQ-------------------
Q9XUE5_CAEEL/305-382---------------------------------------CR..-----Q.Q..AA.FERFI-------------------
O61834_CAEEL/21-103---------------------------------------C...-----........EITFI-------------------
Q22902_CAEEL/21-95---------------------------------------C...-----........FDKSP-------------------
FA11_HUMAN/20-103---------------------------------------C...-----.......VTQLLK-------------------
B9PXJ3_TOXGV/68-137---------------------------------------C...-----.........VHSD-------------------
MIA2_SARMU/9-78---------------------------------------C...-----......FAHDKNI-------------------
Q90865_CHICK/18-104---------------------------------------GH..-----R.SP.LNDFQRLR-------------------
PLMN_BOVIN/24-106---------------------------------------GL..-----G.DL.LDDYVNTQ-------------------
Q23328_CAEEL/212-303---------------------------------------CK..-----T.S..SGYYVVVG-------------------
YMP9_CAEEL/49-134---------------------------------------C...-----P.Q..GLHADAIP-------------------
O42830_PHYPR/61-165---------------------------------------C...-----........AQQFP-------------------
Q9XUE5_CAEEL/122-204---------------------------------------CT..-----Y.R..SFSFERAR-------------------
O17347_CAEEL/123-203---------------------------------------C...-----A.Q...TQFIRVD-------------------
Q9U966_EIMTE/713-788---------------------------------------C...-----..Y...Q.....N-------------------
Q27394_CAEEL/123-209---------------------------------------CS..-----G.E..YA.FTYLS-------------------
Q94248_CAEEL/47-112---------------------------------------I...-----.............-------------------
Q9U966_EIMTE/863-932---------------------------------------C...-----.......TRAAI.-------------------
Q23328_CAEEL/23-103---------------------------------------C...-----........FKRVS-------------------
O97506_PIG/29-112---------------------------------------C...-----.......LPQLHK-------------------
Q94248_CAEEL/1063-1143---------------------------------------C...-----..S...Y.SALYQ-------------------
Q9Y1V3_POLMI/354-432---------------------------------------F...-----.........LDSF-------------------
FA11_HUMAN/291-374---------------------------------------C...-----..H...S.SFYHD-------------------
O61834_CAEEL/202-292---------------------------------------C...-----.......TFMRVN-------------------
B9PXJ3_TOXGV/419-496---------------------------------------C...-----..........VHT-------------------
Q90978_CHICK/30-120---------------------------------------KR..-----R.NP.LHDYKKTG-------------------
B9PXJ3_TOXGV/232-310---------------------------------------C...-----........IQLSD-------------------
HGF_HUMAN/40-124---------------------------------------H...-----.......EFKKSA-------------------
Q94248_CAEEL/242-320---------------------------------------C...-----........YRTIR-------------------
Q9W5Z0_DROME/118-206---------------------------------------G...-----......VSEEKVA-------------------

PF14295

Q7QD96_ANOGA/35-86---------------------------------------------------------FDFQ-------------------
B6JDB0_OLICO/42-92---------------------------------------------------------FDRP-------------------
B6JDB0_OLICO/125-176---------------------------------------------------------TDRY-------------------
Q21BD4_RHOPB/39-89---------------------------------------------------------FDRP-------------------
Q1QRJ6_NITHX/50-100---------------------------------------------------------FDRP-------------------
Q1QRJ6_NITHX/133-187---------------------------------------------------------TDRS-------------------
A4Z2E2_BRASO/27-77---------------------------------------------------------SDRP-------------------
C5BI67_TERTT/43-100---------------------------------------------------------TDLP-------------------
C5BI67_TERTT/122-170---------------------------------------------------------TDRA-------------------
A4S6G3_OSTLU/377-434---------------------------------------------------------AEYE-------------------
A4S6G3_OSTLU/486-538---------------------------------------------------------ANYD-------------------
A4S6G3_OSTLU/585-643---------------------------------------------------------ANYK-------------------
Q2FN86_METHJ/487-537---------------------------------------------------------TNRP-------------------
B2VUM0_PYRTR/713-759---------------------------------------------------------VDRF-------------------
C1E8G6_MICCC/523-580---------------------------------------------------------AELD-------------------
C1E8G6_MICCC/640-698---------------------------------------------------------ANYK-------------------
C1MZS3_MICPC/544-601---------------------------------------------------------THLY-------------------
C1MZS3_MICPC/661-719---------------------------------------------------------ANYK-------------------
D3P9U3_DEFDS/608-658---------------------------------------------------------TDRP-------------------
A4YQL0_BRASO/32-87---------------------------------------------------------IDRP-------------------
Q212S6_RHOPB/26-77---------------------------------------------------------KDRM-------------------
A9V0Z5_MONBE/42-102---------------------------------------------------------INYP-------------------
A8IFR1_CHLRE/186-243---------------------------------------------------------TDLD-------------------
A8XZR6_CAEBR/34-85---------------------------------------------------------RNFN-------------------
Q0C462_HYPNA/58-105---------------------------------------------------------VYRF-------------------
A9VDX2_MONBE/32-89---------------------------------------------------------TTRT-------------------
Q0AR81_MARMM/29-79---------------------------------------------------------HARR-------------------
A9UWV1_MONBE/136-181---------------------------------------------------------VDMQ-------------------
C1E8N1_MICCC/219-266---------------------------------------------------------VEIR-------------------
Q7SFE8_NEUCR/154-203---------------------------------------------------------VDYT-------------------
C1FJX3_MICCC/235-285---------------------------------------------------------TEYW-------------------
A9UVN3_MONBE/45-98---------------------------------------------------------VDYP-------------------
C1MHF5_MICPC/168-214---------------------------------------------------------TERW-------------------
Q0UP20_PHANO/126-176---------------------------------------------------------IDHV-------------------
A7UVW4_NEUCR/512-562---------------------------------------------------------IEYP-------------------
V5ILY1_NEUCR/1388-1435---------------------------------------------------------TDHE-------------------

PF07502

G3NSW1_GASAC/41-130-------------------------------------QTCLAR.....FK.NGRDDFVLDA-------------------
B7PSB0_IXOSC/57-154-------------------------------------...IES.....FQ..INENRIIRT-------------------
H2U8H9_TAKRU/6-100-------------------------------------EGCLEK.....FK.KGRDDFILDA-------------------
W5KZ36_ASTMX/28-122-------------------------------------QQCMSK.....FT.QGKDGFVLDT-------------------
I3K2I2_ORENI/38-127-------------------------------------EQCLAQ.....FE.EGRENFVLDA-------------------
G3PKT8_GASAC/29-121-------------------------------------ASCSAA.....FR.SGPEDFVLDA-------------------
T1J182_STRMM/41-125-------------------------------------SVCLND.....FQ..VSDTTIIRT-------------------
V8N7R6_OPHHA/37-128-------------------------------------ETCLAQ.....FT.AGFPEFVLDT-------------------
H2ZBX2_CIOSA/69-166-------------------------------------DSCSNK.....FL..ENKNKIIRT-------------------
F6ZSJ7_XENTR/27-116-------------------------------------QRCLSR.........PIPDMTIAI-------------------
M4A584_XIPMA/31-117-------------------------------------....DE.....FV.SGSENFVLDA-------------------
A7RY69_NEMVE/28-116-------------------------------------DGCPKI........QVKKNQILRT-------------------
H2MTN1_ORYLA/73-163-------------------------------------DSCVVD.....FS..ASKERIIRT-------------------
H2MRG4_ORYLA/29-119-------------------------------------EACLSN.....FK.KGKEDFVLDT-------------------
F6YM27_ORNAN/27-116-------------------------------------QSCPVE.........KREGVVVDI-------------------
U3IZT3_ANAPL/23-112-------------------------------------QGCSAE.........KEENAIVDI-------------------
F6SZP7_MONDO/126-217-------------------------------------STCLEQ.....YT.VGVPDFVLDT-------------------
M4ANK0_XIPMA/35-125-------------------------------------DSCAGD.....FS..AAEQRIIRT-------------------
H9GRZ2_ANOCA/88-178-------------------------------------.RCASGGA...FS..SRPDSIIRT-------------------
H3C9I2_TETNG/27-117-------------------------------------DSCVGD.....FS..SVGDSIIQA-------------------
Q2KJJ7_BOVIN/42-133-------------------------------------DGCLNR.....FT.PGVPDFVLDT-------------------
J9JMW5_ACYPI/27-110-------------------------------------.GCANR.....FE..VHDDKIIRT-------------------
G3NW92_GASAC/36-126-------------------------------------DSCAGD.....FD..AVGERIIRT-------------------
W5NBX0_LEPOC/28-114-------------------------------------DGCPEA.....FVKLTGQGL...D-------------------
G6D1B9_DANPL/170-253-------------------------------------.SCVAR.....FD..VQRDKIIRT-------------------
W4Z7Q6_STRPU/149-240-------------------------------------..CTRE.....ADYEISQNYIIRT-------------------
B0WBN2_CULQU/54-138-------------------------------------EMCLVR.....FD..VHLNTIIRT-------------------
W5KPE8_ASTMX/26-115-------------------------------------DSCTEL.....FT.EGRADFAVNA-------------------
F6QXL1_CIOIN/65-162-------------------------------------SQCAGQ.....FT..ENTNRIIRT-------------------
K7JW67_NASVI/40-124-------------------------------------QTCIDG.....FV..VHRDKIIRT-------------------
G5BM03_HETGA/34-125-------------------------------------DSCLAG.....FT.SGVPDFVLDT-------------------
H3BGP2_LATCH/23-112-------------------------------------EHCFTD.........QMEDVIIDI-------------------
I3JDS1_ORENI/38-128-------------------------------------DSCVGD.....FS..AVGDRIIRA-------------------
H3BX24_TETNG/31-120-------------------------------------DGCLAD.....FQ.KGKDDFILDT-------------------
Q5VYB9_HUMAN/87-183-------------------------------------EDCPGPGSGG.YS..AMPDAIIRT-------------------
G1T9A5_RABIT/35-126-------------------------------------AICKDR.....FT.ARVPDFVLDI-------------------
F1NZW5_CHICK/24-113-------------------------------------QGCAAQ.........RMDNAIIDI-------------------
G3WZ70_SARHA/92-183-------------------------------------AGCPGGG....YS..VKPDSIIRT-------------------
H3BSM2_HUMAN/110-201-------------------------------------ADCLNS.....FT.AGVPGFVLDT-------------------
F7AX87_MOUSE/47-146-------------------------------------EDCPGAGGTAVYR..AVPDTIIRT-------------------
W5N574_LEPOC/31-120-------------------------------------EECLIN.....FT.TGRPGFVLDT-------------------
H9G7H3_ANOCA/36-128-------------------------------------EKCLAH.....FT.AGLREFVLDP-------------------
U3J961_ANAPL/36-127-------------------------------------ETCLED.....FT.VGMPGLVLDT-------------------
Q0VC64_BOVIN/27-116-------------------------------------QNCLTE.........SLEDVVIDI-------------------
H3CGS7_TETNG/5-97-------------------------------------AACSGA.....FR.PGPEDFVLDS-------------------
U3JUF3_FICAL/107-198-------------------------------------ERCLED.....FT.AGLPDWVLDT-------------------
H2SB93_TAKRU/7-99-------------------------------------AQCNSA.....FR.SGPEDFVLDS-------------------
M3ZWM5_XIPMA/39-127-------------------------------------DTCLSK.....FD.TGKDNFMLNA-------------------
W5NIC2_LEPOC/29-117-------------------------------------QSCGRE.........VHTDMTVDI-------------------
W5KI63_ASTMX/67-158-------------------------------------QACLSR.....FD..SAESHIIRA-------------------
F6RCL0_XENTR/2-92-------------------------------------ETCLDK.....FT.KGFHDFVLDL-------------------
E7F1U6_DANRE/26-113-------------------------------------QQCVET.....FHHPGRENFVLHT-------------------
W5NK71_LEPOC/80-170-------------------------------------DECLNS.....YN..AIEDYIIRA-------------------
I3KRH2_ORENI/28-116-------------------------------------.YCQDK.....FR.RGNEDFVLYA-------------------
C3Y0Q3_BRAFL/44-132-------------------------------------PECEDL.....FR..TDLNQIIQT-------------------
H0ZR45_TAEGU/15-104-------------------------------------QECSAE.........KMENTIIDI-------------------
E9FR71_DAPPU/84-170-------------------------------------GGCLEQ.....SE..ISENTIIRT-------------------
E0VZG2_PEDHC/38-122-------------------------------------ETCIEN.....FD..IHIDKIIRT-------------------
H2RSF4_TAKRU/27-117-------------------------------------DSCVGD.....FG..SLGDSIIQT-------------------
G3TDS8_LOXAF/45-136-------------------------------------TACLDL.....FT.AGVPAFVLDT-------------------
B4JE50_DROGR/43-127-------------------------------------ESCIGH.....FD..VHKNTIIRT-------------------
MANS1_MOUSE/26-115-------------------------------------QNCLTK.........SLEDVVIDI-------------------

PF08276

Y4729_ARATH/342-409---------------------------------------C.........GKGEDGFLKIS.-------------------
Y1137_ARATH/337-407---------------------------------------CDVNSSATAQANNGDIFDIVA.-------------------
RKS1_ARATH/338-406---------------------------------------C..........SEKDGFVKLK.-------------------
Y4119_ARATH/368-431---------------------------------------C.........YKRNDEFLPIE.-------------------
Y1148_ARATH/333-399---------------------------------------CQGN....TNGKTVNGFYHVA.-------------------
Y1643_ARATH/332-398---------------------------------------CQGN....SSGKDANVFYTVP.-------------------
Y1141_ARATH/341-409---------------------------------------C..........NGKEGFAKLK.-------------------
Y1112_ARATH/338-408---------------------------------------CQANLSTKTQGKGVDVFYRLA.-------------------
Y1150_ARATH/334-400---------------------------------------CLGN....STGEDADDFHQIA.-------------------
Y4230_ARATH/339-410---------------------------------------CGK.....DGVVVGDMFLNLS.-------------------
SD11_ARATH/345-413---------------------------------------C..........EKKDAFVKFP.-------------------
Q7XXJ5_ORYSJ/359-424---------------------------------------CTR......NTSSTDIFHPLI.-------------------
Q7XQT8_ORYSJ/353-423---------------------------------------C...........ATDGFLTVR.-------------------
Q943Q1_ORYSJ/357-425---------------------------------------CVGSN..TSSSDSTDKFYSMS.-------------------
Q7XMR2_ORYSJ/371-438---------------------------------------CTIS...GNRTSSADMFHPIA.-------------------
Q7XQX5_ORYSJ/351-414---------------------------------------CV........SSRSDIFNAVP.-------------------
Q7XQT7_ORYSJ/350-421---------------------------------------CG.......NTTTTDGFALVQ.-------------------
Q60D68_ORYSJ/362-427---------------------------------------CGN......TTSSTDVFQAIA.-------------------
Q7EZ32_ORYSJ/358-422---------------------------------------CQ.......VNQTGDGFLSIP.-------------------
Y1661_ARATH/350-416---------------------------------------CNQS....LVAGQEDGFTVLK.-------------------
Q7XI25_ORYSJ/379-447---------------------------------------CASGK..QNNTSSTDMFHPIA.-------------------
SD17_ARATH/341-407---------------------------------------C..........DGRDGFTRLK.-------------------
Q60EJ2_ORYSJ/344-413---------------------------------------C.........ANGTDGFAVVR.-------------------
B120_ARATH/346-412---------------------------------------CER.....NISVGEDEFLTLK.-------------------
Q7Y1P1_ORYSJ/344-411---------------------------------------C..........TGGDGFAVTR.-------------------
Q8LQN6_ORYSJ/344-412---------------------------------------C.........DGAGDGFWTVN.-------------------
Q851M7_ORYSJ/328-394---------------------------------------C..........PGNSTMLQLDN-------------------
Q8H821_ORYSJ/354-415---------------------------------------C...........HGDGFLALPY-------------------
D7KZN2_ARALL/365-430---------------------------------------C...........HGDVFFLMK.-------------------
D7MEU3_ARALL/350-416---------------------------------------C..........GGGDGFVRLK.-------------------
D7MEU5_ARALL/350-415---------------------------------------C...........GRDGFTQLR.-------------------
I1QYI6_ORYGL/369-433---------------------------------------CPS......NRSSTDMFHTIT.-------------------
M4C7T3_BRARP/338-404---------------------------------------C..........GGKDGFARLK.-------------------
M4CIU6_BRARP/181-247---------------------------------------C..........DGRDGFVAVK.-------------------
M4CIZ5_BRARP/356-420---------------------------------------C...........SGDGFLRLN.-------------------
M4FHL1_BRARP/345-410---------------------------------------C...........SGNRFLLLK.-------------------
PSRK_ARATH/348-413---------------------------------------C...........GEDRFFRLM.-------------------
W5BTS4_WHEAT/325-394---------------------------------------C..........GQGDSFITLL.-------------------

PF08277

O16726_CAEEL/19-83--------------------------------------------------------MVVVY-------------------
Q18574_CAEEL/20-92--------------------------------------------------------MIIHH-------------------
O62154_CAEEL/24-92--------------------------------------------------------MIKIF-------------------
O17672_CAEEL/26-95--------------------------------------------------------MILIH-------------------
Q9U2V0_CAEEL/23-94--------------------------------------------------------MLIFY-------------------
O01337_CAEEL/48-117--------------------------------------------------------MVLLH-------------------
O62150_CAEEL/25-95--------------------------------------------------------MVLFY-------------------
O01701_CAEEL/22-92--------------------------------------------------------LIEIY-------------------
O01336_CAEEL/22-95--------------------------------------------------------MVLMH-------------------
Q9XVD0_CAEEL/1-71--------------------------------------------------------MIVSW-------------------
O44831_CAEEL/18-94--------------------------------------------------------MIIVR-------------------
Q9N4A0_CAEEL/25-95--------------------------------------------------------MVVME-------------------
O02127_CAEEL/50-122--------------------------------------------------------MLLFW-------------------
Q9NA49_CAEEL/29-98--------------------------------------------------------MVVIW-------------------
Q9GRV4_CAEEL/22-94--------------------------------------------------------MVLIY-------------------
A8XBL6_CAEBR/41-108--------------------------------------------------------IVKVW-------------------
Q9U2Q4_CAEEL/178-252--------------------------------------------------------MVQVN-------------------
O44833_CAEEL/23-99--------------------------------------------------------MVAVK-------------------
A8WJ07_CAEBR/13-84--------------------------------------------------------MLLSW-------------------
A8Y004_CAEBR/24-93--------------------------------------------------------MIRIL-------------------
O02128_CAEEL/1-73--------------------------------------------------------MLLFW-------------------
O62406_CAEEL/24-92--------------------------------------------------------MVLIY-------------------
O16210_CAEEL/23-99--------------------------------------------------------MLKMW-------------------
Q9NEP2_CAEEL/1-72--------------------------------------------------------MVVFY-------------------
Q9XV53_CAEEL/24-96--------------------------------------------------------FGVID-------------------
Q7YTL3_CAEEL/26-97--------------------------------------------------------MVIIW-------------------
A8Y003_CAEBR/24-93--------------------------------------------------------MIRIS-------------------
O02131_CAEEL/21-93--------------------------------------------------------MLLFW-------------------
A8XU86_CAEBR/1-68--------------------------------------------------------MVITN-------------------
O16208_CAEEL/30-102--------------------------------------------------------FGTVH-------------------
Q9NA50_CAEEL/26-95--------------------------------------------------------LVLIW-------------------
O44835_CAEEL/16-89--------------------------------------------------------MVSVR-------------------
O45492_CAEEL/23-95--------------------------------------------------------MLLFY-------------------
Q9N522_CAEEL/20-88--------------------------------------------------------LIEIY-------------------
Q9U2Q4_CAEEL/29-101--------------------------------------------------------FAIVD-------------------
Q9N4B3_CAEEL/1-70--------------------------------------------------------ML.VW-------------------
Q9XTS6_CAEEL/1-68--------------------------------------------------------MMVTF-------------------
A4F307_CAEEL/1-67--------------------------------------------------------MVVIF-------------------

PF02430

A5K4Z2_PLAVS/55-520WKAFMEKYDIERTHSSGVRVDLGEDAEVENAKYRIPAGRCPVFGKGIVIENSDVSFLRPVATGDQKLKDGGFAFPNA...
Q4YZP5_PLABA/17-475WEKYMEKYDIEKMHGSGIRVDLGEDARVENRDYRIPSGKCPVIGKGITIQNSEVSFLTPVATGDQSVRSGGLALPKT...
A7ASF6_BABBO/97-566WIKYMQKFDIPRNHGSGIYVDLGGYESVGSKSYRMPVGKCPVVGKIIDLGNG.ADFLDPISSEDPSYR..GLAFPETAVD
Q4UHH9_THEAN/247-742WTDFMAKFDIAKVHGSGVYVDLGESATVGSYDYRMPIGKCPVVGKAIILENG.ADFLSSITHHDPKER..GLGFPATKVA
Q7KQK5_PLAF7/110-580WTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGGFAFPPT...

PF00024

Q9VCR4_DROME/150-255------------------------------------------GSTL---VY......HSKK--TI-STL....VT-RREC
Q9VCR4_DROME/265-347------------------------------------------NSSF---IY......AEAR--YL-.GL.....S-QKEC
KLKB1_MOUSE/292-375------------------------------------------GVDF---EG......EELN--VT-.FV....QG-ADVC
PLMN_MOUSE/24-98------------------------------------------GASL---FS......LTKK--QL-.AA....GG-VSDC
KLKB1_MOUSE/21-104------------------------------------------NTFF---RG......GDLA--AI-.YT....PD-AQYC
Q20167_CAEEL/20-106------------------------------------------GTRL---ME......FSTK--VM-KDV.....T-LNEC
Q20167_CAEEL/304-382------------------------------------------NRMM---TS......AYKT--IS-.AL.....S-QHEC
Q20167_CAEEL/205-297------------------------------------------EYLI---DE......SKDV--IV-.ES....SD-AQEC
Q20167_CAEEL/113-200------------------------------------------QSIL---IG......HAMK--VL-.TV....DG-LSDC
Q22815_CAEEL/24-101------------------------------------------NHRL---VNV....RPYHS--EW-.RM....KT-EDMC
Q22815_CAEEL/470-555------------------------------------------DYSV---RI......EAVE--EF-NDLPKGYDG-MQLC
Q22815_CAEEL/375-459------------------------------------------QAEE---SE......NVDI--DS-.NV....PN-KREC
Q9V9X0_DROME/209-287------------------------------------------GYRL---PE......HVKS--SQ-.TV....LS-RRDC
Q9V9X0_DROME/295-376------------------------------------------GKIL---KT......VDSV--YQ-.DI....NT-IDEC
Q18298_CAEEL/226-303------------------------------------------KADV---PS......FGIS--LG-..V....KS-IRSC
Q18298_CAEEL/312-390------------------------------------------TSKL---VN.....SSIIK--EI-.TN....QS-TEKC
Q18298_CAEEL/142-219------------------------------------------GYRI---DE......TPIR--II-.DA....TA-EVQC
Q18298_CAEEL/50-135------------------------------------------GTRH---ID......GPAF--VA-.KI.....D-MVTC
Q21782_CAEEL/228-319------------------------------------------GVEV---SR......EATI--TF-.QV....AI-LEQC
Q21782_CAEEL/329-416------------------------------------------QHIL---LG......HASE--VI-.SV....AS-ENEC
O62201_CAEEL/632-720------------------------------------------DVES---SN......NHQN--YV-.EI.....T-EDDC
O62201_CAEEL/729-814------------------------------------------QKVL---IG......HLVD--AH-.SV....GS-AAEC
HGFL_HUMAN/18-106------------------------------------------GTEL---QHLLHAVVPGPW--QE-.DV....AD-AEEC
PLMN_PIG/20-99------------------------------------------GAFL---FS......LSRK--QV-.AA....RS-VEEC
O45277_CAEEL/419-497------------------------------------------NSIY---NS......FDAT--IV-GGL....QD-LESC
O45277_CAEEL/80-160------------------------------------------NEFL---EK......SGNV--LI-ENI....DD-VNEC
O45277_CAEEL/320-398------------------------------------------NRIL---HK......FEES--RI-GGV.....T-LETC
PLMN_MACEU/17-99------------------------------------------GASL---SN......SQKK--QF-.VA....SS-TEEC
FA11_HUMAN/110-193------------------------------------------DLDM---KG.....INYNS--SV-..A....KS-AQEC
KLKB1_HUMAN/111-194------------------------------------------GVDM---RG......VNFN--VS-.KV....SS-VEEC
Q9XUE5_CAEEL/21-112------------------------------------------RARL---DG......TPVV--IS-.TA....GH-DLTC
Q13208_HUMAN/5-81------------------------------------------.AVV---PG........PW--QE-.DV....AD-AEEC
Q94248_CAEEL/576-659------------------------------------------DFVL---EG......TAIA--VE-TAV.....T-PEEC
Q9VAG2_DROME/113-197------------------------------------------GYVF---SAP...EKLMDS--QP-GTL.....M-LTDC
Q9U966_EIMTE/637-707------------------------------------------GYKA---TE.....ANLLW--TL-.PS....EN-AEEC
O61834_CAEEL/108-192------------------------------------------GRSL---VNS....SFIIK--TF-.SI.....S-MEEC
Q9V9X1_DROME/320-401------------------------------------------GRIL---.K......TVDS--VH-QNV....QT-LDEC
Q9W5Z0_DROME/15-98------------------------------------------NKVI---RG......LDNA--LI-.YT....ST-KEAC
Q9V9X1_DROME/145-223------------------------------------------GYVL---SAP....SKQLE--TL-PGT....LM-LTDC
KLKB1_RAT/111-194------------------------------------------GLDM---RG......SNFN--IS-.KT....DS-IEEC
Q9U966_EIMTE/182-254------------------------------------------GRKL---SS......EGKS--LG-.TA....NN-ANIC
Y2913_ARATH/341-418------------------------------------------NMKL---AD......NSEV--LT-.RT.....S-LSIC
FA11_HUMAN/200-283------------------------------------------NTVF---AD......SNID--SV-.MA....PD-AFVC
Q22902_CAEEL/114-194------------------------------------------GKVL---IG......IVDQ--LV-RDV....AT-VNDC
Q9XUE5_CAEEL/212-295------------------------------------------NFEI---RY.....YDHTQ--SV-.EA.....Q-ESYC
Q9U966_EIMTE/263-337------------------------------------------QVDL---TGD...AGNHIE--AP-.NV....ST-IEQC
KLKB1_HUMAN/201-284------------------------------------------HLAF---SD......VDVA--RV-.LT....PD-AFVC
Q9VAG2_DROME/203-286------------------------------------------NYKL---KT......EVKR--TV-.SV....AS-RREC
PLMN_ERIEU/17-99------------------------------------------GASL---CS......STKK--QL-.SV....GS-TEEC
Q91691_XENLA/29-114------------------------------------------GLEL---VHM...NNGGVK--QE-.IQ....SE-IQVC
SD31_ARATH/332-413------------------------------------------NLEL---YGI...YPANDS--VI-SQI.....S-SQRC
KLKB1_HUMAN/21-104------------------------------------------NAFF---RG......GDVA--SM-.YT....PN-AQYC
Q9U966_EIMTE/421-490------------------------------------------GSRY---.G......TIPI--ST-QTV....DN-ATLC
B9PXJ3_TOXGV/141-214------------------------------------------.VSY---EG.....APDVM--TA-MVT....SQ-SADC
Q23328_CAEEL/311-391------------------------------------------QKTL---SK......RRRI--TT-KAA....SS-ITDC
Q91402_9PIPI/27-111------------------------------------------ETTL---TRL...NKALEV--KT-KMF....NT-TENC
MIA1_SARMU/112-181------------------------------------------GSRT---TE......VAVV--QV-.......SS-VQDC
Q94248_CAEEL/448-532------------------------------------------DHLM---VS.....VAGGL--EH-.DM.....S-IEEC
KLKB1_RAT/201-284------------------------------------------HFAF---AD......LNVS--QV-.VT....PD-AFVC
Q9XUE5_CAEEL/305-382------------------------------------------GSSI---EG......EVVA--SA-QGV.....T-ISDC
O61834_CAEEL/21-103------------------------------------------LETL---KSVN..STASLI--IR-KSV....DS-LSQC
Q22902_CAEEL/21-95------------------------------------------NKSL---FA......RPLI--SL-RNL.....S-LDKC
FA11_HUMAN/20-103------------------------------------------DTCF---EG......GDIT--TV-.FT....PS-AKYC
B9PXJ3_TOXGV/68-137------------------------------------------NKGS---RA.....PTIGE--PV-PDV.....S-LEQC
MIA2_SARMU/9-78------------------------------------------GSRT---EQ........LS--VV-.HV....AS-AQDC
Q90865_CHICK/18-104------------------------------------------GTEL---RAAP..NEPPPS--AP-.AH....GA-AQQC
PLMN_BOVIN/24-106------------------------------------------GASL---LS......LSRK--NL-.AG....RS-VEDC
Q23328_CAEEL/212-303------------------------------------------NEIV---LPI...SGGDVQ--VY-NEV.....E-QGDC
YMP9_CAEEL/49-134------------------------------------------EYVY---FG......TMLA--TM-.TV....DE-HDQC
O42830_PHYPR/61-165------------------------------------------NVDF---NG......DDIQ--TI-YGI.....Q-PGEC
Q9XUE5_CAEEL/122-204------------------------------------------NTQL---EG......FVKK--SV-.TV....EN-REHC
O17347_CAEEL/123-203------------------------------------------QSVL---VG......YAVN--MT-.LT....DS-IESC
Q9U966_EIMTE/713-788------------------------------------------GVSF---TG.....GKAIS--EA-KAA.....S-SQAC
Q27394_CAEEL/123-209------------------------------------------DRYM---DQ......KSVI--KW-TTK....AN-LEEC
Q94248_CAEEL/47-112------------------------------------------....---............--..-.NL....AS-VKEC
Q9U966_EIMTE/863-932------------------------------------------..AF---GG......KELQ--TV-SGL....PH-ETVC
Q23328_CAEEL/23-103------------------------------------------RRSI---GN......YAPI--AE-YRR....TA-LTMC
O97506_PIG/29-112------------------------------------------NTFF---RG......GDVS--AM-.YT....PS-ARHC
Q94248_CAEEL/1063-1143------------------------------------------TSFL---GR......RLLK--AV-.RV....KT-PADC
Q9Y1V3_POLMI/354-432------------------------------------------TKTT---GYKL.RTKRYQL--QW-EHV.....N-AYVC
FA11_HUMAN/291-374------------------------------------------TDFL---GE......ELDI--VA-..A....KS-HEAC
O61834_CAEEL/202-292------------------------------------------GGGL---KS......VSDQ--LI-QNV....GS-FDEC
B9PXJ3_TOXGV/419-496------------------------------------------GNIG---SK.....AQTIG--EV-KRA....SS-LSEC
Q90978_CHICK/30-120------------------------------------------ELML---IKV...NKTLEV--KT-KLL....NT-TEQC
B9PXJ3_TOXGV/232-310------------------------------------------VGSM---TA......DLEE--PM-.EA....DS-VGAC
HGF_HUMAN/40-124------------------------------------------KTTL---IKI...DPALKI--KT-KKV....NT-ADQC
Q94248_CAEEL/242-320------------------------------------------HRYL---LG......ADFE--EH-.DV....DS-VNDC
Q9W5Z0_DROME/118-206------------------------------------------QYVG---LH.....YYTDK--EL-.QV....TS-ESAC

PF14295

Q7QD96_ANOGA/35-86------------------------------------------GTTY--.YS...V......--KN.L.......S.LYEC
B6JDB0_OLICO/42-92------------------------------------------GGDY--.AHL.EI......--VS.G.......D.PAAC
B6JDB0_OLICO/125-176------------------------------------------GGDY--.RSI.TV.....P--PD.S.......E.GDHC
Q21BD4_RHOPB/39-89------------------------------------------GGDY--.SRT.AI......--SS.G.......D.PADC
Q1QRJ6_NITHX/50-100------------------------------------------GADY--.LRM.PL......--RS.G.......D.PADC
Q1QRJ6_NITHX/133-187------------------------------------------GGDY--.RGF.EIKK..DE--RA.D.......A.DQIC
A4Z2E2_BRASO/27-77------------------------------------------GGDY--.MSA.PI......--ES.G.......D.PADC
C5BI67_TERTT/43-100------------------------------------------GNDI--.QHY.VL......--PS.SYVGNIDLR.EGMC
C5BI67_TERTT/122-170------------------------------------------GADY--.RSF.........--NS.N.......Q.PRVC
A4S6G3_OSTLU/377-434------------------------------------------GSTL--.TTG.LF......--LV.P.......S.PEAC
A4S6G3_OSTLU/486-538------------------------------------------GIQI--.SI...V......--NA.V.......S.WSAC
A4S6G3_OSTLU/585-643------------------------------------------GHPL--.NSGSDL......--VV.D.......S.ETEC
Q2FN86_METHJ/487-537------------------------------------------GEDY--.TVF.DL......--SS.P.......D.PEAC
B2VUM0_PYRTR/713-759------------------------------------------GNDL--.KNG.LV......--FA.D.......T.WERC
C1E8G6_MICCC/523-580------------------------------------------GEVL--.NGG.TF......--LT.S.......S.AGAC
C1E8G6_MICCC/640-698------------------------------------------GDPL--IDGT.NL......--LV.D.......S.PEAC
C1MZS3_MICPC/544-601------------------------------------------GDVL--.NGG.TF......--LT.S.......S.MGAC
C1MZS3_MICPC/661-719------------------------------------------GDPL--.NDGTEL......--LV.D.......S.AEAC
D3P9U3_DEFDS/608-658------------------------------------------GYDY--.KNF.DL......--PQ.N.......N.AMLC
A4YQL0_BRASO/32-87------------------------------------------GGDY--.RSF.DT......--.F.D.......D.AQAC
Q212S6_RHOPB/26-77------------------------------------------GADI--.ANF.VL......--PA.N.......SLPENC
A9V0Z5_MONBE/42-102------------------------------------------GNDL--.PNM.PVP....L--VA.A.......N.PELC
A8IFR1_CHLRE/186-243------------------------------------------GKVL--.NNG.DW.....T--YV.D.......S.PDDC
A8XZR6_CAEBR/34-85------------------------------------------SSDI--.EKV..LE....K--SV.D.......S.LSQC
Q0C462_HYPNA/58-105------------------------------------------GATY--.AV...V......--SS.V.......S.SLAC
A9VDX2_MONBE/32-89------------------------------------------GSDY--.DWI.EL.....P--IN.S.......T.VDDC
Q0AR81_MARMM/29-79------------------------------------------GAVY--.QTL.AA......--DS.L.......T.PRAC
A9UWV1_MONBE/136-181------------------------------------------NHDI--.TNF.........--PV.Q.......R.PEDC
C1E8N1_MICCC/219-266------------------------------------------GGDL--.RRGPPV......--PAPA.......S.REDC
Q7SFE8_NEUCR/154-203------------------------------------------ADDL--.GNF.........--LA.G.......N.MAEC
C1FJX3_MICCC/235-285------------------------------------------GDVV--.EEG.TV.....G--LI.R.......T.PEEC
A9UVN3_MONBE/45-98------------------------------------------GNDM--.APC.GSNGCKMD--ST.S.......D.HLDC
C1MHF5_MICPC/168-214------------------------------------------GDVV--.KNG.NE.....N--LR.D.......D.AAGC
Q0UP20_PHANO/126-176------------------------------------------GGDI--.SWS.GNG....F--IT.K.......C.LEEC
A7UVW4_NEUCR/512-562------------------------------------------DGDL--.GT...V......--IV.D.......S.YAEC
V5ILY1_NEUCR/1388-1435------------------------------------------GGDL--.AL...A......--YV.D.......S.YALC

PF07502

G3NSW1_GASAC/41-130------------------------------------------DESV--NDGATFIS.SPPL..TR-----------QRDC
B7PSB0_IXOSC/57-154------------------------------------------EDSR--RMGARYLN.ETQM..GS-----------NRDC
H2U8H9_TAKRU/6-100------------------------------------------DESV--KDGATYLS.SPKL..GR-----------YRDC
W5KZ36_ASTMX/28-122------------------------------------------DESV--KEGATFLS.SPQV..ST-----------VSEC
I3K2I2_ORENI/38-127------------------------------------------DGSV--KDGATFIS.SPKL..YR-----------HKDC
G3PKT8_GASAC/29-121------------------------------------------EAAV--KAGAALLS.SARV..RS-----------AEAC
T1J182_STRMM/41-125------------------------------------------QDSR--QMGAKYLN.ETEM..PS-----------KEEC
V8N7R6_OPHHA/37-128------------------------------------------NASV--ENGATFLA.SPPV..ES-----------SRDC
H2ZBX2_CIOSA/69-166------------------------------------------EESI--QNGAKFLKASTKQ..MS-----------AESC
F6ZSJ7_XENTR/27-116------------------------------------------SGEV--LQNVRGTD.PLYA..AN-----------AEEC
M4A584_XIPMA/31-117------------------------------------------KDAV--EDGADLLD.TQVV..SV-----------DEEC
A7RY69_NEMVE/28-116------------------------------------------KEAL--NNGAKYLK.RAVI..ST-----------AREC
H2MTN1_ORYLA/73-163------------------------------------------KVST--QHGAAFLLAPDRV..HS-----------WRDC
H2MRG4_ORYLA/29-119------------------------------------------DESV--KHGATFIT.APKV..SQ-----------EKEC
F6YM27_ORNAN/27-116------------------------------------------QAAF--SRGIRSSE.PEYS..AT-----------EEAC
U3IZT3_ANAPL/23-112------------------------------------------SFAL--PAGIRGAE.PVYA..SA-----------PEAC
F6SZP7_MONDO/126-217------------------------------------------DASV--SNGATFLG.SPEV..RR-----------GWDC
M4ANK0_XIPMA/35-125------------------------------------------KASI--EQGATFLLAPDRV..YT-----------WRDC
H9GRZ2_ANOCA/88-178------------------------------------------KDSL--AAGATFLGSPGAV..EG-----------ARQC
H3C9I2_TETNG/27-117------------------------------------------KASI--EQGATFLLAPKRV..YT-----------WRDC
Q2KJJ7_BOVIN/42-133------------------------------------------DASV--RNGATFLR.SLTA..RR-----------GRDC
J9JMW5_ACYPI/27-110------------------------------------------EDSK--KLGAKFID.SVEQ..HD-----------RAGC
G3NW92_GASAC/36-126------------------------------------------KASI--ERGATFLLVPDRV..YT-----------WKDC
W5NBX0_LEPOC/28-114------------------------------------------QQSF--DNGASYSGHLPDV..SD-----------EASC
G6D1B9_DANPL/170-253------------------------------------------EESR--EMGARYLS.ELDV..GA-----------RSEC
W4Z7Q6_STRPU/149-240------------------------------------------KDSK--TNGANFVA.ALSV..RT-----------FDVC
B0WBN2_CULQU/54-138------------------------------------------EESR--AMGATFLD.DADV..NS-----------REQC
W5KPE8_ASTMX/26-115------------------------------------------EDSV--QDGATYLS.NPAA..LT-----------VEDC
F6QXL1_CIOIN/65-162------------------------------------------EDSM--HNGAKFLQVSTEH..MT-----------TDSC
K7JW67_NASVI/40-124------------------------------------------QDSR--DMGAKYLT.EFDV..ES-----------RIEC
G5BM03_HETGA/34-125------------------------------------------EASV--SNGATFLG.SPEV..QR-----------GRNC
H3BGP2_LATCH/23-112------------------------------------------KAAL--PLGVRSRE.PLYT..AA-----------AEVC
I3JDS1_ORENI/38-128------------------------------------------RDSI--EQGATFLLAPDRV..YT-----------WKDC
H3BX24_TETNG/31-120------------------------------------------DESV--KDGATFLS.SPNL..GR-----------YRDC
Q5VYB9_HUMAN/87-183------------------------------------------KDSL--AAGASFLRAPAAV..RG-----------WRQC
G1T9A5_RABIT/35-126------------------------------------------NASV--SNGATSWG.SRTV..HH-----------SWDC
F1NZW5_CHICK/24-113------------------------------------------NLSL--PMGIRGAE.PVHV..PT-----------PEAC
G3WZ70_SARHA/92-183------------------------------------------KDSL--GAGATFLTAPAAV..RD-----------WQQC
H3BSM2_HUMAN/110-201------------------------------------------NASV--SNGATFLE.SPTV..RR-----------GWDC
F7AX87_MOUSE/47-146------------------------------------------QDSI--AAGASFLRAPGSV..RG-----------WRQC
W5N574_LEPOC/31-120------------------------------------------DDSV--KEGATFLS.SPEV..QR-----------TKEC
H9G7H3_ANOCA/36-128------------------------------------------DASV--QNGATFLG.SPPL..ER-----------ARDC
U3J961_ANAPL/36-127------------------------------------------DASV--QNGATFLS.SPMV..HR-----------GRDC
Q0VC64_BOVIN/27-116------------------------------------------QLSL--SKGIRGNE.PIHT..LT-----------PQDC
H3CGS7_TETNG/5-97------------------------------------------EDAV--RGGAVLLD.SAQV..PS-----------AEAC
U3JUF3_FICAL/107-198------------------------------------------DDSV--QHGATFLS.SPMV..HR-----------SRDC
H2SB93_TAKRU/7-99------------------------------------------EDAV--MEGAAILD.SAQV..PS-----------ADAC
M3ZWM5_XIPMA/39-127------------------------------------------NESV--NEGATFLS.SPKV..GS-----------YMDC
W5NIC2_LEPOC/29-117------------------------------------------LLAL--RAGMKIKE.PFYS..SS-----------ENDC
W5KI63_ASTMX/67-158------------------------------------------AVSI--ERGATFLSAPSDA..RD-----------PADC
F6RCL0_XENTR/2-92------------------------------------------DYSV--KSGATFLS.SPPL..HS-----------GRDC
E7F1U6_DANRE/26-113------------------------------------------EESI--EAGAVFLA.NPSV..AH-----------EDAC
W5NK71_LEPOC/80-170------------------------------------------RDSI--ELGATFLTAPARV..YS-----------WRDC
I3KRH2_ORENI/28-116------------------------------------------EDAV--KEGAVMLA.TASF..AS-----------ELEC
C3Y0Q3_BRAFL/44-132------------------------------------------TKSL--ENKAVFLDSPMEM..VD-----------QETC
H0ZR45_TAEGU/15-104------------------------------------------DLSL--PRGARGAE.PLRV..PS-----------ASVC
E9FR71_DAPPU/84-170------------------------------------------KDSR--ALGAKFLN.ETSLGADA-----------RDRC
E0VZG2_PEDHC/38-122------------------------------------------QDSR--AMGAKYLN.EADV..NG-----------REDC
H2RSF4_TAKRU/27-117------------------------------------------RPSI--EQGAAFLLVPDRV..FT-----------WKDC
G3TDS8_LOXAF/45-136------------------------------------------EASV--SNGATFLG.SPAV..RR-----------DWDC
B4JE50_DROGR/43-127------------------------------------------GESQ--AIGGKYLQ.GLEL..DT-----------LEEC
MANS1_MOUSE/26-115------------------------------------------QSSL--SKGIRGNE.PIHL..AT-----------QEDC

PF08276

Y4729_ARATH/342-409------------------------------------------KLKL..PDTRTSWYD.KN.--MD-----------LNEC
Y1137_ARATH/337-407------------------------------------------NVKP..PDFYEYL...SL.--IN-----------EEDC
RKS1_ARATH/338-406------------------------------------------RMKI..PDTSDASVD.MN.--IT-----------LKEC
Y4119_ARATH/368-431------------------------------------------NMKL.ATDPTTASVL.TS.--GT-----------FRTC
Y1148_ARATH/333-399------------------------------------------NIKP..PDF..YEFA.SF.--VD-----------AEGC
Y1643_ARATH/332-398------------------------------------------NIKP..PDFYEYA...NS.--QN-----------AEEC
Y1141_ARATH/341-409------------------------------------------RVKI..PNTSAVNVD.MN.--IT-----------LKEC
Y1112_ARATH/338-408------------------------------------------NVKP..PDLYEYA...SF.--VD-----------ADQC
Y1150_ARATH/334-400------------------------------------------NIKP..PDF..YEFA.SS.--VN-----------AEEC
Y4230_ARATH/339-410------------------------------------------VVEVGSPDSQFDA......--HN-----------EKEC
SD11_ARATH/345-413------------------------------------------GLKL..PDTSWSWYDAKNE--MT-----------LEDC
Q7XXJ5_ORYSJ/359-424------------------------------------------HVTL..PRN.PQTI..QEA--TT-----------QSEC
Q7XQT8_ORYSJ/353-423------------------------------------------GVKL..PDAHNATVD.KR.--VT-----------VEEC
Q943Q1_ORYSJ/357-425------------------------------------------DIIL..PDK.AESM..QDV--DS-----------SDEC
Q7XMR2_ORYSJ/371-438------------------------------------------HVKL..PYD.SESI..QDA--TT-----------QSKC
Q7XQX5_ORYSJ/351-414------------------------------------------ATRL..PYN.AHAV..ESV--TT-----------AGEC
Q7XQT7_ORYSJ/350-421------------------------------------------GVKL..PDTHNASVD.TG.--IT-----------VEEC
Q60D68_ORYSJ/362-427------------------------------------------RVQL..PSNTPQSV..DNA--TT-----------QSKC
Q7EZ32_ORYSJ/358-422------------------------------------------NIKW..PDFSYWP...STV--QD-----------ENGC
Y1661_ARATH/350-416------------------------------------------GIKV..PDFGSVVLH....--NN-----------SETC
Q7XI25_ORYSJ/379-447------------------------------------------PVTL..PLY.PQSM..EDA--ST-----------QSDC
SD17_ARATH/341-407------------------------------------------RMKL..PDTTATIVD.RE.--IG-----------LKVC
Q60EJ2_ORYSJ/344-413------------------------------------------HAKA..PDTTAATVD.YD.--AG-----------LQLC
B120_ARATH/346-412------------------------------------------SVKL..PDFEIPE...HNL--VD-----------PEDC
Q7Y1P1_ORYSJ/344-411------------------------------------------NMKL..PESANATVD.MA.--LG-----------LEEC
Q8LQN6_ORYSJ/344-412------------------------------------------RMKL..PAATNATVY.AG.--MT-----------LDQC
Q851M7_ORYSJ/328-394------------------------------------------TQFLTYPPEITTE...QFF--VG-----------ITAC
Q8H821_ORYSJ/354-415------------------------------------------TVRL..PNGSVEAP..AGA--GN-----------DKAC
D7KZN2_ARALL/365-430------------------------------------------RMKL..PDTSTSIVD.KR.--IG-----------LNEC
D7MEU3_ARALL/350-416------------------------------------------KMKL..PDTTTASVD.RG.--IG-----------VKEC
D7MEU5_ARALL/350-415------------------------------------------KIKL..PDTTAAIVD.KR.--IG-----------FKDC
I1QYI6_ORYGL/369-433------------------------------------------RVAL..PANPEKI.E.DA.--TT-----------QSKC
M4C7T3_BRARP/338-404------------------------------------------KMKL..PDTTVTVVD.SG.--VG-----------LKEC
M4CIU6_BRARP/181-247------------------------------------------RMKL..PDTAATVLD.RG.--IG-----------LKEC
M4CIZ5_BRARP/356-420------------------------------------------NMNL..PDTKTASVD.RT.--ID-----------VKKC
M4FHL1_BRARP/345-410------------------------------------------KTKL..PDTKMASFD.RR.--IN-----------LKKC
PSRK_ARATH/348-413------------------------------------------NMKI..PATTAAIVD.KR.--IG-----------LKEC
W5BTS4_WHEAT/325-394------------------------------------------NMKT..PDKFLYI...RN.--RS-----------FDQC

PF08277

O16726_CAEEL/19-83------------------------------------------GEPS--DM...SESQEYQG--LS-----------LDDC
Q18574_CAEEL/20-92------------------------------------------GALM--TC...IDTEFAQK--ET-----------WKDC
O62154_CAEEL/24-92------------------------------------------GKVT--ET.....TEPQAF--NT-----------VKDC
O17672_CAEEL/26-95------------------------------------------GAPM--IY....FNFTEKT--AT-----------WETC
Q9U2V0_CAEEL/23-94------------------------------------------GTID--KF....NVNPLIN--MD-----------LNSC
O01337_CAEEL/48-117------------------------------------------GELT--NF....LNFTEKT--VN-----------WSSC
O62150_CAEEL/25-95------------------------------------------GTIV--TG...IATNVTSS--KS-----------VGDC
O01701_CAEEL/22-92------------------------------------------GTVV--DG....ISYGATC--DD-----------KNSC
O01336_CAEEL/22-95------------------------------------------GEVL--THGGGLSDFTKKP--VN-----------WSTC
Q9XVD0_CAEEL/1-71------------------------------------------GRPT--EM...SPGSTVDQ--VL-----------WDTC
O44831_CAEEL/18-94------------------------------------------GAPE--KST.SYPTQLYTG--LN-----------YTTC
Q9N4A0_CAEEL/25-95------------------------------------------GSVA--TE...VPSVRGTV--NE-----------TFNC
O02127_CAEEL/50-122------------------------------------------GYPA--SDT.KFCEPQLKT--ST-----------FNSC
Q9NA49_CAEEL/29-98------------------------------------------GAPS--GV....DVWEPCS--ET-----------WKQC
Q9GRV4_CAEEL/22-94------------------------------------------GTPE--DV...TMNPSPLT--MD-----------FDAC
A8XBL6_CAEBR/41-108------------------------------------------GQME--G......SKGRIF--EN-----------YEEC
Q9U2Q4_CAEEL/178-252------------------------------------------AKPG--PLM.GSRNIKDNL--TS-----------SDEC
O44833_CAEEL/23-99------------------------------------------GSPV--PST.SYGTSQVGI--AD-----------WRDC
A8WJ07_CAEBR/13-84------------------------------------------GYPS--SE..DYCTLHTTV--GS-----------FLDC
A8Y004_CAEBR/24-93------------------------------------------GKPG--KV....KTSEAMN--IS-----------WMDC
O02128_CAEEL/1-73------------------------------------------GYPA--SSI.KFCEPQSTI--IH-----------FDSC
O62406_CAEEL/24-92------------------------------------------GSVT--SD...ATGISTTF--ST-----------VEDC
O16210_CAEEL/23-99------------------------------------------GSVS--G.....VLGSNKY--LN-----------LTDC
Q9NEP2_CAEEL/1-72------------------------------------------GQPV--DY....SQVSMKS--YS-----------LSTC
Q9XV53_CAEEL/24-96------------------------------------------GEPI--DL...INSTSVQV--KD-----------FDEC
Q7YTL3_CAEEL/26-97------------------------------------------GIQE--DI...DFCEAMNS--ME-----------WPKC
A8Y003_CAEBR/24-93------------------------------------------GQRG--NY....KTSETMD--VS-----------WEDC
O02131_CAEEL/21-93------------------------------------------GYPD--SGT.ENCVSHSSV--IT-----------FEIC
A8XU86_CAEBR/1-68------------------------------------------GEPE--MYS.NPIYPLDAS--AT-----------WEEC
O16208_CAEEL/30-102------------------------------------------GEPD--DY...ANSTSVQV--KN-----------FKEC
Q9NA50_CAEEL/26-95------------------------------------------GSPN--DT....EISETYS--GS-----------WDEC
O44835_CAEEL/16-89------------------------------------------GAPE--IST.SYSTEIINS--LT-----------WDEC
O45492_CAEEL/23-95------------------------------------------GKIV--KF..NKEAISITV--TD-----------LDSC
Q9N522_CAEEL/20-88------------------------------------------RQIL--GD....SNYTEII--DS-----------WNYC
Q9U2Q4_CAEEL/29-101------------------------------------------GEPI--VL...NASSIIQV--TS-----------FDEC
Q9N4B3_CAEEL/1-70------------------------------------------GIPN--TT...NNTQVNTS--LT-----------WDGC
Q9XTS6_CAEEL/1-68------------------------------------------GEPG--VYS.SYSNPLPST--DT-----------WEDC
A4F307_CAEEL/1-67------------------------------------------GEPT--VA......GAQSS--EN-----------WENC

PF02430

A5K4Z2_PLAVS/55-520................NDHISPMTLANLKER.YKDNVEMMKLNDIALCRTHAASFVMAGDQ--NSSYRHPAVYDEKEKTC
Q4YZP5_PLABA/17-475................DVHLSPITIDNLKTM.YKEHPEIVKLNNMSLCAKHTSFYVPGNNA--NSAYRHPAVYDKSNSTC
A7ASF6_BABBO/97-566SNIPTQPKTRGSSSVTAAKLSPVSAKDLRRWGYEG.......NDVANCSEYASNLIPASDK--TTKYRYPFVFDSDNQMC
Q4UHH9_THEAN/247-742SN.......SSKLDMENQLLSPISAQVLRSWNYKHE......SDLSNCAEYSRNIVPGSNR--NSKYRYPFVYDESEKLC
Q7KQK5_PLAF7/110-580................EPLMSPMTLDEMRHF.YKDNKYVKNLDELTLCSRHAGNMIPDNDK--NSNYKYPAVYDDKDKKC

PF00024

Q9VCR4_DROME/150-255A--------------------------------------------------------------------------ERCF.
Q9VCR4_DROME/265-347Q--------------------------------------------------------------------------AMCS.
KLKB1_MOUSE/292-375Q--------------------------------------------------------------------------ETCT.
PLMN_MOUSE/24-98L--------------------------------------------------------------------------AKCE.
KLKB1_MOUSE/21-104Q--------------------------------------------------------------------------KMCT.
Q20167_CAEEL/20-106A--------------------------------------------------------------------------NACS.
Q20167_CAEEL/304-382L--------------------------------------------------------------------------SQCM.
Q20167_CAEEL/205-297N--------------------------------------------------------------------------QLCQ.
Q20167_CAEEL/113-200L--------------------------------------------------------------------------SKCA.
Q22815_CAEEL/24-101L--------------------------------------------------------------------------LFCA.
Q22815_CAEEL/470-555I--------------------------------------------------------------------------ELCV.
Q22815_CAEEL/375-459E--------------------------------------------------------------------------KICK.
Q9V9X0_DROME/209-287L--------------------------------------------------------------------------ELCL.
Q9V9X0_DROME/295-376R--------------------------------------------------------------------------DLCL.
Q18298_CAEEL/226-303M--------------------------------------------------------------------------QACV.
Q18298_CAEEL/312-390L--------------------------------------------------------------------------QKCI.
Q18298_CAEEL/142-219M--------------------------------------------------------------------------EECV.
Q18298_CAEEL/50-135S--------------------------------------------------------------------------SHCR.
Q21782_CAEEL/228-319V--------------------------------------------------------------------------QACR.
Q21782_CAEEL/329-416V--------------------------------------------------------------------------LECI.
O62201_CAEEL/632-720V--------------------------------------------------------------------------FACL.
O62201_CAEEL/729-814I--------------------------------------------------------------------------DLCI.
HGFL_HUMAN/18-106A--------------------------------------------------------------------------GRCG.
PLMN_PIG/20-99A--------------------------------------------------------------------------AKCE.
O45277_CAEEL/419-497E--------------------------------------------------------------------------SECS.
O45277_CAEEL/80-160L--------------------------------------------------------------------------RKCI.
O45277_CAEEL/320-398M--------------------------------------------------------------------------RQCA.
PLMN_MACEU/17-99E--------------------------------------------------------------------------ALCE.
FA11_HUMAN/110-193Q--------------------------------------------------------------------------ERCT.
KLKB1_HUMAN/111-194Q--------------------------------------------------------------------------KRCT.
Q9XUE5_CAEEL/21-112A--------------------------------------------------------------------------QYCR.
Q13208_HUMAN/5-81A--------------------------------------------------------------------------GRCG.
Q94248_CAEEL/576-659K--------------------------------------------------------------------------CKCA.
Q9VAG2_DROME/113-197L--------------------------------------------------------------------------DTCR.
Q9U966_EIMTE/637-707R--------------------------------------------------------------------------QRCE.
O61834_CAEEL/108-192L--------------------------------------------------------------------------SQCQ.
Q9V9X1_DROME/320-401R--------------------------------------------------------------------------DLCL.
Q9W5Z0_DROME/15-98L--------------------------------------------------------------------------SACL.
Q9V9X1_DROME/145-223L--------------------------------------------------------------------------EACQ.
KLKB1_RAT/111-194Q--------------------------------------------------------------------------KLCT.
Q9U966_EIMTE/182-254Q--------------------------------------------------------------------------AMCQ.
Y2913_ARATH/341-418A--------------------------------------------------------------------------SACQ.
FA11_HUMAN/200-283G--------------------------------------------------------------------------RICT.
Q22902_CAEEL/114-194Q--------------------------------------------------------------------------AQCS.
Q9XUE5_CAEEL/212-295L--------------------------------------------------------------------------QKCL.
Q9U966_EIMTE/263-337R--------------------------------------------------------------------------RECL.
KLKB1_HUMAN/201-284R--------------------------------------------------------------------------TICT.
Q9VAG2_DROME/203-286F--------------------------------------------------------------------------ELCL.
PLMN_ERIEU/17-99A--------------------------------------------------------------------------VKCE.
Q91691_XENLA/29-114A--------------------------------------------------------------------------KQCS.
SD31_ARATH/332-413K--------------------------------------------------------------------------KLCL.
KLKB1_HUMAN/21-104Q--------------------------------------------------------------------------MRCT.
Q9U966_EIMTE/421-490Q--------------------------------------------------------------------------QQCQ.
B9PXJ3_TOXGV/141-214Q--------------------------------------------------------------------------AACA.
Q23328_CAEEL/311-391L--------------------------------------------------------------------------RKCL.
Q91402_9PIPI/27-111A--------------------------------------------------------------------------KRCS.
MIA1_SARMU/112-181M--------------------------------------------------------------------------KQCQ.
Q94248_CAEEL/448-532Q--------------------------------------------------------------------------CMCA.
KLKB1_RAT/201-284R--------------------------------------------------------------------------TVCT.
Q9XUE5_CAEEL/305-382I--------------------------------------------------------------------------SLCF.
O61834_CAEEL/21-103T--------------------------------------------------------------------------RFCS.
Q22902_CAEEL/21-95F--------------------------------------------------------------------------SACL.
FA11_HUMAN/20-103Q--------------------------------------------------------------------------VVCT.
B9PXJ3_TOXGV/68-137A--------------------------------------------------------------------------AQCK.
MIA2_SARMU/9-78M--------------------------------------------------------------------------KECQ.
Q90865_CHICK/18-104A--------------------------------------------------------------------------QRCA.
PLMN_BOVIN/24-106A--------------------------------------------------------------------------AKCE.
Q23328_CAEEL/212-303A--------------------------------------------------------------------------KYCS.
YMP9_CAEEL/49-134L--------------------------------------------------------------------------QKCA.
O42830_PHYPR/61-165C--------------------------------------------------------------------------TRCS.
Q9XUE5_CAEEL/122-204L--------------------------------------------------------------------------SACL.
O17347_CAEEL/123-203A--------------------------------------------------------------------------AQCV.
Q9U966_EIMTE/713-788Q--------------------------------------------------------------------------ELCE.
Q27394_CAEEL/123-209L--------------------------------------------------------------------------SDCL.
Q94248_CAEEL/47-112A--------------------------------------------------------------------------AFCA.
Q9U966_EIMTE/863-932Q--------------------------------------------------------------------------FACE.
Q23328_CAEEL/23-103T--------------------------------------------------------------------------QHCI.
O97506_PIG/29-112Q--------------------------------------------------------------------------MMCT.
Q94248_CAEEL/1063-1143F--------------------------------------------------------------------------AACY.
Q9Y1V3_POLMI/354-432A--------------------------------------------------------------------------QKCK.
FA11_HUMAN/291-374Q--------------------------------------------------------------------------KLCT.
O61834_CAEEL/202-292E--------------------------------------------------------------------------QMCV.
B9PXJ3_TOXGV/419-496R--------------------------------------------------------------------------ARCQ.
Q90978_CHICK/30-120A--------------------------------------------------------------------------KRCS.
B9PXJ3_TOXGV/232-310M--------------------------------------------------------------------------ERCR.
HGF_HUMAN/40-124A--------------------------------------------------------------------------NRCT.
Q94248_CAEEL/242-320R--------------------------------------------------------------------------CLCAA
Q9W5Z0_DROME/118-206R--------------------------------------------------------------------------LACE.

PF14295

Q7QD96_ANOGA/35-86Q--------------------------------------------------------------------------GWCR-
B6JDB0_OLICO/42-92A--------------------------------------------------------------------------MFCE-
B6JDB0_OLICO/125-176K--------------------------------------------------------------------------AACE-
Q21BD4_RHOPB/39-89A--------------------------------------------------------------------------IVCE-
Q1QRJ6_NITHX/50-100A--------------------------------------------------------------------------LACE-
Q1QRJ6_NITHX/133-187R--------------------------------------------------------------------------HACD-
A4Z2E2_BRASO/27-77A--------------------------------------------------------------------------LLCE-
C5BI67_TERTT/43-100Q--------------------------------------------------------------------------GHCA-
C5BI67_TERTT/122-170M--------------------------------------------------------------------------DACM-
A4S6G3_OSTLU/377-434C--------------------------------------------------------------------------LACR-
A4S6G3_OSTLU/486-538C--------------------------------------------------------------------------DACL-
A4S6G3_OSTLU/585-643C--------------------------------------------------------------------------AECK-
Q2FN86_METHJ/487-537A--------------------------------------------------------------------------NACR-
B2VUM0_PYRTR/713-759V--------------------------------------------------------------------------QACD-
C1E8G6_MICCC/523-580C--------------------------------------------------------------------------LACQ-
C1E8G6_MICCC/640-698C--------------------------------------------------------------------------AKCA-
C1MZS3_MICPC/544-601C--------------------------------------------------------------------------LACQ-
C1MZS3_MICPC/661-719C--------------------------------------------------------------------------NVCH-
D3P9U3_DEFDS/608-658K--------------------------------------------------------------------------QACD-
A4YQL0_BRASO/32-87R--------------------------------------------------------------------------QTCN-
Q212S6_RHOPB/26-77Q--------------------------------------------------------------------------GACQ-
A9V0Z5_MONBE/42-102Y--------------------------------------------------------------------------NLCQ-
A8IFR1_CHLRE/186-243C--------------------------------------------------------------------------SQCA-
A8XZR6_CAEBR/34-85T--------------------------------------------------------------------------RYCS-
Q0C462_HYPNA/58-105E--------------------------------------------------------------------------AACD-
A9VDX2_MONBE/32-89V--------------------------------------------------------------------------ALCC-
Q0AR81_MARMM/29-79A--------------------------------------------------------------------------ALCD-
A9UWV1_MONBE/136-181R--------------------------------------------------------------------------QSCL-
C1E8N1_MICCC/219-266C--------------------------------------------------------------------------RACL-
Q7SFE8_NEUCR/154-203I--------------------------------------------------------------------------DACA-
C1FJX3_MICCC/235-285C--------------------------------------------------------------------------RRCA-
A9UVN3_MONBE/45-98E--------------------------------------------------------------------------SLCN-
C1MHF5_MICPC/168-214C--------------------------------------------------------------------------ASCF-
Q0UP20_PHANO/126-176I--------------------------------------------------------------------------DACA-
A7UVW4_NEUCR/512-562A--------------------------------------------------------------------------AACD-
V5ILY1_NEUCR/1388-1435A--------------------------------------------------------------------------EKCS-

PF07502

G3NSW1_GASAC/41-130V--------------------------------------------------------------------------AACC-
B7PSB0_IXOSC/57-154L--------------------------------------------------------------------------FWCW-
H2U8H9_TAKRU/6-100V--------------------------------------------------------------------------AACC-
W5KZ36_ASTMX/28-122V--------------------------------------------------------------------------SACC-
I3K2I2_ORENI/38-127V--------------------------------------------------------------------------QACC-
G3PKT8_GASAC/29-121R--------------------------------------------------------------------------SACC-
T1J182_STRMM/41-125M--------------------------------------------------------------------------KWCC-
V8N7R6_OPHHA/37-128V--------------------------------------------------------------------------RACC-
H2ZBX2_CIOSA/69-166K--------------------------------------------------------------------------QLCC-
F6ZSJ7_XENTR/27-116A--------------------------------------------------------------------------ASCC-
M4A584_XIPMA/31-117E--------------------------------------------------------------------------TLCC-
A7RY69_NEMVE/28-116Y--------------------------------------------------------------------------NLCC-
H2MTN1_ORYLA/73-163V--------------------------------------------------------------------------HACC-
H2MRG4_ORYLA/29-119V--------------------------------------------------------------------------NACC-
F6YM27_ORNAN/27-116L--------------------------------------------------------------------------HACC-
U3IZT3_ANAPL/23-112M--------------------------------------------------------------------------RACC-
F6SZP7_MONDO/126-217V--------------------------------------------------------------------------RACC-
M4ANK0_XIPMA/35-125L--------------------------------------------------------------------------HACC-
H9GRZ2_ANOCA/88-178L--------------------------------------------------------------------------EACC-
H3C9I2_TETNG/27-117V--------------------------------------------------------------------------HACC-
Q2KJJ7_BOVIN/42-133V--------------------------------------------------------------------------HACC-
J9JMW5_ACYPI/27-110L--------------------------------------------------------------------------ELCC-
G3NW92_GASAC/36-126V--------------------------------------------------------------------------RACC-
W5NBX0_LEPOC/28-114R--------------------------------------------------------------------------QACC-
G6D1B9_DANPL/170-253L--------------------------------------------------------------------------RLCC-
W4Z7Q6_STRPU/149-240L--------------------------------------------------------------------------EQCC-
B0WBN2_CULQU/54-138L--------------------------------------------------------------------------RLCC-
W5KPE8_ASTMX/26-115V--------------------------------------------------------------------------SACC-
F6QXL1_CIOIN/65-162K--------------------------------------------------------------------------QLCC-
K7JW67_NASVI/40-124M--------------------------------------------------------------------------KWCC-
G5BM03_HETGA/34-125V--------------------------------------------------------------------------RACC-
H3BGP2_LATCH/23-112T--------------------------------------------------------------------------NLCC-
I3JDS1_ORENI/38-128V--------------------------------------------------------------------------HACC-
H3BX24_TETNG/31-120V--------------------------------------------------------------------------GACC-
Q5VYB9_HUMAN/87-183V--------------------------------------------------------------------------AACC-
G1T9A5_RABIT/35-126V--------------------------------------------------------------------------LACC-
F1NZW5_CHICK/24-113I--------------------------------------------------------------------------HACC-
G3WZ70_SARHA/92-183V--------------------------------------------------------------------------AACC-
H3BSM2_HUMAN/110-201V--------------------------------------------------------------------------RACC-
F7AX87_MOUSE/47-146V--------------------------------------------------------------------------TACC-
W5N574_LEPOC/31-120V--------------------------------------------------------------------------RACC-
H9G7H3_ANOCA/36-128V--------------------------------------------------------------------------RECC-
U3J961_ANAPL/36-127V--------------------------------------------------------------------------RACC-
Q0VC64_BOVIN/27-116I--------------------------------------------------------------------------NSCC-
H3CGS7_TETNG/5-97Q--------------------------------------------------------------------------RACC-
U3JUF3_FICAL/107-198M--------------------------------------------------------------------------RACC-
H2SB93_TAKRU/7-99Q--------------------------------------------------------------------------SLCC-
M3ZWM5_XIPMA/39-127V--------------------------------------------------------------------------ASCC-
W5NIC2_LEPOC/29-117I--------------------------------------------------------------------------TSCC-
W5KI63_ASTMX/67-158L--------------------------------------------------------------------------RACC-
F6RCL0_XENTR/2-92M--------------------------------------------------------------------------TACC-
E7F1U6_DANRE/26-113M--------------------------------------------------------------------------AACC-
W5NK71_LEPOC/80-170L--------------------------------------------------------------------------HACC-
I3KRH2_ORENI/28-116E--------------------------------------------------------------------------RACC-
C3Y0Q3_BRAFL/44-132L--------------------------------------------------------------------------ETCC-
H0ZR45_TAEGU/15-104V--------------------------------------------------------------------------RACC-
E9FR71_DAPPU/84-170L--------------------------------------------------------------------------NLCC-
E0VZG2_PEDHC/38-122M--------------------------------------------------------------------------KLCC-
H2RSF4_TAKRU/27-117L--------------------------------------------------------------------------HACC-
G3TDS8_LOXAF/45-136V--------------------------------------------------------------------------RACC-
B4JE50_DROGR/43-127E--------------------------------------------------------------------------RLCC-
MANS1_MOUSE/26-115I--------------------------------------------------------------------------GACC-

PF08276

Y4729_ARATH/342-409K--------------------------------------------------------------------------KVCL-
Y1137_ARATH/337-407Q--------------------------------------------------------------------------QRCL-
RKS1_ARATH/338-406K--------------------------------------------------------------------------QRCL-
Y4119_ARATH/368-431A--------------------------------------------------------------------------SRCV-
Y1148_ARATH/333-399Y--------------------------------------------------------------------------QICL-
Y1643_ARATH/332-398H--------------------------------------------------------------------------QNCL-
Y1141_ARATH/341-409E--------------------------------------------------------------------------QRCL-
Y1112_ARATH/338-408H--------------------------------------------------------------------------QGCL-
Y1150_ARATH/334-400H--------------------------------------------------------------------------QRCV-
Y4230_ARATH/339-410R--------------------------------------------------------------------------AECL-
SD11_ARATH/345-413K--------------------------------------------------------------------------IKCS-
Q7XXJ5_ORYSJ/359-424A--------------------------------------------------------------------------QACL-
Q7XQT8_ORYSJ/353-423W--------------------------------------------------------------------------ARCL-
Q943Q1_ORYSJ/357-425M--------------------------------------------------------------------------KVCL-
Q7XMR2_ORYSJ/371-438A--------------------------------------------------------------------------QACL-
Q7XQX5_ORYSJ/351-414E--------------------------------------------------------------------------SICL-
Q7XQT7_ORYSJ/350-421R--------------------------------------------------------------------------ARCV-
Q60D68_ORYSJ/362-427A--------------------------------------------------------------------------QSCL-
Q7EZ32_ORYSJ/358-422M--------------------------------------------------------------------------NACL-
Y1661_ARATH/350-416K--------------------------------------------------------------------------DVCA-
Q7XI25_ORYSJ/379-447E--------------------------------------------------------------------------EACL-
SD17_ARATH/341-407K--------------------------------------------------------------------------ERCL-
Q60EJ2_ORYSJ/344-413R--------------------------------------------------------------------------RRCL-
B120_ARATH/346-412R--------------------------------------------------------------------------ERCL-
Q7Y1P1_ORYSJ/344-411R--------------------------------------------------------------------------LSCL-
Q8LQN6_ORYSJ/344-412R--------------------------------------------------------------------------QVCL-
Q851M7_ORYSJ/328-394R--------------------------------------------------------------------------LNCL-
Q8H821_ORYSJ/354-415A--------------------------------------------------------------------------HTCL-
D7KZN2_ARALL/365-430K--------------------------------------------------------------------------ERCS-
D7MEU3_ARALL/350-416E--------------------------------------------------------------------------QKCL-
D7MEU5_ARALL/350-415K--------------------------------------------------------------------------ERCA-
I1QYI6_ORYGL/369-433A--------------------------------------------------------------------------ESCL-
M4C7T3_BRARP/338-404E--------------------------------------------------------------------------ERCL-
M4CIU6_BRARP/181-247K--------------------------------------------------------------------------AKCL-
M4CIZ5_BRARP/356-420E--------------------------------------------------------------------------EKCL-
M4FHL1_BRARP/345-410E--------------------------------------------------------------------------ERCL-
PSRK_ARATH/348-413E--------------------------------------------------------------------------EKCK-
W5BTS4_WHEAT/325-394A--------------------------------------------------------------------------EECS-

PF08277

O16726_CAEEL/19-83I--------------------------------------------------------------------------ATCY-
Q18574_CAEEL/20-92V--------------------------------------------------------------------------TSCA-
O62154_CAEEL/24-92I--------------------------------------------------------------------------DECF-
O17672_CAEEL/26-95I--------------------------------------------------------------------------TTCY-
Q9U2V0_CAEEL/23-94V--------------------------------------------------------------------------RIVS-
O01337_CAEEL/48-117V--------------------------------------------------------------------------TNCH-
O62150_CAEEL/25-95R--------------------------------------------------------------------------NGCF-
O01701_CAEEL/22-92L--------------------------------------------------------------------------SYCY-
O01336_CAEEL/22-95V--------------------------------------------------------------------------TNCH-
Q9XVD0_CAEEL/1-71V--------------------------------------------------------------------------KYCY-
O44831_CAEEL/18-94T--------------------------------------------------------------------------SKCA-
Q9N4A0_CAEEL/25-95T--------------------------------------------------------------------------AACA-
O02127_CAEEL/50-122I--------------------------------------------------------------------------DLCL-
Q9NA49_CAEEL/29-98L--------------------------------------------------------------------------QKCL-
Q9GRV4_CAEEL/22-94V--------------------------------------------------------------------------EYCY-
A8XBL6_CAEBR/41-108L--------------------------------------------------------------------------SKCL-
Q9U2Q4_CAEEL/178-252V--------------------------------------------------------------------------KYCW-
O44833_CAEEL/23-99A--------------------------------------------------------------------------QKCL-
A8WJ07_CAEBR/13-84L--------------------------------------------------------------------------NLCL-
A8Y004_CAEBR/24-93L--------------------------------------------------------------------------TKCR-
O02128_CAEEL/1-73I--------------------------------------------------------------------------NLCL-
O62406_CAEEL/24-92K--------------------------------------------------------------------------NGCF-
O16210_CAEEL/23-99M--------------------------------------------------------------------------SDCL-
Q9NEP2_CAEEL/1-72I--------------------------------------------------------------------------AYCY-
Q9XV53_CAEEL/24-96V--------------------------------------------------------------------------EKCE-
Q7YTL3_CAEEL/26-97A--------------------------------------------------------------------------QKCY-
A8Y003_CAEBR/24-93M--------------------------------------------------------------------------VKCR-
O02131_CAEEL/21-93M--------------------------------------------------------------------------NLCL-
A8XU86_CAEBR/1-68I--------------------------------------------------------------------------QYCY-
O16208_CAEEL/30-102I--------------------------------------------------------------------------EKCS-
Q9NA50_CAEEL/26-95L--------------------------------------------------------------------------QKCY-
O44835_CAEEL/16-89V--------------------------------------------------------------------------KQCL-
O45492_CAEEL/23-95V--------------------------------------------------------------------------QNCF-
Q9N522_CAEEL/20-88M--------------------------------------------------------------------------TICY-
Q9U2Q4_CAEEL/29-101T--------------------------------------------------------------------------DKCL-
Q9N4B3_CAEEL/1-70L--------------------------------------------------------------------------TACF-
Q9XTS6_CAEEL/1-68L--------------------------------------------------------------------------EYCL-
A4F307_CAEEL/1-67L--------------------------------------------------------------------------EKCW-

PF02430

A5K4Z2_PLAVS/55-520HMLYLSAQENMGPRYCSPD.AQNR..DAVFCFKPDKNESFENLVYLSKNVRNDWDKKCPRKNLGNAKFGLWVD..GNCEE
Q4YZP5_PLABA/17-475YMLYVAAQENMGPRYCSNN.ANND..NQPFCFTPEKIEKYKNLSYLTKNLRDDWETSCPNKSIKNAKFGIWVD..GYCKD
A7ASF6_BABBO/97-566YILYSAIQYNQGNRYCDNDGSSEEGTSSLLCMKPYKSAEDAHLYYGSAKVDPDWEENCPMHPVRDAIFGKWSG..GSCVA
Q4UHH9_THEAN/247-742YILYSPMQYNQGVKYCDQD.SPDEGTSSLACMYPDKSKEDSHLFYGTSGLHMDWPVVCPVYPIRDSIFGSYDDQKDECVP
Q7KQK5_PLAF7/110-580HILYIAAQENNGPRYCNKD.ESKR..NSMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVD..GNCED

PF00024

Q9VCR4_DROME/150-255....FE------TQF.......RCL--SASFAPSY--------------------------------RNNRERFRGEA--
Q9VCR4_DROME/265-347....HE------AKF.......YCQ--GVSFYYVN--------------------------------Q..........--
KLKB1_MOUSE/292-375....KT------IR.........CQ--FFIYSLLP--------------------------------QD.........--
PLMN_MOUSE/24-98....GE------TDF.......VCR--SFQYHSK.--------------------------------...........--
KLKB1_MOUSE/21-104....FH------PR.........CL--LFSFLAVT--------------------------------PPK........--
Q20167_CAEEL/20-106....NS------LST......EECL--SFEYDAS.--------------------------------...........--
Q20167_CAEEL/304-382....ND------GA........RCS--SATYFYM.--------------------------------...........--
Q20167_CAEEL/205-297....NN------KIGEE...NFPCK--AFAYSNS.--------------------------------...........--
Q20167_CAEEL/113-200....LS------QRSY....DFLCK--SAIYYYE.--------------------------------...........--
Q22815_CAEEL/24-101....QS------AS........RCR--SVVYDTV.--------------------------------...........--
Q22815_CAEEL/470-555....LS------TKF.......TCR--SSTFNPI.--------------------------------...........--
Q22815_CAEEL/375-459....EK------N..........CR--SYTYFEK.--------------------------------...........--
Q9V9X0_DROME/209-287....GE------TEF.......TCR--SANYYRH.--------------------------------...........--
Q9V9X0_DROME/295-376....NS------PY........RCH--SYDYNDT.--------------------------------...........--
Q18298_CAEEL/226-303....NA------GQF.......YCR--SVQFDST.--------------------------------...........--
Q18298_CAEEL/312-390....DM------EN.........CK--SVNYNVL.--------------------------------...........--
Q18298_CAEEL/142-219....KI------Q..........CM--SFGFHHD.--------------------------------...........--
Q18298_CAEEL/50-135....AN------FDPSSE.EAFPCE--GFNFRAG.--------------------------------...........--
Q21782_CAEEL/228-319....VS------TYADGSRLPLLCR--SAHFNRA.--------------------------------...........--
Q21782_CAEEL/329-416....KA------KTLR....SVACH--SILHYPDF--------------------------------...........--
O62201_CAEEL/632-720....TN------SRPGG..GASDCT--ALEYDKT.--------------------------------...........--
O62201_CAEEL/729-814....EK------HII.......GCV--SVMFYAKE--------------------------------...........--
HGFL_HUMAN/18-106....PL------MD.........CR--AFHYNVS.--------------------------------...........--
PLMN_PIG/20-99....AE------TNF.......ICR--AFQYHSK.--------------------------------...........--
O45277_CAEEL/419-497...WSH------IRRR.....EKCL--GVNWIPT.--------------------------------...........--
O45277_CAEEL/80-160....QA------PMNH....KIKCK--TVMYNVN.--------------------------------...........--
O45277_CAEEL/320-398....QS------LQN......FYCA--SINYSFG.--------------------------------...........--
PLMN_MACEU/17-99....KE------T.E......FVCR--SFEHYNK.--------------------------------...........--
FA11_HUMAN/110-193....DD------VH.........CH--FFTYATRQ--------------------------------FP.........--
KLKB1_HUMAN/111-194....NN------IR.........CQ--FFSYATQT--------------------------------FH.........--
Q9XUE5_CAEEL/21-112....NN------IEPTTG.AQRVCA--SFNFDGR.--------------------------------...........--
Q13208_HUMAN/5-81....LL------MD.........CW--AFHYNVS.--------------------------------...........--
Q94248_CAEEL/576-659....EG------HKLY....GEECA--SFLYYYD.--------------------------------...........--
Q9VAG2_DROME/113-197....KN------KT.........CQ--SVNYETG.--------------------------------...........--
Q9U966_EIMTE/637-707....VM------ES.........CG--RFSYDAA.--------------------------------...........--
O61834_CAEEL/108-192....KE------SS.........CR--AALHNND.--------------------------------...........--
Q9V9X1_DROME/320-401....TA------P.F.......RCH--SYDYNET.--------------------------------...........--
Q9W5Z0_DROME/15-98....NE------RRF.......VCR--SVEYDYN.--------------------------------...........--
Q9V9X1_DROME/145-223....AN------ES.........CS--AVNYETG.--------------------------------...........--
KLKB1_RAT/111-194....NN------IH.........CQ--FFTYATKA--------------------------------FH.........--
Q9U966_EIMTE/182-254....GE------DG.........CI--GFSWNRS.--------------------------------...........--
Y2913_ARATH/341-418....GD------CS.........CK--AYAYDEG.--------------------------------...........--
FA11_HUMAN/200-283....HH------PG.........CL--FFTFFSQE--------------------------------WP.........--
Q22902_CAEEL/114-194....NS------QTKY....DITCK--SAMYYEK.--------------------------------...........--
Q9XUE5_CAEEL/212-295....DS------LNT.......FCR--SVEFNPK.--------------------------------...........--
Q9U966_EIMTE/263-337....LD------KD.........CK--WFTFNEV.--------------------------------...........--
KLKB1_HUMAN/201-284....YH------PN.........CL--FFTFYTNV--------------------------------WK.........--
Q9VAG2_DROME/203-286....GE------NDF.......TCR--SANYDRT.--------------------------------...........--
PLMN_ERIEU/17-99....KE------TSF.......ICR--SFQYHSK.--------------------------------...........--
Q91691_XENLA/29-114....DL------LD.........CR--SFVYNWK.--------------------------------...........--
SD31_ARATH/332-413....EN------SA.........CT--AVTYTND.--------------------------------...........--
KLKB1_HUMAN/21-104....FH------PR.........CL--LFSFLPAS--------------------------------SIN........--
Q9U966_EIMTE/421-490....KS------SM.........CE--AFSYDIK.--------------------------------...........--
B9PXJ3_TOXGV/141-214....AD------PS.........CE--IFTYNEH.--------------------------------...........--
Q23328_CAEEL/311-391....EQ------DD.........CR--SSVYISN.--------------------------------...........--
Q91402_9PIPI/27-111....RN------KGLP.....FTCK--AFAFDKN.--------------------------------...........--
MIA1_SARMU/112-181....SR------PT.........CS--HFTYNKN.--------------------------------...........--
Q94248_CAEEL/448-532....NS------KTSRR..YEFQCR--SATYYHA.--------------------------------...........--
KLKB1_RAT/201-284....FH------PN.........CL--FFTFYTNE--------------------------------WE.........--
Q9XUE5_CAEEL/305-382....QN------LN.........CK--SINYDRT.--------------------------------...........--
O61834_CAEEL/21-103....SV------PN.........CT--HFTFSNAE--------------------------------PIE........--
Q22902_CAEEL/21-95....EM------PRE.......TCK--SVTYTKK.--------------------------------...........--
FA11_HUMAN/20-103....YH------PR.........CL--LFTFTAES--------------------------------PSE........--
B9PXJ3_TOXGV/68-137....AV------DG.........CT--HFTYNDD.--------------------------------...........--
MIA2_SARMU/9-78....AL------PT.........CS--HFTYNKN.--------------------------------...........--
Q90865_CHICK/18-104....NR------PD.........CR--AFHHERQ.--------------------------------...........--
PLMN_BOVIN/24-106....EE------TDF.......VCR--AFQYHSK.--------------------------------...........--
Q23328_CAEEL/212-303....EN------KGPDG..STINCR--SLNYFPV.--------------------------------...........--
YMP9_CAEEL/49-134....EK------PR.........CK--AVNFFHPF--------------------------------A..........--
O42830_PHYPR/61-165....ET------AG.........CK--AYTFVNSN--------------------------------...........--
Q9XUE5_CAEEL/122-204....KE------K.E......FVCK--SVNFHYD.--------------------------------...........--
O17347_CAEEL/123-203....QE------AD.........CK--SAMYFYE.--------------------------------...........--
Q9U966_EIMTE/713-788....KD------AK.........CR--FFTLASG.--------------------------------...........--
Q27394_CAEEL/123-209....DE------KSF.......ECR--SISFNRT.--------------------------------...........--
Q94248_CAEEL/47-112....GR------EF.........CR--SAVYNSR.--------------------------------...........--
Q9U966_EIMTE/863-932....LN------KK.........CK--FFTFDQV.--------------------------------...........--
Q23328_CAEEL/23-103....MA------AGNGPE.GGSICK--AFTYELD.--------------------------------...........--
O97506_PIG/29-112....FH------PR.........CL--LFSFLPAD--------------------------------STS........--
Q94248_CAEEL/1063-1143....AL------R..........CR--SANLIAQG--------------------------------...........--
Q9Y1V3_POLMI/354-432....EE------TSF.......VCT--SFDYHKR.--------------------------------...........--
FA11_HUMAN/291-374....NA------VR.........CQ--FFTYTPAQ--------------------------------AS.........--
O61834_CAEEL/202-292....IR------SRIS.....DVCR--SYTYDNS.--------------------------------...........--
B9PXJ3_TOXGV/419-496....AE------KE.........CS--HYTYNVK.--------------------------------...........--
Q90978_CHICK/30-120....RN------KGLS.....FTCK--AFAYDRV.--------------------------------...........--
B9PXJ3_TOXGV/232-310....CD------GR.........CT--HFTFNDN.--------------------------------...........--
HGF_HUMAN/40-124....RN------KGLP.....FTCK--AFVFDKA.--------------------------------...........--
Q94248_CAEEL/242-320TYLPNN------KKN.......KCM--SFQFRNK.--------------------------------...........--
Q9W5Z0_DROME/118-206....IE------SEF.......LCR--SFLYLGQP--------------------------------Q..........--

PF14295

Q7QD96_ANOGA/35-86----.E------EP--------DCQAAAFSFVVN.--------------------------------......PLTPA..
B6JDB0_OLICO/42-92----.R------DR--------RCR..SWSFNYP.--------------------------------......SV.KR..
B6JDB0_OLICO/125-176----.A------DN--------RCR..AWTYARP.--------------------------------......GY.VG..
Q21BD4_RHOPB/39-89----.R------DR--------RCR..SWSFAYP.--------------------------------......TA.PE..
Q1QRJ6_NITHX/50-100----.R------DR--------RCR..AWSFSYP.--------------------------------......SE.RS..
Q1QRJ6_NITHX/133-187----.A------DS--------KCR..AWTYARP.--------------------------------......GY.AG..
A4Z2E2_BRASO/27-77----.H------DR--------RCR..AWSFNYP.--------------------------------......TV.ME..
C5BI67_TERTT/43-100----.R------NS--------NCA..SYTYVKP.--------------------------------......NV.ID..
C5BI67_TERTT/122-170----.D------ES--------QCR..AWTWVKP.--------------------------------......GI.QA..
A4S6G3_OSTLU/377-434----.E------NP--------NCN..VWTFCTAN--------------------------------DGCGRSEF.AY..
A4S6G3_OSTLU/486-538----.A------DP--------ACA..VWNFCDDV--------------------------------.....SGC.DGEF
A4S6G3_OSTLU/585-643----.K------MK--------KCN..AWVFCASI--------------------------------DGCGNEYY.DY..
Q2FN86_METHJ/487-537----.E------DE--------KCM..AYSYVKP.--------------------------------......GF.QS..
B2VUM0_PYRTR/713-759----.M------TS--------GCV..SVSWVS..--------------------------------..........E..
C1E8G6_MICCC/523-580----.E------NP--------GCN..VWTFCTDE--------------------------------GGCGGAAP.TY..
C1E8G6_MICCC/640-698----.E------DD--------RCN..SFVYCGSE--------------------------------SGCGGEYY.DY..
C1MZS3_MICPC/544-601----.E------NP--------SCN..VWSFCTVD--------------------------------DGCGQGTA.LY..
C1MZS3_MICPC/661-719----.R------FN--------GCN..SFVYCAGE--------------------------------DGCYSDYY.LY..
D3P9U3_DEFDS/608-658----.N------DP--------KCK..AWTFVKP.--------------------------------......GY.QG..
A4YQL0_BRASO/32-87----RE------LP--------RCR..AWTYVKPP--------------------------------T..FWHGL.QQ..
Q212S6_RHOPB/26-77----.A------NS--------SCM..AWTFVRS.--------------------------------......AG.QG..
A9V0Z5_MONBE/42-102----.N------TS--------GCN..GFVYTAP.--------------------------------......AW.PN..
A8IFR1_CHLRE/186-243----.N------TK--------QCN..TWAWCGDP--------------------------------.....RGC.NG..
A8XZR6_CAEBR/34-85----.S------IQ--------NCS..HFTFSHA.--------------------------------......AE.KN..
Q0C462_HYPNA/58-105----.D------DL--------SCK..AWSFVD..--------------------------------......TY.GA..
A9VDX2_MONBE/32-89----.Q------DE--------ECQ..AFTYNTAP--------------------------------HV.CTSAP.AG..
Q0AR81_MARMM/29-79----.A------DG--------TCQ..SWVWTRA.--------------------------------......EL.TG..
A9UWV1_MONBE/136-181----.N------NT--------ACV..AIVLNN..--------------------------------.........CT..
C1E8N1_MICCC/219-266----.A------DP--------DCR..GWVLVK..--------------------------------.............
Q7SFE8_NEUCR/154-203----.A------ME--------RCSGCSWGYLDG.--------------------------------......D..KG..
C1FJX3_MICCC/235-285----.G------TT--------GCN..VWVHCGD.--------------------------------......D..ES..
A9UVN3_MONBE/45-98----.S------TK--------NCN..AYVFDN..--------------------------------.........CS..
C1MHF5_MICPC/168-214----.D------AG--------TCT..TWVWHP..--------------------------------.............
Q0UP20_PHANO/126-176----.R------WP--------GCV..DVSWVDQ.--------------------------------.........YR..
A7UVW4_NEUCR/512-562----.A------NI--------DCV..GFIYQHG.--------------------------------......PA.NS..
V5ILY1_NEUCR/1388-1435----.T------TD--------LCM..AFAYVP..--------------------------------......GG.TG..

PF07502

G3NSW1_GASAC/41-130----KD......PE---------CN--VAFMERGD--------------------------------.............
B7PSB0_IXOSC/57-154----QT......SS---------CN--VAVFEEKE--------------------------------FAKPPLHVSEHTF
H2U8H9_TAKRU/6-100----KD......PK---------CN--VAFMERAK--------------------------------..........G.E
W5KZ36_ASTMX/28-122----SD......PN---------CN--LALIESTS--------------------------------........EESTS
I3K2I2_ORENI/38-127----KE......SR---------CN--VAFMEEGA--------------------------------.............
G3PKT8_GASAC/29-121----GM......PL---------CD--LALLQPRG--------------------------------..........GGA
T1J182_STRMM/41-125----DT......YK---------CN--VAVYEEKN--------------------------------.............
V8N7R6_OPHHA/37-128----KN......PD---------CN--LALVEQRP--------------------------------..........G.E
H2ZBX2_CIOSA/69-166----DYTDPNNQHT---------CD--LSVIQLSG--------------------------------.............
F6ZSJ7_XENTR/27-116----AEHQIAGHQD---------CN--LYIFDSRK--------------------------------.............
M4A584_XIPMA/31-117----QD......SR---------CN--LALLEPRD--------------------------------............G
A7RY69_NEMVE/28-116----RH......SS---------CN--LAMISYTN--------------------------------.............
H2MTN1_ORYLA/73-163----AQ......PH---------CT--VAVLQEEP--------------------------------............R
H2MRG4_ORYLA/29-119----KE......PK---------CN--LAFMKRGD--------------------------------............E
F6YM27_ORNAN/27-116----LAKNISGDKE---------CN--LIIFDTRK--------------------------------.............
U3IZT3_ANAPL/23-112----LGKGLPGDKK---------CN--FMIFDARG--------------------------------.............
F6SZP7_MONDO/126-217----ST......PS---------CN--LALVEQKP--------------------------------..........G.E
M4ANK0_XIPMA/35-125----SQ......PH---------CT--VAVVQEDL--------------------------------............R
H9GRZ2_ANOCA/88-178----AR......EP---------CS--LAVLQRAA--------------------------------.............
H3C9I2_TETNG/27-117----SQ......PH---------CT--VAVIQEEQ--------------------------------............G
Q2KJJ7_BOVIN/42-133----SS......ND---------CN--LALVELQP--------------------------------..........D.G
J9JMW5_ACYPI/27-110----RT......SR---------CD--VFVFEEKS--------------------------------.............
G3NW92_GASAC/36-126----SQ......PH---------CT--VAVVQQDR--------------------------------............R
W5NBX0_LEPOC/28-114----GH......KE---------CT--LALLESTA--------------------------------.............
G6D1B9_DANPL/170-253----ET......DS---------CD--VFVFEEKS--------------------------------.............
W4Z7Q6_STRPU/149-240----LK......EN---------CD--TTIFVGEA--------------------------------.............
B0WBN2_CULQU/54-138----ET......EN---------CD--VFVFEEKN--------------------------------.............
W5KPE8_ASTMX/26-115----RN......AR---------CN--LALVERAE--------------------------------.............
F6QXL1_CIOIN/65-162----DYKDPNNQQR---------CD--LSVYQASS--------------------------------.............
K7JW67_NASVI/40-124----ET......EH---------CD--VFIFEEKK--------------------------------.............
G5BM03_HETGA/34-125----TT......QN---------CN--LALVELQP--------------------------------..........D.R
H3BGP2_LATCH/23-112----DGVKINGQKK---------CN--LVIFDFRK--------------------------------.............
I3JDS1_ORENI/38-128----SQ......PH---------CT--VAVLHEDQ--------------------------------............R
H3BX24_TETNG/31-120----KE......PK---------CN--VAFMERGE--------------------------------.............
Q5VYB9_HUMAN/87-183----SE......PR---------CS--VAVVELPR--------------------------------.............
G1T9A5_RABIT/35-126----ET......QN---------CN--LALVELPP--------------------------------..........G.G
F1NZW5_CHICK/24-113----LGEKLSGGKK---------CN--LVIFDAQR--------------------------------.............
G3WZ70_SARHA/92-183----AE......PL---------CT--VAVVELPQ--------------------------------............P
H3BSM2_HUMAN/110-201----TT......QN---------CN--LALVELQP--------------------------------..........D.R
F7AX87_MOUSE/47-146----SE......PS---------CS--VAVVQLPR--------------------------------........GPSVP
W5N574_LEPOC/31-120----KN......PK---------CN--LALMENAE--------------------------------.............
H9G7H3_ANOCA/36-128----KH......PH---------CN--LALVEEQP--------------------------------..........GQE
U3J961_ANAPL/36-127----KD......PA---------CN--LALVEQVP--------------------------------..........N.S
Q0VC64_BOVIN/27-116----STKNISGDKA---------CN--LMIFDTQK--------------------------------.............
H3CGS7_TETNG/5-97----ER......AR---------CN--LALLELRG--------------------------------..........RDA
U3JUF3_FICAL/107-198----KD......PA---------CN--LALVEQGP--------------------------------..........A.P
H2SB93_TAKRU/7-99----ER......AH---------CN--LALLDPRF--------------------------------..........RGA
M3ZWM5_XIPMA/39-127----KD......PR---------CN--VALMENQG--------------------------------.............
W5NIC2_LEPOC/29-117----SK.EVEKGYK---------CN--LMVFDRNK--------------------------------.............
W5KI63_ASTMX/67-158----AE......PR---------CT--VAVVVREE--------------------------------...........RA
F6RCL0_XENTR/2-92----RT......LG---------CN--LALAQETD--------------------------------............N
E7F1U6_DANRE/26-113----KD......AR---------CN--LALVENQA--------------------------------.............
W5NK71_LEPOC/80-170----SD......PH---------CT--VAVAEQER--------------------------------............G
I3KRH2_ORENI/28-116----GQ......VH---------CN--LALLEPSV--------------------------------.............
C3Y0Q3_BRAFL/44-132----AT......DG---------CD--TAVFESGG--------------------------------..........GAG
H0ZR45_TAEGU/15-104----SGHRLAGDKK---------CN--LIIFYAAR--------------------------------.............
E9FR71_DAPPU/84-170----SF......HG---------CN--VAVYEEKD--------------------------------.............
E0VZG2_PEDHC/38-122----ET......SL---------CD--VFVMEQKV--------------------------------.............
H2RSF4_TAKRU/27-117----SQ......PH---------CT--VAVVREDP--------------------------------............R
G3TDS8_LOXAF/45-136----AT......HS---------CN--LALVELRP--------------------------------..........N.G
B4JE50_DROGR/43-127----ET......DA---------CD--VYIFERKA--------------------------------.............
MANS1_MOUSE/26-115----STKDIAGDKA---------CN--LMIFDTRK--------------------------------.............

PF08276

Y4729_ARATH/342-409----RN------CT---------CS--AYSP..FD--------------------------------IR..DGG.....-
Y1137_ARATH/337-407----GN------CS---------CT--AFSY..I.--------------------------------.....EQ.....-
RKS1_ARATH/338-406----KN------CS---------CV--AYAS..AY--------------------------------HESKRGA.....-
Y4119_ARATH/368-431----AD------CS---------CQ--AYAN..D.--------------------------------......G.....-
Y1148_ARATH/333-399----HN------CS---------CL--AFAY..I.--------------------------------.....NG.....-
Y1643_ARATH/332-398----HN------CS---------CL--AFSY..I.--------------------------------.....PG.....-
Y1141_ARATH/341-409----KN------CS---------CV--AYAS..AY--------------------------------HESQDGA.....-
Y1112_ARATH/338-408----SN------CS---------CS--AFAY..I.--------------------------------.....TG.....-
Y1150_ARATH/334-400----HN------CS---------CL--AFAY..I.--------------------------------.....KG.....-
Y4230_ARATH/339-410----NN------CQ---------CQ--AYSYEEVD--------------------------------ILQSN.......-
SD11_ARATH/345-413----SN------CS---------CT--AYAN..TD--------------------------------IR..EGG.....-
Q7XXJ5_ORYSJ/359-424----SS------CS---------CT--AYSY..QN--------------------------------T...........-
Q7XQT8_ORYSJ/353-423----AN------CS---------CV--AYAP..AD--------------------------------IGG.GGGCG.AG-
Q943Q1_ORYSJ/357-425----NN------CS---------CT--AYSY..GS--------------------------------............-
Q7XMR2_ORYSJ/371-438----SS------CS---------CT--AYSY..QN--------------------------------............-
Q7XQX5_ORYSJ/351-414----GK------CS---------CT--AYSF..GN--------------------------------Y...........-
Q7XQT7_ORYSJ/350-421----AN------CS---------CL--AYAA..AD--------------------------------IRG.GGG....G-
Q60D68_ORYSJ/362-427----SY------CS---------CN--AYSY..EN--------------------------------............-
Q7EZ32_ORYSJ/358-422----SN------CS---------CG--AYVY..M.--------------------------------.....TT.....-
Y1661_ARATH/350-416----RD------CS---------CK--AYAL..V.--------------------------------.....VG.....-
Q7XI25_ORYSJ/379-447----HD------CA---------CT--AYTY..NG--------------------------------............-
SD17_ARATH/341-407----ED------CN---------CT--AFAN..AD--------------------------------IR..NGG.....-
Q60EJ2_ORYSJ/344-413----GN------CS---------CT--AYAN..AN--------------------------------LSA.PPG....R-
B120_ARATH/346-412----RN------CS---------CN--AYSL..V.--------------------------------.....GG.....-
Q7Y1P1_ORYSJ/344-411----SN------CA---------CR--AYAS..AN--------------------------------VTS.ADA.....-
Q8LQN6_ORYSJ/344-412----GN------CS---------CR--AYAA..AN--------------------------------AS...GGV...S-
Q851M7_ORYSJ/328-394----SG------SS---------CV--A.STALSD--------------------------------GS..........-
Q8H821_ORYSJ/354-415----VD------CS---------CT--AYVH....--------------------------------.....DG.....-
D7KZN2_ARALL/365-430----KD------CN---------CT--GFAN..KD--------------------------------IR..NGG.....-
D7MEU3_ARALL/350-416----KD------CN---------CT--AFAN..TD--------------------------------IR..GGG.....-
D7MEU5_ARALL/350-415----KT------CN---------CT--AFAN..TD--------------------------------IR..NGG.....-
I1QYI6_ORYGL/369-433----SN------CS---------CN--AYAY..KD--------------------------------............-
M4C7T3_BRARP/338-404----KD------CN---------CT--AFAN..MD--------------------------------IR..DGG.....-
M4CIU6_BRARP/181-247----QD------CN---------CT--AYAN..TD--------------------------------IR..DGG.....-
M4CIZ5_BRARP/356-420----SD------CN---------CT--SFAT..AD--------------------------------VR..NGG.....-
M4FHL1_BRARP/345-410----RD------CT---------CT--SFAA..AD--------------------------------VR..NGG.....-
PSRK_ARATH/348-413----TH------CN---------CT--AYAN..SD--------------------------------IR..NGG.....-
W5BTS4_WHEAT/325-394----RN------CS---------CT--AYAY..AN--------------------------------LS..NLGVTVDQ-

PF08277

O16726_CAEEL/19-83----WD------NN---------CFLAYY....S----------------------------------------------
Q18574_CAEEL/20-92----QN------DT---------CVIAQANLTTP----------------------------------------------
O62154_CAEEL/24-92----ED------SD---------CLLAFF....N----------------------------------------------
O17672_CAEEL/26-95----SS------PG---------CIVAGFE...D----------------------------------------------
Q9U2V0_CAEEL/23-94----DF------ST---------VILASWN..SS----------------------------------------------
O01337_CAEEL/48-117----NK------LD---------CIVAGFE...N----------------------------------------------
O62150_CAEEL/25-95----ED------EH---------CFLMYFR...V----------------------------------------------
O01701_CAEEL/22-92----YG------ST---------CILVYCP..SE----------------------------------------------
O01336_CAEEL/22-95----SK------VN---------CIVAGFE...Y----------------------------------------------
Q9XVD0_CAEEL/1-71----NS------MY---------CVLAYGN...D----------------------------------------------
O44831_CAEEL/18-94----SS------DN---------CILSYSN..SS----------------------------------------------
Q9N4A0_CAEEL/25-95----ND------TE---------CILAYWD..SD----------------------------------------------
O02127_CAEEL/50-122----SE------TY---------CMLAFGN...D----------------------------------------------
Q9NA49_CAEEL/29-98----DE------ED---------CVLIAKI...T----------------------------------------------
Q9GRV4_CAEEL/22-94----GL------SA---------CMMVSHAI.GT----------------------------------------------
A8XBL6_CAEBR/41-108----GD------AT---------CVLIAET...S----------------------------------------------
Q9U2Q4_CAEEL/178-252----KD------LN---------CFVNYYD...K----------------------------------------------
O44833_CAEEL/23-99----ES------ST---------CILAYSS...T----------------------------------------------
A8WJ07_CAEBR/13-84----GK------GT---------CMLAYGS...D----------------------------------------------
A8Y004_CAEBR/24-93----LD------VD---------CSAVYKL..SD----------------------------------------------
O02128_CAEEL/1-73----KE------TY---------CMLAFGN...D----------------------------------------------
O62406_CAEEL/24-92----GS------ES---------CIIAYFS...L----------------------------------------------
O16210_CAEEL/23-99----AN------PE---------CAVVTWR..VP----------------------------------------------
Q9NEP2_CAEEL/1-72----NM------DT---------CVAVYTP...D----------------------------------------------
Q9XV53_CAEEL/24-96----ED------LN---------CILAYQKS.DS----------------------------------------------
Q7YTL3_CAEEL/26-97----ET------ED---------CVTAVLD..TS----------------------------------------------
A8Y003_CAEBR/24-93----AD------VN---------CVVVYKI..SD----------------------------------------------
O02131_CAEEL/21-93----NS------YP---------CMIAYGN...E----------------------------------------------
A8XU86_CAEBR/1-68----NL------AT---------CVAVY.....D----------------------------------------------
O16208_CAEEL/30-102----AI------FD---------CIVASQKS.PS----------------------------------------------
Q9NA50_CAEEL/26-95----CD------VT---------CVVIFRT...S----------------------------------------------
O44835_CAEEL/16-89----ST------EI---------CIMAYSN..SL----------------------------------------------
O45492_CAEEL/23-95----EE------ST---------FILAFWN..SS----------------------------------------------
Q9N522_CAEEL/20-88----WD------VN---------CLAVHKV...G----------------------------------------------
Q9U2Q4_CAEEL/29-101----EE------FD---------CVVAYQSN.AS----------------------------------------------
Q9N4B3_CAEEL/1-70----YS------PA---------CVMAWQN...D----------------------------------------------
Q9XTS6_CAEEL/1-68----GL------ST---------CVAVYNN....----------------------------------------------
A4F307_CAEEL/1-67----DT------WN---------CVLISKL...T----------------------------------------------

PF02430

A5K4Z2_PLAVS/55-520IPYVKEVEAEDLRE---------CNRIVFGASASD.QPTQYEEEMTDYQKIQQGFRQNNREMIKSA.FLPVGAFNSDNFK
Q4YZP5_PLABA/17-475YQKHTVHDSDSLLK---------CNQIIFNESASD.QPKQYEKHLEDTTKFRQGVAERNGKLIGEA.LLPIGSYKSDQIK
A7ASF6_BABBO/97-566IAPAFQEYANSTED---------CAAILFDNSATDLDIEVVNEEFNELKELTSGLKRLNLSKVANAIFSPLSNVAGTSRI
Q4UHH9_THEAN/247-742IEPIFEEEAEDYEA---------CAKIIFEYSPSDVDISTNNQKLSDVDLYKEAMNNGKLSTALSIMFAP..RYSEDRPI
Q7KQK5_PLAF7/110-580IPHVNEFPAIDLFE---------CNKLVFELSASD.QPKQYEQHLTDYEKIKEGFKNKNASMIKSA.FLPTGAFKADRYK

PF00024

Q9VCR4_DROME/150-255GPGQRPSPRL----G--RCMLSDR---DKTVQP...................DAFRAAP---------------------
Q9VCR4_DROME/265-347.......LSL----S--ECLLHSE---DIVSL.....................GPRSLK---------------------
KLKB1_MOUSE/292-375.....CKEEG----C--KCSLRLS---TDGS......................PTRITY---------------------
PLMN_MOUSE/24-98.........E----Q--QCVIMAE---NSKT.......................SSIIR---------------------
KLKB1_MOUSE/21-104.....ETNKR----F--GCFMKES---ITGT......................LPRIHR---------------------
Q20167_CAEEL/20-106.........I----L--QCSHHSD---DGQPF.....................GASVLA---------------------
Q20167_CAEEL/304-382.........D----D--ECQLSDI---SQFSR.....................PNEFVV---------------------
Q20167_CAEEL/205-297.........K----Q--ECHLTAE---SSYVGHK................GDKRFNLAP---------------------
Q20167_CAEEL/113-200.........T----G--ECIMNRD---NKFI......................YPKLFK---------------------
Q22815_CAEEL/24-101.........Q----H--ICHYFSD---EGVD......................QAILSA---------------------
Q22815_CAEEL/470-555.........T----G--QCRLMTE---DSMT......................SPDSFE---------------------
Q22815_CAEEL/375-459.........T----H--TCHLSTK---SDGV......................TIKAPP---------------------
Q9V9X0_DROME/209-287.........S----G--LCELSDM---DRITLS...................AGGSVEP---------------------
Q9V9X0_DROME/295-376........GD----M--VCRLSHH---SRATL.....................TDVMDP---------------------
Q18298_CAEEL/226-303.........S----N--ECFVSDE---TSDV.........................AVP---------------------
Q18298_CAEEL/312-390.........T----R--SCLLSST---SKSI........................SATV---------------------
Q18298_CAEEL/142-219.........A----K--RCSFYNS---TRRD.......................AVIIR---------------------
Q18298_CAEEL/50-135........RN----P--VCEFFPA---TGNKDN...................ITRSLKS---------------------
Q21782_CAEEL/228-319.........T----R--QCSVYSD---AINP......................NGYLEY---------------------
Q21782_CAEEL/329-416........SS----L--NCILNVH---TRHTK.....................NQYFTP---------------------
O62201_CAEEL/632-720.........R----G--FCYLMTS---PPAD......................DVAMTP---------------------
O62201_CAEEL/729-814........TT----L--NCILNDS---TNLED.....................PASFFD---------------------
HGFL_HUMAN/18-106.........S----H--GCQLLPW---TQHSP.....................HTRLRR---------------------
PLMN_PIG/20-99.........D----Q--QCVVMAE---NSKT.......................SPIAR---------------------
O45277_CAEEL/419-497.........T----R--GCMLFHK---QIDF.......................NVLQP---------------------
O45277_CAEEL/80-160.........T----Q--NCVLSKY---ARHE.......................RTVKK---------------------
O45277_CAEEL/320-398.........L----K--ICILNGG---NLHLN.....................GGDTLV---------------------
PLMN_MACEU/17-99.........E----Q--KCVIMSE---NSKT.......................SSVER---------------------
FA11_HUMAN/110-193.....SLEHR----N--ICLLKHT---QTGT......................PTRITK---------------------
KLKB1_HUMAN/111-194.....KAEYR----N--NCLLKYS---PGGT......................PTAIKV---------------------
Q9XUE5_CAEEL/21-112..........----E--TCYFFDD---AATPA....................GTSQLTA---------------------
Q13208_HUMAN/5-81.........S----H--GCQLLPW---TQHSP.....................HSRLRH---------------------
Q94248_CAEEL/576-659.........S----K--TCLINKQ---NRFSNP...................EKFNFVP---------------------
Q9VAG2_DROME/113-197..........----.--LCVLFSA---HADQL.....................PGALTK---------------------
Q9U966_EIMTE/637-707.........S----K--ACSMLSG---EGEE.........................VQ.---------------------
O61834_CAEEL/108-192.........T----S--LCQLSRV---SLNSV....................YNPRLYF---------------------
Q9V9X1_DROME/320-401........GE----L--VCRLSHH---SRATLTD.................LSEPYLSI---------------------
Q9W5Z0_DROME/15-98.........N----M--KCVLSDS---DRRSSG...................QFVQLVD---------------------
Q9V9X1_DROME/145-223..........----.--LCVMFRS---TADQL.....................PGSLSR---------------------
KLKB1_RAT/111-194.....RPEYR----K--SCLLKRS---SSGT......................PTSIKP---------------------
Q9U966_EIMTE/182-254.........S----K--ECTSHPS---EVGSA.....................EDKASV---------------------
Y2913_ARATH/341-418.........S----S--KCLVWSK---DVLN......................LQQLED---------------------
FA11_HUMAN/200-283.....KESQR----N--LCLLKTS---ESGLP.....................STRIKK---------------------
Q22902_CAEEL/114-194.........D----K--ECILASQ---SKAD......................IPDLFI---------------------
Q9XUE5_CAEEL/212-295.........E----K--NCIVSDE---DTFSR....................ADQQGQV---------------------
Q9U966_EIMTE/263-337.........T----K--ICYHKKK---VGNI.......................AYGLK---------------------
KLKB1_HUMAN/201-284.....IESQR----N--VCLLKTS---ESGT.......................PSSST---------------------
Q9VAG2_DROME/203-286.........S----G--ACELSEL---DRLTL....................AGSQAFQ---------------------
PLMN_ERIEU/17-99.........E----Q--QCVIMAE---NSKS......................TPVLRM---------------------
Q91691_XENLA/29-114.........S----Q--TCRLLPW---TQNS.......................ANVLL---------------------
SD31_ARATH/332-413........GE----P--QCRMKLT---RYIS.......................GYSDP---------------------
KLKB1_HUMAN/21-104.....DMEKR----F--GCFLKDS---VTGT......................LPKVHR---------------------
Q9U966_EIMTE/421-490.........G----K--VCYLHVA---YA.........................AKLKR---------------------
B9PXJ3_TOXGV/141-214.........D----Q--KCTFKGR---GFSA.........................FKE---------------------
Q23328_CAEEL/311-391.........S----K--KCELHNV---DVST.......................GDYAR---------------------
Q91402_9PIPI/27-111.........I----K--RCHWFSF---NTMS.......................AGIKD---------------------
MIA1_SARMU/112-181.........S----K--ACHLKDG---APVF.......................YTYNG---------------------
Q94248_CAEEL/448-532.........E----R--DCILNLE---DRNI......................KSKLFE---------------------
KLKB1_RAT/201-284.....TESQR----N--VCFLKTS---KSGRP.....................SPPIIQ---------------------
Q9XUE5_CAEEL/305-382.........A----S--SCFIYAV---GRQD.......................ANIKA---------------------
O61834_CAEEL/21-103.....KKNGG----F--NCHLHSK---SP..........................VLTT---------------------
Q22902_CAEEL/21-95.........T----M--NCQLNGK---SKQD.........................VKT---------------------
FA11_HUMAN/20-103.....DPTRW----F--TCVLKDS---VTET......................LPRVNR---------------------
B9PXJ3_TOXGV/68-137.........S----K--MCHVKEG---KP..........................DLYD---------------------
MIA2_SARMU/9-78.........S----K--KCHLKAG---APEF........................YTYT---------------------
Q90865_CHICK/18-104.........S----Q--LCQLLPW---SQRSP.....................GARLQK---------------------
PLMN_BOVIN/24-106.........E----Q--QCVVMAE---NSKNT.....................P..VFR---------------------
Q23328_CAEEL/212-303.........E----K--KCELYGI---LAEPH....................GSGKLLE---------------------
YMP9_CAEEL/49-134......YQEK----G--FCELLTE---GQLD......................NPSLMR---------------------
O42830_PHYPR/61-165.......PGQ----P--ACYLKSG---TGTRTPSVGAVSGILTGTSTTPTPTPTMTPTP---------------------
Q9XUE5_CAEEL/122-204.........T----S--LCELSVE---DKRS......................KPTHVR---------------------
O17347_CAEEL/123-203.........D----G--ECITNKE---SAMTKP...................AG..FTK---------------------
Q9U966_EIMTE/713-788..........----.--KCSLFAD---DAALRP..................TKSDGAVS---------------------
Q27394_CAEEL/123-209.........D----G--GCHMSKD---SQIS......................RPEAIR---------------------
Q94248_CAEEL/47-112.........T----K--TCGISYE---YTVACA..................SRTQRFKE---------------------
Q9U966_EIMTE/863-932.........S----K--SCKLFAS---DSE.........................RLPA---------------------
Q23328_CAEEL/23-103.........K----Q--LCRLYDN---DGHKI.....................PAVIHP---------------------
O97506_PIG/29-112.....VTDKR----F--GCFLKDS---VTGM......................LPRVLR---------------------
Q94248_CAEEL/1063-1143........EF----N--SCELYRD---SLIDY....................RRPDMIG---------------------
Q9Y1V3_POLMI/354-432.........S----Q--LCYLYSA---SVSR........................QLKR---------------------
FA11_HUMAN/291-374.....CNEGK----G--KCYLKLS---SNGS......................PTKILH---------------------
O61834_CAEEL/202-292.........T----N--ECNLMWA---SARMLGRSP.............LESMKPNLFH---------------------
B9PXJ3_TOXGV/419-496.........S----G--LCYPKRG---KPQF.......................YKYLG---------------------
Q90978_CHICK/30-120.........T----K--RCHWLSF---NSLTN.....................G..VRK---------------------
B9PXJ3_TOXGV/232-310.........T----R--MCYLKGD---KMQLY.....................SSPGDR---------------------
HGF_HUMAN/40-124.........R----K--QCLWFPF---NSMSS.....................G..VKK---------------------
Q94248_CAEEL/242-320..........----.--TCTLNKG---NH..L....................GQYDLIE---------------------
Q9W5Z0_DROME/118-206.......GSQ----Y--NCRLYHL---DHKTLPD.................GPSTYLNH---------------------

PF14295

Q7QD96_ANOGA/35-86Q........E....T--LCQLQ----------------------------------------------------------
B6JDB0_OLICO/42-92G........S....A--ICWLK----------------------------------------------------------
B6JDB0_OLICO/125-176R........D....A--RCYLK----------------------------------------------------------
Q21BD4_RHOPB/39-89A........G....A--SCWLK----------------------------------------------------------
Q1QRJ6_NITHX/50-100E........T....A--VCWLK----------------------------------------------------------
Q1QRJ6_NITHX/133-187K........A....A--RCFLK----------------------------------------------------------
A4Z2E2_BRASO/27-77A........G....A--VCWLK----------------------------------------------------------
C5BI67_TERTT/43-100A........Y....P--HCYLK----------------------------------------------------------
C5BI67_TERTT/122-170A........S....G--VCWLK----------------------------------------------------------
A4S6G3_OSTLU/377-434S........Y....S--SCELK----------------------------------------------------------
A4S6G3_OSTLU/486-538A........Y....Q--TCVLK----------------------------------------------------------
A4S6G3_OSTLU/585-643K........F....G--ECWLK----------------------------------------------------------
Q2FN86_METHJ/487-537E........K....A--RCWLK----------------------------------------------------------
B2VUM0_PYRTR/713-759R........H....G--ACYMK----------------------------------------------------------
C1E8G6_MICCC/523-580S........Y....S--RCSLK----------------------------------------------------------
C1E8G6_MICCC/640-698K........H....R--ECWLK----------------------------------------------------------
C1MZS3_MICPC/544-601S........Y....S--QCVLK----------------------------------------------------------
C1MZS3_MICPC/661-719K........H....R--ECWLK----------------------------------------------------------
D3P9U3_DEFDS/608-658P........N....P--RCWLK----------------------------------------------------------
A4YQL0_BRASO/32-87P........P....A--RCWLK----------------------------------------------------------
Q212S6_RHOPB/26-77Q........M....P--HCWLK----------------------------------------------------------
A9V0Z5_MONBE/42-102PQHATCSFAN....G--CCWLK----------------------------------------------------------
A8IFR1_CHLRE/186-243G........QLFRFR--QCWLK----------------------------------------------------------
A8XZR6_CAEBR/34-85I........I....S--NCHLF----------------------------------------------------------
Q0C462_HYPNA/58-105S........P....A--RCELK----------------------------------------------------------
A9VDX2_MONBE/32-89S........Q....H--CCGLK----------------------------------------------------------
Q0AR81_MARMM/29-79S........E....P--ACSLL----------------------------------------------------------
A9UWV1_MONBE/136-181N........P....P--TCWLK----------------------------------------------------------
C1E8N1_MICCC/219-266D........A....G--VCWLK----------------------------------------------------------
Q7SFE8_NEUCR/154-203N........K....H--RCWLK----------------------------------------------------------
C1FJX3_MICCC/235-285C........H....G--SCWLK----------------------------------------------------------
A9UVN3_MONBE/45-98D........G....P--ICWLK----------------------------------------------------------
C1MHF5_MICPC/168-214D........S....K--ECWLK----------------------------------------------------------
Q0UP20_PHANO/126-176P........G....G--ACYLK----------------------------------------------------------
A7UVW4_NEUCR/512-562NG......LD....V--PCYLK----------------------------------------------------------
V5ILY1_NEUCR/1388-1435I........Q....A--PCYMK----------------------------------------------------------

PF07502

G3NSW1_GASAC/41-130EE...GAV------K--SCFLFDC---...V-------------------------YNK---------------------
B7PSB0_IXOSC/57-154PA...QGK------G--SCYLFDC---...G-------------------------PPS---------------------
H2U8H9_TAKRU/6-100EEEKGGLI------S--SCFLFDC---...L-------------------------YKK---------------------
W5KZ36_ASTMX/28-122EE...STI------H--ACFTFNC---...L-------------------------YKQ---------------------
I3K2I2_ORENI/38-127EE...GTI------S--SCFLFDC---...L-------------------------YKQ---------------------
G3PKT8_GASAC/29-121EA...AEH------R--ECVLFNC---...V-------------------------HRN---------------------
T1J182_STRMM/41-125.......K------G--SCYIFDC---...S-------------------------PMG---------------------
V8N7R6_OPHHA/37-128DS...DGI------Q--SCFLLNC---...L-------------------------YDQ---------------------
H2ZBX2_CIOSA/69-166GG...GGK------P--CCFLFSC---T.NH-------------------------STG---------------------
F6ZSJ7_XENTR/27-116.I...NKH------L--NCYLFHC---....-------------------------.PT---------------------
M4A584_XIPMA/31-117EE...EDT------R--NCFLFNC---...V-------------------------HKN---------------------
A7RY69_NEMVE/28-116STSGSDAV------R--MCYLFDC---....-------------------------.GS---------------------
H2MTN1_ORYLA/73-163KA...GDS------L--GCYLFNC---...T-------------------------YRN---------------------
H2MRG4_ORYLA/29-119EN...GPI------E--SCFLFDC---...L-------------------------YKN---------------------
F6YM27_ORNAN/27-116.T...RNQ------Q--NCYLFYC---....-------------------------.PS---------------------
U3IZT3_ANAPL/23-112.T...KTH------P--NCYLFYC---....-------------------------.PS---------------------
F6SZP7_MONDO/126-217GE...DAI------S--ACFLLNC---...L-------------------------YEQ---------------------
M4ANK0_XIPMA/35-125RP...ADG------L--SCYLFNC---...T-------------------------YRN---------------------
H9GRZ2_ANOCA/88-178TP...SDA------P--RCYLFNC---...T-------------------------FRG---------------------
H3C9I2_TETNG/27-117LP...GAD------L--DCYLFNC---...T-------------------------YRG---------------------
Q2KJJ7_BOVIN/42-133GE...DAI------V--SCFLINC---...L-------------------------YEQ---------------------
J9JMW5_ACYPI/27-110.......P------G--TCYLFEC---...G-------------------------PSD---------------------
G3NW92_GASAC/36-126QL...GDT------L--SCYLFNC---...T-------------------------YRG---------------------
W5NBX0_LEPOC/28-114.....GAP------A--ECHLVSC---...L-------------------------SAG---------------------
G6D1B9_DANPL/170-253.......P------G--SCYLFSC---...G-------------------------PPE---------------------
W4Z7Q6_STRPU/149-240YR...SED------T--NCFLFVC---RPEG-------------------------KNG---------------------
B0WBN2_CULQU/54-138.......Q------G--TCFLFNC---...G-------------------------PPS---------------------
W5KPE8_ASTMX/26-115EQ...DSI------T--NCFLFDC---...V-------------------------YRN---------------------
F6QXL1_CIOIN/65-162TR...SRK------P--KCFIFSC---L.NE-------------------------STG---------------------
K7JW67_NASVI/40-124.......P------G--SCYLFHC---...G-------------------------PPH---------------------
G5BM03_HETGA/34-125GE...DSI------S--SCFLMNC---...L-------------------------YEQ---------------------
H3BGP2_LATCH/23-112.H...PQQ------D--NCYLFHC---....-------------------------.PS---------------------
I3JDS1_ORENI/38-128QP...GDS------L--RCYLFNC---...T-------------------------YRS---------------------
H3BX24_TETNG/31-120EE...GSI------S--SCFLFDC---...L-------------------------YKM---------------------
Q5VYB9_HUMAN/87-183RPAPPAAV------L--GCYLFNC---...T-------------------------ARG---------------------
G1T9A5_RABIT/35-126GE...DAV------A--ACFLMDC---...L-------------------------YEQ---------------------
F1NZW5_CHICK/24-113.A...STQ------P--NCYLFHC---....-------------------------.PS---------------------
G3WZ70_SARHA/92-183QA...AGD------L--HCYLFNC---...T-------------------------YRG---------------------
H3BSM2_HUMAN/110-201GE...DAI------A--ACFLINC---...L-------------------------YEQ---------------------
F7AX87_MOUSE/47-146AP...MPA------P--RCYLFNC---...T-------------------------ARG---------------------
W5N574_LEPOC/31-120EE...GLI------K--HCFLFDC---...L-------------------------YKQ---------------------
H9G7H3_ANOCA/36-128EQ...DGI------R--SCFLLDC---...L-------------------------YDQ---------------------
U3J961_ANAPL/36-127GE...DHI------Q--GCFLLNC---...L-------------------------YEH---------------------
Q0VC64_BOVIN/27-116.K...FKL------P--NCYLFFC---....-------------------------.PS---------------------
H3CGS7_TETNG/5-97AG...ARN------H--TCVLFNC---...I-------------------------HRN---------------------
U3JUF3_FICAL/107-198EE...DHI------R--GCFLLNC---...L-------------------------YEK---------------------
H2SB93_TAKRU/7-99ED...ARN------F--TCVLFNC---...I-------------------------HRN---------------------
M3ZWM5_XIPMA/39-127.E...GTI------N--SCYLFDC---...L-------------------------YNK---------------------
W5NIC2_LEPOC/29-117.K...LKH------P--NCYLLHC---....-------------------------.PS---------------------
W5KI63_ASTMX/67-158AP...RDG------P--RCYLFNC---...T-------------------------YRG---------------------
F6RCL0_XENTR/2-92GE...DVI------N--SCFLINC---...V-------------------------YEQ---------------------
E7F1U6_DANRE/26-113......SD------N--NCFLFNC---...L-------------------------YKH---------------------
W5NK71_LEPOC/80-170RS...EES------L--SCFLFNC---...T-------------------------YRG---------------------
I3KRH2_ORENI/28-116PG...EEN------R--TCVLFNC---...V-------------------------RRN---------------------
C3Y0Q3_BRAFL/44-132SA...DSS------R--NCYLFSC---....-------------------------...---------------------
H0ZR45_TAEGU/15-104.A...STH------P--NCYLFYC---....-------------------------.PS---------------------
E9FR71_DAPPU/84-170.......G------G--NCYLFDC---...G-------------------------PAE---------------------
E0VZG2_PEDHC/38-122.......P------G--SCYLFHC---...G-------------------------SPE---------------------
H2RSF4_TAKRU/27-117QP...GKS------L--KCYLFNC---...T-------------------------YRN---------------------
G3TDS8_LOXAF/45-136LE...DDT------P--SCFLMNC---...L-------------------------YEQ---------------------
B4JE50_DROGR/43-127.......G------G--YCYLFEC---...G-------------------------PPE---------------------
MANS1_MOUSE/26-115.T...DRQ------P--NCYLFFC---....-------------------------.PS---------------------

PF08276

Y4729_ARATH/342-409--------------K--GCILWFG---DLIDI------------------------------------------------
Y1137_ARATH/337-407--------------I--GCLVWNR---ELVDV------------------------------------------------
RKS1_ARATH/338-406--------------I--GCLKWHG---GMLDA------------------------------------------------
Y4119_ARATH/368-431--------------N--KCLVWTK---DAFNL------------------------------------------------
Y1148_ARATH/333-399--------------I--GCLMWNQ---DLMDA------------------------------------------------
Y1643_ARATH/332-398--------------I--GCLMWSK---DLMDT------------------------------------------------
Y1141_ARATH/341-409--------------K--GCLTWHG---NMLDT------------------------------------------------
Y1112_ARATH/338-408--------------I--GCLLWNH---ELIDT------------------------------------------------
Y1150_ARATH/334-400--------------I--GCLVWNQ---DLMDA------------------------------------------------
Y4230_ARATH/339-410--------------T--KCWIWLE---DLNNL------------------------------------------------
SD11_ARATH/345-413--------------K--GCLLWFG---DLVDM------------------------------------------------
Q7XXJ5_ORYSJ/359-424--------------S--TCSIWHD---ELFSV------------------------------------------------
Q7XQT8_ORYSJ/353-423--------------S--GCIIWAD---DLVDL------------------------------------------------
Q943Q1_ORYSJ/357-425--------------K--GCLVWHT---ELLNA------------------------------------------------
Q7XMR2_ORYSJ/371-438--------------N--ICSVWHG---DLFSV------------------------------------------------
Q7XQX5_ORYSJ/351-414--------------N--GCSIWHG---KLVNV------------------------------------------------
Q7XQT7_ORYSJ/350-421--------------S--GCVIWTG---GIVDL------------------------------------------------
Q60D68_ORYSJ/362-427--------------N--RCSIWHG---DLLSV------------------------------------------------
Q7EZ32_ORYSJ/358-422--------------I--GCLLWGS---DLIDM------------------------------------------------
Y1661_ARATH/350-416--------------I--GCMIWTR---DLIDM------------------------------------------------
Q7XI25_ORYSJ/379-447--------------N--RCSIWHG---ELRSV------------------------------------------------
SD17_ARATH/341-407--------------S--GCVIWTR---EILDM------------------------------------------------
Q60EJ2_ORYSJ/344-413--------------R--GCVMWTG---ELEDL------------------------------------------------
B120_ARATH/346-412--------------I--GCMIWNQ---DLVDL------------------------------------------------
Q7Y1P1_ORYSJ/344-411--------------K--GCFMWTA---DLLDM------------------------------------------------
Q8LQN6_ORYSJ/344-412--------------R--GCVIWAV---DLLDM------------------------------------------------
Q851M7_ORYSJ/328-394--------------G--LCFLKVS---NFVSG------------------------------------------------
Q8H821_ORYSJ/354-415--------------A--KCLVWNG---ELVNM------------------------------------------------
D7KZN2_ARALL/365-430--------------S--GCVIWTR---ELRDM------------------------------------------------
D7MEU3_ARALL/350-416--------------S--GCVTWTG---ELFDI------------------------------------------------
D7MEU5_ARALL/350-415--------------S--GCVIWIG---RFVDI------------------------------------------------
I1QYI6_ORYGL/369-433--------------S--TCFVWHS---ELLNV------------------------------------------------
M4C7T3_BRARP/338-404--------------S--GCVIWKG---DIFDI------------------------------------------------
M4CIU6_BRARP/181-247--------------S--GCVIWNG---GLFDI------------------------------------------------
M4CIZ5_BRARP/356-420--------------L--GCVFWTG---DLVE.------------------------------------------------
M4FHL1_BRARP/345-410--------------T--GCVMWTR---QLNDT------------------------------------------------
PSRK_ARATH/348-413--------------S--GCIIWIG---EFRDI------------------------------------------------
W5BTS4_WHEAT/325-394--------------S--RCLVWMG---ELVDT------------------------------------------------

PF08277

O16726_CAEEL/19-83--------------S..VCHLFEY...GN.M-----------------------SV...---------------------
Q18574_CAEEL/20-92--------------N..ECQLCSI...QN.L-----------------------MHIQK---------------------
O62154_CAEEL/24-92--------------S..VCSHYYV...SDQS-----------------------ITVVE---------------------
O17672_CAEEL/26-95--------------G..ICKLFEI...GS.I-----------------------STIKR---------------------
Q9U2V0_CAEEL/23-94--------------E..NCHLFGF...DQIL-----------------------DQILE---------------------
O01337_CAEEL/48-117--------------G..TCKLFEI...GK.L-----------------------STIKR---------------------
O62150_CAEEL/25-95--------------E..KCYFHSY...LN.T-----------------------GQLIS---------------------
O01701_CAEEL/22-92--------------G..KCTVFDY...IR.R-----------------------PKSLK---------------------
O01336_CAEEL/22-95--------------E..TCTHIEL...GR.V-----------------------FTIKR---------------------
Q9XVD0_CAEEL/1-71--------------S..SCTLFDF...GD.V-----------------------STVEK---------------------
O44831_CAEEL/18-94--------------G..YCLLYAV...GD.I-----------------------ILVRN---------------------
Q9N4A0_CAEEL/25-95--------------N..KCVNYKY...SE.F-----------------------DGGNN---------------------
O02127_CAEEL/50-122--------------S..SCTLCDI...YA.V-----------------------NKITQ---------------------
Q9NA49_CAEEL/29-98--------------T..NFYIFRQ...GK.E-----------------------FHVVQ---------------------
Q9GRV4_CAEEL/22-94--------------Q..NCIAYEI...GQ.V-----------------------STVRE---------------------
A8XBL6_CAEBR/41-108--------------S..GCVNFNF...AN.V-----------------------PIVEK---------------------
Q9U2Q4_CAEEL/178-252--------------DSKECWWWSI...DN.V-----------------------HFLEK---------------------
O44833_CAEEL/23-99--------------E..VCVLYAV...GD.V-----------------------IQVKN---------------------
A8WJ07_CAEBR/13-84--------------E..NCNLCDI...YT.T-----------------------SSINQ---------------------
A8Y004_CAEBR/24-93--------------V..QCQYFSF...GS.I-----------------------STLQK---------------------
O02128_CAEEL/1-73--------------S..SCTLCDI...YA.V-----------------------SKITQ---------------------
O62406_CAEEL/24-92--------------T..TCVFYNY......V-----------------------NDGKT---------------------
O16210_CAEEL/23-99--------------L..YCGVFKLVVPNTDS-----------------------LGIMK---------------------
Q9NEP2_CAEEL/1-72--------------SSEVCIVFEF...GQ.I-----------------------STLQQ---------------------
Q9XV53_CAEEL/24-96--------------E..PCQLFPW...NT.I-----------------------SGVKG---------------------
Q7YTL3_CAEEL/26-97--------------G..TCFTCKF...KA.A-----------------------WTVKK---------------------
A8Y003_CAEBR/24-93--------------I..QCQYFSF...GS.I-----------------------STIQQ---------------------
O02131_CAEEL/21-93--------------N..SCTFCNA...HV.I-----------------------NSITQ---------------------
A8XU86_CAEBR/1-68--------------N..NCELFEA...GN.L-----------------------ETIT.---------------------
O16208_CAEEL/30-102--------------E..PCNLFLW...NS.V-----------------------EKVKR---------------------
Q9NA50_CAEEL/26-95--------------A..GGEIYKI...GT.P-----------------------FSVQK---------------------
O44835_CAEEL/16-89--------------N..ICYLYAV...GD.V-----------------------IEVRH---------------------
O45492_CAEEL/23-95--------------G..YCNLFGF...SS.F-----------------------DEIRE---------------------
Q9N522_CAEEL/20-88--------------D..GCRRFSY...GN.I-----------------------.TIER---------------------
Q9U2Q4_CAEEL/29-101--------------D..PCYLFQY...DS.I-----------------------QEIKS---------------------
Q9N4B3_CAEEL/1-70--------------S..TCYNYAF...YY.V-----------------------DYVSR---------------------
Q9XTS6_CAEEL/1-68--------------...NCQMFEI...GQ.I-----------------------ST...---------------------
A4F307_CAEEL/1-67--------------S..GCEYYYI...GD.T-----------------------VSVDK---------------------

PF02430

A5K4Z2_PLAVS/55-520.SKGRGFNWANFDSVKKKCYIFNTKPTCLINDKNFIATTALSHPQEVDL.EFPCSIYKD.....................
Q4YZP5_PLABA/17-475.SHGRGYNWGNYDSQNKKCYIFETKPTCLINDRNFIATTALSSTEEFEE.QFPCDIYKN.....................
A7ASF6_BABBO/97-566.SRGVGMNWATYDKDSGMCALINETPNCLILNAGSIALTAIGSPLEYDAVNYPCHIDTN.....................
Q4UHH9_THEAN/247-742YTKGVGINWATYSVEEKKCNILDVVPSCLIISNGHYALTSLSSPNEEDAINYPCDIVQGKGFLKNPNGGKKNAQEPPKEP
Q7KQK5_PLAF7/110-580.SHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVEN.NFPCSLYKD.....................

PF00024

Q9VCR4_DROME/150-255------------------------------------------......YDEEYMEN.QC---------------------
Q9VCR4_DROME/265-347------------------------------------------L....RENSVYMRRVKC---------------------
KLKB1_MOUSE/292-375------------------------------------------....GMQGSSGYSLRLC---------------------
PLMN_MOUSE/24-98------------------------------------------.....MRDVILFEK.RV---------------------
KLKB1_MOUSE/21-104------------------------------------------.....TGAISGHSLKQC---------------------
Q20167_CAEEL/20-106------------------------------------------K...ASQTISFFQQ.IC---------------------
Q20167_CAEEL/304-382------------------------------------------.....ANFTDYFDK.IC---------------------
Q20167_CAEEL/205-297------------------------------------------.....LNSGEYFEK.YC---------------------
Q20167_CAEEL/113-200------------------------------------------TN.ILDTLVDYFEN.NC---------------------
Q22815_CAEEL/24-101------------------------------------------K....MTYLRVVSQ.SC---------------------
Q22815_CAEEL/470-555------------------------------------------YD..EFQKALYFEN.GC---------------------
Q22815_CAEEL/375-459------------------------------------------S...GDFTATTSTK.FC---------------------
Q9V9X0_DROME/209-287------------------------------------------.....YDGADYLEN.NC---------------------
Q9V9X0_DROME/295-376------------------------------------------YL..DVPEAATYELSAC---------------------
Q18298_CAEEL/226-303------------------------------------------.....STSLDILEP.FC---------------------
Q18298_CAEEL/312-390------------------------------------------S....DENYDFYER.SC---------------------
Q18298_CAEEL/142-219------------------------------------------.....DIKMDYYEN.NC---------------------
Q18298_CAEEL/50-135------------------------------------------E....EVPTFYFEK.VC---------------------
Q21782_CAEEL/228-319------------------------------------------K...PNQNVIYIEK.IC---------------------
Q21782_CAEEL/329-416------------------------------------------E...LAYKVDYVELGSC---------------------
O62201_CAEEL/632-720------------------------------------------R...PRNPVTSYEK.IC---------------------
O62201_CAEEL/729-814------------------------------------------E...TATIVDFFSIQDC---------------------
HGFL_HUMAN/18-106------------------------------------------.....SGRCDLFQKKDY---------------------
PLMN_PIG/20-99------------------------------------------.....MRDVVLFEKRIY---------------------
O45277_CAEEL/419-497------------------------------------------.....SFKAQFLAN.TC---------------------
O45277_CAEEL/80-160------------------------------------------S...KGLQIDLYEN.RC---------------------
O45277_CAEEL/320-398------------------------------------------....GSREFDYFEN.TC---------------------
PLMN_MACEU/17-99------------------------------------------.....KRDVVLFEKRIY---------------------
FA11_HUMAN/110-193------------------------------------------L....DKVVSGFSLKSC---------------------
KLKB1_HUMAN/111-194------------------------------------------L....SNVESGFSLKPC---------------------
Q9XUE5_CAEEL/21-112------------------------------------------N...PSANNFYYEK.TC---------------------
Q13208_HUMAN/5-81------------------------------------------.....SGRCDLFQKKDY---------------------
Q94248_CAEEL/576-659------------------------------------------.S..INQSRSYFEW.TC---------------------
Q9VAG2_DROME/113-197------------------------------------------S...QFPVFTIYAQKSC---------------------
Q9U966_EIMTE/637-707------------------------------------------.....GENLVSGPP.RC---------------------
O61834_CAEEL/108-192------------------------------------------K...ASYSVDLYEN.NC---------------------
Q9V9X1_DROME/320-401------------------------------------------......EEAATYEQSAC---------------------
Q9W5Z0_DROME/15-98------------------------------------------.....AQGTDYFEN.LC---------------------
Q9V9X1_DROME/145-223------------------------------------------S...QYPVFTVYAQKSC---------------------
KLKB1_RAT/111-194------------------------------------------V....DNLVSGFSLKSC---------------------
Q9U966_EIMTE/182-254------------------------------------------.....SGPRDGCSL.NV---------------------
Y2913_ARATH/341-418------------------------------------------E...NSEG.....NIFY---------------------
FA11_HUMAN/200-283------------------------------------------.....SKALSGFSLQSC---------------------
Q22902_CAEEL/114-194------------------------------------------D....DDKSLYLEN.SC---------------------
Q9XUE5_CAEEL/212-295------------------------------------------......VGKDYYEP.IC---------------------
Q9U966_EIMTE/263-337------------------------------------------G...DHTASRLCDA.SC---------------------
KLKB1_HUMAN/201-284------------------------------------------P...QENTISGYSLLTC---------------------
Q9VAG2_DROME/203-286------------------------------------------V....NDGSDYLEN.HC---------------------
PLMN_ERIEU/17-99------------------------------------------......RDVILFEKKMY---------------------
Q91691_XENLA/29-114------------------------------------------Q...RNVQYDLYQKKDY---------------------
SD31_ARATH/332-413------------------------------------------.....SLSSISYVK.TC---------------------
KLKB1_HUMAN/21-104------------------------------------------.....TGAVSGHSLKQC---------------------
Q9U966_EIMTE/421-490------------------------------------------A....NYNFISGPR.QC---------------------
B9PXJ3_TOXGV/141-214------------------------------------------RG..V.LGVTSGPKQFC---------------------
Q23328_CAEEL/311-391------------------------------------------D...SDRETVLIEN.GC---------------------
Q91402_9PIPI/27-111------------------------------------------K...YDISFDLYEKKDY---------------------
MIA1_SARMU/112-181------------------------------------------D........MTGPR.SC---------------------
Q94248_CAEEL/448-532------------------------------------------KQ.FTDVNVTYIGL.AC---------------------
KLKB1_RAT/201-284------------------------------------------.....ENAVSGYSLFTC---------------------
Q9XUE5_CAEEL/305-382------------------------------------------.....NPSMDYYEF.NC---------------------
O61834_CAEEL/21-103------------------------------------------.....SGSRTVGTK.TC---------------------
Q22902_CAEEL/21-95------------------------------------------V...KNPMSDFYHR.TC---------------------
FA11_HUMAN/20-103------------------------------------------.....TAAISGYSFKQC---------------------
B9PXJ3_TOXGV/68-137------------------------------------------.....LTGGKTASR.SC---------------------
MIA2_SARMU/9-78------------------------------------------G...D....MTGPR.SC---------------------
Q90865_CHICK/18-104------------------------------------------.....NIHYDLYQKKDF---------------------
PLMN_BOVIN/24-106------------------------------------------.....MRDVILYEKRIY---------------------
Q23328_CAEEL/212-303------------------------------------------.....NEKVIYAEK.FC---------------------
YMP9_CAEEL/49-134------------------------------------------P....FRKATYYEKIRC---------------------
O42830_PHYPR/61-165------------------------------------------TPTTSSPTCTTAPYGSC---------------------
Q9XUE5_CAEEL/122-204------------------------------------------....MSEKIDYYDN.NC---------------------
O17347_CAEEL/123-203------------------------------------------E...ENDKVIYFQN.GC---------------------
Q9U966_EIMTE/713-788------------------------------------------G...N.KRCILLED.IC---------------------
Q27394_CAEEL/123-209------------------------------------------LNNNPNYRIDYYEN.NC---------------------
Q94248_CAEEL/47-112------------------------------------------YQVEDGQGTDLVQI.AC---------------------
Q9U966_EIMTE/863-932------------------------------------------.....ENTVLSGPR.RC---------------------
Q23328_CAEEL/23-103------------------------------------------........IMGTDI.FY---------------------
O97506_PIG/29-112------------------------------------------.....ENAISGHSLKQC---------------------
Q94248_CAEEL/1063-1143------------------------------------------Y....DASTVYFDGINC---------------------
Q9Y1V3_POLMI/354-432------------------------------------------.....SKRWDHYEREGV---------------------
FA11_HUMAN/291-374------------------------------------------....GRGGISGYTLRLC---------------------
O61834_CAEEL/202-292------------------------------------------G...DLDDCVNFSL.KC---------------------
B9PXJ3_TOXGV/419-496------------------------------------------DM.TGSRTCDTSCLRRG---------------------
Q90978_CHICK/30-120------------------------------------------K...QDHAFDLFEKKDY---------------------
B9PXJ3_TOXGV/232-310------------------------------------------TG.PKSCDSSCFSN.GV---------------------
HGF_HUMAN/40-124------------------------------------------E...FGHEFDLYENKDY---------------------
Q94248_CAEEL/242-320------------------------------------------......QRKTLYQYVGC---------------------
Q9W5Z0_DROME/118-206------------------------------------------....ERPLIDHGEP.IG---------------------

PF14295

Q7QD96_ANOGA/35-86--------------------------------------------------------------------------------
B6JDB0_OLICO/42-92--------------------------------------------------------------------------------
B6JDB0_OLICO/125-176--------------------------------------------------------------------------------
Q21BD4_RHOPB/39-89--------------------------------------------------------------------------------
Q1QRJ6_NITHX/50-100--------------------------------------------------------------------------------
Q1QRJ6_NITHX/133-187--------------------------------------------------------------------------------
A4Z2E2_BRASO/27-77--------------------------------------------------------------------------------
C5BI67_TERTT/43-100--------------------------------------------------------------------------------
C5BI67_TERTT/122-170--------------------------------------------------------------------------------
A4S6G3_OSTLU/377-434--------------------------------------------------------------------------------
A4S6G3_OSTLU/486-538--------------------------------------------------------------------------------
A4S6G3_OSTLU/585-643--------------------------------------------------------------------------------
Q2FN86_METHJ/487-537--------------------------------------------------------------------------------
B2VUM0_PYRTR/713-759--------------------------------------------------------------------------------
C1E8G6_MICCC/523-580--------------------------------------------------------------------------------
C1E8G6_MICCC/640-698--------------------------------------------------------------------------------
C1MZS3_MICPC/544-601--------------------------------------------------------------------------------
C1MZS3_MICPC/661-719--------------------------------------------------------------------------------
D3P9U3_DEFDS/608-658--------------------------------------------------------------------------------
A4YQL0_BRASO/32-87--------------------------------------------------------------------------------
Q212S6_RHOPB/26-77--------------------------------------------------------------------------------
A9V0Z5_MONBE/42-102--------------------------------------------------------------------------------
A8IFR1_CHLRE/186-243--------------------------------------------------------------------------------
A8XZR6_CAEBR/34-85--------------------------------------------------------------------------------
Q0C462_HYPNA/58-105--------------------------------------------------------------------------------
A9VDX2_MONBE/32-89--------------------------------------------------------------------------------
Q0AR81_MARMM/29-79--------------------------------------------------------------------------------
A9UWV1_MONBE/136-181--------------------------------------------------------------------------------
C1E8N1_MICCC/219-266--------------------------------------------------------------------------------
Q7SFE8_NEUCR/154-203--------------------------------------------------------------------------------
C1FJX3_MICCC/235-285--------------------------------------------------------------------------------
A9UVN3_MONBE/45-98--------------------------------------------------------------------------------
C1MHF5_MICPC/168-214--------------------------------------------------------------------------------
Q0UP20_PHANO/126-176--------------------------------------------------------------------------------
A7UVW4_NEUCR/512-562--------------------------------------------------------------------------------
V5ILY1_NEUCR/1388-1435--------------------------------------------------------------------------------

PF07502

G3NSW1_GASAC/41-130------------------------------------------KYACRFFRKTGYIS------------------------
B7PSB0_IXOSC/57-154------------------------------------------RFVCLFTAHRFYT.------------------------
H2U8H9_TAKRU/6-100------------------------------------------QYVCRFVRKKGFIN------------------------
W5KZ36_ASTMX/28-122------------------------------------------KQVCRFVRKTGFKN------------------------
I3K2I2_ORENI/38-127------------------------------------------KYVCRVVGKKGYNS------------------------
G3PKT8_GASAC/29-121------------------------------------------RFVCRFVNHKGFLS------------------------
T1J182_STRMM/41-125------------------------------------------DFKCRFTAHEHYTS------------------------
V8N7R6_OPHHA/37-128------------------------------------------ALVCRFAKKDGFLN------------------------
H2ZBX2_CIOSA/69-166------------------------------------------KFNCLFSNHDGYNT------------------------
F6ZSJ7_XENTR/27-116------------------------------------------PESCPLKRSKGVTS------------------------
M4A584_XIPMA/31-117------------------------------------------RFVCQFVNQDGYKS------------------------
A7RY69_NEMVE/28-116------------------------------------------PSKCMYAPYSHYAT------------------------
H2MTN1_ORYLA/73-163------------------------------------------TNVCSFSPQRGFTT------------------------
H2MRG4_ORYLA/29-119------------------------------------------KYVCRFVKQQGFTS------------------------
F6YM27_ORNAN/27-116------------------------------------------EEACPMKPARGLVS------------------------
U3IZT3_ANAPL/23-112------------------------------------------TEACPMKPATGFVS------------------------
F6SZP7_MONDO/126-217------------------------------------------TFVCKFSRKEGFLN------------------------
M4ANK0_XIPMA/35-125------------------------------------------KNICSFAPQEGFTT------------------------
H9GRZ2_ANOCA/88-178------------------------------------------RHVCLFAPQPGYHS------------------------
H3C9I2_TETNG/27-117------------------------------------------QHVCSFAPQPGFSA------------------------
Q2KJJ7_BOVIN/42-133------------------------------------------NFVCKFAPREGFIN------------------------
J9JMW5_ACYPI/27-110------------------------------------------DFKCKFTNHKNYSS------------------------
G3NW92_GASAC/36-126------------------------------------------ASVCSFAPQQGFTT------------------------
W5NBX0_LEPOC/28-114------------------------------------------RDVCVLTAKDGFTA------------------------
G6D1B9_DANPL/170-253------------------------------------------DFRCKFTAHGNFSS------------------------
W4Z7Q6_STRPU/149-240------------------------------------------ENRCLFTYHLGYIS------------------------
B0WBN2_CULQU/54-138------------------------------------------NFYCKFTHHSNYTS------------------------
W5KPE8_ASTMX/26-115------------------------------------------KYVCRFVKTTGFSN------------------------
F6QXL1_CIOIN/65-162------------------------------------------EFSCLFSNHAGYTS------------------------
K7JW67_NASVI/40-124------------------------------------------DFKCKFTSHANYSS------------------------
G5BM03_HETGA/34-125------------------------------------------NFVCKFARRDGFSN------------------------
H3BGP2_LATCH/23-112------------------------------------------AEACPMKTLKGLKS------------------------
I3JDS1_ORENI/38-128------------------------------------------KNVCSFSAQKGFTT------------------------
H3BX24_TETNG/31-120------------------------------------------KYACRFVKKKGFSS------------------------
Q5VYB9_HUMAN/87-183------------------------------------------RNVCKFALHSGYSS------------------------
G1T9A5_RABIT/35-126------------------------------------------NFVCKFAPREGFIN------------------------
F1NZW5_CHICK/24-113------------------------------------------TEACPMKPAMGLVS------------------------
G3WZ70_SARHA/92-183------------------------------------------RNVCKFSLHRGYNS------------------------
H3BSM2_HUMAN/110-201------------------------------------------NFVCKFAPREGFIN------------------------
F7AX87_MOUSE/47-146------------------------------------------RSVCKFAPLRGYRT------------------------
W5N574_LEPOC/31-120------------------------------------------TYVCRFAKKQGFSN------------------------
H9G7H3_ANOCA/36-128------------------------------------------AFVCKFARKVGFLN------------------------
U3J961_ANAPL/36-127------------------------------------------SFVCRFVRKAGFLN------------------------
Q0VC64_BOVIN/27-116------------------------------------------EEACPLKPAKGLMS------------------------
H3CGS7_TETNG/5-97------------------------------------------RFVCRFANQDGFRS------------------------
U3JUF3_FICAL/107-198------------------------------------------NFVCRFARKIGFVN------------------------
H2SB93_TAKRU/7-99------------------------------------------RFVCRFVNLVGYRS------------------------
M3ZWM5_XIPMA/39-127------------------------------------------KYACRFVKKSGYFS------------------------
W5NIC2_LEPOC/29-117------------------------------------------DKFCPLKHSIGMDS------------------------
W5KI63_ASTMX/67-158------------------------------------------ASVCAYSPQRGFTA------------------------
F6RCL0_XENTR/2-92------------------------------------------EFVCKFIRKPGFVN------------------------
E7F1U6_DANRE/26-113------------------------------------------RFVCKFTPKQGFTN------------------------
W5NK71_LEPOC/80-170------------------------------------------RNICKFSLQEGYNS------------------------
I3KRH2_ORENI/28-116------------------------------------------RFACRFVTQSGYQS------------------------
C3Y0Q3_BRAFL/44-132------------------------------------------QGRCSFASHSGYLS------------------------
H0ZR45_TAEGU/15-104------------------------------------------TEACPMKPATGLVS------------------------
E9FR71_DAPPU/84-170------------------------------------------DFRCKFTSHSHYTS------------------------
E0VZG2_PEDHC/38-122------------------------------------------DFKCKFTQHKNYTS------------------------
H2RSF4_TAKRU/27-117------------------------------------------KHVCSFSPHPGFSA------------------------
G3TDS8_LOXAF/45-136------------------------------------------NFVCKFAPREGFIN------------------------
B4JE50_DROGR/43-127------------------------------------------NFHCKFTRHANYTS------------------------
MANS1_MOUSE/26-115------------------------------------------EDACPLKPAKGLVT------------------------

PF08276

Y4729_ARATH/342-409--------------------------------------------------------------------------------
Y1137_ARATH/337-407--------------------------------------------------------------------------------
RKS1_ARATH/338-406--------------------------------------------------------------------------------
Y4119_ARATH/368-431--------------------------------------------------------------------------------
Y1148_ARATH/333-399--------------------------------------------------------------------------------
Y1643_ARATH/332-398--------------------------------------------------------------------------------
Y1141_ARATH/341-409--------------------------------------------------------------------------------
Y1112_ARATH/338-408--------------------------------------------------------------------------------
Y1150_ARATH/334-400--------------------------------------------------------------------------------
Y4230_ARATH/339-410--------------------------------------------------------------------------------
SD11_ARATH/345-413--------------------------------------------------------------------------------
Q7XXJ5_ORYSJ/359-424--------------------------------------------------------------------------------
Q7XQT8_ORYSJ/353-423--------------------------------------------------------------------------------
Q943Q1_ORYSJ/357-425--------------------------------------------------------------------------------
Q7XMR2_ORYSJ/371-438--------------------------------------------------------------------------------
Q7XQX5_ORYSJ/351-414--------------------------------------------------------------------------------
Q7XQT7_ORYSJ/350-421--------------------------------------------------------------------------------
Q60D68_ORYSJ/362-427--------------------------------------------------------------------------------
Q7EZ32_ORYSJ/358-422--------------------------------------------------------------------------------
Y1661_ARATH/350-416--------------------------------------------------------------------------------
Q7XI25_ORYSJ/379-447--------------------------------------------------------------------------------
SD17_ARATH/341-407--------------------------------------------------------------------------------
Q60EJ2_ORYSJ/344-413--------------------------------------------------------------------------------
B120_ARATH/346-412--------------------------------------------------------------------------------
Q7Y1P1_ORYSJ/344-411--------------------------------------------------------------------------------
Q8LQN6_ORYSJ/344-412--------------------------------------------------------------------------------
Q851M7_ORYSJ/328-394--------------------------------------------------------------------------------
Q8H821_ORYSJ/354-415--------------------------------------------------------------------------------
D7KZN2_ARALL/365-430--------------------------------------------------------------------------------
D7MEU3_ARALL/350-416--------------------------------------------------------------------------------
D7MEU5_ARALL/350-415--------------------------------------------------------------------------------
I1QYI6_ORYGL/369-433--------------------------------------------------------------------------------
M4C7T3_BRARP/338-404--------------------------------------------------------------------------------
M4CIU6_BRARP/181-247--------------------------------------------------------------------------------
M4CIZ5_BRARP/356-420--------------------------------------------------------------------------------
M4FHL1_BRARP/345-410--------------------------------------------------------------------------------
PSRK_ARATH/348-413--------------------------------------------------------------------------------
W5BTS4_WHEAT/325-394--------------------------------------------------------------------------------

PF08277

O16726_CAEEL/19-83------------------------------------------.....KSSKSVV.AFKT---------------------
Q18574_CAEEL/20-92------------------------------------------...RFRGNMII..ALKT---------------------
O62154_CAEEL/24-92------------------------------------------...TDRSEGSYV.AFKT---------------------
O17672_CAEEL/26-95------------------------------------------...LDANSGKQV.AVKI---------------------
Q9U2V0_CAEEL/23-94------------------------------------------...IKTNEGDMG.QYLI---------------------
O01337_CAEEL/48-117------------------------------------------...LNSHYGKMV.AVKT---------------------
O62150_CAEEL/25-95------------------------------------------...VVEVHKSQW.AYVA---------------------
O01701_CAEEL/22-92------------------------------------------...VEKSSKDER.NIVY---------------------
O01336_CAEEL/22-95------------------------------------------...LNAYSEKMV.AVKG---------------------
Q9XVD0_CAEEL/1-71------------------------------------------...LDPEENLKV.AMKI---------------------
O44831_CAEEL/18-94------------------------------------------DQDIFSSGNESV.SFKI---------------------
Q9N4A0_CAEEL/25-95------------------------------------------...IKVDLSSK..EFKV---------------------
O02127_CAEEL/50-122------------------------------------------...SNSITNIKT.AIKV---------------------
Q9NA49_CAEEL/29-98------------------------------------------...KTKESGEKV.AFKK---------------------
Q9GRV4_CAEEL/22-94------------------------------------------...TDSGGSNKV.AIKM---------------------
A8XBL6_CAEBR/41-108------------------------------------------...SNAYSGIKI.GFKR---------------------
Q9U2Q4_CAEEL/178-252------------------------------------------...VHPSENKVM.AIKI---------------------
O44833_CAEEL/23-99------------------------------------------DQEGYANDKEEKVAFKV---------------------
A8WJ07_CAEBR/13-84------------------------------------------...RTASDGIQI.GVKD---------------------
A8Y004_CAEBR/24-93------------------------------------------...ADFQNDE.I.AVKI---------------------
O02128_CAEEL/1-73------------------------------------------...SNYTSNIQT.AIKI---------------------
O62406_CAEEL/24-92------------------------------------------...ITVEENSNN.AYVA---------------------
O16210_CAEEL/23-99------------------------------------------ITKTGEEDGTVV.GIKA---------------------
Q9NEP2_CAEEL/1-72------------------------------------------...LEASSGKVM.GVKV---------------------
Q9XV53_CAEEL/24-96------------------------------------------...NESGGVGQV.AFRV---------------------
Q7YTL3_CAEEL/26-97------------------------------------------...TSREGKTKV.AFKL---------------------
A8Y003_CAEBR/24-93------------------------------------------...AKSENDEIV..LKI---------------------
O02131_CAEEL/21-93------------------------------------------...SDSSSGSKI.GIKV---------------------
A8XU86_CAEBR/1-68------------------------------------------.....KNLEKRV.AFKI---------------------
O16208_CAEEL/30-102------------------------------------------...NDSGGEGLT.AFRV---------------------
Q9NA50_CAEEL/26-95------------------------------------------...IIGAGGNIV.GIKR---------------------
O44835_CAEEL/16-89------------------------------------------...DQNGYSELR.DTVS---------------------
O45492_CAEEL/23-95------------------------------------------...IESDEGDVG.QYLA---------------------
Q9N522_CAEEL/20-88------------------------------------------...FEQSSESIV.AFKR---------------------
Q9U2Q4_CAEEL/29-101------------------------------------------...NASGGEGQV.AFKV---------------------
Q9N4B3_CAEEL/1-70------------------------------------------...TTSANESVV.AFKV---------------------
Q9XTS6_CAEEL/1-68------------------------------------------...ATSTSETKI.AFKF---------------------
A4F307_CAEEL/1-67------------------------------------------...VEKNSQKRV.ALK.---------------------

PF02430

A5K4Z2_PLAVS/55-520...EIEREIKKQSRNMNLYSVDGE...RIVLP.RIFISNDKESIKCPCEPERISNSTCN.FYVCNCVEKRAEIKENNQVV
Q4YZP5_PLABA/17-475...KINEEIKVLNKNIS......NGNNSIEFP.RIFISTDKNSLNCPCEPTQLTESSCN.FYVCNCVEKRQYIAENNDVE
A7ASF6_BABBO/97-566.........GYVEPRAK......TTNKYLDVPFEVTTALSTKTLKCNAYVHTKYSDSCGTYFLCSDVKPNWFIRFLHMIG
Q4UHH9_THEAN/247-742EPEEPKKEGAENKPKEKGKSEKKNEKSMPSGPFTPYTSLKKEGFECSKYTVERVNKSCGVYYECSETP..........VL
Q7KQK5_PLAF7/110-580...EIMKEIERESKRIKLNDNDDEGNKKIIAP.RIFISDDKDSLKCPCDPEMVSNSTCR.FFVCKCVERRAEVTSNNEVV

PF00024

Q9VCR4_DROME/150-255--------------------------------------------------------------------------
Q9VCR4_DROME/265-347--------------------------------------------------------------------------
KLKB1_MOUSE/292-375--------------------------------------------------------------------------
PLMN_MOUSE/24-98--------------------------------------------------------------------------
KLKB1_MOUSE/21-104--------------------------------------------------------------------------
Q20167_CAEEL/20-106--------------------------------------------------------------------------
Q20167_CAEEL/304-382--------------------------------------------------------------------------
Q20167_CAEEL/205-297--------------------------------------------------------------------------
Q20167_CAEEL/113-200--------------------------------------------------------------------------
Q22815_CAEEL/24-101--------------------------------------------------------------------------
Q22815_CAEEL/470-555--------------------------------------------------------------------------
Q22815_CAEEL/375-459--------------------------------------------------------------------------
Q9V9X0_DROME/209-287--------------------------------------------------------------------------
Q9V9X0_DROME/295-376--------------------------------------------------------------------------
Q18298_CAEEL/226-303--------------------------------------------------------------------------
Q18298_CAEEL/312-390--------------------------------------------------------------------------
Q18298_CAEEL/142-219--------------------------------------------------------------------------
Q18298_CAEEL/50-135--------------------------------------------------------------------------
Q21782_CAEEL/228-319--------------------------------------------------------------------------
Q21782_CAEEL/329-416--------------------------------------------------------------------------
O62201_CAEEL/632-720--------------------------------------------------------------------------
O62201_CAEEL/729-814--------------------------------------------------------------------------
HGFL_HUMAN/18-106--------------------------------------------------------------------------
PLMN_PIG/20-99--------------------------------------------------------------------------
O45277_CAEEL/419-497--------------------------------------------------------------------------
O45277_CAEEL/80-160--------------------------------------------------------------------------
O45277_CAEEL/320-398--------------------------------------------------------------------------
PLMN_MACEU/17-99--------------------------------------------------------------------------
FA11_HUMAN/110-193--------------------------------------------------------------------------
KLKB1_HUMAN/111-194--------------------------------------------------------------------------
Q9XUE5_CAEEL/21-112--------------------------------------------------------------------------
Q13208_HUMAN/5-81--------------------------------------------------------------------------
Q94248_CAEEL/576-659--------------------------------------------------------------------------
Q9VAG2_DROME/113-197--------------------------------------------------------------------------
Q9U966_EIMTE/637-707--------------------------------------------------------------------------
O61834_CAEEL/108-192--------------------------------------------------------------------------
Q9V9X1_DROME/320-401--------------------------------------------------------------------------
Q9W5Z0_DROME/15-98--------------------------------------------------------------------------
Q9V9X1_DROME/145-223--------------------------------------------------------------------------
KLKB1_RAT/111-194--------------------------------------------------------------------------
Q9U966_EIMTE/182-254--------------------------------------------------------------------------
Y2913_ARATH/341-418--------------------------------------------------------------------------
FA11_HUMAN/200-283--------------------------------------------------------------------------
Q22902_CAEEL/114-194--------------------------------------------------------------------------
Q9XUE5_CAEEL/212-295--------------------------------------------------------------------------
Q9U966_EIMTE/263-337--------------------------------------------------------------------------
KLKB1_HUMAN/201-284--------------------------------------------------------------------------
Q9VAG2_DROME/203-286--------------------------------------------------------------------------
PLMN_ERIEU/17-99--------------------------------------------------------------------------
Q91691_XENLA/29-114--------------------------------------------------------------------------
SD31_ARATH/332-413--------------------------------------------------------------------------
KLKB1_HUMAN/21-104--------------------------------------------------------------------------
Q9U966_EIMTE/421-490--------------------------------------------------------------------------
B9PXJ3_TOXGV/141-214--------------------------------------------------------------------------
Q23328_CAEEL/311-391--------------------------------------------------------------------------
Q91402_9PIPI/27-111--------------------------------------------------------------------------
MIA1_SARMU/112-181--------------------------------------------------------------------------
Q94248_CAEEL/448-532--------------------------------------------------------------------------
KLKB1_RAT/201-284--------------------------------------------------------------------------
Q9XUE5_CAEEL/305-382--------------------------------------------------------------------------
O61834_CAEEL/21-103--------------------------------------------------------------------------
Q22902_CAEEL/21-95--------------------------------------------------------------------------
FA11_HUMAN/20-103--------------------------------------------------------------------------
B9PXJ3_TOXGV/68-137--------------------------------------------------------------------------
MIA2_SARMU/9-78--------------------------------------------------------------------------
Q90865_CHICK/18-104--------------------------------------------------------------------------
PLMN_BOVIN/24-106--------------------------------------------------------------------------
Q23328_CAEEL/212-303--------------------------------------------------------------------------
YMP9_CAEEL/49-134--------------------------------------------------------------------------
O42830_PHYPR/61-165--------------------------------------------------------------------------
Q9XUE5_CAEEL/122-204--------------------------------------------------------------------------
O17347_CAEEL/123-203--------------------------------------------------------------------------
Q9U966_EIMTE/713-788--------------------------------------------------------------------------
Q27394_CAEEL/123-209--------------------------------------------------------------------------
Q94248_CAEEL/47-112--------------------------------------------------------------------------
Q9U966_EIMTE/863-932--------------------------------------------------------------------------
Q23328_CAEEL/23-103--------------------------------------------------------------------------
O97506_PIG/29-112--------------------------------------------------------------------------
Q94248_CAEEL/1063-1143--------------------------------------------------------------------------
Q9Y1V3_POLMI/354-432--------------------------------------------------------------------------
FA11_HUMAN/291-374--------------------------------------------------------------------------
O61834_CAEEL/202-292--------------------------------------------------------------------------
B9PXJ3_TOXGV/419-496--------------------------------------------------------------------------
Q90978_CHICK/30-120--------------------------------------------------------------------------
B9PXJ3_TOXGV/232-310--------------------------------------------------------------------------
HGF_HUMAN/40-124--------------------------------------------------------------------------
Q94248_CAEEL/242-320--------------------------------------------------------------------------
Q9W5Z0_DROME/118-206--------------------------------------------------------------------------

PF14295

Q7QD96_ANOGA/35-86--------------------------------------------------------------------------
B6JDB0_OLICO/42-92--------------------------------------------------------------------------
B6JDB0_OLICO/125-176--------------------------------------------------------------------------
Q21BD4_RHOPB/39-89--------------------------------------------------------------------------
Q1QRJ6_NITHX/50-100--------------------------------------------------------------------------
Q1QRJ6_NITHX/133-187--------------------------------------------------------------------------
A4Z2E2_BRASO/27-77--------------------------------------------------------------------------
C5BI67_TERTT/43-100--------------------------------------------------------------------------
C5BI67_TERTT/122-170--------------------------------------------------------------------------
A4S6G3_OSTLU/377-434--------------------------------------------------------------------------
A4S6G3_OSTLU/486-538--------------------------------------------------------------------------
A4S6G3_OSTLU/585-643--------------------------------------------------------------------------
Q2FN86_METHJ/487-537--------------------------------------------------------------------------
B2VUM0_PYRTR/713-759--------------------------------------------------------------------------
C1E8G6_MICCC/523-580--------------------------------------------------------------------------
C1E8G6_MICCC/640-698--------------------------------------------------------------------------
C1MZS3_MICPC/544-601--------------------------------------------------------------------------
C1MZS3_MICPC/661-719--------------------------------------------------------------------------
D3P9U3_DEFDS/608-658--------------------------------------------------------------------------
A4YQL0_BRASO/32-87--------------------------------------------------------------------------
Q212S6_RHOPB/26-77--------------------------------------------------------------------------
A9V0Z5_MONBE/42-102--------------------------------------------------------------------------
A8IFR1_CHLRE/186-243--------------------------------------------------------------------------
A8XZR6_CAEBR/34-85--------------------------------------------------------------------------
Q0C462_HYPNA/58-105--------------------------------------------------------------------------
A9VDX2_MONBE/32-89--------------------------------------------------------------------------
Q0AR81_MARMM/29-79--------------------------------------------------------------------------
A9UWV1_MONBE/136-181--------------------------------------------------------------------------
C1E8N1_MICCC/219-266--------------------------------------------------------------------------
Q7SFE8_NEUCR/154-203--------------------------------------------------------------------------
C1FJX3_MICCC/235-285--------------------------------------------------------------------------
A9UVN3_MONBE/45-98--------------------------------------------------------------------------
C1MHF5_MICPC/168-214--------------------------------------------------------------------------
Q0UP20_PHANO/126-176--------------------------------------------------------------------------
A7UVW4_NEUCR/512-562--------------------------------------------------------------------------
V5ILY1_NEUCR/1388-1435--------------------------------------------------------------------------

PF07502

G3NSW1_GASAC/41-130--------------------------------------------------------------------------
B7PSB0_IXOSC/57-154--------------------------------------------------------------------------
H2U8H9_TAKRU/6-100--------------------------------------------------------------------------
W5KZ36_ASTMX/28-122--------------------------------------------------------------------------
I3K2I2_ORENI/38-127--------------------------------------------------------------------------
G3PKT8_GASAC/29-121--------------------------------------------------------------------------
T1J182_STRMM/41-125--------------------------------------------------------------------------
V8N7R6_OPHHA/37-128--------------------------------------------------------------------------
H2ZBX2_CIOSA/69-166--------------------------------------------------------------------------
F6ZSJ7_XENTR/27-116--------------------------------------------------------------------------
M4A584_XIPMA/31-117--------------------------------------------------------------------------
A7RY69_NEMVE/28-116--------------------------------------------------------------------------
H2MTN1_ORYLA/73-163--------------------------------------------------------------------------
H2MRG4_ORYLA/29-119--------------------------------------------------------------------------
F6YM27_ORNAN/27-116--------------------------------------------------------------------------
U3IZT3_ANAPL/23-112--------------------------------------------------------------------------
F6SZP7_MONDO/126-217--------------------------------------------------------------------------
M4ANK0_XIPMA/35-125--------------------------------------------------------------------------
H9GRZ2_ANOCA/88-178--------------------------------------------------------------------------
H3C9I2_TETNG/27-117--------------------------------------------------------------------------
Q2KJJ7_BOVIN/42-133--------------------------------------------------------------------------
J9JMW5_ACYPI/27-110--------------------------------------------------------------------------
G3NW92_GASAC/36-126--------------------------------------------------------------------------
W5NBX0_LEPOC/28-114--------------------------------------------------------------------------
G6D1B9_DANPL/170-253--------------------------------------------------------------------------
W4Z7Q6_STRPU/149-240--------------------------------------------------------------------------
B0WBN2_CULQU/54-138--------------------------------------------------------------------------
W5KPE8_ASTMX/26-115--------------------------------------------------------------------------
F6QXL1_CIOIN/65-162--------------------------------------------------------------------------
K7JW67_NASVI/40-124--------------------------------------------------------------------------
G5BM03_HETGA/34-125--------------------------------------------------------------------------
H3BGP2_LATCH/23-112--------------------------------------------------------------------------
I3JDS1_ORENI/38-128--------------------------------------------------------------------------
H3BX24_TETNG/31-120--------------------------------------------------------------------------
Q5VYB9_HUMAN/87-183--------------------------------------------------------------------------
G1T9A5_RABIT/35-126--------------------------------------------------------------------------
F1NZW5_CHICK/24-113--------------------------------------------------------------------------
G3WZ70_SARHA/92-183--------------------------------------------------------------------------
H3BSM2_HUMAN/110-201--------------------------------------------------------------------------
F7AX87_MOUSE/47-146--------------------------------------------------------------------------
W5N574_LEPOC/31-120--------------------------------------------------------------------------
H9G7H3_ANOCA/36-128--------------------------------------------------------------------------
U3J961_ANAPL/36-127--------------------------------------------------------------------------
Q0VC64_BOVIN/27-116--------------------------------------------------------------------------
H3CGS7_TETNG/5-97--------------------------------------------------------------------------
U3JUF3_FICAL/107-198--------------------------------------------------------------------------
H2SB93_TAKRU/7-99--------------------------------------------------------------------------
M3ZWM5_XIPMA/39-127--------------------------------------------------------------------------
W5NIC2_LEPOC/29-117--------------------------------------------------------------------------
W5KI63_ASTMX/67-158--------------------------------------------------------------------------
F6RCL0_XENTR/2-92--------------------------------------------------------------------------
E7F1U6_DANRE/26-113--------------------------------------------------------------------------
W5NK71_LEPOC/80-170--------------------------------------------------------------------------
I3KRH2_ORENI/28-116--------------------------------------------------------------------------
C3Y0Q3_BRAFL/44-132--------------------------------------------------------------------------
H0ZR45_TAEGU/15-104--------------------------------------------------------------------------
E9FR71_DAPPU/84-170--------------------------------------------------------------------------
E0VZG2_PEDHC/38-122--------------------------------------------------------------------------
H2RSF4_TAKRU/27-117--------------------------------------------------------------------------
G3TDS8_LOXAF/45-136--------------------------------------------------------------------------
B4JE50_DROGR/43-127--------------------------------------------------------------------------
MANS1_MOUSE/26-115--------------------------------------------------------------------------

PF08276

Y4729_ARATH/342-409--------------------------------------------------------------------------
Y1137_ARATH/337-407--------------------------------------------------------------------------
RKS1_ARATH/338-406--------------------------------------------------------------------------
Y4119_ARATH/368-431--------------------------------------------------------------------------
Y1148_ARATH/333-399--------------------------------------------------------------------------
Y1643_ARATH/332-398--------------------------------------------------------------------------
Y1141_ARATH/341-409--------------------------------------------------------------------------
Y1112_ARATH/338-408--------------------------------------------------------------------------
Y1150_ARATH/334-400--------------------------------------------------------------------------
Y4230_ARATH/339-410--------------------------------------------------------------------------
SD11_ARATH/345-413--------------------------------------------------------------------------
Q7XXJ5_ORYSJ/359-424--------------------------------------------------------------------------
Q7XQT8_ORYSJ/353-423--------------------------------------------------------------------------
Q943Q1_ORYSJ/357-425--------------------------------------------------------------------------
Q7XMR2_ORYSJ/371-438--------------------------------------------------------------------------
Q7XQX5_ORYSJ/351-414--------------------------------------------------------------------------
Q7XQT7_ORYSJ/350-421--------------------------------------------------------------------------
Q60D68_ORYSJ/362-427--------------------------------------------------------------------------
Q7EZ32_ORYSJ/358-422--------------------------------------------------------------------------
Y1661_ARATH/350-416--------------------------------------------------------------------------
Q7XI25_ORYSJ/379-447--------------------------------------------------------------------------
SD17_ARATH/341-407--------------------------------------------------------------------------
Q60EJ2_ORYSJ/344-413--------------------------------------------------------------------------
B120_ARATH/346-412--------------------------------------------------------------------------
Q7Y1P1_ORYSJ/344-411--------------------------------------------------------------------------
Q8LQN6_ORYSJ/344-412--------------------------------------------------------------------------
Q851M7_ORYSJ/328-394--------------------------------------------------------------------------
Q8H821_ORYSJ/354-415--------------------------------------------------------------------------
D7KZN2_ARALL/365-430--------------------------------------------------------------------------
D7MEU3_ARALL/350-416--------------------------------------------------------------------------
D7MEU5_ARALL/350-415--------------------------------------------------------------------------
I1QYI6_ORYGL/369-433--------------------------------------------------------------------------
M4C7T3_BRARP/338-404--------------------------------------------------------------------------
M4CIU6_BRARP/181-247--------------------------------------------------------------------------
M4CIZ5_BRARP/356-420--------------------------------------------------------------------------
M4FHL1_BRARP/345-410--------------------------------------------------------------------------
PSRK_ARATH/348-413--------------------------------------------------------------------------
W5BTS4_WHEAT/325-394--------------------------------------------------------------------------

PF08277

O16726_CAEEL/19-83--------------------------------------------------------------------------
Q18574_CAEEL/20-92--------------------------------------------------------------------------
O62154_CAEEL/24-92--------------------------------------------------------------------------
O17672_CAEEL/26-95--------------------------------------------------------------------------
Q9U2V0_CAEEL/23-94--------------------------------------------------------------------------
O01337_CAEEL/48-117--------------------------------------------------------------------------
O62150_CAEEL/25-95--------------------------------------------------------------------------
O01701_CAEEL/22-92--------------------------------------------------------------------------
O01336_CAEEL/22-95--------------------------------------------------------------------------
Q9XVD0_CAEEL/1-71--------------------------------------------------------------------------
O44831_CAEEL/18-94--------------------------------------------------------------------------
Q9N4A0_CAEEL/25-95--------------------------------------------------------------------------
O02127_CAEEL/50-122--------------------------------------------------------------------------
Q9NA49_CAEEL/29-98--------------------------------------------------------------------------
Q9GRV4_CAEEL/22-94--------------------------------------------------------------------------
A8XBL6_CAEBR/41-108--------------------------------------------------------------------------
Q9U2Q4_CAEEL/178-252--------------------------------------------------------------------------
O44833_CAEEL/23-99--------------------------------------------------------------------------
A8WJ07_CAEBR/13-84--------------------------------------------------------------------------
A8Y004_CAEBR/24-93--------------------------------------------------------------------------
O02128_CAEEL/1-73--------------------------------------------------------------------------
O62406_CAEEL/24-92--------------------------------------------------------------------------
O16210_CAEEL/23-99--------------------------------------------------------------------------
Q9NEP2_CAEEL/1-72--------------------------------------------------------------------------
Q9XV53_CAEEL/24-96--------------------------------------------------------------------------
Q7YTL3_CAEEL/26-97--------------------------------------------------------------------------
A8Y003_CAEBR/24-93--------------------------------------------------------------------------
O02131_CAEEL/21-93--------------------------------------------------------------------------
A8XU86_CAEBR/1-68--------------------------------------------------------------------------
O16208_CAEEL/30-102--------------------------------------------------------------------------
Q9NA50_CAEEL/26-95--------------------------------------------------------------------------
O44835_CAEEL/16-89--------------------------------------------------------------------------
O45492_CAEEL/23-95--------------------------------------------------------------------------
Q9N522_CAEEL/20-88--------------------------------------------------------------------------
Q9U2Q4_CAEEL/29-101--------------------------------------------------------------------------
Q9N4B3_CAEEL/1-70--------------------------------------------------------------------------
Q9XTS6_CAEEL/1-68--------------------------------------------------------------------------
A4F307_CAEEL/1-67--------------------------------------------------------------------------

PF02430

A5K4Z2_PLAVS/55-520IKEEFRDYYEN.GEEKSNKQMLLIIIGITGGVCVVALASMAYFRK........KANNDK..........YDKMD
Q4YZP5_PLABA/17-475IKEEFRSEYES....PSNQRVIVIIIFICVGI.ILVILLVGYFFKS.......NKKGEN..........YDRM.
A7ASF6_BABBO/97-566LYNTKR.................IVIFVCCTTTAIVLTI..WIWKRFIKA...KKEPAPPSFDKYLSN.YD.YD
Q4UHH9_THEAN/247-742FTKKNR.................IYLYIILAVSLVVLAVLAYFGYRYYSKNHLKKHNSQIYEDDNVNNYYN.ED
Q7KQK5_PLAF7/110-580VKEEYKDEYADIPEHKPTYDKMKIIIASSAAVAVLATILMVYLYKR.......KGNAEK..........YDKMD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window