Sequence alignment for CL0169

PF05840

VGA_BPG4/115-441PDELQLSDEIVEDYRLTVLSIIE................ELQECYDVLGQL.DINNTIDHK.P.................
A0A011RTX4_VIBPH/74-400VDGHKAASDVRDEFVSVTEKLMD................ELAQCYNVLPQL.DINNTIDHR.P.................
VGA_BPPHK/49-381SEETHLDDETYALYESQTGLLED................HMALVRKCAAQL.DNSNTIDHRTP.................
A9ZT18_9CAUD/122-510DELRDMAFRIAKIMEAYLQLTAS....RKHADREEDVDQAVVDAYEALAHFCTQTFGIKA..PRK...........YQKQ
VPA_BP186/139-507ADIDLLAADIANFIRAELADIDD.........TGFSELKTLYTWYMRAGFI.SLQFNVTP..PKW.......ERVTKKYF
VPA_BPP2/133-515KELKKFAARISSQLFMMYEELSDAWVDAHGEKESLFTDEAQAHLYGHVAGA.ARAFNIS...PLY......WKKYRKGQM
ENDP2_SALTI/193-568DQVKRLSTLVAAHMSMCLDAAC.....GDLFVSDDVKPEEIRQAWERVAAE.AMRLEVIP..PAF..EQLRRKKRRRKPV
Q8XBG0_ECO57/179-564HQIQTLATMTAAMFSSTFEKLCD....GFGATDGELTMDVTLKAYQMLARM.ALHLHAMP..PHY..DALTTDKDRRNEP
P12_BPPM2/101-478LQRDKRRKDKAKQLALICQQMGI..VDFDKSMTLEQATALVISKYQKLAEF.TINQIDTA..PAYSTYEAFMKKGGNPEI
REP_BPHC1/204-578SKLKKMAYEMATAFIRFQCDCSHFLKNGIEKDNEGDIQGYFYQLYKWCGEI.AFSAGFKI..PHW......EKIENDKRI
O80256_9VIRU/150-506DECVELAKAKAKAFSKTLSKFDE.............IEEPFTKACELLASL.GLSFR.....PEL..........IKQKR

PF01076

65KD_ZYMMA/1-192MPNYAIFRFEKHKTVGTIKAASL---------------------------------------------------------
O87277_9STAP/1-193MS.YAVCRMQKVK.SAGLKGMQF---------------------------------------------------------
P71098_BACTI/20-220HNNREMNEKEKER.NSHIDQSRS---------------------------------------------------------
L2IEI5_ENTFC/1-193MS.FAVARMQKVK.SGNLVGVGN---------------------------------------------------------
Q45448_BACIU/1-193MANYAVIRMEKYK.KDRLNGTQK---------------------------------------------------------
PRE_STRAG/1-194MS.YMVARMQKMK.AGNLGGAFK---------------------------------------------------------
PRE1_STAAU/1-198MS.HSILRVARVKGSSNTNGIQR---------------------------------------------------------
C3DBP7_BACTU/1-192MNKFAIIHMQKFQ.ISDVQGIQK---------------------------------------------------------
Q52058_9ZZZZ/3-190SNNFCILRFQKIKSAIAVRRRLK---------------------------------------------------------
Q09026_OENOE/1-199.MYKLVLHVKHFK.KGNLSKLEN---------------------------------------------------------
Q53618_STAAU/1-198MA.YSIIRVAKVKSKTNTKGIQK---------------------------------------------------------
Q48524_LACCA/1-194MS.YLVANMQKLK.ADNLVGLGN---------------------------------------------------------
B6FKS6_9CLOT/6-219KADMSCARVKKYT.ASDVSKAER---------------------------------------------------------
Q52050_BUTFI/1-198MG.YGIMRCEKRK.IQACGGIQA---------------------------------------------------------
PREA_LACPN/1-194MS.FAVARMTKLK.ADNLVGIGN---------------------------------------------------------
P71520_MARHA/20-221HNNREFTERGKER.NDHIDFSKS---------------------------------------------------------
Q53620_STAAU/1-198MS.YSIVRVSKVKSGTNTTGIQK---------------------------------------------------------

PF03432

Q9WW30_PEDPE/8-248---------RSDSASRLVNYAEK---------------------------------------------------------
D2JCN4_STAEP/8-236---------STKSTSRAINYAEK---------------------------------------------------------
Q56424_BACFG/7-242---------KGTSFSGCVCYVLR---------------------------------------------------------
VIRD2_RHIRD/16-264---------GTKTLQQIINQLEY---------------------------------------------------------
A0A015PKP4_BACFG/7-242---------SISHGVAALEYDLA---------------------------------------------------------
Q9ZIP2_FUSNU/13-276---------TKSSLYNILKYVGS---------------------------------------------------------
A6H977_9ZZZZ/12-252---------KKSDFAELVKYITD---------------------------------------------------------
A0A031PR62_ECOLX/61-315---------RNESFVALVDVMKD---------------------------------------------------------
Q9Z361_STAEP/8-242---------ATKSTSRAINYAEK---------------------------------------------------------
LTRB_LACLM/34-307---------NEDHLTNLFPYISN---------------------------------------------------------
Q9XAW2_PSEAC/12-285---------GKTSFKSLAKYACE---------------------------------------------------------
B3H352_ACTP7/14-247---------.ASSCKACVDYLLN---------------------------------------------------------
TRAI5_ECOLX/12-252---------GKSDFAGLANYITD---------------------------------------------------------
Q54883_STREE/11-264---------GKNYRSKLIKYILN---------------------------------------------------------
RLX1_STAAU/8-238---------NTKSASRAINYAEE---------------------------------------------------------
A9CQY2_STAAU/8-239---------NTKSASRAINYAEK---------------------------------------------------------
K7VR95_LACLC/9-280---------NGASAASALNYALG---------------------------------------------------------

PF02217

LT_POVBO/129-222--------------------------------------------------------------------------------
LT_POVMK/151-247--------------------------------------------------------------------------------
Q80FI2_9POLY/134-228--------------------------------------------------------------------------------
Q9DPC0_POVJC/137-230--------------------------------------------------------------------------------
LT_POVLY/200-298--------------------------------------------------------------------------------
Q20HY2_9POLY/139-233--------------------------------------------------------------------------------
Q9J7C9_SV40/136-229--------------------------------------------------------------------------------
Q20HX6_9POLY/120-214--------------------------------------------------------------------------------
LT_POVHA/261-354--------------------------------------------------------------------------------
B9A7H1_BFPYV/111-204--------------------------------------------------------------------------------
LT_POVMC/285-377--------------------------------------------------------------------------------

PF08724

A7LIB2_9VIRU/14-197------------FYEVIIRLPSD---------------------------------------------------------
Q9WKM1_PAVHB/3-177------------LFRGVLQ....---------------------------------------------------------
Q8JQG1_9VIRU/4-192------------FYEIVIKVPSD---------------------------------------------------------
Q7TG44_9VIRU/4-191------------YYEVIVQLPND---------------------------------------------------------
Q9J0X5_9VIRU/3-177------------MFRGVVH....---------------------------------------------------------
Q9J0X7_9VIRU/3-177------------MFRGVIQ....---------------------------------------------------------
Q6JL80_9VIRU/4-189------------FYEVIVRVPFD---------------------------------------------------------
VU94_HHV6Z/17-203------------YIMLTIKGPVE---------------------------------------------------------
Q88271_9VIRU/3-177------------MYRGVIQ....---------------------------------------------------------

PF07232

Y35K_HALSI/1-316MAKRD....GMKLRDELTFDTSR---------------------------------------------------------
Y36K_HALSN/1-328MASQPEEGFGERLRKEVTVDTSR---------------------------------------------------------

PF01446

G8PF48_PEDCP/80-316---------MKNSSQLKQIIAEA---------------------------------------------------------

PF00799

REP_TPCTV/8-120--------------------------------------------------------------------------------
REPA_MSVS/10-117--------------------------------------------------------------------------------
REP_BGYMJ/7-119--------------------------------------------------------------------------------
REP_BCTVC/7-119--------------------------------------------------------------------------------
U9TRZ4_RHIID/23-135--------------------------------------------------------------------------------
REPE_ONYPE/14-143--------------------------------------------------------------------------------

PF02407

MREP_SCSVF/5-83--------------------------------------------------------------------------------
REP6_SCSVF/6-86--------------------------------------------------------------------------------
REP2_SCSVF/2-88--------------------------------------------------------------------------------
MREP_BBTVA/6-83--------------------------------------------------------------------------------

PF03389

C4YZP3_9RICK/17-222---------QNAVATAAYISASK---------------------------------------------------------
TRAA_AGRT5/17-243---------RSVVLSAAYQHCAK---------------------------------------------------------
D4LKI8_9FIRM/17-286---------RSAVAASAYMSCSR---------------------------------------------------------
B0T9A7_CAUSK/17-219---------RSSVAAAAYRSATA---------------------------------------------------------
R5L7A7_9FIRM/19-253---------..AVASAAYISGQK---------------------------------------------------------
TRAA_RHISN/17-243---------RSAVLSAAYRHCAR---------------------------------------------------------
Q2KC95_RHIEC/17-258---------RSIISAAAYRHRTR---------------------------------------------------------
B7KN07_CYAP7/17-212---------KSSTAAAAYRAGEK---------------------------------------------------------
D5HHM6_9FIRM/55-279---------RSAVAAAAYRSGTK---------------------------------------------------------
D6DI62_CLOSC/17-286---------RSAVAASAYLSCSR---------------------------------------------------------
A9HLM3_GLUDA/17-229---------RSAVAAAAYRSAEK---------------------------------------------------------
D4LM09_9FIRM/19-247---------..VVNSAAYISGQK---------------------------------------------------------
D4JZW7_9FIRM/17-288---------RSAVAAAAYLSCSK---------------------------------------------------------
Q11MR5_CHESB/17-249---------RSVVSAAAYRHRTR---------------------------------------------------------
B1X3B9_CYAA5/17-213---------QSATEAAAYRAAEK---------------------------------------------------------
D4JZZ9_9FIRM/19-243---------QSAVAGAAYQSGER---------------------------------------------------------
Q8KIN6_RHIEC/17-249---------RSIVSAAAYRHRAR---------------------------------------------------------
A4YML6_BRASO/18-217---------.SAVASAAYRSGSR---------------------------------------------------------
I4DCV2_DESAJ/17-214---------KSSVASAAYRSGEK---------------------------------------------------------
C7JJ99_ACEP3/17-217---------RSAVAAAAYRAASR---------------------------------------------------------
F8C170_OLICO/17-243---------RSAVLAAAYRHCAK---------------------------------------------------------
B0S201_FINM2/20-247---------.SVIAKAAYNARDK---------------------------------------------------------
D4JD91_9FIRM/17-307---------KSVISASAYLNGDV---------------------------------------------------------
G2SZV4_ROSHA/17-288---------RSAVAAAAYLSCSR---------------------------------------------------------
G2I8U9_GLUMN/17-219---------RSVVAAAAYRAGQE---------------------------------------------------------
B0T9Q2_CAUSK/17-219---------RSAVAAAAYRSGQS---------------------------------------------------------
C4YZX3_9RICK/17-223---------QNAVASAAYISASK---------------------------------------------------------
D6GRF6_FILAD/17-241---------KSAVAASAYRSGEK---------------------------------------------------------
D4KAU2_9FIRM/17-241---------QSAVAAAAYQSGEK---------------------------------------------------------
D4MXT5_9FIRM/18-307---------.SIISASAYLNGDV---------------------------------------------------------
C0QML1_DESAH/17-230---------RSATAASAYRSAEK---------------------------------------------------------
R6LS79_9FIRM/20-249---------QSAVASAAYRAGEK---------------------------------------------------------
K9SN36_9CYAN/17-213---------RSATAAAAYRSGSI---------------------------------------------------------
Q1QF79_NITHX/18-243---------.SAVLSAAYRHCAR---------------------------------------------------------
G2ILJ4_9SPHN/17-216---------RSAVAAAAYRSASR---------------------------------------------------------
E8RPW5_ASTEC/17-230---------RSAVAAAAYRSGTK---------------------------------------------------------
R7B4C7_9CLOT/17-288---------RSAVAASAYLSCTN---------------------------------------------------------
G9WII5_9LACT/17-241---------RSAIASAAYRSGEK---------------------------------------------------------
A5V2N3_SPHWW/17-216---------RSAVAAAAYRAAER---------------------------------------------------------
MOBA_BIFLO/19-253---------..ATATLSYITGKR---------------------------------------------------------
C5B6Q9_METEA/17-230---------RSAVASAAYRAGER---------------------------------------------------------
C5B6U1_METEA/17-216---------RSAVAAAAYRSASE---------------------------------------------------------
B9K371_AGRVS/17-242---------RSAVAAAAYRHTAR---------------------------------------------------------
G8PF77_PEDCP/12-236---------RSAIASAAYRSGER---------------------------------------------------------
A1VX68_POLNA/17-235---------RSATAAAAYRAGVE---------------------------------------------------------
Q03N47_LACBA/17-240---------RSAIAGAAYRSGEK---------------------------------------------------------
C7RI54_ANAPD/18-245---------KSAVASAAYISGEK---------------------------------------------------------
D4KA38_9FIRM/17-241---------QSAVASAAYQSGER---------------------------------------------------------
Q7CW18_AGRT5/17-228---------RSAVASAAYRCAVL---------------------------------------------------------

PF05840

VGA_BPG4/115-441...........LGNDHWNLLYEK...............PVYKHWYQLVSNRPLKDIRAD....YNYAKA-KGVKDECS..
A0A011RTX4_VIBPH/74-400...........EGDEKWFLENEK...............TVTQFCRKLAAERPLKDIRDE....YNYPKK-KGIKDECS..
VGA_BPPHK/49-381...........LDPECVFLFEMICPGVRYGK.......TLNSLWSKYAAQWPEKLIRQE....LDMVKP-LSFKDEVA..
A9ZT18_9CAUD/122-510THLSASSDIMRMISDSWWLGRLVKVRKIMREHLAIAMGQVSNNASPYASWDCVREHQEQQQRNYEAIKN-MVLFDEET.E
VPA_BP186/139-507CEDEIAPAVMRMFNEVWWRGRLRRIAAAWREHLQIAVGNVSKKRHAYASKNCVTDWREQKRRTREFLKG-LDLEDEEG..
VPA_BPP2/133-515TTRQAYSAIARLFNDEWWTHQLKGQRMRWHETLLIAVGEVNKDRSPYASKHAIRDVRARRQANLEFLKS-CDLENRET.G
ENDP2_SALTI/193-568PYELIPPSLARMLCADWWYRKLWQMRCEWREEQLRAVCLVNKKASPYVSYEAVIHKREQRRKSLEFFRS-HELINEDG..
Q8XBG0_ECO57/179-564DTELLPGAILRLTCAEWWKRKLWLLRCEWREEQLRAACLVSRKTSPYLSQDALSEFRAQREKTRDFLKS-FMLENEDG..
P12_BPPM2/101-478LADKLEIAIRRMTCDKWWQRKLNRARDMTLEHLNITLGLVNKKKSPYASLQAVNEFKYAKKSQQKWLDS-MQLESDDG.E
REP_BPHC1/204-578KAEHIDSTLIRLTCEKWWFKQMRDIQKRMVEHIAIACGEVRANAASYISNQSFQEWQLQQRKNHDYLRA-MIIENIDNPE
O80256_9VIRU/150-506QSNELECLTSRAMCENWLRRQLRRRYFAEVEAVRDLL.LVSKNENPYCSAHGLEVMKSRKSATEQVLSN-TVCYVEDNPE

PF01076

65KD_ZYMMA/1-192--------------------------------------HMTRGRET......QNADPDRKELNEILKG...STDPSAD--
O87277_9STAP/1-193--------------------------------------HNQRERKSR...TNDDIDHERTRENYDLKND.KNIDYNER--
P71098_BACTI/20-220--------------------------------------HENKYLVQK...DVKDLYEKEFGEVLEKYNA.KQKRNDRK--
L2IEI5_ENTFC/1-193--------------------------------------HNQRNTDNH...SNKDIDVERSHLNYDLVN..RTENYKRD--
Q45448_BACIU/1-193--------------------------------------HNQREFQKS...KNENIDRERTHLNYDLVNE.KPISYSKA--
PRE_STRAG/1-194--------------------------------------HNERVFETH...SNKDINPSRSHLNYELTDRDRSVSYEKQ--
PRE1_STAAU/1-198--------------------------------------HNQRENKNY...NNKDINHEETYKNYDLINA.QNIKYKDK--
C3DBP7_BACTU/1-192--------------------------------------HNQRQGKSK...SNLDIDYSKSEQNYDLLNQ.QKIRYEST--
Q52058_9ZZZZ/3-190--------------------------------------HNSRINQP......ENANPEKSNLNQYFNS......YDEA--
Q09026_OENOE/1-199--------------------------------------HNSRRYLHD...NNKNIRPELSKNNIQFIDH..KGTLTQD--
Q53618_STAAU/1-198--------------------------------------HVQRQNKNY...ENMDIDLEKSYLNYDLVND.SPIDYNQK--
Q48524_LACCA/1-194--------------------------------------HDQRRTQHH...KNPDIDVDRSALNYDLVAG.RTGHFKTD--
B6FKS6_9CLOT/6-219--------------------------------------HNERKNETY...ENMNVIEERIPYNVHFKKP.FAPTYMEQ--
Q52050_BUTFI/1-198--------------------------------------ENNRQADKQKDFKASDIDWDRTNENEFLIQS...MNLQQD--
PREA_LACPN/1-194--------------------------------------HDQRKTTNH...SNEDIDVSRSHLNYDLVAG.RTDNFKTD--
P71520_MARHA/20-221--------------------------------------DRNVYLVKN...DLRELYEREFGAAKDRYND.KQQRRDRK--
Q53620_STAAU/1-198--------------------------------------HVQRENNNY...ENEDIDHSKTYLNYDLVNA.NKQNFNNL--

PF03432

Q9WW30_PEDPE/8-248-----------...........................RAVLKDGLN...LDVDYAKSQLKQ------------------
D2JCN4_STAEP/8-236-----------...........................RAEEKSALN...CDIDYAKSSFKA------------------
Q56424_BACFG/7-242-----------E......................DKS.KLLEAVGVEG...TPEQMAEQFEL------------------
VIRD2_RHIRD/16-264-----------LSRKG.................KLELQRSARHLDIPVPPDQIRELAQSWVT------------------
A0A015PKP4_BACFG/7-242-----------KEIN..................GQAVATEIARHELYG..CTGAEMVQEMKP------------------
Q9ZIP2_FUSNU/13-276-----------QNE...................KEKDDRVYKTTGINVS.DDYKKAFKEMML------------------
A6H977_9ZZZZ/12-252-----------E.....Q...........G...KTERLGHVRVTNCEA..NTLPAVMAEVMA------------------
A0A031PR62_ECOLX/61-315-----------G.....C...........E...WVNFYGVTCFHNCTS..LETAAADMEYIA------------------
Q9Z361_STAEP/8-242-----------...........................RAVEKSGLN...CDVDYAKSSFKA------------------
LTRB_LACLM/34-307-----------PDKTMS............KQLVSGHGITNVYDAANEF..IATKKLKALSKG------------------
Q9XAW2_PSEAC/12-285-----------RDHIDP...............ETGAVERRECSTETNC..LDKDTAWREMKA------------------
B3H352_ACTP7/14-247-----------...........................KPDDTAQIL....QGDPRLSQSIA------------------
TRAI5_ECOLX/12-252-----------A.....Q...........S...KDHRLGHVQATNCEA..GSIQDAITEVLA------------------
Q54883_STREE/11-264-----------PSKTKN............LTLVSDFGMRNYLDFPSYK..ELVKMYNDNFLS------------------
RLX1_STAAU/8-238-----------...........................RAEEKSGLN...CDVDYAKSYFKQ------------------
A9CQY2_STAAU/8-239-----------...........................RAEEKSGLN...CDVDYAKSAFKQ------------------
K7VR95_LACLC/9-280-----------QDRPMHEKTEQWLQDHQLERPVELTNCRAVAVGGTNG..IDPFIAKEQFDV------------------

PF02217

LT_POVBO/129-222--------------------------------------------------PDFPEVLKEYVS------------------
LT_POVMK/151-247--------------------------------------------------NDMPADLMEYLS------------------
Q80FI2_9POLY/134-228--------------------------------------------------IPLPDAVESCLL------------------
Q9DPC0_POVJC/137-230--------------------------------------------------KDFPVDLHAFLS------------------
LT_POVLY/200-298--------------------------------------------------DDFPVCLYSFLS------------------
Q20HY2_9POLY/139-233--------------------------------------------------ICLPADVEACLL------------------
Q9J7C9_SV40/136-229--------------------------------------------------KDFPSELLSFLS------------------
Q20HX6_9POLY/120-214--------------------------------------------------IDLPASIEACLL------------------
LT_POVHA/261-354--------------------------------------------------DDFPTILRGFLS------------------
B9A7H1_BFPYV/111-204--------------------------------------------------YELPPEVEAYLL------------------
LT_POVMC/285-377--------------------------------------------------SDFPSSLTGYLS------------------

PF08724

A7LIB2_9VIRU/14-197-----------ID-------------------------------------QDVPGLSLNFVE------------------
Q9WKM1_PAVHB/3-177-----------..-------------------------------------.....VSSNVLD------------------
Q8JQG1_9VIRU/4-192-----------LD-------------------------------------EHLPGISDSFVN------------------
Q7TG44_9VIRU/4-191-----------VE-------------------------------------SQVPGISDSFVN------------------
Q9J0X5_9VIRU/3-177-----------..-------------------------------------.....VSANFIN------------------
Q9J0X7_9VIRU/3-177-----------..-------------------------------------.....LTANITD------------------
Q6JL80_9VIRU/4-189-----------VE-------------------------------------EHLPGISDNFVD------------------
VU94_HHV6Z/17-203-----------WE-------------------------------------AEIPGISTDFFC------------------
Q88271_9VIRU/3-177-----------..-------------------------------------.....VNANFTD------------------

PF07232

Y35K_HALSI/1-316-----------AVKAVSWGEAIDRFQSWYDDQRGTQIVVENE.LGETVGFDMPNRFTPEYRE------------------
Y36K_HALSN/1-328-----------GVRATSTAQAVENFEGWYADQRDTQMVVEEATTGERVGFRTPNRFTPEYRE------------------

PF01446

G8PF48_PEDCP/80-316-----------V--------------------VREPKGRFLFLT------------LTVK--------------------

PF00799

REP_TPCTV/8-120---------------------------------FQIAAKNYFLT------------YP-N--------------------
REPA_MSVS/10-117---------------------------------FSHRNANTFLT------------YP-K--------------------
REP_BGYMJ/7-119---------------------------------FRVQSKNYFLT------------YP-R--------------------
REP_BCTVC/7-119---------------------------------FRIQAKNIFLT------------YP-Q--------------------
U9TRZ4_RHIID/23-135---------------------------------FSIIAKIIFFT------------YS-R--------------------
REPE_ONYPE/14-143---------------------------------...QAQNIFLT------------YS-Q--------------------

PF02407

MREP_SCSVF/5-83-------------------------------------VICWCFT------------LNNP--------------------
REP6_SCSVF/6-86-------------------------------------STSWVFT------------LNFE--------------------
REP2_SCSVF/2-88-------------------------------------ARRYCFT------------LNYA--------------------
MREP_BBTVA/6-83-------------------------------------.VCWMFT------------INNP--------------------

PF03389

C4YZP3_9RICK/17-222-----------LVYKTI------------DKETGEEISITYDFT.KKQGVVYSKISVPKGFEYAAWLH............
TRAA_AGRT5/17-243-----------M.....------------...EYEREARTIDYT.RKQGLVHQEFILPAD.A.PKWVR............
D4LKI8_9FIRM/17-286-----------I.....------------...YNDYDGIQHDYT.RKHGLIYQEVMLPPM.A.PPKWK............
B0T9A7_CAUSK/17-219-----------L.....------------...RDARLEMVFNYS.QKGGVAFTGLMAPDT.A.PAEFR............
R5L7A7_9FIRM/19-253-----------L.....------------...KDTRLGLSFNYT.RKEEVVFAEVLLPKN.A.PEDLA............
TRAA_RHISN/17-243-----------M.....------------...DYEREARTIDYR.AKQGLLHEEFVIPAE.S.PEWLR............
Q2KC95_RHIEC/17-258-----------M.....------------...MDEQVGASFNYRGGASDLVHEELALPDC.V.PDWLH........EELA
B7KN07_CYAP7/17-212-----------I.....------------...HDERTGLTFDYT.RKRGVYATEILAPLN.A.PNWVY............
D5HHM6_9FIRM/55-279-----------L.....------------...TNEWDGLTHDYT.RKGGVVHAEIMLPAH.A.PPEFA............
D6DI62_CLOSC/17-286-----------L.....------------...YNDYDGIQHDYT.KKQGLVWQEVFLPEY.A.PQEWK............
A9HLM3_GLUDA/17-229-----------L.....------------...TDERTGQIHDYR.NKNGVVATACSVGNQRV..................
D4LM09_9FIRM/19-247-----------L.....------------...YNDYYGQVHDYT.RKSGVMFTEILKPDY.V.PERLS............
D4JZW7_9FIRM/17-288-----------I.....------------...LNDYDGIQHDYT.RKKGLAWQEVFLPEF.A.PSEWK............
Q11MR5_CHESB/17-249-----------M.....------------...DEEQTGMSFRYEGGKAELVHEELALPDQ.T.PAWLR............
B1X3B9_CYAA5/17-213-----------I.....------------...HDLRIGETFNYT.RKKGVYATEILTPHN.A.PNWMA............
D4JZZ9_9FIRM/19-243-----------L.....------------...FSEYDQKTKFYN.KKKELVHAEIMLPSH.A.PPGFA............
Q8KIN6_RHIEC/17-249-----------M.....------------...MDEQAGTSFSYRGGAGELMYEELALPDE.I.PDWLR............
A4YML6_BRASO/18-217-----------L.....------------...RDERLGREQDFS.AKRGVVHSEVILPEN.A.PEAWS............
I4DCV2_DESAJ/17-214-----------I.....------------...QDEHIGQTFDYT.KKMGVDYKEILAPDH.S.PAWVQ............
C7JJ99_ACEP3/17-217-----------L.....------------...HDVRLDRDHDFS.NKSGVVHSEILLPDG.A.PERFL............
F8C170_OLICO/17-243-----------M.....------------...TYEAEARVVDYT.GKRNMVHDEFVLPPD.A.PQWAC............
B0S201_FINM2/20-247-----------L.....------------...QDEYYGKTHDYS.KKEDLVFSKIFLPEH.I.PKEFS............
D4JD91_9FIRM/17-307-----------M.....------------...KNEETGRISYYT.SKKEVVYTSLMMCEN.APPEWQIVPEENIKRFQKS
G2SZV4_ROSHA/17-288-----------M.....------------...LNEYDGVQHDYT.RKQGLGWRQVFLPAT.A.PAEWQ............
G2I8U9_GLUMN/17-219-----------L.....------------...TDERQGLTHDYT.RKQGVEDAFIVAPDG...ADWAQ............
B0T9Q2_CAUSK/17-219-----------L.....------------...TDDRLAMEFDFS.NKDGIEHAEIMAPDD.A.PQAYR............
C4YZX3_9RICK/17-223-----------LVYKTI------------DKETGEKISITYDFT.KKQGVVYSKIFLPEGFEDAEWLQ............
D6GRF6_FILAD/17-241-----------I.....------------...KNEYDGIVHDFT.RKSGIAHTEILLPQN.A.PQEFA............
D4KAU2_9FIRM/17-241-----------L.....------------...FCEYDQEVKHYP.EKRGIVHNEILLPAN.A.PLEYT............
D4MXT5_9FIRM/18-307-----------M.....------------...KNEETGRISYYT.SKKEVVYTSLIMCEN.APPEWLHVPEENIKRFQQS
C0QML1_DESAH/17-230-----------V.....------------...KDLRTGEDFDYT.RKGGVEHKEIIGSTL....................
R6LS79_9FIRM/20-249-----------L.....------------...HSEYYGEDSDYT.RKGGVICSEILLPSH.A.PPEYA............
K9SN36_9CYAN/17-213-----------V.....------------...HDERTDLEFNYT.RKDDVYGAEIFAPLN.A.PTWVY............
Q1QF79_NITHX/18-243-----------M.....------------...DYEAEARVVDYS.NKRNLAHEDFVLPPD.A.PAWVR............
G2ILJ4_9SPHN/17-216-----------L.....------------...HDERLDRDHDFT.NKSGVVHSEILLPEG.A.PERFA............
E8RPW5_ASTEC/17-230-----------L.....------------...TNERDGLTHDYT.RKSGVEETEIVLPEG.VDAEWAR............
R7B4C7_9CLOT/17-288-----------I.....------------...LNDYDGVRHDFT.RKKGLVWQDVFLPEF.A.PAEWK............
G9WII5_9LACT/17-241-----------L.....------------...FDQREGKSYFFA.RSV.MPESFILIPKN.A.PEWAN............
A5V2N3_SPHWW/17-216-----------L.....------------...HDERLGRGHDFT.NKAGVVHSEIMLPDG.A.PERLR............
MOBA_BIFLO/19-253-----------V.....------------...HDERRGETYDYG.RKERVLRVGTLLPEG.A.PAEFA............
C5B6Q9_METEA/17-230-----------L.....------------...ENERDGLTHDYT.RRAGIAHAEIVLPQG.SRADWAR............
C5B6U1_METEA/17-216-----------L.....------------...HDERAEQRHDFR.AKGGVVHSEILLPQG.A.PERLS............
B9K371_AGRVS/17-242-----------M.....------------...ENEREGRVADFF.NKPGLVHSEFALPDD.A.PDWAR............
G8PF77_PEDCP/12-236-----------L.....------------...FDDKEGRNYFYA.RTV.MPESFILSPKN.A.PDWTS............
A1VX68_POLNA/17-235-----------I.....------------...TDERTGEVHDYR.RRGGVDSAQLFFPAN.A.PEWAS............
Q03N47_LACBA/17-240-----------L.....------------...FDQKEGRSYFYA.RSV.MPESFILTPKN.A.PKWAS............
C7RI54_ANAPD/18-245-----------I.....------------...KNEWDGVTHDYT.KKQGVISKEIFLPDH.A.PEEYK............
D4KA38_9FIRM/17-241-----------L.....------------...FSEYDQKQKYYS.HKSEIVHTEIMLPPH.A.PPAYA............
Q7CW18_AGRT5/17-228-----------L.....------------...VNQRDGLVHDFT.RKEGVAHSEIVLPQG.VSAGWAL............

PF05840

VGA_BPG4/115-441..KILEESTMKS......RRGFTVQR--------LMNAMRTAHSKGWYVVFDTLTLADDRLKDFYDN.............
A0A011RTX4_VIBPH/74-400..RLLEASTMKS......RRGFAIQR--------LMNAMRQAHADGWFIVFDTLTLADDRLEAFYDN.............
VGA_BPPHK/49-381..KYMEKMQEKT......RKNRMTQK--------VINEMRIAHQKGWFFVFDTLTLADDRLQAFNEN.............
A9ZT18_9CAUD/122-510EEHDLWDMVKKSVSNPAIRRHELMVR--------CRGCEDIGNELGLQGLFLTLT.TPSKYHNSYKKGGFIDH.......
VPA_BP186/139-507NRISLIEKYDGSVANPAIRRCELMAR--------IRGFENICNELGYVGEFYTLT.APSKYHATTKAGYRNSK.......
VPA_BPP2/133-515ERIDLISKVMGSISNPEIRRMELMNT--------IAGIERYAAAEGDVGMFITLT.APSKYHPTRQVGKGESKTVQLNHG
ENDP2_SALTI/193-568DTLDMEDVVNASNSNPAHRRNEMMAC--------VKGLELIAEMRGDCAVFYTIT.CPSRFHATLNNGRPNPK.......
Q8XBG0_ECO57/179-564FTIDLETVYYAGVSNPVHRKAEMMAT--------MKGLELLAEARGDKAVFLTVT.CPSKYHATTENGHPNPK.......
P12_BPPM2/101-478TTLDLAEVFKGSVSNPEIRRVELMVR--------IRGYEEYAQEQGMKAVFYTIT.APSKYHANSKK.............
REP_BPHC1/204-578EQVELFDMFLKSSSNPALRRNEMMVR--------LRGLEEWAEENNNEALFLTLT.APSSFHA....GNGNKK.......
O80256_9VIRU/150-506TWFTLQELAAKSLSNPTIRRAEMFVR--------LKAFEDICKESGHVAMFYTVT.APSRFHV.FKGDDINPK.......

PF01076

65KD_ZYMMA/1-192------------------VKSMLNKI--------QKETGKPLRKNGVQAIELFFG-MSPEWS.KQAT-------------
O87277_9STAP/1-193------------------VKEIIESQ--------KTGT.RKTRKDAVLVNELLVT-SDRDFF.EQLD-------------
P71098_BACTI/20-220------------------IDDYYKHI--------Q....SSKKTSLQQEMIVQVG-DMKDFN.YRAD-------------
L2IEI5_ENTFC/1-193------------------IEQFINDN--------KSSS.RAVRKDAVLINEWIIT-SDNPFF.KDKD-------------
Q45448_BACIU/1-193------------------IHEKIEGR--------V..K.RKVRADAVLVSEFLIT-ASPDYM.NGLS-------------
PRE_STRAG/1-194------------------IKDYVNEN--------KVSN.RAIRKDAVLCDEWIIT-SDKDFF.EKLD-------------
PRE1_STAAU/1-198------------------IDETIDEN--------YSGK.RKIRSDAIRHVDGLVT-SDKDFF.DDLS-------------
C3DBP7_BACTU/1-192------------------IKQEISER--------V..K.RKPRANSVVLSEFVVT-ASPDYM.HSLS-------------
Q52058_9ZZZZ/3-190------------------LEIYKKQL--------P....EKVRKNAVHAVEILIT-ASPEIL.SKMT-------------
Q09026_OENOE/1-199------------------VKARTDQR--------LNNK.RAIRSDANLISEIVVG-ADDKYF.QTLT-------------
Q53618_STAAU/1-198------------------IEEKIEQN--------YNGK.RKIRKDAVKHIDGLIT-SGNEFS.KNQT-------------
Q48524_LACCA/1-194------------------IEAYINEH--------KTSQ.RAVRKDAVLVNEWIIS-SDSHFF.ADLT-------------
B6FKS6_9CLOT/6-219------------------LKQMETDG--------MVSL.RGLRKDATLFNEIVID-VNTMYFERNGG-------------
Q52050_BUTFI/1-198------------------IKKELKEH--------G...IDKWRKDAVVCIDGLYT-ASPEFF.EGKT-------------
PREA_LACPN/1-194------------------IEAYINEN--------KASK.RAVRKDAVLVNEWIIT-SDKDFF.EQLD-------------
P71520_MARHA/20-221------------------IDDYYKHV--------Q....QGKKTRPQQEMIVQIG-EQDQFQDNEPN-------------
Q53620_STAAU/1-198------------------IDEKIEQN--------YTGK.RKIRTDAIKHIDGLIT-SDNDFF.DNQT-------------

PF03432

Q9WW30_PEDPE/8-248--------------------VREVYG........NQ........GKTQAYASRIS-FSPKE.LD--------PTNEND--
D2JCN4_STAEP/8-236--------------------TREMYG........KT........DGNEGHVVIQS-FKPNE.VT--------P.....--
Q56424_BACFG/7-242--------------------QTLLND........KV.........KNTVGHTSLN-FSPED..G--------ERLKTD--
VIRD2_RHIRD/16-264--------------------EAGIYD........ESQS..DDDRQQDLTTHIIVS-FPAGTDQT--------A...AY--
A0A015PKP4_BACFG/7-242--------------------YHIDFP........NVK.......NNCLRFEVSPS-IEESATFT--------D.....--
Q9ZIP2_FUSNU/13-276--------------------TKELHC........KL........DGRQYRHHIQS-FKPGE.VD--------E.....--
A6H977_9ZZZZ/12-252--------------------TQHGNT........RS........EADKTYHLLVS-FRAGE..K--------P..DA.--
A0A031PR62_ECOLX/61-315--------------------RQAHYA........KD........DTDPVFHYILS-WQSHE..S--------P..RP.--
Q9Z361_STAEP/8-242--------------------SRELYG........KT........DGNQGHVIIQS-FKPGE.VT--------P.....--
LTRB_LACLM/34-307--------------------TDFNFDPQTGKVRFNVES..LEKNNAVLGHHLIQS-FSPDDNLT--------P.....--
Q9XAW2_PSEAC/12-285--------------------VSDMNG........RV.........KDPVYHFTVS-WPAHEKPT--------D.....--
B3H352_ACTP7/14-247--------------------DSLDFN........NT.........YTAGCLSFEE-SDLPEIQK--------R.....--
TRAI5_ECOLX/12-252--------------------TQHTNT........RA........KGDKTYHLIVS-FRAGE..Q--------P..SA.--
Q54883_STREE/11-264--------------------NDTLYE........FRHDRQEVNQRKIHSHHIIQS-FSPDDHLT--------P.....--
RLX1_STAAU/8-238--------------------TRALYG........KE........NGVQAHTVIQS-FKPGE.VT--------A.....--
A9CQY2_STAAU/8-239--------------------TRALYG........KE........DGIQAHTVIQS-FKPGE.VT--------P.....--
K7VR95_LACLC/9-280--------------------IRQLHN........QTK.......ESNQVLRITQS-FALDE.LN--------PKVQKD--

PF02217

LT_POVBO/129-222--------------------NALFTN-------------------RTYNCFIIFT-TA----------------------
LT_POVMK/151-247--------------------CAILSN-------------------KTLPCFLIYT-TL----------------------
Q80FI2_9POLY/134-228--------------------AKKSIQ-------------------SCPEVHLLIT-SN----------------------
Q9DPC0_POVJC/137-230--------------------QAVFSN-------------------KTVASFAVYT-TK----------------------
LT_POVLY/200-298--------------------HAIYSN-------------------KTMNSFLIYT-TL----------------------
Q20HY2_9POLY/139-233--------------------AAKSIQ-------------------SCPEGHLVVT-TH----------------------
Q9J7C9_SV40/136-229--------------------HAVFSN-------------------RTLACFAIYT-TK----------------------
Q20HX6_9POLY/120-214--------------------TAKSVQ-------------------SCPDAHLIIT-TC----------------------
LT_POVHA/261-354--------------------HAIFSN-------------------KTQNAFIIYS-TK----------------------
B9A7H1_BFPYV/111-204--------------------TPRSVQ-------------------SCPDCHLLIT-SI----------------------
LT_POVMC/285-377--------------------HAIYSN-------------------KTFPAFLVYS-TK----------------------

PF08724

A7LIB2_9VIRU/14-197--------------------WLSTGV-------------------WE..PTGIWN-MEHVNLPM--------...VTL--
Q9WKM1_PAVHB/3-177--------------------CANDNW-------------------WC....SLLD-LDTSDWEP--------...LTH--
Q8JQG1_9VIRU/4-192--------------------WVAEKE-------------------WELPPDSDMD-LNLIEQAP--------...LTV--
Q7TG44_9VIRU/4-191--------------------WITSRE-------------------WTLPEDADWD-LDQVDQVQ--------...LTL--
Q9J0X5_9VIRU/3-177--------------------FVNDNW-------------------WC....CFYQ-LEEDDWPR--------...LQG--
Q9J0X7_9VIRU/3-177--------------------FANDSW-------------------WC....SFLQ-LDSDDWPE--------...LRG--
Q6JL80_9VIRU/4-189--------------------WVTGQI-------------------WELPPESDLN-LTLIEQPQ--------...LTV--
VU94_HHV6Z/17-203--------------------KFSN..-------------------..VPVPHFRD-MHSPGAPD--------IKWITA--
Q88271_9VIRU/3-177--------------------FANDNW-------------------WC....CFFQ-LDVDDWPE--------...LRG--

PF07232

Y35K_HALSI/1-316--------------------MLYAKA--------QSLERGLRERWGSLLHTGMVT-LTASSTDDEGRLRPPLEHFEDL--
Y36K_HALSN/1-328--------------------MLYAKA--------QSLERGLREEWGDLLHTAMVT-LTASTTEEDGGPRPLVDHLRDL--

PF01446

G8PF48_PEDCP/80-316---------------------------------------------NAYSAEELKS-SLRALTKA----------------

PF00799

REP_TPCTV/8-120---------------------------------------------CSLSKEEALD-QL......----------------
REPA_MSVS/10-117---------------------------------------------CPENPEIACQ-MI......----------------
REP_BGYMJ/7-119---------------------------------------------CTIPKEEALS-QL......----------------
REP_BCTVC/7-119---------------------------------------------CSLSKEEALE-QI......----------------
U9TRZ4_RHIID/23-135---------------------------------------------CPLTPSYCIE-SL.....R----------------
REPE_ONYPE/14-143---------------------------------------------CDLSKEEIKT-FIINLCNE----------------

PF02407

MREP_SCSVF/5-83---------------------------------------------.......LAP-LS----------------------
REP6_SCSVF/6-86---------------------------------------------GE.....IPI-LP----------------------
REP2_SCSVF/2-88---------------------------------------------TEIERETFLS-LF----------------------
MREP_BBTVA/6-83---------------------------------------------TT.......L-PV----------------------

PF03389

C4YZP3_9RICK/17-222....................NREQLW--------NAAEAREKREDSTIARCIEFA-LPKEVCKE----------------
TRAA_AGRT5/17-243..........ALIADCSVAGASEAFW--------NKVEAFEKRSDAQLARDLTIA-LPRELTSE----------------
D4LKI8_9FIRM/17-286....................NREQLW--------NAVEAAEKTKDSRLAREFVVA-LPIELDKD----------------
B0T9A7_CAUSK/17-219....................DREQMW--------NAAEAADKRADSRTAREVLIS-LPHELTDD----------------
R5L7A7_9FIRM/19-253....................DRETLW--------NAVEKRENKRNSQYAREFEIA-VPNEWNRE----------------
TRAA_RHISN/17-243..........SMIADRSVASASEAFW--------NKVEDFEKRSDAQLAKDVTIA-LPIELTTE----------------
Q2KC95_RHIEC/17-258LPDCVPDWLHEAIDGLSVASASEALW--------NAVEAFETLGNAQLARELIIA-LPEELTRA----------------
B7KN07_CYAP7/17-212....................NREKLW--------NAVELFETRSNSRLAREFDIA-LPVELNHQ----------------
D5HHM6_9FIRM/55-279....................DRSTLW--------NSVEQIEKARDSQLAREIEAA-LPRELSGE----------------
D6DI62_CLOSC/17-286....................DREQLW--------NAVEEVETAKDSRLAREFVVA-LPIELSRE----------------
A9HLM3_GLUDA/17-229....................DRETLW--------NAAEAAEKRKDGRTAREWLLA-LPSELSPR----------------
D4LM09_9FIRM/19-247....................DRETLW--------NEVERAEKGKRAQLAYSFDIA-LQNELTLE----------------
D4JZW7_9FIRM/17-288....................ERSVLW--------NAVEENEKTKDSRLAREFVVA-LPIELNET----------------
Q11MR5_CHESB/17-249..........TMIDGRTIAGASEVLW--------NAVDTFEKRVDAQLAREMIFA-LPEELSKA----------------
B1X3B9_CYAA5/17-213....................DRSQLW--------NAAELFEKRSNSRTAREFDIA-LPTELTHP----------------
D4JZZ9_9FIRM/19-243....................DRQILW--------NAVEAVENQWNSQLARRIVLA-FPVEVPKE----------------
Q8KIN6_RHIEC/17-249..........SAISGQSVSKASEVFW--------NAVDAFETRADAQLARELIIA-LPEELTRA----------------
A4YML6_BRASO/18-217....................DRERLW--------NDVEAFEVRKDAQLAREVEFA-LPRELSEA----------------
I4DCV2_DESAJ/17-214....................DRGQLW--------NQVELAERRKDAQLARELNIA-LPKELSKE----------------
C7JJ99_ACEP3/17-217....................DRATLW--------NEVEAIEKRKDAQLAREVEFS-IPREMTQA----------------
F8C170_OLICO/17-243..........AMMATRSAAEVSAAFW--------NKLEAFEKRSDAQLSKEYIIA-LPIELTTA----------------
B0S201_FINM2/20-247....................NREYLW--------NSVEKIEKSKNSQLARNLLFT-LPRELNEQ----------------
D4JD91_9FIRM/17-307VRYKRSEDKEAALEKFKITFQKQRLW--------NEVLKIEKNADAQLGRSFEFA-LPKEWSRQ----------------
G2SZV4_ROSHA/17-288....................DREILW--------NAVEETETAKDSRLAREFVAA-LPIELSRE----------------
G2I8U9_GLUMN/17-219....................DRNALW--------NAAEAAEKRKDAKTGREYELA-LPAELDAG----------------
B0T9Q2_CAUSK/17-219....................DRAALW--------NAVEAAERRKDAVPAQEVLLA-LPHELDFE----------------
C4YZX3_9RICK/17-223....................DRQQLW--------NAVEARERRDDSTIARAIEFS-LPREVSQE----------------
D6GRF6_FILAD/17-241....................NRSVLW--------NSVEKIEKSKNSQLAREIEIA-LPKELDQE----------------
D4KAU2_9FIRM/17-241....................DRNTLW--------NAAEAVEKQWNSQLARRWVLS-IPREIPPD----------------
D4MXT5_9FIRM/18-307IRYKRADDKEAVLEKFKITFQKQRLW--------NEVLKIEKNADAQLGRSFEFS-LPKEWSRQ----------------
C0QML1_DESAH/17-230....................SREELW--------NLAESTETRKNATTAREYEVA-LPKELDLE----------------
R6LS79_9FIRM/20-249....................DRETLW--------NAVEKAERRKKAQLAYSFDIA-LQNEFSMQ----------------
K9SN36_9CYAN/17-213....................DRNKLW--------NSVEHSEKRKDALVALEHEVA-LPIELTHE----------------
Q1QF79_NITHX/18-243..........AMIADRSVSGASETFW--------NYVEAFETRSDAQFAREAIIA-LPVELTRE----------------
G2ILJ4_9SPHN/17-216....................DRKKLW--------NEVEATEKRKDAQLAREVEFS-IPREMTQA----------------
E8RPW5_ASTEC/17-230....................DREQLW--------NAAEMAEKRNDARVAREFEVA-LPHELNAD----------------
R7B4C7_9CLOT/17-288....................DRGLLW--------NAVEKNEKTKDSRLAREFVPA-LPIELTPA----------------
G9WII5_9LACT/17-241....................DREKLW--------NEVERKDRKSNSRYAKEFNVA-LPIELNES----------------
A5V2N3_SPHWW/17-216....................DRQTLW--------NEVEAGEKRKDAQLAREVEFA-IPREMTKE----------------
MOBA_BIFLO/19-253....................DPAVLF--------NAVELHETGRTARPAKKIVVA-LPREFTPR----------------
C5B6Q9_METEA/17-230....................DRSALW--------NAAERAEKRADARVAREFEIA-LPHELSAE----------------
C5B6U1_METEA/17-216....................DRATLW--------NAVEASEKRKDAQLAREVEFA-LPRELSRA----------------
B9K371_AGRVS/17-242..........VMKYGKSPAQSSEAFW--------NKVEAFETRKDAQLAKEFILA-VPVELSTE----------------
G8PF77_PEDCP/12-236....................DRERLW--------NEVERKDRRANSRYAKEFNVA-LPVELNED----------------
A1VX68_POLNA/17-235....................DRNELW--------NAAEKSETRKNSTVAREFEVA-LPAELTTS----------------
Q03N47_LACBA/17-240....................DREQLW--------NEVEKKDRKSNSRYAKEFNVA-LPIELSTD----------------
C7RI54_ANAPD/18-245....................DRKTLW--------NSVELFEKNSNAQLARNFIIS-LPKELSIE----------------
D4KA38_9FIRM/17-241....................DRNTLW--------NAAEAIEKQWNSQLARRIVLA-IPREIPPE----------------
Q7CW18_AGRT5/17-228....................DRSTLW--------NAAEFAEKRKDARVAREFEIA-LPHELSPE----------------

PF05840

VGA_BPG4/115-441.......PN..ALRDYFRDIGRMVLTAE...-......GRSVHD------SSSDCYQYFCVPEYGTQHGRLHFHAVHL--
A0A011RTX4_VIBPH/74-400.......PN..ALRDYFRDIGRMVLAAE...-......GRKAND------SHADCYQYFCVPEYGTANGRLHFHAVHF--
VGA_BPPHK/49-381.......PN..ALRDYFRTVGRAVLRAE...-......GRSVKD------SYNDCYRYLCVPEFGGQHGRLHWHVVHM--
A9ZT18_9CAUD/122-510WNG.AS.PR..DAQAYLNKKW.QLIRAKLNR-DEIRWFGVRVAE------PHHD..............GTPHWHLLIW--
VPA_BP186/139-507WNG.AS.PS..DTQSYLTGLW.ARIRAKLHR-EEIRIFGIRVAE------PHHD..............GTPHWHMLMF--
VPA_BPP2/133-515WNDEAFNPK..DAQRYLCHIW.SLMRTAFKD-NDLQVYGLRVVE------PHHD..............GTPHWHMMLF--
ENDP2_SALTI/193-568WTS.AT.VR..QSSDYLVDTF.AAFRKAMHK-AGLRWYGVRVAE------PHHD..............GTVHWHLLCF--
Q8XBG0_ECO57/179-564WNG.AT.MR..DSSDYLVNTFFAAVRKKLNR-DGLRWYGIRTVE------PHHD..............GTVHWHMMVF--
P12_BPPM2/101-478YNN.AT.PK..ETQAFLVNQW.AKARAELNK-IDVPVFGVRVVE------PHHD..............ATPHWHMLLF--
REP_BPHC1/204-578WLG.VN.PR..ETQNYLNKVW.QQFRALLSK-RNIKFYGMRVAE------PHKD..............GTPHWHALAY--
O80256_9VIRU/150-506WLE.AGKPSAIDAHHHLMGVT.NAFRKALDK-AKIKIYGLRIVE------PHHD..............GTPHNHFLFF--

PF01076

65KD_ZYMMA/1-192-------PE--KLEHWKTITQ-QWAEQTFGE.NNLVSLQLHADE------T..........-------.TPHLTGF..--
O87277_9STAP/1-193-------PG--EQKRFFEESY-KLFSERYGK.QNIAYATVHNDE------Q..........-------.TPHMHLG..--
P71098_BACTI/20-220-------YE--KANEILLDWF-KDFEKRNPN.LKVYNAVIHNDE------A..........-------.SPHMHLNFV--
L2IEI5_ENTFC/1-193-------DK--EIKDFFDTAK-SYFADKFGD.NNIRYAQVHLDE------T..........-------.TPHMHLG..--
Q45448_BACIU/1-193-------DE--EQRRYFETAV-DHLKEKYSA.ENMLYATVHMDE------A..........-------.TPHMHVG..--
PRE_STRAG/1-194-------EE--QTRTFFETAK-NYFAENYGE.SNIAYASVHLDE------S..........-------.TPHMHMG..--
PRE1_STAAU/1-198-------GE--EIERFFKDSL-EFLENEYGK.ENMLYATVHLDE------R..........-------.VPHMHFG..--
C3DBP7_BACTU/1-192-------LE--EQKRYFESSL-DFIQKRYGK.QNTLYAMVHMDE------A..........-------.TPHMHIG..--
Q52058_9ZZZZ/3-190-------FQ--EQKNYFNQSL-AWAENQLGGREILLSACIHRDE------A..........-------.TPHLHMI..--
Q09026_OENOE/1-199-------DQ--KKIDFGRTAT-KLIQERYGK.ENVLRSYLHLDE------VD.........-------DNGIQHPGLH--
Q53618_STAAU/1-198-------LE--ETKQFFEHAK-TFLEQEYGK.DNLLYATVHMDE------K..........-------.TPHMHYG..--
Q48524_LACCA/1-194-------AA--DMRKYFETAK-DYFAEKFGE.ENIRYAIVHLDE------S..........-------.TPHMHMG..--
B6FKS6_9CLOT/6-219-------YE--YAKQFYEEAF-HFIEEKFGA.DNVISAVMHADE------INVAATEELGK-------EVYHYHLHA.--
Q52050_BUTFI/1-198-------KE--ECMEYFKDCL-EYHEKTYG...VTINAVIHFDE------A..........-------.TPHMHCQS.--
PREA_LACPN/1-194-------EA--ETRKYFETAK-QYFADNYGD.ENIRYAVVHMDE------K..........-------.TPHMHMG..--
P71520_MARHA/20-221-------RE--MAKEVLQEWF-QEFQQRNPQ.LKMYNAVIHDDE------A..........-------.SPHMHMNFV--
Q53620_STAAU/1-198-------PE--DTKQFFEYAK-EFLEQEYGK.DNLLYATVHMDE------K..........-------.TPHMHYG..--

PF03432

Q9WW30_PEDPE/8-248-------QQ--KALEIAKEVY-----QKTYP.NQQV-ALYEHAD--....T-----------------NALHVHAVIGAI
D2JCN4_STAEP/8-236-------.E--QCNQLGLELA-----EKIAP.NHQV-AVYTHND--....T-----------------DHVHNHIVINSI
Q56424_BACFG/7-242-------DA--LMLQIAHDYM-----AKMGIENTQY-IVARHTD--....R-----------------EHPHCHIVFNRV
VIRD2_RHIRD/16-264-------EA--SREWAAEMFG-----SGYGGGRYNY-LTAYHVD--....R-----------------DHPHLHVVVNRR
A0A015PKP4_BACFG/7-242-------.A--DWAELGNDFM-----QRMGLANHQY-IIIRHSG--TESKK-----------------EQAHLHILANRV
Q9ZIP2_FUSNU/13-276-------.E--TAHKMAVEFA-----EKNFK.GFDV-FISTHID--....K-----------------GHIHNHIIINTV
A6H977_9ZZZZ/12-252-------.E--TLRAIEDRIC-----AGLGFAEHQR-VSAVHHD--....T-----------------DNLHIHIAINKI
A0A031PR62_ECOLX/61-315-------.E--QIYDSVRHTL-----KSLGLADHQY-VSAVHTD--....T-----------------DNLHVHVAVNRV
Q9Z361_STAEP/8-242-------.E--QCNQLGLALA-----EKLAP.NHQV-AVYTHAD--....T-----------------DHVHNHIVMNSI
LTRB_LACLM/34-307-------.E--QIHEIGRQTI-----LEFTGGEYEF-VIATHVD--....R-----------------EHIHNHIIFNST
Q9XAW2_PSEAC/12-285-------.A--QVFEAGREGM-----KSLGMEGHQY-LAAVHRD--....T-----------------DNVHGHFMVNRV
B3H352_ACTP7/14-247-------.E--IMARFEKAMF-----AGLEPEQYNI-AWVQHTD--....K-----------------GRLELNFVIPNV
TRAI5_ECOLX/12-252-------.D--TLRAIEERIC-----VGLGYGEHQR-ISAVHND--....T-----------------DNLHIHIAINKI
Q54883_STREE/11-264-------.E--QINRIGYEAA-----KELTGGRFRF-IVATHVD--....K-----------------GHIHNHIILNSI
RLX1_STAAU/8-238-------.K--ECNEIGLELA-----KKIAP.DYQV-AVYTHTD--....K-----------------DHYHNHIIINSV
A9CQY2_STAAU/8-239-------.E--QCNQLGLELA-----EKIAP.NHQV-AVYTHTD--....K-----------------DHYHNHIVINSV
K7VR95_LACLC/9-280-------WQ--KANDLGVELA-----ENLYP.NHQS-AVYTHLD--G..KN-----------------HVLHNHIIVNKV

PF02217

LT_POVBO/129-222--------E--KGKELYPCIQ.....AAYKCTFIAL.YMYN---------G-----------------DSV.LYIITV--
LT_POVMK/151-247--------E--KVELLYNKLS....EEVLSPRFNQVDHKYG---------R-----------------KYVPIFIITG--
Q80FI2_9POLY/134-228--------S--KLQELQPLIL.....QHFSTKGYVT.AQWA---------G-----------------GYAFMLIILA--
Q9DPC0_POVJC/137-230--------E--KAQILYKKLM.....EKYSVTFISR.HGFG---------G-----------------HNI.LFFLTP--
LT_POVLY/200-298--------E--KARQLYKTVEKSKIVVDFKASFSYQ.DEEG---------E-----------------GCL.LFLITL--
Q20HY2_9POLY/139-233--------Q--KLQELQSSLL.....NHFDTAGHLV.CKWG---------T-----------------DFAIMLIILT--
Q9J7C9_SV40/136-229--------E--KAALLYKKIM.....EKYSVTFISR.HNSY---------N-----------------HNI.LFFLTP--
Q20HX6_9POLY/120-214--------N--KLQNLRPQLM.....TNFTTRGHIQ.AVWD---------S-----------------SYA.LFVILM--
LT_POVHA/261-354--------E--KCEVLYEQI......DKYNPDYKGI.FIMK---------Q-----------------TEAFVMFMTP--
B9A7H1_BFPYV/111-204--------T--KMPQLKAHLY.....EHFGIKGHML.AHWT---------G-----------------IAL.LVLQLE--
LT_POVMC/285-377--------E--KCKQLYDTI......GKFRPEFKCL.VHYE---------E-----------------GGM.LFFLTM--

PF08724

A7LIB2_9VIRU/14-197-------AE--KIKNIFIQRWNQFN-QD.ET.....-DFFFQLE--EG..S-----------------EYIHLHCCIA--
Q9WKM1_PAVHB/3-177-------TN--RLMAIYLSSVASKL-DFTGGPLAGC-LYFFQVE--CNKFE-----------------EGYHIHVVIG--
Q8JQG1_9VIRU/4-192-------AE--KLQRDFLVQWRRVS-KAPEA.....-LFFVQFE--KG..E-----------------SYFHLHVLVE--
Q7TG44_9VIRU/4-191-------GD--KIQREIRTHWGTMA-KEPDF.....-HYFIQLE--QG..E-----------------VFFHLHVLLE--
Q9J0X5_9VIRU/3-177-------WE--RLIAHLIVKVAGEF-AVPGGSTLGL-QYFLQAE--HNHFD-----------------EGFHVHVVVG--
Q9J0X7_9VIRU/3-177-------VE--RLVAIFICKVAAVL-DNPSGTSLGC-KYFLQAE--GNHYD-----------------AGFHVHIVIG--
Q6JL80_9VIRU/4-189-------AD--RIRRVFLYEWNKFS-KQ.ES.....-KFFVQFE--KG..S-----------------EYFHLHTLVE--
VU94_HHV6Z/17-203-------CT--KMIDVILNYWNNKT-AVPTPA....-KWYAQAE--NK..A-----------------GRPSLTLLIA--
Q88271_9VIRU/3-177-------PE--RLMAHYICKVAALL-DTPSGPFLGC-KYFLQVE--GNHFD-----------------NGFHIHVVIG--

PF07232

Y35K_HALSI/1-316-------LE--SWEAVRRALA-----RVLEGREWEYLAILEPHE......S-----------------GYVHIHLGVFVR
Y36K_HALSN/1-328-------LS--SWSAVYDALR-----HTLEDREFEYLAIIEPTTPAGNGPA-----------------GYAHIHLGVFVK

PF01446

G8PF48_PEDCP/80-316--------F--GKLSRYKKVS-----KNLLGYLRSTEITVNEHD------GS----------------YNQHLHVLLF--

PF00799

REP_TPCTV/8-120--------Q--RLQTPTNKK-----------YIK...VARELHE------N.----------------GEPHLHVLIQ--
REPA_MSVS/10-117--------W--ELVVRWIPK-----------YIL...CAREAHK------D.----------------GSLHLHALLQ--
REP_BGYMJ/7-119--------Q--KIHTTTNKK-----------FIK...VCEERHD------N.----------------GEPHLHALIQ--
REP_BCTVC/7-119--------Q--GIQLSSNKK-----------YIK...IARELHE------D.----------------GQPHLHVLLQ--
U9TRZ4_RHIID/23-135--------S--KLSSRRSPI-----------GIIGYSVGLEHLT------D.----------------GGLHIHVLIK--
REPE_ONYPE/14-143--------K--KLQIN....-----------YLI...IGIENHQ------DH----------------KGKHHHVFFQ--

PF02407

MREP_SCSVF/5-83--------L--HESMK---------------YLV---YQTEAGD------N-----------------GTIHYQGYVE--
REP6_SCSVF/6-86--------F--NESVQ---------------YAC---WQHERV.------.-----------------GHDHLQGFIQ--
REP2_SCSVF/2-88--------S--QDELN---------------YFV---VGDETAT------T-----------------GQKHLQGFVS--
MREP_BBTVA/6-83--------M--RDEIK---------------YMV---YQVERGQ------E-----------------GTRHVQGYVE--

PF03389

C4YZP3_9RICK/17-222--------E--NIKLVEEYAQ-----QYIVARGLVCDVNIHYDN------S.................NNPHVHFQFL--
TRAA_AGRT5/17-243--------Q--NIALVRDFVE-----KHILGKGMVADWVYHDNP------..................GNPHIHLMTT--
D4LKI8_9FIRM/17-286--------S--NISLLQNFIQ-----KNFVDMGMCADFAIHDTD------G.................HNPHAHILLT--
B0T9A7_CAUSK/17-219--------Q--RHALVRAFIA-----ESLVAKGMIADYGIHHPD------AHGDA.............RNHHAHILVT--
R5L7A7_9FIRM/19-253--------Q--TISRMREFIK-----ENFVNKGMAADWAYHEKE------..................GNHHVHCMCT--
TRAA_RHISN/17-243--------Q--NIVLVRDFVE-----RHVTAKGMVADWVYHDAP------..................GNPHVHLMTT--
Q2KC95_RHIEC/17-258--------E--NITLVREFVR-----DNLTARGMVVDWVYHDKD------..................GNPHAHVMTT--
B7KN07_CYAP7/17-212--------Q--KRELVREFVR-----GQIVNNGLVADVAFHDMN------S.................HNPHVHILLT--
D5HHM6_9FIRM/55-279--------Q--QLALVRAYVK-----DNFVDKGMCADFAIHDKG------T.................GNPHVHIMLT--
D6DI62_CLOSC/17-286--------E--QIELLQEFIR-----EQFVSDGMCADAAIHDTD------G.................HNPHAHILLT--
A9HLM3_GLUDA/17-229--------D--RQQLAAEFAK-----MLHQKYGVATDICIHEPS------RTGDD.............RNHHAHLMAT--
D4LM09_9FIRM/19-247--------E--NIQLAREFCQ-----EQFVARGMIVDLAVHEGK------SKDGD...........EPDNPHFHVLAP--
D4JZW7_9FIRM/17-288--------Q--WEKLLSDFIS-----GTFVDDGMCADVAIHDPY------PPG...............HNPHAHIMLT--
Q11MR5_CHESB/17-249--------E--NIALVREFVR-----DHLTSKGMVADWVYHDKD------..................GNPHIHLMTT--
B1X3B9_CYAA5/17-213--------Q--KQELVRNFAQ-----DNFVDKGLVADLAFHEIN------T.................HNPHVHIMIT--
D4JZZ9_9FIRM/19-243--------Q--YLSMIKEFCQ-----EQFVSKGMIADFAIHDKG------D.................GNPHAHILLT--
Q8KIN6_RHIEC/17-249--------E--NITLVREFVR-----DNLTSKGMIADWVYHDKD------..................GNPHIHLMTT--
A4YML6_BRASO/18-217--------Q--GIELARDFAQ-----SEFVGLGMVADLNVHWDR------AEDGL.............PKPHAHVMLT--
I4DCV2_DESAJ/17-214--------Q--QIELIRSFTK-----EKFVDKGMVADITMHHLD------G.................ENPHAHVMLT--
C7JJ99_ACEP3/17-217--------Q--GIALARDFVR-----EQFVERGMVADLNVHWDI------GEDGQ.............AKPHAHVMLS--
F8C170_OLICO/17-243--------Q--NVALMRQFVA-----EHILSKGQVADWVYHDDP------..................GNPHVHLMTS--
B0S201_FINM2/20-247--------D--RIKLISEFIE-----ENFTSKGMIADCNIHNPM------ASDHE.............EQPHAHILLT--
D4JD91_9FIRM/17-307--------E--QIQYTTDYIQ-----KTFVDRGMCADWSIHDKG------D.................GNPHVHLLLT--
G2SZV4_ROSHA/17-288--------E--QIQLLQDFIK-----EQFVADGMCADAAIHDPY------PPG...............HNPHAHILLT--
G2I8U9_GLUMN/17-219--------A--RKELARDFAR-----ELVARYGVVADVAMHEPG------REGDN.............RNHHAHILTT--
B0T9Q2_CAUSK/17-219--------Q--RRDLVRAFVQ-----EHLVAKGMIADVAMHRPG------KEGDQ.............RNFHAHIMVT--
C4YZX3_9RICK/17-223--------E--NTKLVEEFVK-----KNIVACGLVCDVNIHYDN------P.................DNPHVHFQFL--
D6GRF6_FILAD/17-241--------K--QIELVREYVK-----ENFVKVGMCADIALHDKN------D.................GNPHCHILIT--
D4KAU2_9FIRM/17-241--------Q--YAALVRDFCR-----QQFVSKGMCVDFAIHDKG------D.................GNPHAHVMLT--
D4MXT5_9FIRM/18-307--------E--QIDYTTEYIQ-----KTFVDKGMCADWSIHDKG------D.................GNPHVHLLVT--
C0QML1_DESAH/17-230--------Q--CINLCREFAE-----KLNAKHGCAVDICIHAGH------TDKDTGESN.........DNRHAHLLTT--
R6LS79_9FIRM/20-249--------E--NIALAKQFLL-----ENFVSRRMVVDFAVHQPD------KEDGG............ISNPHFHVMCP--
K9SN36_9CYAN/17-213--------Q--KQDLVRQYVL-----EQHASEGKIVDIAYHNFD------G.................NNPHAHILFT--
Q1QF79_NITHX/18-243--------Q--NIALMRAFVT-----QEILPRGQVADWVYHNEP------..................GNPHVHLMTT--
G2ILJ4_9SPHN/17-216--------Q--GIELARDFVG-----QEFVDRGMIADLNVHWDV------GADGL.............AKPHAHVMLT--
E8RPW5_ASTEC/17-230--------Q--RLELVREFSQ-----SVADTYGVAVDFAIHAPD------EAMDE.............RNHHAHILIT--
R7B4C7_9CLOT/17-288--------Q--WQELLTDFIQ-----NNFVAEGMCADVAIHDPH------SPG...............HNPHAHIMLT--
G9WII5_9LACT/17-241--------E--QKTLLTNYVQ-----EDFVDSGMVADVAIHRDH------P.................DNPHAHVMLT--
A5V2N3_SPHWW/17-216--------Q--GVALARDFVK-----AEFVTRGMVADLNVHWDV------GADGE.............AKPHAHVMLT--
MOBA_BIFLO/19-253--------Q--RVQALEGYIR-----ENLNADGYAATYAIHDDG------QG................NNPHAHILVA--
C5B6Q9_METEA/17-230--------Q--RLEATRSFAQ-----SLADRYGTAVDFAIHAPH------GDTDV.............RNHHAHLMMT--
C5B6U1_METEA/17-216--------E--GIALARDFVQ-----ATFVSRGMVADLNLHWDQ------AADGS.............YKPHAHVLLT--
B9K371_AGRVS/17-242--------Q--NIAMMRDFVS-----SEVTARGLVADWVYHDAT------..................GNPHLHLMTS--
G8PF77_PEDCP/12-236--------E--QKELLTKYIQ-----KKFVNDGMVADVAIHRDH------P.................DNPHAHVMLT--
A1VX68_POLNA/17-235--------E--RQELAHEFTK-----ALVRKYGFAADCAIHFPH------KKENQSKRKDAAVENGDSRNHHAHILCS--
Q03N47_LACBA/17-240--------E--QKELLTKYVQ-----DNFVDQGMVADVAIHRDH------P.................DNPHAHVMLT--
C7RI54_ANAPD/18-245--------E--NKKMIEEYVQ-----NNFVKEGMIVDLAIHDES------REGN..............QNIHAHIMTI--
D4KA38_9FIRM/17-241--------Q--HADLIRDYCR-----EFFVSKGMIADFAIHDKG------N.................GNPHAHILLT--
Q7CW18_AGRT5/17-228--------G--RLKAARAFAQ-----DLANRYGAAVDFAIHSPS------EHGDI.............RNHHAHVLMT--

PF05840

VGA_BPG4/115-441-------MRTLPLG--------------------------------------------SLDPNFGKLVRINRQINSLQNT
A0A011RTX4_VIBPH/74-400-------MRTLPTG--------------------------------------------SVDPNFGRRVRNRRQLNSLQNT
VGA_BPPHK/49-381-------VRTLPLG--------------------------------------------SHDPNFGRPVRNYRQINSFRGM
A9ZT18_9CAUD/122-510-------VRK....--------------------------------------------..........EDISAVRDTFIT
VPA_BP186/139-507-------MLP....--------------------------------------------..........EDVERVRLIIRD
VPA_BPP2/133-515-------CNP....--------------------------------------------..........RQRNQIIEIMRR
ENDP2_SALTI/193-568-------MRK....--------------------------------------------..........KDRRSITALLRK
Q8XBG0_ECO57/179-564-------AHP....--------------------------------------------..........EEIDTIVSHTRD
P12_BPPM2/101-478-------MLP....--------------------------------------------..........EHEQVTTKALRG
REP_BPHC1/204-578-------VPA....--------------------------------------------..........EHKEEVIRLFKQ
O80256_9VIRU/150-506-------MLP....--------------------------------------------..........EHESVVTRILGD

PF01076

65KD_ZYMMA/1-192-------...----------------------------------------------------------..MVPRDPDT..
O87277_9STAP/1-193-------...----------------------------------------------------------..VVPMRDG...
P71098_BACTI/20-220-------PVA----------------------------------------------------------SGYKRGLEKQ..
L2IEI5_ENTFC/1-193-------...----------------------------------------------------------..IVPFNDEH..
Q45448_BACIU/1-193-------...----------------------------------------------------------..IVPITEDG..
PRE_STRAG/1-194-------...----------------------------------------------------------..VVPFENG...
PRE1_STAAU/1-198-------...----------------------------------------------------------..FVPLTEDG..
C3DBP7_BACTU/1-192-------...----------------------------------------------------------..VMPITEDN..
Q52058_9ZZZZ/3-190-------...----------------------------------------------------------..FMPLKEKK..
Q09026_OENOE/1-199-------...----------------------------------------------------------VDLVPMTKNG..
Q53618_STAAU/1-198-------...----------------------------------------------------------..VVPITEDG..
Q48524_LACCA/1-194-------...----------------------------------------------------------..IVPFDDEH..
B6FKS6_9CLOT/6-219-------...----------------------------------------------------------.MVLPVVEKEIL
Q52050_BUTFI/1-198-------...----------------------------------------------------------VPLVEREDGS..
PREA_LACPN/1-194-------...----------------------------------------------------------..IVPFDDDK..
P71520_MARHA/20-221-------PVA----------------------------------------------------------TGYKKGMDTQ..
Q53620_STAAU/1-198-------...----------------------------------------------------------..VVPITDDG..

PF03432

Q9WW30_PEDPE/8-248DLET...GRKMHGN..--------------------------..........WQEYREKLVHNTDEISQEHGLEVTQVD.
D2JCN4_STAEP/8-236DLET...GKKFNNN..--------------------------..........K.KALHDIRQANDEICVSHNLSIPEE..
Q56424_BACFG/7-242DND....GKTISDK..--------------------------..........N..DFYRNEKVCKMLTAKYRLHFANG..
VIRD2_RHIRD/16-264ELLGHGWLKISRRH..--------------------------..........PQLNYDGLRKKMAEISLRHGIVLDAT..
A0A015PKP4_BACFG/7-242SLS....GELYRDN..--------------------------..........W..IGKKATEAANAIAKERNFVQSQ...
Q9ZIP2_FUSNU/13-276NIDT...GMKFREL..--------------------------..........NKNEYNQKKENNVELKSHEFYLEDLKKS
A6H977_9ZZZZ/12-252HPTR...NTIHEPY..--------------------------..........R..AYRALADLCATLERDYGLERDN...
A0A031PR62_ECOLX/61-315HPET...GYLNRLS..--------------------------..........W..SQEKLSRACRELELKHGFAPDNGCW
Q9Z361_STAEP/8-242DLET...GKKFNNN..--------------------------..........K.QALRNVRNFNDEVCMEHGLSVPDKD.
LTRB_LACLM/34-307NLYT...GKQFDWKVI--------------------------PKEKTKSGKAYDVTKNNFEKVSDKIASRYGAKIIEK..
Q9XAW2_PSEAC/12-285NPET...YKAVYPD..--------------------------..........R..DYFKLDKTMREMELRQGWSHDKGPY
B3H352_ACTP7/14-247EMTS...GKRLQPY..--------------------------..........YDRADRPLAENFKQVINHEYSLSDPN..
TRAI5_ECOLX/12-252HPTR...HTMHEPY..--------------------------..........Y..PHRALAELCTALERDYGLERDN...
Q54883_STREE/11-264DQNS...DKKFLWD..--------------------------..........Y.KAEHNLRMVSDRLSKIAGAKIIEN..
RLX1_STAAU/8-238NLET...GNKYQSN..--------------------------..........K.EQRDFIKKANDQLCEERGLSVPEK..
A9CQY2_STAAU/8-239DLET...GKKYQSN..--------------------------..........K.KQRDLVKKENDNICREHGLSVTERG.
K7VR95_LACLC/9-280NLET...GKKLREQ..--------------------------..........KGESVQRAREMNDRLASRENWHILEP..

PF02217

LT_POVBO/129-222-------G.KHRVN--------------------------------------------AMENLCSKKCTVSFLQA-----
LT_POVMK/151-247-------T.KHRVS--------------------------------------------AVFNYCATYCSVSFIVV-----
Q80FI2_9POLY/134-228-------N.STRVS--------------------------------------------TLINFCCKHCTVSPYVV-----
Q9DPC0_POVJC/137-230-------Q.RHRVS--------------------------------------------AINNYCQKLCTFSFLIC-----
LT_POVLY/200-298-------G.KHRVS--------------------------------------------AVKHFCVSQCTFSFIHC-----
Q20HY2_9POLY/139-233-------T.GTRIS--------------------------------------------TVLNFCKKHCTVSPLCV-----
Q9J7C9_SV40/136-229-------H.RHRVS--------------------------------------------AINNYAQKLCTFSFLIC-----
Q20HX6_9POLY/120-214-------ERPTRVS--------------------------------------------TVGNFCKKHCTVSLCIV-----
LT_POVHA/261-354-------G.KHRVA--------------------------------------------AVKSYCCKFCTVSFLLC-----
B9A7H1_BFPYV/111-204-------K.PTRIS--------------------------------------------TVHNFCKKYCTISICSV-----
LT_POVMC/285-377-------T.KHRVS--------------------------------------------AVKNYCSKLCSVSFLMC-----

PF08724

A7LIB2_9VIRU/14-197-------QGNVRSF--------------------------------------------VLGRYMSQIKDSIIRDVYEG--
Q9WKM1_PAVHB/3-177-------GPGLNPR--------------------------------------------NL...TVCVEGLFNNVLYHL--
Q8JQG1_9VIRU/4-192-------TTGVKSM--------------------------------------------VLGRFLSQIREKLVQTIYRG--
Q7TG44_9VIRU/4-191-------TCSVKPM--------------------------------------------VLGRYIRHIQQKIVSKVYCA--
Q9J0X5_9VIRU/3-177-------GPFVTPR--------------------------------------------NV...CNIVETGFNKVLREL--
Q9J0X7_9VIRU/3-177-------GPFINAR--------------------------------------------NV...CNAVETTFNKVLGDL--
Q6JL80_9VIRU/4-189-------TSGISSM--------------------------------------------VLGRYVSQIRAQLVKVVFQN--
VU94_HHV6Z/17-203-------LDGIPTA--------------------------------------------TIGKHTTEIRGVLIKDFFDG--
Q88271_9VIRU/3-177-------GPFLTPR--------------------------------------------NV...CSAVEGGFNKVLADF--

PF07232

Y35K_HALSI/1-316GPVV---AEQFEPV-----------------------------------------LDAHLRNCPTAGEDAHQ.VFDENGD
Y36K_HALSN/1-328GPVV---AEQFQDV-----------------------------------------LDAHVKNSEGAGREAHRAVVEDDED

PF01446

G8PF48_PEDCP/80-316-------VRSS-YFKS-------------------------------------------SDSYINQEEWTRLWQKALKVD

PF00799

REP_TPCTV/8-120-------FEGK-FNCK-------------------------------------------NQRF-----------------
REPA_MSVS/10-117-------TEKP-VRIS-------------------------------------------DSRF-----------------
REP_BGYMJ/7-119-------FEGK-FICT-------------------------------------------NKRL-----------------
REP_BCTVC/7-119-------LEGK-VQIT-------------------------------------------NIRL-----------------
U9TRZ4_RHIID/23-135-------LDKK-IDLR-------------------------------------------DGRF-----------------
REPE_ONYPE/14-143-------LNKQ-FRTR-------------------------------------------DLTI-----------------

PF02407

MREP_SCSVF/5-83-------MKKR.TSLV-------------------------------------------QMKK-----------------
REP6_SCSVF/6-86-------FKSRNTTLR-------------------------------------------QAKY-----------------
REP2_SCSVF/2-88-------FKNK.IRLG-------------------------------------------GLKK-----------------
MREP_BBTVA/6-83-------MKRR.SSLK-------------------------------------------QMRG-----------------

PF03389

C4YZP3_9RICK/17-222-------ERRLERLKNEEVVFAK.................................RKDGEL..................
TRAA_AGRT5/17-243-------LRPLT.EDG...FGAK.KVAVI...........................GEDGQLVR.....TKSGKIL....
D4LKI8_9FIRM/17-286-------VRPLN.ENG...TWQY.KTEKEYLC........................IKDGEEKGFTASEFKDAQKEGWEK
B0T9A7_CAUSK/17-219-------TRRVG.PEG...F.......................................GLK..................
R5L7A7_9FIRM/19-253-------MRAFN.KDG...SWSN.MRKTEFAR........................DDNGNKIPLLDENGKQKVRIRKGK
TRAA_RHISN/17-243-------LRPLT.ADG...FGAK.KLAVV...........................GPDGNSLR.....NDAGKIV....
Q2KC95_RHIEC/17-258-------LRPLA.EEG...FGRK.RVTIM...........................GEDGKPLRVVTPDSPNGRIV....
B7KN07_CYAP7/17-212-------TREIT.PLG...L.......................................GSK..................
D5HHM6_9FIRM/55-279-------LRPLK.ENG...QWGA.KCRKAYDL........................DENGQRIPDGKGGWKNHRED....
D6DI62_CLOSC/17-286-------VRPLD.EQG...KWQY.KTEKEYLC........................MKNGEERGFTAAEFRAAQNEGWEK
A9HLM3_GLUDA/17-229-------TRIVTIENGKPVF.......................................GAKA.................
D4LM09_9FIRM/19-247-------IRPFT.EEG...IWGN.KQKREYVL........................DEEGNRIKDAKGKYVFNAVS....
D4JZW7_9FIRM/17-288-------VRPLD.EKG...NWKY.KTQKEYLC........................VKNGEEQGFTADEFKTAQTEGWEK
Q11MR5_CHESB/17-249-------LRPLT.DDG...FGNK.KVAVL...........................GDDGKPLRVVTPDRPKGKIV....
B1X3B9_CYAA5/17-213-------TRIVD.ENG...L.......................................GAK..................
D4JZZ9_9FIRM/19-243-------LRAMD.EHG...KWLP.KARKVYDL........................DENGERIRLPSGNWKCHKEN....
Q8KIN6_RHIEC/17-249-------LRPLT.EEG...FGAK.KVPVL...........................GEGGKPLRVVTPDRPNGKIV....
A4YML6_BRASO/18-217-------MRAVD.ENG...F.......................................GQK..................
I4DCV2_DESAJ/17-214-------TREIG.PEG...F.......................................GKK..................
C7JJ99_ACEP3/17-217-------TRSVD.ENG...F.......................................GAK..................
F8C170_OLICO/17-243-------LRPLT.EDG...FGPK.RVHVV...........................GEDGATLR.....GRTGKIV....
B0S201_FINM2/20-247-------LREID.EKG...NWKP.KCRKEYIL........................DENGEKIKLKSGNYKSRKVN....
D4JD91_9FIRM/17-307-------MRPFN.PDH...SWGK.KEVKDWDFVRDKNGNIVIDESHPNWWQDKKNPDRHGIRIPVLDENGIQKIGARNRL
G2SZV4_ROSHA/17-288-------VRPLD.EKG...KWQY.KTEKEYLC........................VKDGEEQGFTAAEFKQAQADGWEK
G2I8U9_GLUMN/17-219-------TRTVG.ENG...L.......................................GAK..................
B0T9Q2_CAUSK/17-219-------TRRVD.RAG...F.......................................GGK..................
C4YZX3_9RICK/17-223-------ERILERLDDGVVVFAK.................................RKDGEL..................
D6GRF6_FILAD/17-241-------MRPLN.EDK...TWGA.KSKKEYIL........................DENGEKIKLKNGNYKTRKIN....
D4KAU2_9FIRM/17-241-------MRAMD.ERG...KWLP.KSRKVYEL........................DKNGERIKLPSGRWKSHKED....
D4MXT5_9FIRM/18-307-------MRPFN.PNH...SWGN.KEVKDWDFVRDTDGNIVVDESHPDWWQDKKNPDRHGIRIPVLDENGVQKVGARNRK
C0QML1_DESAH/17-230-------TRPMI.QAG........................................TALGPDKC................
R6LS79_9FIRM/20-249-------IRPIE.PGG...KWGN.KQQREYLL........................DEHGDRIRDEAGNYVFNAVP....
K9SN36_9CYAN/17-213-------VRPID.ENG...F.......................................GKK..................
Q1QF79_NITHX/18-243-------LRPLI.ESG...FGGK.KVAVT...........................GEDGKPLR.....TQAGKIR....
G2ILJ4_9SPHN/17-216-------MREVS.PDG...F.......................................GQK..................
E8RPW5_ASTEC/17-230-------TREVT.ANG...L.......................................GEKS.................
R7B4C7_9CLOT/17-288-------VRPLD.EQG...NWQY.KTEKEYLC........................VRNGEERGFTAAEFKAAQADGWEK
G9WII5_9LACT/17-241-------NRPFN.PDG...TWGI.KSKKQYIL........................DKNGNKTYTGTSKYPKSRKML...
A5V2N3_SPHWW/17-216-------MREVG.PDG...F.......................................GAK..................
MOBA_BIFLO/19-253-------NRQIDPKTG...GWAKLKQRMEYVL........................DERGERVPLIDPKTGAQKLDKRG.
C5B6Q9_METEA/17-230-------VRRVG.VDG...L.......................................GEKT.................
C5B6U1_METEA/17-216-------LRAVG.PEG...F.......................................GAK..................
B9K371_AGRVS/17-242-------LRPLT.NDG...FGGK.KVAIL...........................DANGQPQR.....SKSGQIQ....
G8PF77_PEDCP/12-236-------NRPFN.PDE...TWGL.KSKRENIL........................DENGNKTYTGNSRFPKSRKVW...
A1VX68_POLNA/17-235-------TRKLT.AEG...F.......................................TVK..................
Q03N47_LACBA/17-240-------NRPFN.PDG...TWGL.KAKTQYIK........................DENGKQLLT.KSGFPKQRKIW...
C7RI54_ANAPD/18-245-------VRPIN.EDG...TWGQ.KSKKEYIL........................DEKGEKVLNKNGKPKTRKVE....
D4KA38_9FIRM/17-241-------MRAMD.ENG...KWLP.KSRKVYDL........................DENGERIRLPSGSWKSHKED....
Q7CW18_AGRT5/17-228-------TRQVG.KAG...L.......................................GEKT.................

PF05840

VGA_BPG4/115-441WPYGYSMPIAVRYSQDAFSRAGWL................WPVDSKGEPLKATSYMAVGFYVAK----YVNKK-------
A0A011RTX4_VIBPH/74-400WPYGYSMPIAVRYTQDAFSRSGWL................WPVDAKGEPLKATSYMAVGFYVAK----YVNKK-------
VGA_BPPHK/49-381WPYGFTQPIAVRYQHDAYSRKGWL................WPVDKSGKAMQSKPYQAVAWYVTK----YVAKQ-------
A9ZT18_9CAUD/122-510Y........ATEEDRGELHPEFEKEKQKPFRKGVYVGPLDYRPRCDFGYIDPTKGTATG.YIAK----YISKN-------
VPA_BP186/139-507Y........AWEEDHYELRSDKAK.................KARFHAEAIDPEKGSATG.YVAK----YISKN-------
VPA_BPP2/133-515Y........ALKEDGDE...RGAA.................RNRFQAKHLN..QGGAAG.YIAK----YISKN-------
ENDP2_SALTI/193-568F........AIREDREELGANT...................GPRFKPELINPRKGTPTS.YIAK----YISKN-------
Q8XBG0_ECO57/179-564I........AIQEDRHELGDDI...................TPRFKAEYVDGSKGTPTX.YIAT----YIGKN-------
P12_BPPM2/101-478Y........AMQIDGDE...KGAE.................QARFTAENIDPSKGSAVG.YIAK----YISKN-------
REP_BPHC1/204-578K........ALELDGNE...KGAA.................EHRCKVEKCDKTKGSATA.YIAK----YIAKN-------
O80256_9VIRU/150-506C........ALSDSPNE...SGAK.................KYRFKAEKIDFKKGSAVG.YVAK----YLSKN-------

PF01076

65KD_ZYMMA/1-192.----------------------------------------.GRLNASRWFDGRKALSA--LQT....GYAAS-------
O87277_9STAP/1-193.----------------------------------------..KLQGKNVFN.RQELLW--LQD....KFPEH-------
P71098_BACTI/20-220.----------------------------------------..VSFDRAITQQDATLDK--TRPFDDWREKEV-------
L2IEI5_ENTFC/1-193.----------------------------------------..KLSAKTVFN.RQALQA--VQD....ELPKY-------
Q45448_BACIU/1-193.----------------------------------------..RLSAKDFFNGKLKMKA--IQD....DFHRH-------
PRE_STRAG/1-194.----------------------------------------..KLSSKAMFD.REELKH--IQE....DLPRY-------
PRE1_STAAU/1-198.----------------------------------------..RLSAKEQLGNKKDFTQ--LQD....RFNEY-------
C3DBP7_BACTU/1-192.----------------------------------------..RLSAKDMFT.RKELIS--LQQ....DFPLE-------
Q52058_9ZZZZ/3-190.----------------------------------------..LNANYYIGGSKHKMIE--LQD....DFYKN-------
Q09026_OENOE/1-199.----------------------------------------..KLSSDALWD.RKELFD--FHT....YMAKG-------
Q53618_STAAU/1-198.----------------------------------------..RLSAKEVLGNKKALTE--FQD....RFNEH-------
Q48524_LACCA/1-194.----------------------------------------..KLSAKRVFN.RTALRD--VQD....QLPAY-------
B6FKS6_9CLOT/6-219W----------------------------------------SKRCKDEKLRGTVKEVVH--QIS....HSKKW-------
Q52050_BUTFI/1-198.----------------------------------------.FKLCAKELMGNIKQYHQ--RQN....EFHEE-------
PREA_LACPN/1-194.----------------------------------------..KLSAKRIFN.REALQH--IQE....ELPQY-------
P71520_MARHA/20-221.----------------------------------------..VSFDRAIKQQDATLNQ--THPFEDWREREI-------
Q53620_STAAU/1-198.----------------------------------------..RLSAKEVVGNKKALTA--FQD....RFNEH-------

PF03432

Q9WW30_PEDPE/8-248....PNRYEKRTMAEIKMQA......................KGQPTWKDQIRQAVDKTMANR.----LVTDF-------
D2JCN4_STAEP/8-236.....KAKLRYTQAEYSVLN..................K....GKTSWKDEIRHAIDQSQ....----.AASY-------
Q56424_BACFG/7-242.........KDNIKEERLRP........................YDKAKHEVYKALKGELP...----HARSW-------
VIRD2_RHIRD/16-264...........SRAERGIAER.......................PITYAEHRRLERMQAQK...----..IQF-------
A0A015PKP4_BACFG/7-242..............DIGKVN........................KAEIKEAMDGVLKKMQG...----..FDF-------
Q9ZIP2_FUSNU/13-276SDEICLANNLSVIPQKEKAESQNIYN.........RREYNVVMNKTSYKMELAKDIKRASKN..----.CKSK-------
A6H977_9ZZZZ/12-252....HETRQRVSENRANDMER...................HAGVESLVGWIKRECLPELQA...----.AQSW-------
A0A031PR62_ECOLX/61-315...VHAPGNRIVRKTAVERDRQ..............NAWTRGKKQTFREYIAQTAVAGLRSE..----PVHDW-------
Q9Z361_STAEP/8-242.....TARLRYTQTEKAIAD.................PNTKSTAQYSWKDEIREAIDQSQ....----.ATNM-------
LTRB_LACLM/34-307.....SPGN..SHLKYTKWQ.......................TQSIYKSQIKQRLDYLLE...----MSSDI-------
Q9XAW2_PSEAC/12-285...AVHERNGQKVVDWAKDEPSHRQPDREKLPGKARQMEVMTGNESLTTYAQGQPKKDALEALN----KGGGW-------
B3H352_ACTP7/14-247.....NPIKQKNLIDRKDLP.....................TDKKQALQAITDGLTALANAG..----QINDR-------
TRAI5_ECOLX/12-252....HEPRKRGAEGRAADMER...................HAGVESLVGWIKRECLDEIKG...----.AQSW-------
Q54883_STREE/11-264.........RYSHRQYEVYR........................KTNYKYEIKQRVYFLIE...----NSKNF-------
RLX1_STAAU/8-238.....SSEIRYTLAEQNMI......................DKDKRSWKNDIRMAVEETKD...----NAVAF-------
A9CQY2_STAAU/8-239.....IAKMRYTQAEKGIVF.....................DRDEYSWKDELRDLIENAKT...----HTSNL-------
K7VR95_LACLC/9-280......PKERQTETEKELIA......................KNEYSYMDDLRERINKSLQDV.----SVSSY-------

PF02217

LT_POVBO/129-222--------------------------------------------------------------------------------
LT_POVMK/151-247--------------------------------------------------------------------------------
Q80FI2_9POLY/134-228--------------------------------------------------------------------------------
Q9DPC0_POVJC/137-230--------------------------------------------------------------------------------
LT_POVLY/200-298--------------------------------------------------------------------------------
Q20HY2_9POLY/139-233--------------------------------------------------------------------------------
Q9J7C9_SV40/136-229--------------------------------------------------------------------------------
Q20HX6_9POLY/120-214--------------------------------------------------------------------------------
LT_POVHA/261-354--------------------------------------------------------------------------------
B9A7H1_BFPYV/111-204--------------------------------------------------------------------------------
LT_POVMC/285-377--------------------------------------------------------------------------------

PF08724

A7LIB2_9VIRU/14-197-------------------------------------------KQIKIPDWFAITKTKR..GGQ----NKTVT-------
Q9WKM1_PAVHB/3-177-------------------------------------------VTENVKLKFLPGMTTK...GK----YFRDG-------
Q8JQG1_9VIRU/4-192-------------------------------------------VEPTLPNWFAVTKTRNGAGGG----NKVVD-------
Q7TG44_9VIRU/4-191-------------------------------------------TSLRWKDGCVVTKTKN.FGGA----NKVRA-------
Q9J0X5_9VIRU/3-177-------------------------------------------TEPTYEVSFKPAISKK...GK----YARDG-------
Q9J0X7_9VIRU/3-177-------------------------------------------TDPSMSVQFKPAVSKK...GE----YYRDG-------
Q6JL80_9VIRU/4-189-------------------------------------------IEPRINDWVAITKVKK..GGA----NKVVD-------
VU94_HHV6Z/17-203-------------------------------------------NAPKIDDWCTYAKTKK.NGGG----TQVFS-------
Q88271_9VIRU/3-177-------------------------------------------TSPTITVQFKPAVSKK...GK----YHRDG-------

PF07232

Y35K_HALSI/1-316EDAVRVRRSSHPSRSGGVEN-------------LGAYLAAYMAGEYGSEPSEMPENVRAFYATM----WASGR-------
Y36K_HALSN/1-328EAAVSIRRSARPDREDGIEN-------------LGAYLAAYMAGEYGVEALAMPAHVRAFYAAM----WATGT-------

PF01446

G8PF48_PEDCP/80-316YEPVVHVQVVKANKRKGTDSLQASAEE--------------TAKYEVKSADYMTVDDERNLVVI----KNLEYALAGTRQ

PF00799

REP_TPCTV/8-120--------------------------------------------FDLVSPTRST..........----...HFH------
REPA_MSVS/10-117--------------------------------------------FDING...............----....FH------
REP_BGYMJ/7-119--------------------------------------------FDLVSTTRSA..........----...HFH------
REP_BCTVC/7-119--------------------------------------------FDLVSPTRSA..........----...HFH------
U9TRZ4_RHIID/23-135--------------------------------------------FDIVDGDGET..........----...VYH------
REPE_ONYPE/14-143--------------------------------------------FNIPKNIKEKKLIDHENIKI----KDFFYS------

PF02407

MREP_SCSVF/5-83-----------------------------------------------------------------------LL-------
REP6_SCSVF/6-86-----------------------------------------------------------------------IF-------
REP2_SCSVF/2-88-----------------------------------------------------------------------KF-------
MREP_BBTVA/6-83-----------------------------------------------------------------------FF-------

PF03389

C4YZP3_9RICK/17-222............................................SRRK............FLAN----LRHQC-------
TRAA_AGRT5/17-243.........................................YELWAGSTD..........DFNV----VRDGW-------
D4LKI8_9FIRM/17-286QYRYKAGKKKVYLTPSAAQEKGYERIDKHPKSTRYGRQNPISEQWNSE....E.......QLCL----WRANW-------
B0T9A7_CAUSK/17-219.........................................AREWDNP....D.......AVKA----LRLEW-------
R5L7A7_9FIRM/19-253GEEKLWKRIDVI.............................QNQWNSK....E.......QLKE----WRKNW-------
TRAA_RHISN/17-243.........................................YELWAGSLD..........DFNA----FRDGW-------
Q2KC95_RHIEC/17-258.........................................NRVWAGDRE..........TMKA----WKIAW-------
B7KN07_CYAP7/17-212.........................................VRDLDKK....D.......FLLQ----IRESW-------
D5HHM6_9FIRM/55-279.........................................TTDWNDK....G.......NVEI----WRAAW-------
D6DI62_CLOSC/17-286QYPYKVGKKKVYMTPSAAEAQELIRADKHPKSTRYGRQNPISERWNSE....D.......QLAA----WREAW-------
A9HLM3_GLUDA/17-229.........................................TFELENRERQRRGLPSTMQEMKG----IRREW-------
D4LM09_9FIRM/19-247.........................................TTGWNDP....E.......LLKE----WRKAW-------
D4JZW7_9FIRM/17-288QYQYKVGKKKVYMTASAAEEKGYERVSKYPKSTKYGRQNPIAERWNSE....E.......QLVL----WRAAW-------
Q11MR5_CHESB/17-249.........................................YRLWAGDKD..........TMKA----WKIGW-------
B1X3B9_CYAA5/17-213.........................................DRSLDKK....D.......FLLK----LRESW-------
D4JZZ9_9FIRM/19-243.........................................TVDWNDQ....K.......YAEV----WRHSW-------
Q8KIN6_RHIEC/17-249.........................................YKVWAGDKE..........TMKA----WKIAW-------
A4YML6_BRASO/18-217.........................................VRDWNRT....E.......LVER----WRKRW-------
I4DCV2_DESAJ/17-214.........................................NREWNDR....E.......LLKD----WRKEW-------
C7JJ99_ACEP3/17-217.........................................ERSWNDK....E.......LLLT----WRERW-------
F8C170_OLICO/17-243.........................................YKLWAGDKN..........DFLS----VRQGW-------
B0S201_FINM2/20-247.........................................LNDWNEP....D.......KAKE----WRENF-------
D4JD91_9FIRM/17-307QWKRVLTD.................................ATGWNNP....K.......NCEL----WRSEW-------
G2SZV4_ROSHA/17-288QYQYKVGKKKVYMAPSAAQAQGYERVSKYPKSTKYGRQNPITEHWNSD....E.......QLVL----WRAAW-------
G2I8U9_GLUMN/17-219.........................................TRVLDVASTAST.......EIEH----MRGVW-------
B0T9Q2_CAUSK/17-219.........................................NRDWNHA....S.......FIPQ----LRAAW-------
C4YZX3_9RICK/17-223............................................WKRG............FLCN----LMEQC-------
D6GRF6_FILAD/17-241.........................................TTDWNEQ....D.......KAEE----WRKAW-------
D4KAU2_9FIRM/17-241.........................................TVDWNDR....K.......YGEI----WRHEW-------
D4MXT5_9FIRM/18-307QWKRVLTD.................................ATGWNNP....K.......NCEL----WRSEW-------
C0QML1_DESAH/17-230.........................................EREWSDKNRKEAGLCYRNVELKQ----EREEW-------
R6LS79_9FIRM/20-249.........................................TTDWGSP....E.......TLEH----WRQAW-------
K9SN36_9CYAN/17-213.........................................VKAWDQK....Q.......TLKL----HHKAW-------
Q1QF79_NITHX/18-243.........................................YALWAGDTP..........DFLA----QRARW-------
G2ILJ4_9SPHN/17-216.........................................ERDWNRT....E.......LVEQ----WRERW-------
E8RPW5_ASTEC/17-230.........................................DLERENKWLKAHDKPTTDAQLKA----LRLEW-------
R7B4C7_9CLOT/17-288QYPYKVGRKKVYMPSSEADKHGYERANKHPKSTKFGRQNPIAERWNSE....E.......QLIE----WRKAW-------
G9WII5_9LACT/17-241.........................................LIDWDKK....E.......KIDE----WRHNW-------
A5V2N3_SPHWW/17-216.........................................VRDWNAT....A.......LLQH----WREAW-------
MOBA_BIFLO/19-253.........................................RRQWKRTSVSLNPLDRKA.KLQS----LRESW-------
C5B6Q9_METEA/17-230.........................................AIERENKWLLSHDQPTAPMQLRD----IRQSW-------
C5B6U1_METEA/17-216.........................................ERSWNAR....E.......ELVG----WRERW-------
B9K371_AGRVS/17-242.........................................YKLWAGDKT..........DFLD----LRDAW-------
G8PF77_PEDCP/12-236.........................................LVDWDKK....E.......KINQ----WRHNW-------
A1VX68_POLNA/17-235.........................................TRELDDRKTGAD.......QVVE----CRALF-------
Q03N47_LACBA/17-240.........................................LVDWDKK....E.......KINE----WRHNW-------
C7RI54_ANAPD/18-245.........................................LTTWNDK....G.......NVEK----WRENF-------
D4KA38_9FIRM/17-241.........................................TVDWNDQ....K.......YGEI----WRQGW-------
Q7CW18_AGRT5/17-228.........................................CLEHKNARLLANGMATTDMQLRD----IRQSW-------

PF05840

VGA_BPG4/115-441----------------SDID............MAVKGLGNK--EWNNSLKTKINLIPKKVFRIRMSRNFGM.......KL
A0A011RTX4_VIBPH/74-400----------------SDMD............LAAKGLGAK--EWNNSLKTKLSLLPKKLFRIRMSRNFGM.......KM
VGA_BPPHK/49-381----------------SDQR............QKAITERQK--KCKNPLMA...ICLKKEFRVRSSRKLGM.......EL
A9ZT18_9CAUD/122-510----------------IDGYAMDG........DISDET.GK--PVKDMARN..VSAWKSRWSIRQFQFFGGAPVTTYREL
VPA_BP186/139-507----------------IDGYALDG........ETDDES.GE--LLKETAPA..VSAWAARWHIRQFQFIGGAPVTVYREL
VPA_BPP2/133-515----------------IDGYALDG........QLDNDT.GR--PLKDTAAA..VTAWASTWRIPQFKTVGLPTMGAYREL
ENDP2_SALTI/193-568----------------IDGRGLAK........EISKET.GR--SLRDSAEH..VSAWASLHRVQQFRFFGIPGRQAYREL
Q8XBG0_ECO57/179-564----------------LDSRAVDGIDPKTGKPRVDHET.GK--SMTESVER..AIGWARLHRVRQFQFFGIPSRQVWREL
P12_BPPM2/101-478----------------INANHIEG........EKDNETGGE--FNNENGLVLNVGAWASRWRIRQFQFVGGASVGVWREI
REP_BPHC1/204-578----------------IDGFALAG........EVSDEDPTL--SLHDNALR..VRAWASRWGIRQFQFYGGASICVWREL
O80256_9VIRU/150-506----------------IDGQHI..........DFDRNS.NK--SGTEAAQS..VVSFNRLNGVRQFQFYGGCSVSVWREM

PF01076

65KD_ZYMMA/1-192----------------MEPLG.----------.LARGVKG.--..SKATHQ----------RVQRHYG------------
O87277_9STAP/1-193----------------MKKQGF----------ELKRGERG.--..SDRKHI----------ETAKFKK------------
P71098_BACTI/20-220----------------QLLEKA----------LKERGI...--...ERKLV----------GTNEYKD------------
L2IEI5_ENTFC/1-193----------------LNERGF----------ELERGEKG.--..SERKNL----------TVPEYKK------------
Q45448_BACIU/1-193----------------MVENGF----------DLVRGEP..--..SEKKHE----------NVHQYKI------------
PRE_STRAG/1-194----------------MSDHGF----------ELERGKLN.--..SEAKHK----------TVAEFKR------------
PRE1_STAAU/1-198----------------VNEKGY----------ELERGTSKE--.VTEREHK----------AMDQYKK------------
C3DBP7_BACTU/1-192----------------MREKGF----------DVDRGEG..--..SEKKHL----------SPQAFKE------------
Q52058_9ZZZZ/3-190----------------VGQK.F----------KMDRGRPAA--.ITKAKHL----------NSRDYLA------------
Q09026_OENOE/1-199----------------LQANGF----------QLERGEEY.--..SRTKHL----------DPNVYKA------------
Q53618_STAAU/1-198----------------INSCGY----------DLSRGITRG--.VTPRRHE----------QISRYKN------------
Q48524_LACCA/1-194----------------LPQHGL----------NIQRGVQE.--..SGRKSL----------AVPGYKA------------
B6FKS6_9CLOT/6-219----------------KSDIPL----------TDEKGNP..--..LLRKNG----------KPMFRAS------------
Q52050_BUTFI/1-198----------------VGLK.Y----------GLERGQVQD--REERREHL----------DTLEFKT------------
PREA_LACPN/1-194----------------LKENGF----------DVQRGNKN.--..KERKNL----------SVPEYKA------------
P71520_MARHA/20-221----------------GFLEEK----------INARGI...--...DRELV----------GTNDYED------------
Q53620_STAAU/1-198----------------VKQRGY----------DLERGQSRQ--.VTNAKHE----------QISQYKQ------------

PF03432

Q9WW30_PEDPE/8-248----------------QTFRDD----------LKQKT-VDV--W...ERGKDLTYQLTGTN..YKARGNKLGTA..YEKG
D2JCN4_STAEP/8-236----------------EELGND----------LQQNG-IKI--E..RITDKTITYRHLEED..KKVRGKKLGED..YDKG
Q56424_BACFG/7-242----------------NELKEA----------LSERD-IEL--KFKVSRTTKEVQGVKFEYGGISFSGSKVSRE..FSYM
VIRD2_RHIRD/16-264----------------EDTDFD----------ETSPE-EDR--R...DLSQSFDPFRSDPS..TGEPDRATRHD..KQPL
A0A015PKP4_BACFG/7-242----------------TKFKEE----------LGKRG-FKV--REARASTGKLNGYYVTARSGTEYKASEIGKG..YTLA
Q9ZIP2_FUSNU/13-276----------------EDFIKA----------LDEKG-VIV--D.WEDHKKHITFKFKDEKK.KSIRLANLEKT..FQDE
A6H977_9ZZZZ/12-252----------------EDLHRV----------LRENG-LKL--R..ERGNGFIFEAGDG....TTVKASTVSRD..LSKP
A0A031PR62_ECOLX/61-315----------------LSLHRR----------LAEDG-LYL--S..QMDGKFLVMDGWDRNR.EGVQLDSFGPS..WCAE
Q9Z361_STAEP/8-242----------------NEFKDH----------LNQHG-IEI--E..RVTPKSITYRHLVED..KKVRGRKLGED..YNKG
LTRB_LACLM/34-307----------------EDFKRK----------ATALN-LSF--D...FSGKWTTYRLLDEPQMKNTRGRNLDKN..RPEK
Q9XAW2_PSEAC/12-285----------------HELHEA----------LGRHG-LEI--R..QKGQGFAIHSKTDPEQ.TPIKASTMAQE..LGGG
B3H352_ACTP7/14-247----------------QDVINA----------LERAG-FEI--A..RITPKNLSIKTDGQN..LRLKGAFYEQD.FRFST
TRAI5_ECOLX/12-252----------------QELHQV----------MRDNG-MEL--R..VRANGLVFEAGDG....TMVKASTVARD..LSKP
Q54883_STREE/11-264----------------EDLKKK----------AKALH-LKI--D...FRHKHVTYFMTDSNMKQVVRDSKLSRKQPYNET
RLX1_STAAU/8-238----------------EEFNTL----------LKEKG-VEI--T..RVTKNNVTYRHIEED..KKVRGNKLGDS..YDKG
A9CQY2_STAAU/8-239----------------ETFSEH----------LEEKG-VGV--...KLRGETISYKPENEN..KWVRGRTLGSE..YEKG
K7VR95_LACLC/9-280----------------ETFKER----------LSDNG-VIL--SERGQTFSYAFLDANNKQ..RRARETRLGSD..FGRE

PF02217

LT_POVBO/129-222-----------------------------------KG-VLK--P------------------------------------
LT_POVMK/151-247-----------------------------------KG-VIK--E------------------------------------
Q80FI2_9POLY/134-228-----------------------------------RG-VKK--H------------------------------------
Q9DPC0_POVJC/137-230-----------------------------------KG-VNK--E------------------------------------
LT_POVLY/200-298-----------------------------------KA-VVK--P------------------------------------
Q20HY2_9POLY/139-233-----------------------------------RG-LKK--H------------------------------------
Q9J7C9_SV40/136-229-----------------------------------KG-VNK--E------------------------------------
Q20HX6_9POLY/120-214-----------------------------------RG-IKK--N------------------------------------
LT_POVHA/261-354-----------------------------------KA-VTK--P------------------------------------
B9A7H1_BFPYV/111-204-----------------------------------RG-IKK--N------------------------------------
LT_POVMC/285-377-----------------------------------KA-VTK--P------------------------------------

PF08724

A7LIB2_9VIRU/14-197----------------AAYILH----------YLIPK-KQP--ELQWAFTNMPLFTAAALC--LQKRQELLDAF------
Q9WKM1_PAVHB/3-177----------------EQFIEN----------YLMKK-IPL--NVVWCVTNIDGYIDTCIS--ATFRKGACHAK------
Q8JQG1_9VIRU/4-192----------------ECYIPN----------YLLPK-TQP--ELQWAWTNMEEYISACLN--LAERKRLVAQH------
Q7TG44_9VIRU/4-191----------------ESYIPA----------YLIPK-QQP--EVQWAWTNVPEYIKACLH--RELRASLARLH------
Q9J0X5_9VIRU/3-177----------------FDFVTN----------YLMPK-LYP--NVVYSVTNFSEYEYVCNS--LAYRRNMHKKA------
Q9J0X7_9VIRU/3-177----------------FDFVTN----------YLMPK-LYP--NVIYSVTNLEEYQYVCNS--LCYRKNMHKQH------
Q6JL80_9VIRU/4-189----------------SGYIPA----------YLLPK-VQP--ELQWAWTNLEEYKLAALN--LEERKRLVAQF------
VU94_HHV6Z/17-203----------------LSYIPF----------ALLQI-IRP--QFQWAWTNINELGDVCDE--I.HRKHIISHF------
Q88271_9VIRU/3-177----------------FDFVTY----------YLMPK-LYP--NVIYSVTNLEEYQYVCNS--LCYRRTMHKRQ------

PF07232

Y35K_HALSI/1-316----------------QWFRPS----------NGAQELMQP--EEDDEGDSIEEWEMVGIAPEGDLGD.IIEVDPSEPRS
Y36K_HALSN/1-328----------------QWFRPS----------NGAQRHMQP--ES.DDEESVEEWEMVGIAPEGDLEDEIIEVDPEQPRD

PF01446

G8PF48_PEDCP/80-316ISYGGLFKQIKQDLKLEDVENG----------DLIHVGDED----YTKEQMEAAEEVVAKWDFKKQNYFI----------

PF00799

REP_TPCTV/8-120----------------PNIQ..----------...GAKSSS----DVNSYVDKDGDTI.EWGEFQID-------------
REPA_MSVS/10-117----------------PNIQ..----------...SAKSVN----RVRDYILKEPLAVFERGTFIPR-------------
REP_BGYMJ/7-119----------------PNIQ..----------...GAKSSS----DVKEYIDKDGVTI.EWGQFQVD-------------
REP_BCTVC/7-119----------------PNIQ..----------...GAKSSS----DVKSYVDKDGDTI.EWGEFQID-------------
U9TRZ4_RHIID/23-135----------------PSVE..----------...ECKNFN----AARDYIRKE.....YKENLDAG-------------
REPE_ONYPE/14-143----------------PHIEPR----------PGNPIKDTT----DVRNYVKKDGDFI.EEGTFK.H-------------

PF02407

MREP_SCSVF/5-83----------------PG..AH----------LEKRRGSQG----EARAYAMKE--------------------------
REP6_SCSVF/6-86----------------NGLNPH----------LEIAR.DVE----KAQLYAMKE--------------------------
REP2_SCSVF/2-88----------------GN.RAH----------WEIARGSDS----QNRDYCCKE--------------------------
MREP_BBTVA/6-83----------------PG..AH----------LEKRKGSQE----EARSYCMKE--------------------------

PF03389

C4YZP3_9RICK/17-222----------------EVEINK----------VYEEAGLPF..KVTAKSYKALGIDQE.PTKHRGAT.......------
TRAA_AGRT5/17-243----------------FERLNH----------HLTLGGIDL..KIDGRSYEKQGIDLE.PTIHLGVGAKAISRK------
D4LKI8_9FIRM/17-286----------------ADAVNK----------MLALNQINA..AIDHRSFAAQGITEQ.PTIHEGYIAQNMEKK------
B0T9A7_CAUSK/17-219----------------AQIQNL----------HLRQHLGPEAPQVTHLSLADQGQGRE.PTIHLGPSASGMERR------
R5L7A7_9FIRM/19-253----------------ADYCNK----------FLIE...EQ..KIDHRSFEEQGLDIE.PTIHEGYAARQMEQK------
TRAA_RHISN/17-243----------------FACQNR----------HLALAGLDI..RIDGRSFEKQGIELT.PTIHLGVGTKAIERK------
Q2KC95_RHIEC/17-258----------------AETANR----------HLALAGHEI..RLDGRSYAEQNLGGI.AQRHLGSVKA.....------
B7KN07_CYAP7/17-212----------------ANYTNE----------ALSNAGNTE..RIDHRTLSEQGINRI.PQIHLGPDVAAMMD.------
D5HHM6_9FIRM/55-279----------------AAYTNR----------VLESAGRPE..RIDHRSYKRQGIDKI.PSVHLGPAASQMEKR------
D6DI62_CLOSC/17-286----------------ADVSNR----------CLERAGREE..HIDHRSNAARGIDEI.PTIHEGVTAQALERK------
A9HLM3_GLUDA/17-229----------------ADMVNH----------ALELAGSTE..RIDHRSHADRGLDEA.PSRHLGPAATAIERK------
D4LM09_9FIRM/19-247----------------TEKVND----------KFRECHMAA..RIDHRSYKEQGIDLI.PTIHEGYEVRAMEKK------
D4JZW7_9FIRM/17-288----------------ADVTNR----------HLERAGHKE..RIDHRSHADRGLSEQ.PTIHEGVVARALEKK------
Q11MR5_CHESB/17-249----------------AETANK----------HLALAGHDI..RLDGRSYAEQGLDGI.AQSHLGPAKAALARK------
B1X3B9_CYAA5/17-213----------------ATYTND----------ALESIGSSE..KIDHRSLKEQNISRI.PQIHLGANVAAMMKR------
D4JZZ9_9FIRM/19-243----------------ETITNR----------YLEAAGRPE..RVDLRSFERQGLQQI.PTVHLGPAAHQMEKR------
Q8KIN6_RHIEC/17-249----------------AETANR----------HLALAGHDI..RLDGRSYAEQGLDGI.AQKHLGPEKAALARK------
A4YML6_BRASO/18-217----------------AELANE----------RLAELDIDA..RIDHRSLEAQGIALE.PQSQIGAPAKRIEGR------
I4DCV2_DESAJ/17-214----------------AERTNQ----------ALEKADISE..RIDHRSLKDQGIKNRLPQKHIGVHASAMEKR------
C7JJ99_ACEP3/17-217----------------ASLANE----------RLAELDLDV..RIDHRSFAAQGIDLE.PQNKIGPAGMRREER------
F8C170_OLICO/17-243----------------IDLQNH----------HLALAGLDV..RVDGRSYAERGIDVV.PTTHIGVAAKAIERR------
B0S201_FINM2/20-247----------------SKKANE----------YLARNNINK..RIDPRTFKEQGREEL.PQIHLGTSSYQMEKK------
D4JD91_9FIRM/17-307----------------AKVCNE----------HLPLHN.....QVDHRSYEKQGKLQI.PTIHEGADARKIEQK------
G2SZV4_ROSHA/17-288----------------ADVANR----------HLERTGHEE..RIDHRSHAERALLER.PTVHEGVVARAMEKK------
G2I8U9_GLUMN/17-219----------------ARQVNM----------ALERHQVEQ..RVDHRSFERQGREQE.PTRHMGVSATAMER.------
B0T9Q2_CAUSK/17-219----------------SDVQNR----------HLRHHLGPDAPQVSHLSLAARGVDRA.PTVHLGPAATALERK------
C4YZX3_9RICK/17-223----------------AIEINK----------VYEEAGLPY..VITEKSFKDRGIDQI.PKLHIGPAH......------
D6GRF6_FILAD/17-241----------------ADITNK----------YLEENSIQE..KVDHRSYQRQGIEQI.PTIHMGVSASQMEKK------
D4KAU2_9FIRM/17-241----------------EVIQNR----------YLEANNRPE..RVDLRSYERQGLDII.PTVHEGAAVRQMEKR------
D4MXT5_9FIRM/18-307----------------ARMCNQ----------HLSVDN.....QIDHRSYERQGKLKV.PTIHEGPDARKIEEK------
C0QML1_DESAH/17-230----------------GTLANK----------ALALAGEEA..RIDHRSLKDQGIDRE.PQIHVGPTASAMHKK------
R6LS79_9FIRM/20-249----------------ADLCNQ----------KFAEKGLDC..RIDHRSYARQGIEQI.PTVHEGPSVRAMEAK------
K9SN36_9CYAN/17-213----------------ADYVND----------ALERAGHDV..RVDHRSYAERNIFRI.PQIHLGAKIIELENR------
Q1QF79_NITHX/18-243----------------IDLQNQ----------HLALAGLDV..RVEGRSYAERGIAIV.PTTHIGVATKAIDRR------
G2ILJ4_9SPHN/17-216----------------ADHVNA----------RLAELDIDA..RIDHRSLEAQGIDLE.PQDKIGPAASRMGE.------
E8RPW5_ASTEC/17-230----------------EERTNQ----------ALALAGHDV..RIDHRSHQERGLEIE.PTQHVGVHATQMDRR------
R7B4C7_9CLOT/17-288----------------ADVTNR----------YLERYGHDE..RIDHRSHADRGLTEQ.PTIHEGVVARALEKK------
G9WII5_9LACT/17-241----------------ATSVNQ----------VLAQKNLPD..RISEKSFAGQGIDAV.PTQHIGINSKRQERR------
A5V2N3_SPHWW/17-216----------------AEHVNE----------RCAALRIDA..RIDHRSYEAQGIGLE.PQHKIGAAGARREA.------
MOBA_BIFLO/19-253----------------AKTCNA----------RLDETA.....RIDHRSLEDQGSDLE.PTIHEGYAARAIER.------
C5B6Q9_METEA/17-230----------------EGIANE----------RMAAAGLDL..RIDHRSHQERGLELQ.PTEHMGIHATQMERR------
C5B6U1_METEA/17-216----------------AGHVNT----------RLAELGHDV..RIDHRSLADQGLALE.PQHKIGPAGARREA.------
B9K371_AGRVS/17-242----------------YAMQNK----------HLRLNGHDI..HVDGRSYAERGIGLV.PTPHIGVSTKNIQR.------
G8PF77_PEDCP/12-236----------------AVSVNQ----------VLEQKNIPD..RISEKSFVDQGIDEV.ATQHEGINSKRYERK------
A1VX68_POLNA/17-235----------------AEMTNA----------ALAKAGHSA..RVDHRSLVAQGIDDRDAGIHLGPIATAIERR------
Q03N47_LACBA/17-240----------------ATSVNQ----------SLAQKNIPD..RISEKSFVDQGIQET.PTQHEGINSQRQNRK------
C7RI54_ANAPD/18-245----------------SDLCNE----------YLAKNNIEK..RVDHRSFKRQGIKQI.PTIHLGASASAMERK------
D4KA38_9FIRM/17-241----------------AATANR----------YLEANGRPE..RLDLRSYERQGLDKI.PTVHMGPAVSQMEKR------
Q7CW18_AGRT5/17-228----------------EGIANR----------QLQHEGLDV..RIDHRSHIERGLELS.PTEHMGVHASQM..R------

PF05840

VGA_BPG4/115-441LSMAHL-------
A0A011RTX4_VIBPH/74-400LTMTNL-------
VGA_BPPHK/49-381PSMAHL-------
A9ZT18_9CAUD/122-510RRLANQ-------
VPA_BP186/139-507RRMADP-------
VPA_BPP2/133-515RKLPRG-------
ENDP2_SALTI/193-568RLLAGQ-------
Q8XBG0_ECO57/179-564RRLASQ-------
P12_BPPM2/101-478RRAKPE-------
REP_BPHC1/204-578RRLISG-------
O80256_9VIRU/150-506RRLRDE-------

PF01076

65KD_ZYMMA/1-192-------------
O87277_9STAP/1-193-------------
P71098_BACTI/20-220-------------
L2IEI5_ENTFC/1-193-------------
Q45448_BACIU/1-193-------------
PRE_STRAG/1-194-------------
PRE1_STAAU/1-198-------------
C3DBP7_BACTU/1-192-------------
Q52058_9ZZZZ/3-190-------------
Q09026_OENOE/1-199-------------
Q53618_STAAU/1-198-------------
Q48524_LACCA/1-194-------------
B6FKS6_9CLOT/6-219-------------
Q52050_BUTFI/1-198-------------
PREA_LACPN/1-194-------------
P71520_MARHA/20-221-------------
Q53620_STAAU/1-198-------------

PF03432

Q9WW30_PEDPE/8-248EIYHELERR----
D2JCN4_STAEP/8-236GLEIGFNRQ----
Q56424_BACFG/7-242NIDYRLRRN----
VIRD2_RHIRD/16-264EQHARFQES----
A0A015PKP4_BACFG/7-242HIERTQSKL----
Q9ZIP2_FUSNU/13-276TFKKEYLEQ----
A6H977_9ZZZZ/12-252KLEARFGAF----
A0A031PR62_ECOLX/61-315KLMKKMGDY----
Q9Z361_STAEP/8-242GIEDGFERQ----
LTRB_LACLM/34-307YNLESIIER----
Q9XAW2_PSEAC/12-285KLTKRIGPY----
B3H352_ACTP7/14-247DLSADITER----
TRAI5_ECOLX/12-252SLEARLGPF----
Q54883_STREE/11-264YFEKKFVQR----
RLX1_STAAU/8-238VIENGFAIE----
A9CQY2_STAAU/8-239AIDHEHERH----
K7VR95_LACLC/9-280TILHELEKR----

PF02217

LT_POVBO/129-222-------------
LT_POVMK/151-247-------------
Q80FI2_9POLY/134-228-------------
Q9DPC0_POVJC/137-230-------------
LT_POVLY/200-298-------------
Q20HY2_9POLY/139-233-------------
Q9J7C9_SV40/136-229-------------
Q20HX6_9POLY/120-214-------------
LT_POVHA/261-354-------------
B9A7H1_BFPYV/111-204-------------
LT_POVMC/285-377-------------

PF08724

A7LIB2_9VIRU/14-197-------------
Q9WKM1_PAVHB/3-177-------------
Q8JQG1_9VIRU/4-192-------------
Q7TG44_9VIRU/4-191-------------
Q9J0X5_9VIRU/3-177-------------
Q9J0X7_9VIRU/3-177-------------
Q6JL80_9VIRU/4-189-------------
VU94_HHV6Z/17-203-------------
Q88271_9VIRU/3-177-------------

PF07232

Y35K_HALSI/1-316DPYRRLRTPPPGG
Y36K_HALSN/1-328DPYRRLRTPPPGG

PF01446

G8PF48_PEDCP/80-316-------------

PF00799

REP_TPCTV/8-120-------------
REPA_MSVS/10-117-------------
REP_BGYMJ/7-119-------------
REP_BCTVC/7-119-------------
U9TRZ4_RHIID/23-135-------------
REPE_ONYPE/14-143-------------

PF02407

MREP_SCSVF/5-83-------------
REP6_SCSVF/6-86-------------
REP2_SCSVF/2-88-------------
MREP_BBTVA/6-83-------------

PF03389

C4YZP3_9RICK/17-222-------------
TRAA_AGRT5/17-243-------------
D4LKI8_9FIRM/17-286-------------
B0T9A7_CAUSK/17-219-------------
R5L7A7_9FIRM/19-253-------------
TRAA_RHISN/17-243-------------
Q2KC95_RHIEC/17-258-------------
B7KN07_CYAP7/17-212-------------
D5HHM6_9FIRM/55-279-------------
D6DI62_CLOSC/17-286-------------
A9HLM3_GLUDA/17-229-------------
D4LM09_9FIRM/19-247-------------
D4JZW7_9FIRM/17-288-------------
Q11MR5_CHESB/17-249-------------
B1X3B9_CYAA5/17-213-------------
D4JZZ9_9FIRM/19-243-------------
Q8KIN6_RHIEC/17-249-------------
A4YML6_BRASO/18-217-------------
I4DCV2_DESAJ/17-214-------------
C7JJ99_ACEP3/17-217-------------
F8C170_OLICO/17-243-------------
B0S201_FINM2/20-247-------------
D4JD91_9FIRM/17-307-------------
G2SZV4_ROSHA/17-288-------------
G2I8U9_GLUMN/17-219-------------
B0T9Q2_CAUSK/17-219-------------
C4YZX3_9RICK/17-223-------------
D6GRF6_FILAD/17-241-------------
D4KAU2_9FIRM/17-241-------------
D4MXT5_9FIRM/18-307-------------
C0QML1_DESAH/17-230-------------
R6LS79_9FIRM/20-249-------------
K9SN36_9CYAN/17-213-------------
Q1QF79_NITHX/18-243-------------
G2ILJ4_9SPHN/17-216-------------
E8RPW5_ASTEC/17-230-------------
R7B4C7_9CLOT/17-288-------------
G9WII5_9LACT/17-241-------------
A5V2N3_SPHWW/17-216-------------
MOBA_BIFLO/19-253-------------
C5B6Q9_METEA/17-230-------------
C5B6U1_METEA/17-216-------------
B9K371_AGRVS/17-242-------------
G8PF77_PEDCP/12-236-------------
A1VX68_POLNA/17-235-------------
Q03N47_LACBA/17-240-------------
C7RI54_ANAPD/18-245-------------
D4KA38_9FIRM/17-241-------------
Q7CW18_AGRT5/17-228-------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window