Sequence alignment for CL0169

PF00799

REP_TPCTV/8-120-----------------------------------------------FQIAAKN--------------------------
REPA_MSVS/10-117-----------------------------------------------FSHRNAN--------------------------
REP_BGYMJ/7-119-----------------------------------------------FRVQSKN--------------------------
REP_BCTVC/7-119-----------------------------------------------FRIQAKN--------------------------
U9TRZ4_RHIID/23-135-----------------------------------------------FSIIAKI--------------------------
REPE_ONYPE/14-143-----------------------------------------------...QAQN--------------------------

PF05840

VGA_BPG4/115-441---PDELQLSDEIVEDYRLTVLSIIE................ELQECYDVLGQL.DINNTIDHK.P..............
A0A0E2J468_CHLPS/74-400---VDGHKAASDVRDEFVSVTEKLMD................ELAQCYNVLPQL.DINNTIDHR.P..............
VGA_BPPHK/49-381---SEETHLDDETYALYESQTGLLED................HMALVRKCAAQL.DNSNTIDHRTP..............
A9ZT18_9CAUD/122-510---DELRDMAFRIAKIMEAYLQLTAS....RKHADREEDVDQAVVDAYEALAHFCTQTFGIKA..PRK...........Y
VPA_BP186/139-507---ADIDLLAADIANFIRAELADIDD.........TGFSELKTLYTWYMRAGFI.SLQFNVTP..PKW.......ERVTK
VPA_BPP2/133-515---KELKKFAARISSQLFMMYEELSDAWVDAHGEKESLFTDEAQAHLYGHVAGA.ARAFNIS...PLY......WKKYRK
ENDP2_SALTI/193-568---DQVKRLSTLVAAHMSMCLDAAC.....GDLFVSDDVKPEEIRQAWERVAAE.AMRLEVIP..PAF..EQLRRKKRRR
Q8XBG0_ECO57/179-564---HQIQTLATMTAAMFSSTFEKLCD....GFGATDGELTMDVTLKAYQMLARM.ALHLHAMP..PHY..DALTTDKDRR
P12_BPPM2/101-478---LQRDKRRKDKAKQLALICQQMGI..VDFDKSMTLEQATALVISKYQKLAEF.TINQIDTA..PAYSTYEAFMKKGGN
REP_BPHC1/204-578---SKLKKMAYEMATAFIRFQCDCSHFLKNGIEKDNEGDIQGYFYQLYKWCGEI.AFSAGFKI..PHW......EKIEND
O80256_9VIRU/150-506---DECVELAKAKAKAFSKTLSKFDE.............IEEPFTKACELLASL.GLSFR.....PEL..........IK

PF02407

MREP_SCSVF/5-83--------------------------------------------VICWCFTLNN--------------------------
REP6_SCSVF/6-86--------------------------------------------STSWVFTLNF--------------------------
REP2_SCSVF/2-88--------------------------------------------ARRYCFTLNY--------------------------
MREP_BBTVA/6-83--------------------------------------------.VCWMFTINN--------------------------

PF07232

Y35K_HALSI/1-316MAKRD....GMKLRDELTFDTSRAVK------------------AVSWGEAIDR--------------------------
Y36K_HALSN/1-328MASQPEEGFGERLRKEVTVDTSRGVR------------------ATSTAQAVEN--------------------------

PF08724

A7LIB2_9VIRU/14-197----------------------------------------------FYEVIIRL--------------------------
Q9WKM1_PAVHB/3-177----------------------------------------------LFRGVLQ.--------------------------
Q8JQG1_9VIRU/4-192----------------------------------------------FYEIVIKV--------------------------
Q7TG44_9VIRU/4-191----------------------------------------------YYEVIVQL--------------------------
Q9J0X5_9VIRU/3-177----------------------------------------------MFRGVVH.--------------------------
Q9J0X7_9VIRU/3-177----------------------------------------------MFRGVIQ.--------------------------
Q6JL80_9VIRU/4-189----------------------------------------------FYEVIVRV--------------------------
VU94_HHV6Z/17-203----------------------------------------------YIMLTIKG--------------------------
Q88271_9VIRU/3-177----------------------------------------------MYRGVIQ.--------------------------

PF03389

C4YZP3_9RICK/17-222---------------------------------------QNAVATAAYISASKL--------------------------
TRAA_AGRFC/17-243---------------------------------------RSVVLSAAYQHCAKM--------------------------
D4LKI8_9FIRM/17-286---------------------------------------RSAVAASAYMSCSRI--------------------------
B0T9A7_CAUSK/17-219---------------------------------------RSSVAAAAYRSATAL--------------------------
R5L7A7_9FIRM/19-253---------------------------------------..AVASAAYISGQKL--------------------------
TRAA_RHISN/17-243---------------------------------------RSAVLSAAYRHCARM--------------------------
Q2KC95_RHIEC/17-258---------------------------------------RSIISAAAYRHRTRM--------------------------
B7KN07_CYAP7/17-212---------------------------------------KSSTAAAAYRAGEKI--------------------------
D5HHM6_9FIRM/55-279---------------------------------------RSAVAAAAYRSGTKL--------------------------
D6DI62_CLOSC/17-286---------------------------------------RSAVAASAYLSCSRL--------------------------
A9HLM3_GLUDA/17-229---------------------------------------RSAVAAAAYRSAEKL--------------------------
D4LM09_9FIRM/19-247---------------------------------------..VVNSAAYISGQKL--------------------------
D4JZW7_9FIRM/17-288---------------------------------------RSAVAAAAYLSCSKI--------------------------
Q11MR5_CHESB/17-249---------------------------------------RSVVSAAAYRHRTRM--------------------------
B1X3B9_CYAA5/17-213---------------------------------------QSATEAAAYRAAEKI--------------------------
D4JZZ9_9FIRM/19-243---------------------------------------QSAVAGAAYQSGERL--------------------------
Q8KIN6_RHIEC/17-249---------------------------------------RSIVSAAAYRHRARM--------------------------
A4YML6_BRASO/18-217---------------------------------------.SAVASAAYRSGSRL--------------------------
I4DCV2_DESAJ/17-214---------------------------------------KSSVASAAYRSGEKI--------------------------
C7JJ99_ACEP3/17-217---------------------------------------RSAVAAAAYRAASRL--------------------------
F8C170_OLICO/17-243---------------------------------------RSAVLAAAYRHCAKM--------------------------
B0S201_FINM2/20-247---------------------------------------.SVIAKAAYNARDKL--------------------------
D4JD91_9FIRM/17-307---------------------------------------KSVISASAYLNGDVM--------------------------
G2SZV4_ROSHA/17-288---------------------------------------RSAVAAAAYLSCSRM--------------------------
G2I8U9_KOMMN/17-219---------------------------------------RSVVAAAAYRAGQEL--------------------------
B0T9Q2_CAUSK/17-219---------------------------------------RSAVAAAAYRSGQSL--------------------------
C4YZX3_9RICK/17-223---------------------------------------QNAVASAAYISASKL--------------------------
D6GRF6_FILAD/17-241---------------------------------------KSAVAASAYRSGEKI--------------------------
D4KAU2_9FIRM/17-241---------------------------------------QSAVAAAAYQSGEKL--------------------------
D4MXT5_9FIRM/18-307---------------------------------------.SIISASAYLNGDVM--------------------------
C0QML1_DESAH/17-230---------------------------------------RSATAASAYRSAEKV--------------------------
R6LS79_9FIRM/20-249---------------------------------------QSAVASAAYRAGEKL--------------------------
K9SN36_9CYAN/17-213---------------------------------------RSATAAAAYRSGSIV--------------------------
Q1QF79_NITHX/18-243---------------------------------------.SAVLSAAYRHCARM--------------------------
G2ILJ4_9SPHN/17-216---------------------------------------RSAVAAAAYRSASRL--------------------------
E8RPW5_ASTEC/17-230---------------------------------------RSAVAAAAYRSGTKL--------------------------
R7B4C7_9CLOT/17-288---------------------------------------RSAVAASAYLSCTNI--------------------------
G9WII5_9LACT/17-241---------------------------------------RSAIASAAYRSGEKL--------------------------
A5V2N3_SPHWW/17-216---------------------------------------RSAVAAAAYRAAERL--------------------------
MOBA_BIFLO/19-253---------------------------------------..ATATLSYITGKRV--------------------------
C5B6Q9_METEA/17-230---------------------------------------RSAVASAAYRAGERL--------------------------
C5B6U1_METEA/17-216---------------------------------------RSAVAAAAYRSASEL--------------------------
B9K371_AGRVS/17-242---------------------------------------RSAVAAAAYRHTARM--------------------------
G8PF77_PEDCP/12-236---------------------------------------RSAIASAAYRSGERL--------------------------
A1VX68_POLNA/17-235---------------------------------------RSATAAAAYRAGVEI--------------------------
Q03N47_LACBA/17-240---------------------------------------RSAIAGAAYRSGEKL--------------------------
C7RI54_ANAPD/18-245---------------------------------------KSAVASAAYISGEKI--------------------------
D4KA38_9FIRM/17-241---------------------------------------QSAVASAAYQSGERL--------------------------
Q7CW18_AGRFC/17-228---------------------------------------RSAVASAAYRCAVLL--------------------------

PF03432

Q9WW30_PEDPE/8-248-------------------------------------RSDSASRLVNYAEK...--------------------------
D2JCN4_STAEP/8-236-------------------------------------STKSTSRAINYAEK...--------------------------
Q56424_BACFG/7-242-------------------------------------KGTSFSGCVCYVLRE..--------------------------
VIRD2_RHIRD/16-264-------------------------------------GTKTLQQIINQLEYLSR--------------------------
A0A015PKP4_BACFG/7-242-------------------------------------SISHGVAALEYDLAKEI--------------------------
Q9ZIP2_FUSNU/13-276-------------------------------------TKSSLYNILKYVGSQNE--------------------------
A6H977_9ZZZZ/12-252-------------------------------------KKSDFAELVKYITDE..--------------------------
Q4FIJ3_SALCE/61-315-------------------------------------RNESFVALVDVMKDG..--------------------------
Q9Z361_STAEP/8-242-------------------------------------ATKSTSRAINYAEK...--------------------------
LTRB_LACLM/34-307-------------------------------------NEDHLTNLFPYISNPDK--------------------------
Q9XAW2_PSEAC/12-285-------------------------------------GKTSFKSLAKYACERDH--------------------------
B3H352_ACTP7/14-247-------------------------------------.ASSCKACVDYLLN...--------------------------
TRAI5_ECOLX/12-252-------------------------------------GKSDFAGLANYITDA..--------------------------
Q54883_STREE/11-264-------------------------------------GKNYRSKLIKYILNPSK--------------------------
RLX1_STAAU/8-238-------------------------------------NTKSASRAINYAEE...--------------------------
A9CQY2_STAAU/8-239-------------------------------------NTKSASRAINYAEK...--------------------------
K7VR95_LACLC/9-280-------------------------------------NGASAASALNYALGQDR--------------------------

PF01076

65KD_ZYMMA/1-192------------------------------------MPNYAIFRFEKHKTVGTI--------------------------
O87277_9STAP/1-193------------------------------------MS.YAVCRMQKVK.SAGL--------------------------
P71098_BACTI/20-220------------------------------------HNNREMNEKEKER.NSHI--------------------------
O32791_9LACT/1-193------------------------------------MS.FAVARMQKVK.SGNL--------------------------
Q45448_BACIU/1-193------------------------------------MANYAVIRMEKYK.KDRL--------------------------
PRE_STRAG/1-194------------------------------------MS.YMVARMQKMK.AGNL--------------------------
PRE1_STAAU/1-198------------------------------------MS.HSILRVARVKGSSNT--------------------------
A0A0F6IVM1_BACTU/1-192------------------------------------MNKFAIIHMQKFQ.ISDV--------------------------
Q52058_9ZZZZ/3-190------------------------------------SNNFCILRFQKIKSAIAV--------------------------
Q09026_OENOE/1-199------------------------------------.MYKLVLHVKHFK.KGNL--------------------------
Q53618_STAAU/1-198------------------------------------MA.YSIIRVAKVKSKTNT--------------------------
Q48524_LACCA/1-194------------------------------------MS.YLVANMQKLK.ADNL--------------------------
B6FKS6_9FIRM/6-219------------------------------------KADMSCARVKKYT.ASDV--------------------------
Q52050_BUTFI/1-198------------------------------------MG.YGIMRCEKRK.IQAC--------------------------
PREA_LACPN/1-194------------------------------------MS.FAVARMTKLK.ADNL--------------------------
P71520_MARHA/20-221------------------------------------HNNREFTERGKER.NDHI--------------------------
Q53620_STAAU/1-198------------------------------------MS.YSIVRVSKVKSGTNT--------------------------

PF01446

G8PF48_PEDCP/80-316-----------------------------------MKNSSQLKQIIAEAVVREP--------------------------

PF02217

LT_POVBO/129-222--------------------------------------------------------------------------------
LT_POVMK/151-247--------------------------------------------------------------------------------
Q80FI2_9VIRU/134-228--------------------------------------------------------------------------------
Q9DPC0_POVJC/137-230--------------------------------------------------------------------------------
LT_POVLY/200-298--------------------------------------------------------------------------------
Q20HY2_9VIRU/139-233--------------------------------------------------------------------------------
Q9J7C9_SV40/136-229--------------------------------------------------------------------------------
Q20HX6_9VIRU/120-214--------------------------------------------------------------------------------
LT_POVHA/261-354--------------------------------------------------------------------------------
B9A7H1_BFPYV/111-204--------------------------------------------------------------------------------
LT_POVMC/285-377--------------------------------------------------------------------------------

PF00799

REP_TPCTV/8-120--------------------------------------------------------------------------------
REPA_MSVS/10-117--------------------------------------------------------------------------------
REP_BGYMJ/7-119--------------------------------------------------------------------------------
REP_BCTVC/7-119--------------------------------------------------------------------------------
U9TRZ4_RHIID/23-135--------------------------------------------------------------------------------
REPE_ONYPE/14-143--------------------------------------------------------------------------------

PF05840

VGA_BPG4/115-441..............LGNDHWNLLYEK...............PVYKHWYQLVSNRPLKDIRAD....YNYAKAKGVKDECS
A0A0E2J468_CHLPS/74-400..............EGDEKWFLENEK...............TVTQFCRKLAAERPLKDIRDE....YNYPKKKGIKDECS
VGA_BPPHK/49-381..............LDPECVFLFEMICPGVRYGK.......TLNSLWSKYAAQWPEKLIRQE....LDMVKPLSFKDEVA
A9ZT18_9CAUD/122-510QKQTHLSASSDIMRMISDSWWLGRLVKVRKIMREHLAIAMGQVSNNASPYASWDCVREHQEQQQRNYEAIKNMVLFDEET
VPA_BP186/139-507KYFCEDEIAPAVMRMFNEVWWRGRLRRIAAAWREHLQIAVGNVSKKRHAYASKNCVTDWREQKRRTREFLKGLDLEDEEG
VPA_BPP2/133-515GQMTTRQAYSAIARLFNDEWWTHQLKGQRMRWHETLLIAVGEVNKDRSPYASKHAIRDVRARRQANLEFLKSCDLENRET
ENDP2_SALTI/193-568KPVPYELIPPSLARMLCADWWYRKLWQMRCEWREEQLRAVCLVNKKASPYVSYEAVIHKREQRRKSLEFFRSHELINEDG
Q8XBG0_ECO57/179-564NEPDTELLPGAILRLTCAEWWKRKLWLLRCEWREEQLRAACLVSRKTSPYLSQDALSEFRAQREKTRDFLKSFMLENEDG
P12_BPPM2/101-478PEILADKLEIAIRRMTCDKWWQRKLNRARDMTLEHLNITLGLVNKKKSPYASLQAVNEFKYAKKSQQKWLDSMQLESDDG
REP_BPHC1/204-578KRIKAEHIDSTLIRLTCEKWWFKQMRDIQKRMVEHIAIACGEVRANAASYISNQSFQEWQLQQRKNHDYLRAMIIENIDN
O80256_9VIRU/150-506QKRQSNELECLTSRAMCENWLRRQLRRRYFAEVEAVRDLL.LVSKNENPYCSAHGLEVMKSRKSATEQVLSNTVCYVEDN

PF02407

MREP_SCSVF/5-83--------------------------------------------------------------------------------
REP6_SCSVF/6-86--------------------------------------------------------------------------------
REP2_SCSVF/2-88--------------------------------------------------------------------------------
MREP_BBTVA/6-83--------------------------------------------------------------------------------

PF07232

Y35K_HALSI/1-316-------------------------------------------------------FQSWYDDQRGTQIVVENE.LGETVG
Y36K_HALSN/1-328-------------------------------------------------------FEGWYADQRDTQMVVEEATTGERVG

PF08724

A7LIB2_9VIRU/14-197--------------------------------------------------------------------------------
Q9WKM1_PAVHB/3-177--------------------------------------------------------------------------------
Q8JQG1_9VIRU/4-192--------------------------------------------------------------------------------
Q7TG44_9VIRU/4-191--------------------------------------------------------------------------------
Q9J0X5_9VIRU/3-177--------------------------------------------------------------------------------
Q9J0X7_9VIRU/3-177--------------------------------------------------------------------------------
Q6JL80_9VIRU/4-189--------------------------------------------------------------------------------
VU94_HHV6Z/17-203--------------------------------------------------------------------------------
Q88271_9VIRU/3-177--------------------------------------------------------------------------------

PF03389

C4YZP3_9RICK/17-222--------------------------------------VYKTIDKETGEE---------------IS---ITYDFT.KKQ
TRAA_AGRFC/17-243--------------------------------------........EYER---------------EA---RTIDYT.RKQ
D4LKI8_9FIRM/17-286--------------------------------------........YNDY---------------DG---IQHDYT.RKH
B0T9A7_CAUSK/17-219--------------------------------------........RDAR---------------LE---MVFNYS.QKG
R5L7A7_9FIRM/19-253--------------------------------------........KDTR---------------LG---LSFNYT.RKE
TRAA_RHISN/17-243--------------------------------------........DYER---------------EA---RTIDYR.AKQ
Q2KC95_RHIEC/17-258--------------------------------------........MDEQ---------------VG---ASFNYRGGAS
B7KN07_CYAP7/17-212--------------------------------------........HDER---------------TG---LTFDYT.RKR
D5HHM6_9FIRM/55-279--------------------------------------........TNEW---------------DG---LTHDYT.RKG
D6DI62_CLOSC/17-286--------------------------------------........YNDY---------------DG---IQHDYT.KKQ
A9HLM3_GLUDA/17-229--------------------------------------........TDER---------------TG---QIHDYR.NKN
D4LM09_9FIRM/19-247--------------------------------------........YNDY---------------YG---QVHDYT.RKS
D4JZW7_9FIRM/17-288--------------------------------------........LNDY---------------DG---IQHDYT.RKK
Q11MR5_CHESB/17-249--------------------------------------........DEEQ---------------TG---MSFRYEGGKA
B1X3B9_CYAA5/17-213--------------------------------------........HDLR---------------IG---ETFNYT.RKK
D4JZZ9_9FIRM/19-243--------------------------------------........FSEY---------------DQ---KTKFYN.KKK
Q8KIN6_RHIEC/17-249--------------------------------------........MDEQ---------------AG---TSFSYRGGAG
A4YML6_BRASO/18-217--------------------------------------........RDER---------------LG---REQDFS.AKR
I4DCV2_DESAJ/17-214--------------------------------------........QDEH---------------IG---QTFDYT.KKM
C7JJ99_ACEP3/17-217--------------------------------------........HDVR---------------LD---RDHDFS.NKS
F8C170_OLICO/17-243--------------------------------------........TYEA---------------EA---RVVDYT.GKR
B0S201_FINM2/20-247--------------------------------------........QDEY---------------YG---KTHDYS.KKE
D4JD91_9FIRM/17-307--------------------------------------........KNEE---------------TG---RISYYT.SKK
G2SZV4_ROSHA/17-288--------------------------------------........LNEY---------------DG---VQHDYT.RKQ
G2I8U9_KOMMN/17-219--------------------------------------........TDER---------------QG---LTHDYT.RKQ
B0T9Q2_CAUSK/17-219--------------------------------------........TDDR---------------LA---MEFDFS.NKD
C4YZX3_9RICK/17-223--------------------------------------VYKTIDKETGEK---------------IS---ITYDFT.KKQ
D6GRF6_FILAD/17-241--------------------------------------........KNEY---------------DG---IVHDFT.RKS
D4KAU2_9FIRM/17-241--------------------------------------........FCEY---------------DQ---EVKHYP.EKR
D4MXT5_9FIRM/18-307--------------------------------------........KNEE---------------TG---RISYYT.SKK
C0QML1_DESAH/17-230--------------------------------------........KDLR---------------TG---EDFDYT.RKG
R6LS79_9FIRM/20-249--------------------------------------........HSEY---------------YG---EDSDYT.RKG
K9SN36_9CYAN/17-213--------------------------------------........HDER---------------TD---LEFNYT.RKD
Q1QF79_NITHX/18-243--------------------------------------........DYEA---------------EA---RVVDYS.NKR
G2ILJ4_9SPHN/17-216--------------------------------------........HDER---------------LD---RDHDFT.NKS
E8RPW5_ASTEC/17-230--------------------------------------........TNER---------------DG---LTHDYT.RKS
R7B4C7_9CLOT/17-288--------------------------------------........LNDY---------------DG---VRHDFT.RKK
G9WII5_9LACT/17-241--------------------------------------........FDQR---------------EG---KSYFFA.RSV
A5V2N3_SPHWW/17-216--------------------------------------........HDER---------------LG---RGHDFT.NKA
MOBA_BIFLO/19-253--------------------------------------........HDER---------------RG---ETYDYG.RKE
C5B6Q9_METEA/17-230--------------------------------------........ENER---------------DG---LTHDYT.RRA
C5B6U1_METEA/17-216--------------------------------------........HDER---------------AE---QRHDFR.AKG
B9K371_AGRVS/17-242--------------------------------------........ENER---------------EG---RVADFF.NKP
G8PF77_PEDCP/12-236--------------------------------------........FDDK---------------EG---RNYFYA.RTV
A1VX68_POLNA/17-235--------------------------------------........TDER---------------TG---EVHDYR.RRG
Q03N47_LACBA/17-240--------------------------------------........FDQK---------------EG---RSYFYA.RSV
C7RI54_ANAPD/18-245--------------------------------------........KNEW---------------DG---VTHDYT.KKQ
D4KA38_9FIRM/17-241--------------------------------------........FSEY---------------DQ---KQKYYS.HKS
Q7CW18_AGRFC/17-228--------------------------------------........VNQR---------------DG---LVHDFT.RKE

PF03432

Q9WW30_PEDPE/8-248----------------------------------------------.....................---...RAV-LKD
D2JCN4_STAEP/8-236----------------------------------------------.....................---...RAE-EKS
Q56424_BACFG/7-242----------------------------------------------....................D---KS.KLL-EAV
VIRD2_RHIRD/16-264----------------------------------------------KG.................KL---ELQRSA-RHL
A0A015PKP4_BACFG/7-242----------------------------------------------N..................GQ---AVATEI-ARH
Q9ZIP2_FUSNU/13-276----------------------------------------------...................KE---KDDRVY-KTT
A6H977_9ZZZZ/12-252----------------------------------------------...Q...........G...KT---ERLGHV-RVT
Q4FIJ3_SALCE/61-315----------------------------------------------...C...........E...WV---NFYGVT-CFH
Q9Z361_STAEP/8-242----------------------------------------------.....................---...RAV-EKS
LTRB_LACLM/34-307----------------------------------------------TMS............KQLVSG---HGITNV-YDA
Q9XAW2_PSEAC/12-285----------------------------------------------IDP...............ETG---AVERRE-CST
B3H352_ACTP7/14-247----------------------------------------------.....................---...KPD-DTA
TRAI5_ECOLX/12-252----------------------------------------------...Q...........S...KD---HRLGHV-QAT
Q54883_STREE/11-264----------------------------------------------TKN............LTLVSD---FGMRNY-LDF
RLX1_STAAU/8-238----------------------------------------------.....................---...RAE-EKS
A9CQY2_STAAU/8-239----------------------------------------------.....................---...RAE-EKS
K7VR95_LACLC/9-280----------------------------------------------PMHEKTEQWLQDHQLERPVEL---TNCRAV-AVG

PF01076

65KD_ZYMMA/1-192--------------------------------------KAASLHMTRGRE---------------T......QNADPDRK
O87277_9STAP/1-193--------------------------------------KGMQFHNQRERK---------------SR...TNDDIDHERT
P71098_BACTI/20-220--------------------------------------DQSRSHENKYLV---------------QK...DVKDLYEKEF
O32791_9LACT/1-193--------------------------------------VGVGNHNQRNTD---------------NH...SNKDIDVERS
Q45448_BACIU/1-193--------------------------------------NGTQKHNQREFQ---------------KS...KNENIDRERT
PRE_STRAG/1-194--------------------------------------GGAFKHNERVFE---------------TH...SNKDINPSRS
PRE1_STAAU/1-198--------------------------------------NGIQRHNQRENK---------------NY...NNKDINHEET
A0A0F6IVM1_BACTU/1-192--------------------------------------QGIQKHNQRQGK---------------SK...SNLDIDYSKS
Q52058_9ZZZZ/3-190--------------------------------------RRRLKHNSRINQ---------------P......ENANPEKS
Q09026_OENOE/1-199--------------------------------------SKLENHNSRRYL---------------HD...NNKNIRPELS
Q53618_STAAU/1-198--------------------------------------KGIQKHVQRQNK---------------NY...ENMDIDLEKS
Q48524_LACCA/1-194--------------------------------------VGLGNHDQRRTQ---------------HH...KNPDIDVDRS
B6FKS6_9FIRM/6-219--------------------------------------SKAERHNERKNE---------------TY...ENMNVIEERI
Q52050_BUTFI/1-198--------------------------------------GGIQAENNRQAD---------------KQKDFKASDIDWDRT
PREA_LACPN/1-194--------------------------------------VGIGNHDQRKTT---------------NH...SNEDIDVSRS
P71520_MARHA/20-221--------------------------------------DFSKSDRNVYLV---------------KN...DLRELYEREF
Q53620_STAAU/1-198--------------------------------------TGIQKHVQRENN---------------NY...ENEDIDHSKT

PF01446

G8PF48_PEDCP/80-316--------------------------------------KGRFLFLTLTVK--------------------NAYSAEELKS

PF02217

LT_POVBO/129-222--------------------------------------------------------------------------------
LT_POVMK/151-247--------------------------------------------------------------------------------
Q80FI2_9VIRU/134-228--------------------------------------------------------------------------------
Q9DPC0_POVJC/137-230--------------------------------------------------------------------------------
LT_POVLY/200-298--------------------------------------------------------------------------------
Q20HY2_9VIRU/139-233--------------------------------------------------------------------------------
Q9J7C9_SV40/136-229--------------------------------------------------------------------------------
Q20HX6_9VIRU/120-214--------------------------------------------------------------------------------
LT_POVHA/261-354--------------------------------------------------------------------------------
B9A7H1_BFPYV/111-204--------------------------------------------------------------------------------
LT_POVMC/285-377--------------------------------------------------------------------------------

PF00799

REP_TPCTV/8-120--------------------------------------------------------------------------------
REPA_MSVS/10-117--------------------------------------------------------------------------------
REP_BGYMJ/7-119--------------------------------------------------------------------------------
REP_BCTVC/7-119--------------------------------------------------------------------------------
U9TRZ4_RHIID/23-135--------------------------------------------------------------------------------
REPE_ONYPE/14-143--------------------------------------------------------------------------------

PF05840

VGA_BPG4/115-441....KILEESTMKS......--------------------------------RRGFTVQ--------RLMNAMRTAHSKG
A0A0E2J468_CHLPS/74-400....RLLEASTMKS......--------------------------------RRGFAIQ--------RLMNAMRQAHADG
VGA_BPPHK/49-381....KYMEKMQEKT......--------------------------------RKNRMTQ--------KVINEMRIAHQKG
A9ZT18_9CAUD/122-510.EEEHDLWDMVKKSVSNPAI--------------------------------RRHELMV--------RCRGCEDIGNELG
VPA_BP186/139-507..NRISLIEKYDGSVANPAI--------------------------------RRCELMA--------RIRGFENICNELG
VPA_BPP2/133-515.GERIDLISKVMGSISNPEI--------------------------------RRMELMN--------TIAGIERYAAAEG
ENDP2_SALTI/193-568..DTLDMEDVVNASNSNPAH--------------------------------RRNEMMA--------CVKGLELIAEMRG
Q8XBG0_ECO57/179-564..FTIDLETVYYAGVSNPVH--------------------------------RKAEMMA--------TMKGLELLAEARG
P12_BPPM2/101-478.ETTLDLAEVFKGSVSNPEI--------------------------------RRVELMV--------RIRGYEEYAQEQG
REP_BPHC1/204-578PEEQVELFDMFLKSSSNPAL--------------------------------RRNEMMV--------RLRGLEEWAEENN
O80256_9VIRU/150-506PETWFTLQELAAKSLSNPTI--------------------------------RRAEMFV--------RLKAFEDICKESG

PF02407

MREP_SCSVF/5-83----------------------------------------------------------------------------P...
REP6_SCSVF/6-86----------------------------------------------------------------------------EGE.
REP2_SCSVF/2-88----------------------------------------------------------------------------ATEI
MREP_BBTVA/6-83----------------------------------------------------------------------------PTT.

PF07232

Y35K_HALSI/1-316FDMPNRFTPEYR-------------------------------------------EMLY--------AKAQSLERGLRER
Y36K_HALSN/1-328FRTPNRFTPEYR-------------------------------------------EMLY--------AKAQSLERGLREE

PF08724

A7LIB2_9VIRU/14-197-----------------PSD--------------------------------IDQDVPG--------LSLNFVEWLSTGV
Q9WKM1_PAVHB/3-177-----------------...--------------------------------.......--------VSSNVLDCANDNW
Q8JQG1_9VIRU/4-192-----------------PSD--------------------------------LDEHLPG--------ISDSFVNWVAEKE
Q7TG44_9VIRU/4-191-----------------PND--------------------------------VESQVPG--------ISDSFVNWITSRE
Q9J0X5_9VIRU/3-177-----------------...--------------------------------.......--------VSANFINFVNDNW
Q9J0X7_9VIRU/3-177-----------------...--------------------------------.......--------LTANITDFANDSW
Q6JL80_9VIRU/4-189-----------------PFD--------------------------------VEEHLPG--------ISDNFVDWVTGQI
VU94_HHV6Z/17-203-----------------PVE--------------------------------WEAEIPG--------ISTDFFCKFSN..
Q88271_9VIRU/3-177-----------------...--------------------------------.......--------VNANFTDFANDNW

PF03389

C4YZP3_9RICK/17-222GVVYSKISVPKGFEYAAWLH................................NREQLWN--------AA---EAREKRED
TRAA_AGRFC/17-243GLVHQEFILPAD.A.PKWVR......................ALIADCSVAGASEAFWN--------KV---EAFEKRSD
D4LKI8_9FIRM/17-286GLIYQEVMLPPM.A.PPKWK................................NREQLWN--------AV---EAAEKTKD
B0T9A7_CAUSK/17-219GVAFTGLMAPDT.A.PAEFR................................DREQMWN--------AA---EAADKRAD
R5L7A7_9FIRM/19-253EVVFAEVLLPKN.A.PEDLA................................DRETLWN--------AV---EKRENKRN
TRAA_RHISN/17-243GLLHEEFVIPAE.S.PEWLR......................SMIADRSVASASEAFWN--------KV---EDFEKRSD
Q2KC95_RHIEC/17-258DLVHEELALPDC.V.PDWLH........EELALPDCVPDWLHEAIDGLSVASASEALWN--------AV---EAFETLGN
B7KN07_CYAP7/17-212GVYATEILAPLN.A.PNWVY................................NREKLWN--------AV---ELFETRSN
D5HHM6_9FIRM/55-279GVVHAEIMLPAH.A.PPEFA................................DRSTLWN--------SV---EQIEKARD
D6DI62_CLOSC/17-286GLVWQEVFLPEY.A.PQEWK................................DREQLWN--------AV---EEVETAKD
A9HLM3_GLUDA/17-229GVVATACSVGNQRV......................................DRETLWN--------AA---EAAEKRKD
D4LM09_9FIRM/19-247GVMFTEILKPDY.V.PERLS................................DRETLWN--------EV---ERAEKGKR
D4JZW7_9FIRM/17-288GLAWQEVFLPEF.A.PSEWK................................ERSVLWN--------AV---EENEKTKD
Q11MR5_CHESB/17-249ELVHEELALPDQ.T.PAWLR......................TMIDGRTIAGASEVLWN--------AV---DTFEKRVD
B1X3B9_CYAA5/17-213GVYATEILTPHN.A.PNWMA................................DRSQLWN--------AA---ELFEKRSN
D4JZZ9_9FIRM/19-243ELVHAEIMLPSH.A.PPGFA................................DRQILWN--------AV---EAVENQWN
Q8KIN6_RHIEC/17-249ELMYEELALPDE.I.PDWLR......................SAISGQSVSKASEVFWN--------AV---DAFETRAD
A4YML6_BRASO/18-217GVVHSEVILPEN.A.PEAWS................................DRERLWN--------DV---EAFEVRKD
I4DCV2_DESAJ/17-214GVDYKEILAPDH.S.PAWVQ................................DRGQLWN--------QV---ELAERRKD
C7JJ99_ACEP3/17-217GVVHSEILLPDG.A.PERFL................................DRATLWN--------EV---EAIEKRKD
F8C170_OLICO/17-243NMVHDEFVLPPD.A.PQWAC......................AMMATRSAAEVSAAFWN--------KL---EAFEKRSD
B0S201_FINM2/20-247DLVFSKIFLPEH.I.PKEFS................................NREYLWN--------SV---EKIEKSKN
D4JD91_9FIRM/17-307EVVYTSLMMCEN.APPEWQIVPEENIKRFQKSVRYKRSEDKEAALEKFKITFQKQRLWN--------EV---LKIEKNAD
G2SZV4_ROSHA/17-288GLGWRQVFLPAT.A.PAEWQ................................DREILWN--------AV---EETETAKD
G2I8U9_KOMMN/17-219GVEDAFIVAPDG...ADWAQ................................DRNALWN--------AA---EAAEKRKD
B0T9Q2_CAUSK/17-219GIEHAEIMAPDD.A.PQAYR................................DRAALWN--------AV---EAAERRKD
C4YZX3_9RICK/17-223GVVYSKIFLPEGFEDAEWLQ................................DRQQLWN--------AV---EARERRDD
D6GRF6_FILAD/17-241GIAHTEILLPQN.A.PQEFA................................NRSVLWN--------SV---EKIEKSKN
D4KAU2_9FIRM/17-241GIVHNEILLPAN.A.PLEYT................................DRNTLWN--------AA---EAVEKQWN
D4MXT5_9FIRM/18-307EVVYTSLIMCEN.APPEWLHVPEENIKRFQQSIRYKRADDKEAVLEKFKITFQKQRLWN--------EV---LKIEKNAD
C0QML1_DESAH/17-230GVEHKEIIGSTL........................................SREELWN--------LA---ESTETRKN
R6LS79_9FIRM/20-249GVICSEILLPSH.A.PPEYA................................DRETLWN--------AV---EKAERRKK
K9SN36_9CYAN/17-213DVYGAEIFAPLN.A.PTWVY................................DRNKLWN--------SV---EHSEKRKD
Q1QF79_NITHX/18-243NLAHEDFVLPPD.A.PAWVR......................AMIADRSVSGASETFWN--------YV---EAFETRSD
G2ILJ4_9SPHN/17-216GVVHSEILLPEG.A.PERFA................................DRKKLWN--------EV---EATEKRKD
E8RPW5_ASTEC/17-230GVEETEIVLPEG.VDAEWAR................................DREQLWN--------AA---EMAEKRND
R7B4C7_9CLOT/17-288GLVWQDVFLPEF.A.PAEWK................................DRGLLWN--------AV---EKNEKTKD
G9WII5_9LACT/17-241.MPESFILIPKN.A.PEWAN................................DREKLWN--------EV---ERKDRKSN
A5V2N3_SPHWW/17-216GVVHSEIMLPDG.A.PERLR................................DRQTLWN--------EV---EAGEKRKD
MOBA_BIFLO/19-253RVLRVGTLLPEG.A.PAEFA................................DPAVLFN--------AV---ELHETGRT
C5B6Q9_METEA/17-230GIAHAEIVLPQG.SRADWAR................................DRSALWN--------AA---ERAEKRAD
C5B6U1_METEA/17-216GVVHSEILLPQG.A.PERLS................................DRATLWN--------AV---EASEKRKD
B9K371_AGRVS/17-242GLVHSEFALPDD.A.PDWAR......................VMKYGKSPAQSSEAFWN--------KV---EAFETRKD
G8PF77_PEDCP/12-236.MPESFILSPKN.A.PDWTS................................DRERLWN--------EV---ERKDRRAN
A1VX68_POLNA/17-235GVDSAQLFFPAN.A.PEWAS................................DRNELWN--------AA---EKSETRKN
Q03N47_LACBA/17-240.MPESFILTPKN.A.PKWAS................................DREQLWN--------EV---EKKDRKSN
C7RI54_ANAPD/18-245GVISKEIFLPDH.A.PEEYK................................DRKTLWN--------SV---ELFEKNSN
D4KA38_9FIRM/17-241EIVHTEIMLPPH.A.PPAYA................................DRNTLWN--------AA---EAIEKQWN
Q7CW18_AGRFC/17-228GVAHSEIVLPQG.VSAGWAL................................DRSTLWN--------AA---EFAEKRKD

PF03432

Q9WW30_PEDPE/8-248GLN...LDVDYA---KSQLK--------------------------------QVREVYG........NQ........GKT
D2JCN4_STAEP/8-236ALN...CDIDYA---KSSFK--------------------------------ATREMYG........KT........DGN
Q56424_BACFG/7-242GVEG...TPEQM---AEQFE--------------------------------LQTLLND........KV.........KN
VIRD2_RHIRD/16-264DIPVPPDQIREL---AQSWV--------------------------------TEAGIYD........ESQS..DDDRQQD
A0A015PKP4_BACFG/7-242ELYG..CTGAEM---VQEMK--------------------------------PYHIDFP........NVK.......NNC
Q9ZIP2_FUSNU/13-276GINVS.DDYKKA---FKEMM--------------------------------LTKELHC........KL........DGR
A6H977_9ZZZZ/12-252NCEA..NTLPAV---MAEVM--------------------------------ATQHGNT........RS........EAD
Q4FIJ3_SALCE/61-315NCTS..LETAAA---DMEYI--------------------------------ARQAHYA........KD........DTD
Q9Z361_STAEP/8-242GLN...CDVDYA---KSSFK--------------------------------ASRELYG........KT........DGN
LTRB_LACLM/34-307ANEF..IATKKL---KALSK--------------------------------GTDFNFDPQTGKVRFNVES..LEKNNAV
Q9XAW2_PSEAC/12-285ETNC..LDKDTA---WREMK--------------------------------AVSDMNG........RV.........KD
B3H352_ACTP7/14-247QIL....QGDPR---LSQSI--------------------------------ADSLDFN........NT.........YT
TRAI5_ECOLX/12-252NCEA..GSIQDA---ITEVL--------------------------------ATQHTNT........RA........KGD
Q54883_STREE/11-264PSYK..ELVKMY---NDNFL--------------------------------SNDTLYE........FRHDRQEVNQRKI
RLX1_STAAU/8-238GLN...CDVDYA---KSYFK--------------------------------QTRALYG........KE........NGV
A9CQY2_STAAU/8-239GLN...CDVDYA---KSAFK--------------------------------QTRALYG........KE........DGI
K7VR95_LACLC/9-280GTNG..IDPFIA---KEQFD--------------------------------VIRQLHN........QTK.......ESN

PF01076

65KD_ZYMMA/1-192ELNEILKG...S---TDPSA--------------------------------DVKSMLN--------KIQKETGKPLRKN
O87277_9STAP/1-193RENYDLKND.KN---IDYNE--------------------------------RVKEIIE--------SQKTGT.RKTRKD
P71098_BACTI/20-220GEVLEKYNA.KQ---KRNDR--------------------------------KIDDYYK--------HIQ....SSKKTS
O32791_9LACT/1-193HLNYDLVN..RT---ENYKR--------------------------------DIEQFIN--------DNKSSS.RAVRKD
Q45448_BACIU/1-193HLNYDLVNE.KP---ISYSK--------------------------------AIHEKIE--------GRV..K.RKVRAD
PRE_STRAG/1-194HLNYELTDRDRS---VSYEK--------------------------------QIKDYVN--------ENKVSN.RAIRKD
PRE1_STAAU/1-198YKNYDLINA.QN---IKYKD--------------------------------KIDETID--------ENYSGK.RKIRSD
A0A0F6IVM1_BACTU/1-192EQNYDLLNQ.QK---IRYES--------------------------------TIKQEIS--------ERV..K.RKPRAN
Q52058_9ZZZZ/3-190NLNQYFNS....---..YDE--------------------------------ALEIYKK--------QLP....EKVRKN
Q09026_OENOE/1-199KNNIQFIDH..K---GTLTQ--------------------------------DVKARTD--------QRLNNK.RAIRSD
Q53618_STAAU/1-198YLNYDLVND.SP---IDYNQ--------------------------------KIEEKIE--------QNYNGK.RKIRKD
Q48524_LACCA/1-194ALNYDLVAG.RT---GHFKT--------------------------------DIEAYIN--------EHKTSQ.RAVRKD
B6FKS6_9FIRM/6-219PYNVHFKKP.FA---PTYME--------------------------------QLKQMET--------DGMVSL.RGLRKD
Q52050_BUTFI/1-198NENEFLIQS...---MNLQQ--------------------------------DIKKELK--------EHG...IDKWRKD
PREA_LACPN/1-194HLNYDLVAG.RT---DNFKT--------------------------------DIEAYIN--------ENKASK.RAVRKD
P71520_MARHA/20-221GAAKDRYND.KQ---QRRDR--------------------------------KIDDYYK--------HVQ....QGKKTR
Q53620_STAAU/1-198YLNYDLVNA.NK---QNFNN--------------------------------LIDEKIE--------QNYTGK.RKIRTD

PF01446

G8PF48_PEDCP/80-316SLRALTKAFGKL---SRYKK--------------------------------VSKNLLG------YLRSTEITVNEHDGS

PF02217

LT_POVBO/129-222---------------PDFPE--------------------------------VLKEYVS---------------NALFTN
LT_POVMK/151-247---------------NDMPA--------------------------------DLMEYLS---------------CAILSN
Q80FI2_9VIRU/134-228---------------IPLPD--------------------------------AVESCLL---------------AKKSIQ
Q9DPC0_POVJC/137-230---------------KDFPV--------------------------------DLHAFLS---------------QAVFSN
LT_POVLY/200-298---------------DDFPV--------------------------------CLYSFLS---------------HAIYSN
Q20HY2_9VIRU/139-233---------------ICLPA--------------------------------DVEACLL---------------AAKSIQ
Q9J7C9_SV40/136-229---------------KDFPS--------------------------------ELLSFLS---------------HAVFSN
Q20HX6_9VIRU/120-214---------------IDLPA--------------------------------SIEACLL---------------TAKSVQ
LT_POVHA/261-354---------------DDFPT--------------------------------ILRGFLS---------------HAIFSN
B9A7H1_BFPYV/111-204---------------YELPP--------------------------------EVEAYLL---------------TPRSVQ
LT_POVMC/285-377---------------SDFPS--------------------------------SLTGYLS---------------HAIYSN

PF00799

REP_TPCTV/8-120------YFLTYPNCSLS---------------------------KE--EALDQL....-..QRLQTPTNKKYIK...VAR
REPA_MSVS/10-117------TFLTYPKCPEN---------------------------PE--IACQMI....-..WELVVRWIPKYIL...CAR
REP_BGYMJ/7-119------YFLTYPRCTIP---------------------------KE--EALSQL....-..QKIHTTTNKKFIK...VCE
REP_BCTVC/7-119------IFLTYPQCSLS---------------------------KE--EALEQI....-..QGIQLSSNKKYIK...IAR
U9TRZ4_RHIID/23-135------IFFTYSRCPLT---------------------------PS--YCIESL....-.RSKLSSRRSPIGIIGYSVGL
REPE_ONYPE/14-143------IFLTYSQCDLS---------------------------KE--EIKTFIINLC-NEKKLQIN....YLI...IGI

PF05840

VGA_BPG4/115-441WY---VVFDTLTLADDRLKDFYDN....................PN..ALRDYFRDIGRMVLTAE.........GRSVHD
A0A0E2J468_CHLPS/74-400WF---IVFDTLTLADDRLEAFYDN....................PN..ALRDYFRDIGRMVLAAE.........GRKAND
VGA_BPPHK/49-381WF---FVFDTLTLADDRLQAFNEN....................PN..ALRDYFRTVGRAVLRAE.........GRSVKD
A9ZT18_9CAUD/122-510LQ---GLFLTLT.TPSKYHNSYKKGGFIDH.......WNG.AS.PR..DAQAYLNKKW.QLIRAKLNRDEIRWFGVRVAE
VPA_BP186/139-507YV---GEFYTLT.APSKYHATTKAGYRNSK.......WNG.AS.PS..DTQSYLTGLW.ARIRAKLHREEIRIFGIRVAE
VPA_BPP2/133-515DV---GMFITLT.APSKYHPTRQVGKGESKTVQLNHGWNDEAFNPK..DAQRYLCHIW.SLMRTAFKDNDLQVYGLRVVE
ENDP2_SALTI/193-568DC---AVFYTIT.CPSRFHATLNNGRPNPK.......WTS.AT.VR..QSSDYLVDTF.AAFRKAMHKAGLRWYGVRVAE
Q8XBG0_ECO57/179-564DK---AVFLTVT.CPSKYHATTENGHPNPK.......WNG.AT.MR..DSSDYLVNTFFAAVRKKLNRDGLRWYGIRTVE
P12_BPPM2/101-478MK---AVFYTIT.APSKYHANSKK.............YNN.AT.PK..ETQAFLVNQW.AKARAELNKIDVPVFGVRVVE
REP_BPHC1/204-578NE---ALFLTLT.APSSFHA....GNGNKK.......WLG.VN.PR..ETQNYLNKVW.QQFRALLSKRNIKFYGMRVAE
O80256_9VIRU/150-506HV---AMFYTVT.APSRFHV.FKGDDINPK.......WLE.AGKPSAIDAHHHLMGVT.NAFRKALDKAKIKIYGLRIVE

PF02407

MREP_SCSVF/5-83..---..LAPLS--------------------------------LH--ESMKYL------------------VYQTEAGD
REP6_SCSVF/6-86..---..IPILP--------------------------------FN--ESVQYA------------------CWQHERV.
REP2_SCSVF/2-88ER---ETFLSLF--------------------------------SQ--DELNYF------------------VVGDETAT
MREP_BBTVA/6-83..---....LPV--------------------------------MR--DEIKYM------------------VYQVERGQ

PF07232

Y35K_HALSI/1-316WG---SLLHTGM-VTLTASSTDDEGRLRP---------------PL--EHFEDLLESWEAVRRALARVLEGREWEYLAIL
Y36K_HALSN/1-328WG---DLLHTAM-VTLTASTTEEDGGPRP---------------LV--DHLRDLLSSWSAVYDALRHTLEDREFEYLAII

PF08724

A7LIB2_9VIRU/14-197WE..PTGIWNMEHVNLPM...VTL--------------------AE--KIKNIFIQRWNQFNQD.ET.....DFFFQLEE
Q9WKM1_PAVHB/3-177WC....SLLDLDTSDWEP...LTH--------------------TN--RLMAIYLSSVASKLDFTGGPLAGCLYFFQVEC
Q8JQG1_9VIRU/4-192WELPPDSDMDLNLIEQAP...LTV--------------------AE--KLQRDFLVQWRRVSKAPEA.....LFFVQFEK
Q7TG44_9VIRU/4-191WTLPEDADWDLDQVDQVQ...LTL--------------------GD--KIQREIRTHWGTMAKEPDF.....HYFIQLEQ
Q9J0X5_9VIRU/3-177WC....CFYQLEEDDWPR...LQG--------------------WE--RLIAHLIVKVAGEFAVPGGSTLGLQYFLQAEH
Q9J0X7_9VIRU/3-177WC....SFLQLDSDDWPE...LRG--------------------VE--RLVAIFICKVAAVLDNPSGTSLGCKYFLQAEG
Q6JL80_9VIRU/4-189WELPPESDLNLTLIEQPQ...LTV--------------------AD--RIRRVFLYEWNKFSKQ.ES.....KFFVQFEK
VU94_HHV6Z/17-203..VPVPHFRDMHSPGAPDIKWITA--------------------CT--KMIDVILNYWNNKTAVPTPA....KWYAQAEN
Q88271_9VIRU/3-177WC....CFFQLDVDDWPE...LRG--------------------PE--RLMAHYICKVAALLDTPSGPFLGCKYFLQVEG

PF03389

C4YZP3_9RICK/17-222STIARCIEFALPKEV--C--------------------------K------EENIKLVEEYAQQYIVA-RGLVCDVNIHY
TRAA_AGRFC/17-243AQLARDLTIALPREL--T--------------------------S------EQNIALVRDFVEKHILG-KGMVADWVYHD
D4LKI8_9FIRM/17-286SRLAREFVVALPIEL--D--------------------------K------DSNISLLQNFIQKNFVD-MGMCADFAIHD
B0T9A7_CAUSK/17-219SRTAREVLISLPHEL--T--------------------------D------DQRHALVRAFIAESLVA-KGMIADYGIHH
R5L7A7_9FIRM/19-253SQYAREFEIAVPNEW--N--------------------------R------EQTISRMREFIKENFVN-KGMAADWAYHE
TRAA_RHISN/17-243AQLAKDVTIALPIEL--T--------------------------T------EQNIVLVRDFVERHVTA-KGMVADWVYHD
Q2KC95_RHIEC/17-258AQLARELIIALPEEL--T--------------------------R------AENITLVREFVRDNLTA-RGMVVDWVYHD
B7KN07_CYAP7/17-212SRLAREFDIALPVEL--N--------------------------H------QQKRELVREFVRGQIVN-NGLVADVAFHD
D5HHM6_9FIRM/55-279SQLAREIEAALPREL--S--------------------------G------EQQLALVRAYVKDNFVD-KGMCADFAIHD
D6DI62_CLOSC/17-286SRLAREFVVALPIEL--S--------------------------R------EEQIELLQEFIREQFVS-DGMCADAAIHD
A9HLM3_GLUDA/17-229GRTAREWLLALPSEL--S--------------------------P------RDRQQLAAEFAKMLHQK-YGVATDICIHE
D4LM09_9FIRM/19-247AQLAYSFDIALQNEL--T--------------------------L------EENIQLAREFCQEQFVA-RGMIVDLAVHE
D4JZW7_9FIRM/17-288SRLAREFVVALPIEL--N--------------------------E------TQWEKLLSDFISGTFVD-DGMCADVAIHD
Q11MR5_CHESB/17-249AQLAREMIFALPEEL--S--------------------------K------AENIALVREFVRDHLTS-KGMVADWVYHD
B1X3B9_CYAA5/17-213SRTAREFDIALPTEL--T--------------------------H------PQKQELVRNFAQDNFVD-KGLVADLAFHE
D4JZZ9_9FIRM/19-243SQLARRIVLAFPVEV--P--------------------------K------EQYLSMIKEFCQEQFVS-KGMIADFAIHD
Q8KIN6_RHIEC/17-249AQLARELIIALPEEL--T--------------------------R------AENITLVREFVRDNLTS-KGMIADWVYHD
A4YML6_BRASO/18-217AQLAREVEFALPREL--S--------------------------E------AQGIELARDFAQSEFVG-LGMVADLNVHW
I4DCV2_DESAJ/17-214AQLARELNIALPKEL--S--------------------------K------EQQIELIRSFTKEKFVD-KGMVADITMHH
C7JJ99_ACEP3/17-217AQLAREVEFSIPREM--T--------------------------Q------AQGIALARDFVREQFVE-RGMVADLNVHW
F8C170_OLICO/17-243AQLSKEYIIALPIEL--T--------------------------T------AQNVALMRQFVAEHILS-KGQVADWVYHD
B0S201_FINM2/20-247SQLARNLLFTLPREL--N--------------------------E------QDRIKLISEFIEENFTS-KGMIADCNIHN
D4JD91_9FIRM/17-307AQLGRSFEFALPKEW--S--------------------------R------QEQIQYTTDYIQKTFVD-RGMCADWSIHD
G2SZV4_ROSHA/17-288SRLAREFVAALPIEL--S--------------------------R------EEQIQLLQDFIKEQFVA-DGMCADAAIHD
G2I8U9_KOMMN/17-219AKTGREYELALPAEL--D--------------------------A------GARKELARDFARELVAR-YGVVADVAMHE
B0T9Q2_CAUSK/17-219AVPAQEVLLALPHEL--D--------------------------F------EQRRDLVRAFVQEHLVA-KGMIADVAMHR
C4YZX3_9RICK/17-223STIARAIEFSLPREV--S--------------------------Q------EENTKLVEEFVKKNIVA-CGLVCDVNIHY
D6GRF6_FILAD/17-241SQLAREIEIALPKEL--D--------------------------Q------EKQIELVREYVKENFVK-VGMCADIALHD
D4KAU2_9FIRM/17-241SQLARRWVLSIPREI--P--------------------------P------DQYAALVRDFCRQQFVS-KGMCVDFAIHD
D4MXT5_9FIRM/18-307AQLGRSFEFSLPKEW--S--------------------------R------QEQIDYTTEYIQKTFVD-KGMCADWSIHD
C0QML1_DESAH/17-230ATTAREYEVALPKEL--D--------------------------L------EQCINLCREFAEKLNAK-HGCAVDICIHA
R6LS79_9FIRM/20-249AQLAYSFDIALQNEF--S--------------------------M------QENIALAKQFLLENFVS-RRMVVDFAVHQ
K9SN36_9CYAN/17-213ALVALEHEVALPIEL--T--------------------------H------EQKQDLVRQYVLEQHAS-EGKIVDIAYHN
Q1QF79_NITHX/18-243AQFAREAIIALPVEL--T--------------------------R------EQNIALMRAFVTQEILP-RGQVADWVYHN
G2ILJ4_9SPHN/17-216AQLAREVEFSIPREM--T--------------------------Q------AQGIELARDFVGQEFVD-RGMIADLNVHW
E8RPW5_ASTEC/17-230ARVAREFEVALPHEL--N--------------------------A------DQRLELVREFSQSVADT-YGVAVDFAIHA
R7B4C7_9CLOT/17-288SRLAREFVPALPIEL--T--------------------------P------AQWQELLTDFIQNNFVA-EGMCADVAIHD
G9WII5_9LACT/17-241SRYAKEFNVALPIEL--N--------------------------E------SEQKTLLTNYVQEDFVD-SGMVADVAIHR
A5V2N3_SPHWW/17-216AQLAREVEFAIPREM--T--------------------------K------EQGVALARDFVKAEFVT-RGMVADLNVHW
MOBA_BIFLO/19-253ARPAKKIVVALPREF--T--------------------------P------RQRVQALEGYIRENLNA-DGYAATYAIHD
C5B6Q9_METEA/17-230ARVAREFEIALPHEL--S--------------------------A------EQRLEATRSFAQSLADR-YGTAVDFAIHA
C5B6U1_METEA/17-216AQLAREVEFALPREL--S--------------------------R------AEGIALARDFVQATFVS-RGMVADLNLHW
B9K371_AGRVS/17-242AQLAKEFILAVPVEL--S--------------------------T------EQNIAMMRDFVSSEVTA-RGLVADWVYHD
G8PF77_PEDCP/12-236SRYAKEFNVALPVEL--N--------------------------E------DEQKELLTKYIQKKFVN-DGMVADVAIHR
A1VX68_POLNA/17-235STVAREFEVALPAEL--T--------------------------T------SERQELAHEFTKALVRK-YGFAADCAIHF
Q03N47_LACBA/17-240SRYAKEFNVALPIEL--S--------------------------T------DEQKELLTKYVQDNFVD-QGMVADVAIHR
C7RI54_ANAPD/18-245AQLARNFIISLPKEL--S--------------------------I------EENKKMIEEYVQNNFVK-EGMIVDLAIHD
D4KA38_9FIRM/17-241SQLARRIVLAIPREI--P--------------------------P------EQHADLIRDYCREFFVS-KGMIADFAIHD
Q7CW18_AGRFC/17-228ARVAREFEIALPHEL--S--------------------------P------EGRLKAARAFAQDLANR-YGAAVDFAIHS

PF03432

Q9WW30_PEDPE/8-248QAYASRISFSPKE.L--D--------------------------PTNENDQQKALEIAKEVYQKTYP.-NQQVALYEHAD
D2JCN4_STAEP/8-236EGHVVIQSFKPNE.V--T--------------------------P......EQCNQLGLELAEKIAP.-NHQVAVYTHND
Q56424_BACFG/7-242TVGHTSLNFSPED..--G--------------------------ERLKTDDALMLQIAHDYMAKMGIE-NTQYIVARHTD
VIRD2_RHIRD/16-264LTTHIIVSFPAGTDQ--T--------------------------A...AYEASREWAAEMFGSGYGGG-RYNYLTAYHVD
A0A015PKP4_BACFG/7-242LRFEVSPSIEESATF--T--------------------------D......ADWAELGNDFMQRMGLA-NHQYIIIRHSG
Q9ZIP2_FUSNU/13-276QYRHHIQSFKPGE.V--D--------------------------E......ETAHKMAVEFAEKNFK.-GFDVFISTHID
A6H977_9ZZZZ/12-252KTYHLLVSFRAGE..--K--------------------------P..DA..ETLRAIEDRICAGLGFA-EHQRVSAVHHD
Q4FIJ3_SALCE/61-315PVFHYILSWQSHE..--S--------------------------P..RP..EQIYDSVRHTLKSLGLA-DHQYVSAVHTD
Q9Z361_STAEP/8-242QGHVIIQSFKPGE.V--T--------------------------P......EQCNQLGLALAEKLAP.-NHQVAVYTHAD
LTRB_LACLM/34-307LGHHLIQSFSPDDNL--T--------------------------P......EQIHEIGRQTILEFTGG-EYEFVIATHVD
Q9XAW2_PSEAC/12-285PVYHFTVSWPAHEKP--T--------------------------D......AQVFEAGREGMKSLGME-GHQYLAAVHRD
B3H352_ACTP7/14-247AGCLSFEESDLPEIQ--K--------------------------R......EIMARFEKAMFAGLEPE-QYNIAWVQHTD
TRAI5_ECOLX/12-252KTYHLIVSFRAGE..--Q--------------------------P..SA..DTLRAIEERICVGLGYG-EHQRISAVHND
Q54883_STREE/11-264HSHHIIQSFSPDDHL--T--------------------------P......EQINRIGYEAAKELTGG-RFRFIVATHVD
RLX1_STAAU/8-238QAHTVIQSFKPGE.V--T--------------------------A......KECNEIGLELAKKIAP.-DYQVAVYTHTD
A9CQY2_STAAU/8-239QAHTVIQSFKPGE.V--T--------------------------P......EQCNQLGLELAEKIAP.-NHQVAVYTHTD
K7VR95_LACLC/9-280QVLRITQSFALDE.L--N--------------------------PKVQKDWQKANDLGVELAENLYP.-NHQSAVYTHLD

PF01076

65KD_ZYMMA/1-192GVQAIELFFGMSPEWS.K--------------------------QATPEKLEHWKTITQQWAEQTFGE.NNLVSLQLHAD
O87277_9STAP/1-193AVLVNELLVTSDRDFF.E--------------------------QLDPGEQKRFFEESYKLFSERYGK.QNIAYATVHND
P71098_BACTI/20-220LQQEMIVQVGDMKDFN.Y--------------------------RADYEKANEILLDWFKDFEKRNPN.LKVYNAVIHND
O32791_9LACT/1-193AVLINEWIITSDNPFF.K--------------------------DKDDKEIKDFFDTAKSYFADKFGD.NNIRYAQVHLD
Q45448_BACIU/1-193AVLVSEFLITASPDYM.N--------------------------GLSDEEQRRYFETAVDHLKEKYSA.ENMLYATVHMD
PRE_STRAG/1-194AVLCDEWIITSDKDFF.E--------------------------KLDEEQTRTFFETAKNYFAENYGE.SNIAYASVHLD
PRE1_STAAU/1-198AIRHVDGLVTSDKDFF.D--------------------------DLSGEEIERFFKDSLEFLENEYGK.ENMLYATVHLD
A0A0F6IVM1_BACTU/1-192SVVLSEFVVTASPDYM.H--------------------------SLSLEEQKRYFESSLDFIQKRYGK.QNTLYAMVHMD
Q52058_9ZZZZ/3-190AVHAVEILITASPEIL.S--------------------------KMTFQEQKNYFNQSLAWAENQLGGREILLSACIHRD
Q09026_OENOE/1-199ANLISEIVVGADDKYF.Q--------------------------TLTDQKKIDFGRTATKLIQERYGK.ENVLRSYLHLD
Q53618_STAAU/1-198AVKHIDGLITSGNEFS.K--------------------------NQTLEETKQFFEHAKTFLEQEYGK.DNLLYATVHMD
Q48524_LACCA/1-194AVLVNEWIISSDSHFF.A--------------------------DLTAADMRKYFETAKDYFAEKFGE.ENIRYAIVHLD
B6FKS6_9FIRM/6-219ATLFNEIVIDVNTMYFER--------------------------NGGYEYAKQFYEEAFHFIEEKFGA.DNVISAVMHAD
Q52050_BUTFI/1-198AVVCIDGLYTASPEFF.E--------------------------GKTKEECMEYFKDCLEYHEKTYG...VTINAVIHFD
PREA_LACPN/1-194AVLVNEWIITSDKDFF.E--------------------------QLDEAETRKYFETAKQYFADNYGD.ENIRYAVVHMD
P71520_MARHA/20-221PQQEMIVQIGEQDQFQDN--------------------------EPNREMAKEVLQEWFQEFQQRNPQ.LKMYNAVIHDD
Q53620_STAAU/1-198AIKHIDGLITSDNDFF.D--------------------------NQTPEDTKQFFEYAKEFLEQEYGK.DNLLYATVHMD

PF01446

G8PF48_PEDCP/80-316YNQHLHVLLFVRSSYFKS--------------------------SDSYINQEEWTRLWQKALKVDYEPVVHVQVVKANKR

PF02217

LT_POVBO/129-222RTYNCFIIFTTAEKGK-----------------------------------ELYPCIQ.....AAYKC-TFIAL.YMYNG
LT_POVMK/151-247KTLPCFLIYTTLEKVE-----------------------------------LLYNKLS....EEVLSP-RFNQVDHKYGR
Q80FI2_9VIRU/134-228SCPEVHLLITSNSKLQ-----------------------------------ELQPLIL.....QHFST-KGYVT.AQWAG
Q9DPC0_POVJC/137-230KTVASFAVYTTKEKAQ-----------------------------------ILYKKLM.....EKYSV-TFISR.HGFGG
LT_POVLY/200-298KTMNSFLIYTTLEKAR-----------------------------------QLYKTVEKSKIVVDFKA-SFSYQ.DEEGE
Q20HY2_9VIRU/139-233SCPEGHLVVTTHQKLQ-----------------------------------ELQSSLL.....NHFDT-AGHLV.CKWGT
Q9J7C9_SV40/136-229RTLACFAIYTTKEKAA-----------------------------------LLYKKIM.....EKYSV-TFISR.HNSYN
Q20HX6_9VIRU/120-214SCPDAHLIITTCNKLQ-----------------------------------NLRPQLM.....TNFTT-RGHIQ.AVWDS
LT_POVHA/261-354KTQNAFIIYSTKEKCE-----------------------------------VLYEQI......DKYNP-DYKGI.FIMKQ
B9A7H1_BFPYV/111-204SCPDCHLLITSITKMP-----------------------------------QLKAHLY.....EHFGI-KGHML.AHWTG
LT_POVMC/285-377KTFPAFLVYSTKEKCK-----------------------------------QLYDTI......GKFRP-EFKCL.VHYEE

PF00799

REP_TPCTV/8-120ELHE------------N.--GEPHLHVL-----IQFEG------------------------------------------
REPA_MSVS/10-117EAHK------------D.--GSLHLHAL-----LQTEK------------------------------------------
REP_BGYMJ/7-119ERHD------------N.--GEPHLHAL-----IQFEG------------------------------------------
REP_BCTVC/7-119ELHE------------D.--GQPHLHVL-----LQLEG------------------------------------------
U9TRZ4_RHIID/23-135EHLT------------D.--GGLHIHVL-----IKLDK------------------------------------------
REPE_ONYPE/14-143ENHQ------------DH--KGKHHHVF-----FQLNK------------------------------------------

PF05840

VGA_BPG4/115-441SSSDCYQYFCVPEYGTQH--GRLHFHAV-----HLMRTLPLGSLDPNFGKLVRI-NRQINSLQNTWPYGYSMPIAVRYSQ
A0A0E2J468_CHLPS/74-400SHADCYQYFCVPEYGTAN--GRLHFHAV-----HFMRTLPTGSVDPNFGRRVRN-RRQLNSLQNTWPYGYSMPIAVRYTQ
VGA_BPPHK/49-381SYNDCYRYLCVPEFGGQH--GRLHWHVV-----HMVRTLPLGSHDPNFGRPVRN-YRQINSFRGMWPYGFTQPIAVRYQH
A9ZT18_9CAUD/122-510PHHD..............--GTPHWHLL-----IWVRK..............ED-ISAVRDTFITY........ATEEDR
VPA_BP186/139-507PHHD..............--GTPHWHML-----MFMLP..............ED-VERVRLIIRDY........AWEEDH
VPA_BPP2/133-515PHHD..............--GTPHWHMM-----LFCNP..............RQ-RNQIIEIMRRY........ALKEDG
ENDP2_SALTI/193-568PHHD..............--GTVHWHLL-----CFMRK..............KD-RRSITALLRKF........AIREDR
Q8XBG0_ECO57/179-564PHHD..............--GTVHWHMM-----VFAHP..............EE-IDTIVSHTRDI........AIQEDR
P12_BPPM2/101-478PHHD..............--ATPHWHML-----LFMLP..............EH-EQVTTKALRGY........AMQIDG
REP_BPHC1/204-578PHKD..............--GTPHWHAL-----AYVPA..............EH-KEEVIRLFKQK........ALELDG
O80256_9VIRU/150-506PHHD..............--GTPHNHFL-----FFMLP..............EH-ESVVTRILGDC........ALSDSP

PF02407

MREP_SCSVF/5-83N-------------------GTIHYQGY-----VEMKK------------------------------------------
REP6_SCSVF/6-86.-------------------GHDHLQGF-----IQFKS------------------------------------------
REP2_SCSVF/2-88T-------------------GQKHLQGF-----VSFKN------------------------------------------
MREP_BBTVA/6-83E-------------------GTRHVQGY-----VEMKR------------------------------------------

PF07232

Y35K_HALSI/1-316EPHE-------......S--GYVHIHLG-----VFVRG---------PVVAEQF-EPVLDAHLRNCPTAGEDAHQ.VFDE
Y36K_HALSN/1-328EPTT-------PAGNGPA--GYAHIHLG-----VFVKG---------PVVAEQF-QDVLDAHVKNSEGAGREAHRAVVED

PF08724

A7LIB2_9VIRU/14-197G..S----------------EYIHLHCC-----IAQGN--------------VR-SFVLGRYMSQI--------------
Q9WKM1_PAVHB/3-177NKFE----------------EGYHIHVV-----IGGPG--------------LN-PRNL...TVCV--------------
Q8JQG1_9VIRU/4-192G..E----------------SYFHLHVL-----VETTG--------------VK-SMVLGRFLSQI--------------
Q7TG44_9VIRU/4-191G..E----------------VFFHLHVL-----LETCS--------------VK-PMVLGRYIRHI--------------
Q9J0X5_9VIRU/3-177NHFD----------------EGFHVHVV-----VGGPF--------------VT-PRNV...CNIV--------------
Q9J0X7_9VIRU/3-177NHYD----------------AGFHVHIV-----IGGPF--------------IN-ARNV...CNAV--------------
Q6JL80_9VIRU/4-189G..S----------------EYFHLHTL-----VETSG--------------IS-SMVLGRYVSQI--------------
VU94_HHV6Z/17-203K..A----------------GRPSLTLL-----IALDG--------------IP-TATIGKHTTEI--------------
Q88271_9VIRU/3-177NHFD----------------NGFHIHVV-----IGGPF--------------LT-PRNV...CSAV--------------

PF03389

C4YZP3_9RICK/17-222DNS.................NNPHVHFQ-----FLERR--------------LERLKNEEVVFAK.------------..
TRAA_AGRFC/17-243NP..................GNPHIHLM-----TTLRP--------------LT.EDG...FGAK.------------KV
D4LKI8_9FIRM/17-286TDG.................HNPHAHIL-----LTVRP--------------LN.ENG...TWQY.------------KT
B0T9A7_CAUSK/17-219PDAHGDA.............RNHHAHIL-----VTTRR--------------VG.PEG...F....------------..
R5L7A7_9FIRM/19-253KE..................GNHHVHCM-----CTMRA--------------FN.KDG...SWSN.------------MR
TRAA_RHISN/17-243AP..................GNPHVHLM-----TTLRP--------------LT.ADG...FGAK.------------KL
Q2KC95_RHIEC/17-258KD..................GNPHAHVM-----TTLRP--------------LA.EEG...FGRK.------------RV
B7KN07_CYAP7/17-212MNS.................HNPHVHIL-----LTTRE--------------IT.PLG...L....------------..
D5HHM6_9FIRM/55-279KGT.................GNPHVHIM-----LTLRP--------------LK.ENG...QWGA.------------KC
D6DI62_CLOSC/17-286TDG.................HNPHAHIL-----LTVRP--------------LD.EQG...KWQY.------------KT
A9HLM3_GLUDA/17-229PSRTGDD.............RNHHAHLM-----ATTRI--------------VTIENGKPVF....------------..
D4LM09_9FIRM/19-247GKSKDGD...........EPDNPHFHVL-----APIRP--------------FT.EEG...IWGN.------------KQ
D4JZW7_9FIRM/17-288PYPPG...............HNPHAHIM-----LTVRP--------------LD.EKG...NWKY.------------KT
Q11MR5_CHESB/17-249KD..................GNPHIHLM-----TTLRP--------------LT.DDG...FGNK.------------KV
B1X3B9_CYAA5/17-213INT.................HNPHVHIM-----ITTRI--------------VD.ENG...L....------------..
D4JZZ9_9FIRM/19-243KGD.................GNPHAHIL-----LTLRA--------------MD.EHG...KWLP.------------KA
Q8KIN6_RHIEC/17-249KD..................GNPHIHLM-----TTLRP--------------LT.EEG...FGAK.------------KV
A4YML6_BRASO/18-217DRAEDGL.............PKPHAHVM-----LTMRA--------------VD.ENG...F....------------..
I4DCV2_DESAJ/17-214LDG.................ENPHAHVM-----LTTRE--------------IG.PEG...F....------------..
C7JJ99_ACEP3/17-217DIGEDGQ.............AKPHAHVM-----LSTRS--------------VD.ENG...F....------------..
F8C170_OLICO/17-243DP..................GNPHVHLM-----TSLRP--------------LT.EDG...FGPK.------------RV
B0S201_FINM2/20-247PMASDHE.............EQPHAHIL-----LTLRE--------------ID.EKG...NWKP.------------KC
D4JD91_9FIRM/17-307KGD.................GNPHVHLL-----LTMRP--------------FN.PDH...SWGK.------------KE
G2SZV4_ROSHA/17-288PYPPG...............HNPHAHIL-----LTVRP--------------LD.EKG...KWQY.------------KT
G2I8U9_KOMMN/17-219PGREGDN.............RNHHAHIL-----TTTRT--------------VG.ENG...L....------------..
B0T9Q2_CAUSK/17-219PGKEGDQ.............RNFHAHIM-----VTTRR--------------VD.RAG...F....------------..
C4YZX3_9RICK/17-223DNP.................DNPHVHFQ-----FLERI--------------LERLDDGVVVFAK.------------..
D6GRF6_FILAD/17-241KND.................GNPHCHIL-----ITMRP--------------LN.EDK...TWGA.------------KS
D4KAU2_9FIRM/17-241KGD.................GNPHAHVM-----LTMRA--------------MD.ERG...KWLP.------------KS
D4MXT5_9FIRM/18-307KGD.................GNPHVHLL-----VTMRP--------------FN.PNH...SWGN.------------KE
C0QML1_DESAH/17-230GHTDKDTGESN.........DNRHAHLL-----TTTRP--------------MI.QAG........------------..
R6LS79_9FIRM/20-249PDKEDGG............ISNPHFHVM-----CPIRP--------------IE.PGG...KWGN.------------KQ
K9SN36_9CYAN/17-213FDG.................NNPHAHIL-----FTVRP--------------ID.ENG...F....------------..
Q1QF79_NITHX/18-243EP..................GNPHVHLM-----TTLRP--------------LI.ESG...FGGK.------------KV
G2ILJ4_9SPHN/17-216DVGADGL.............AKPHAHVM-----LTMRE--------------VS.PDG...F....------------..
E8RPW5_ASTEC/17-230PDEAMDE.............RNHHAHIL-----ITTRE--------------VT.ANG...L....------------..
R7B4C7_9CLOT/17-288PHSPG...............HNPHAHIM-----LTVRP--------------LD.EQG...NWQY.------------KT
G9WII5_9LACT/17-241DHP.................DNPHAHVM-----LTNRP--------------FN.PDG...TWGI.------------KS
A5V2N3_SPHWW/17-216DVGADGE.............AKPHAHVM-----LTMRE--------------VG.PDG...F....------------..
MOBA_BIFLO/19-253DGQG................NNPHAHIL-----VANRQ--------------IDPKTG...GWAKL------------KQ
C5B6Q9_METEA/17-230PHGDTDV.............RNHHAHLM-----MTVRR--------------VG.VDG...L....------------..
C5B6U1_METEA/17-216DQAADGS.............YKPHAHVL-----LTLRA--------------VG.PEG...F....------------..
B9K371_AGRVS/17-242AT..................GNPHLHLM-----TSLRP--------------LT.NDG...FGGK.------------KV
G8PF77_PEDCP/12-236DHP.................DNPHAHVM-----LTNRP--------------FN.PDE...TWGL.------------KS
A1VX68_POLNA/17-235PHKKENQSKRKDAAVENGDSRNHHAHIL-----CSTRK--------------LT.AEG...F....------------..
Q03N47_LACBA/17-240DHP.................DNPHAHVM-----LTNRP--------------FN.PDG...TWGL.------------KA
C7RI54_ANAPD/18-245ESREGN..............QNIHAHIM-----TIVRP--------------IN.EDG...TWGQ.------------KS
D4KA38_9FIRM/17-241KGN.................GNPHAHIL-----LTMRA--------------MD.ENG...KWLP.------------KS
Q7CW18_AGRFC/17-228PSEHGDI.............RNHHAHVL-----MTTRQ--------------VG.KAG...L....------------..

PF03432

Q9WW30_PEDPE/8-248....T---------------NALHVHAV-----IGAID--------------LE-T...GRKMHGN............WQ
D2JCN4_STAEP/8-236....T---------------DHVHNHIV-----INSID--------------LE-T...GKKFNNN............K.
Q56424_BACFG/7-242....R---------------EHPHCHIV-----FNRVD--------------ND-....GKTISDK............N.
VIRD2_RHIRD/16-264....R---------------DHPHLHVV-----VNRRE--------------LL-GHGWLKISRRH............PQ
A0A015PKP4_BACFG/7-242TESKK---------------EQAHLHIL-----ANRVS--------------LS-....GELYRDN............W.
Q9ZIP2_FUSNU/13-276....K---------------GHIHNHII-----INTVN--------------ID-T...GMKFREL............NK
A6H977_9ZZZZ/12-252....T---------------DNLHIHIA-----INKIH--------------PT-R...NTIHEPY............R.
Q4FIJ3_SALCE/61-315....T---------------DNLHVHVA-----VNRVH--------------PE-T...GYLNRLS............W.
Q9Z361_STAEP/8-242....T---------------DHVHNHIV-----MNSID--------------LE-T...GKKFNNN............K.
LTRB_LACLM/34-307....R---------------EHIHNHII-----FNSTN--------------LY-T...GKQFDWKVIPKEKTKSGKAYD
Q9XAW2_PSEAC/12-285....T---------------DNVHGHFM-----VNRVN--------------PE-T...YKAVYPD............R.
B3H352_ACTP7/14-247....K---------------GRLELNFV-----IPNVE--------------MT-S...GKRLQPY............YD
TRAI5_ECOLX/12-252....T---------------DNLHIHIA-----INKIH--------------PT-R...HTMHEPY............Y.
Q54883_STREE/11-264....K---------------GHIHNHII-----LNSID--------------QN-S...DKKFLWD............Y.
RLX1_STAAU/8-238....K---------------DHYHNHII-----INSVN--------------LE-T...GNKYQSN............K.
A9CQY2_STAAU/8-239....K---------------DHYHNHIV-----INSVD--------------LE-T...GKKYQSN............K.
K7VR95_LACLC/9-280G..KN---------------HVLHNHII-----VNKVN--------------LE-T...GKKLREQ............KG

PF01076

65KD_ZYMMA/1-192ET..........--------.TPHLTGF.......MVP--------------RD-PDT....GRLN--------------
O87277_9STAP/1-193EQ..........--------.TPHMHLG.......VVP--------------MR-DG......KLQ--------------
P71098_BACTI/20-220EA..........--------.SPHMHLNFVPVASGYKR--------------GL-EKQ.....VSF--------------
O32791_9LACT/1-193ET..........--------.TPHMHLG.......IVP--------------FN-DEH.....KLS--------------
Q45448_BACIU/1-193EA..........--------.TPHMHVG.......IVP--------------IT-EDG.....RLS--------------
PRE_STRAG/1-194ES..........--------.TPHMHMG.......VVP--------------FE-NG......KLS--------------
PRE1_STAAU/1-198ER..........--------.VPHMHFG.......FVP--------------LT-EDG.....RLS--------------
A0A0F6IVM1_BACTU/1-192EA..........--------.TPHMHIG.......VMP--------------IT-EDN.....RLS--------------
Q52058_9ZZZZ/3-190EA..........--------.TPHLHMI.......FMP--------------LK-EKK.....LNA--------------
Q09026_OENOE/1-199EVD.........--------DNGIQHPGLH...VDLVP--------------MT-KNG.....KLS--------------
Q53618_STAAU/1-198EK..........--------.TPHMHYG.......VVP--------------IT-EDG.....RLS--------------
Q48524_LACCA/1-194ES..........--------.TPHMHMG.......IVP--------------FD-DEH.....KLS--------------
B6FKS6_9FIRM/6-219EINVAATEELGK--------EVYHYHLHA.....MVLP--------------VV-EKEILWSKRCK--------------
Q52050_BUTFI/1-198EA..........--------.TPHMHCQS....VPLVE--------------RE-DGS....FKLC--------------
PREA_LACPN/1-194EK..........--------.TPHMHMG.......IVP--------------FD-DDK.....KLS--------------
P71520_MARHA/20-221EA..........--------.SPHMHMNFVPVATGYKK--------------GM-DTQ.....VSF--------------
Q53620_STAAU/1-198EK..........--------.TPHMHYG.......VVP--------------IT-DDG.....RLS--------------

PF01446

G8PF48_PEDCP/80-316KGT-----------------DSLQASAE------ETAK--------------YE-VKSADYMTVDD--------------

PF02217

LT_POVBO/129-222--------------------DSV.LYIITVG.KHRVNA--------------ME--------------------------
LT_POVMK/151-247--------------------KYVPIFIITGT.KHRVSA--------------VF--------------------------
Q80FI2_9VIRU/134-228--------------------GYAFMLIILAN.STRVST--------------LI--------------------------
Q9DPC0_POVJC/137-230--------------------HNI.LFFLTPQ.RHRVSA--------------IN--------------------------
LT_POVLY/200-298--------------------GCL.LFLITLG.KHRVSA--------------VK--------------------------
Q20HY2_9VIRU/139-233--------------------DFAIMLIILTT.GTRIST--------------VL--------------------------
Q9J7C9_SV40/136-229--------------------HNI.LFFLTPH.RHRVSA--------------IN--------------------------
Q20HX6_9VIRU/120-214--------------------SYA.LFVILMERPTRVST--------------VG--------------------------
LT_POVHA/261-354--------------------TEAFVMFMTPG.KHRVAA--------------VK--------------------------
B9A7H1_BFPYV/111-204--------------------IAL.LVLQLEK.PTRIST--------------VH--------------------------
LT_POVMC/285-377--------------------GGM.LFFLTMT.KHRVSA--------------VK--------------------------

PF00799

REP_TPCTV/8-120--------------------------KFNCKNQRF----------F----------------------------------
REPA_MSVS/10-117--------------------------PVRISDSRF----------F----------------------------------
REP_BGYMJ/7-119--------------------------KFICTNKRL----------F----------------------------------
REP_BCTVC/7-119--------------------------KVQITNIRL----------F----------------------------------
U9TRZ4_RHIID/23-135--------------------------KIDLRDGRF----------F----------------------------------
REPE_ONYPE/14-143--------------------------QFRTRDLTI----------F----------------------------------

PF05840

VGA_BPG4/115-441DAFSRAGWL................WPVDSKGEPLKATSYMAVGFYVA--------------------------------
A0A0E2J468_CHLPS/74-400DAFSRSGWL................WPVDAKGEPLKATSYMAVGFYVA--------------------------------
VGA_BPPHK/49-381DAYSRKGWL................WPVDKSGKAMQSKPYQAVAWYVT--------------------------------
A9ZT18_9CAUD/122-510GELHPEFEKEKQKPFRKGVYVGPLDYRPRCDFGYIDPTKGTATG.YIA--------------------------------
VPA_BP186/139-507YELRSDKAK.................KARFHAEAIDPEKGSATG.YVA--------------------------------
VPA_BPP2/133-515DE...RGAA.................RNRFQAKHLN..QGGAAG.YIA--------------------------------
ENDP2_SALTI/193-568EELGANT...................GPRFKPELINPRKGTPTS.YIA--------------------------------
Q8XBG0_ECO57/179-564HELGDDI...................TPRFKAEYVDGSKGTPTX.YIA--------------------------------
P12_BPPM2/101-478DE...KGAE.................QARFTAENIDPSKGSAVG.YIA--------------------------------
REP_BPHC1/204-578NE...KGAA.................EHRCKVEKCDKTKGSATA.YIA--------------------------------
O80256_9VIRU/150-506NE...SGAK.................KYRFKAEKIDFKKGSAVG.YVA--------------------------------

PF02407

MREP_SCSVF/5-83--------------------------------------------------------------------------------
REP6_SCSVF/6-86--------------------------------------------------------------------------------
REP2_SCSVF/2-88--------------------------------------------------------------------------------
MREP_BBTVA/6-83--------------------------------------------------------------------------------

PF07232

Y35K_HALSI/1-316NGDEDAV-------------------RVRRSSHPSRSGGVENLGAYLA--------------------------------
Y36K_HALSN/1-328DEDEAAV-------------------SIRRSARPDREDGIENLGAYLA--------------------------------

PF08724

A7LIB2_9VIRU/14-197--------------------------KDSIIRDVYEGKQIKIPDWFAI--------------------------------
Q9WKM1_PAVHB/3-177--------------------------EGLFNNVLYHLVTENVKLKFLP--------------------------------
Q8JQG1_9VIRU/4-192--------------------------REKLVQTIYRGVEPTLPNWFAV--------------------------------
Q7TG44_9VIRU/4-191--------------------------QQKIVSKVYCATSLRWKDGCVV--------------------------------
Q9J0X5_9VIRU/3-177--------------------------ETGFNKVLRELTEPTYEVSFKP--------------------------------
Q9J0X7_9VIRU/3-177--------------------------ETTFNKVLGDLTDPSMSVQFKP--------------------------------
Q6JL80_9VIRU/4-189--------------------------RAQLVKVVFQNIEPRINDWVAI--------------------------------
VU94_HHV6Z/17-203--------------------------RGVLIKDFFDGNAPKIDDWCTY--------------------------------
Q88271_9VIRU/3-177--------------------------EGGFNKVLADFTSPTITVQFKP--------------------------------

PF03389

C4YZP3_9RICK/17-222..............................RKDGEL............................................
TRAA_AGRFC/17-243AVI...........................GEDGQLVR.....TKSGKIL..............................
D4LKI8_9FIRM/17-286EKEYLC........................IKDGEEKGFTASEFKDAQKEGWEKQYRYKAGKKKVYLTPSAAQEKGYERI
B0T9A7_CAUSK/17-219.................................GLK............................................
R5L7A7_9FIRM/19-253KTEFAR........................DDNGNKIPLLDENGKQKVRIRKGKGEEKLWKRIDVI..............
TRAA_RHISN/17-243AVV...........................GPDGNSLR.....NDAGKIV..............................
Q2KC95_RHIEC/17-258TIM...........................GEDGKPLRVVTPDSPNGRIV..............................
B7KN07_CYAP7/17-212.................................GSK............................................
D5HHM6_9FIRM/55-279RKAYDL........................DENGQRIPDGKGGWKNHRED..............................
D6DI62_CLOSC/17-286EKEYLC........................MKNGEERGFTAAEFRAAQNEGWEKQYPYKVGKKKVYMTPSAAEAQELIRA
A9HLM3_GLUDA/17-229.................................GAKA...........................................
D4LM09_9FIRM/19-247KREYVL........................DEEGNRIKDAKGKYVFNAVS..............................
D4JZW7_9FIRM/17-288QKEYLC........................VKNGEEQGFTADEFKTAQTEGWEKQYQYKVGKKKVYMTASAAEEKGYERV
Q11MR5_CHESB/17-249AVL...........................GDDGKPLRVVTPDRPKGKIV..............................
B1X3B9_CYAA5/17-213.................................GAK............................................
D4JZZ9_9FIRM/19-243RKVYDL........................DENGERIRLPSGNWKCHKEN..............................
Q8KIN6_RHIEC/17-249PVL...........................GEGGKPLRVVTPDRPNGKIV..............................
A4YML6_BRASO/18-217.................................GQK............................................
I4DCV2_DESAJ/17-214.................................GKK............................................
C7JJ99_ACEP3/17-217.................................GAK............................................
F8C170_OLICO/17-243HVV...........................GEDGATLR.....GRTGKIV..............................
B0S201_FINM2/20-247RKEYIL........................DENGEKIKLKSGNYKSRKVN..............................
D4JD91_9FIRM/17-307VKDWDFVRDKNGNIVIDESHPNWWQDKKNPDRHGIRIPVLDENGIQKIGARNRLQWKRVLTD..................
G2SZV4_ROSHA/17-288EKEYLC........................VKDGEEQGFTAAEFKQAQADGWEKQYQYKVGKKKVYMAPSAAQAQGYERV
G2I8U9_KOMMN/17-219.................................GAK............................................
B0T9Q2_CAUSK/17-219.................................GGK............................................
C4YZX3_9RICK/17-223..............................RKDGEL............................................
D6GRF6_FILAD/17-241KKEYIL........................DENGEKIKLKNGNYKTRKIN..............................
D4KAU2_9FIRM/17-241RKVYEL........................DKNGERIKLPSGRWKSHKED..............................
D4MXT5_9FIRM/18-307VKDWDFVRDTDGNIVVDESHPDWWQDKKNPDRHGIRIPVLDENGVQKVGARNRKQWKRVLTD..................
C0QML1_DESAH/17-230..............................TALGPDKC..........................................
R6LS79_9FIRM/20-249QREYLL........................DEHGDRIRDEAGNYVFNAVP..............................
K9SN36_9CYAN/17-213.................................GKK............................................
Q1QF79_NITHX/18-243AVT...........................GEDGKPLR.....TQAGKIR..............................
G2ILJ4_9SPHN/17-216.................................GQK............................................
E8RPW5_ASTEC/17-230.................................GEKS...........................................
R7B4C7_9CLOT/17-288EKEYLC........................VRNGEERGFTAAEFKAAQADGWEKQYPYKVGRKKVYMPSSEADKHGYERA
G9WII5_9LACT/17-241KKQYIL........................DKNGNKTYTGTSKYPKSRKML.............................
A5V2N3_SPHWW/17-216.................................GAK............................................
MOBA_BIFLO/19-253RMEYVL........................DERGERVPLIDPKTGAQKLDKRG...........................
C5B6Q9_METEA/17-230.................................GEKT...........................................
C5B6U1_METEA/17-216.................................GAK............................................
B9K371_AGRVS/17-242AIL...........................DANGQPQR.....SKSGQIQ..............................
G8PF77_PEDCP/12-236KRENIL........................DENGNKTYTGNSRFPKSRKVW.............................
A1VX68_POLNA/17-235.................................TVK............................................
Q03N47_LACBA/17-240KTQYIK........................DENGKQLLT.KSGFPKQRKIW.............................
C7RI54_ANAPD/18-245KKEYIL........................DEKGEKVLNKNGKPKTRKVE..............................
D4KA38_9FIRM/17-241RKVYDL........................DENGERIRLPSGSWKSHKED..............................
Q7CW18_AGRFC/17-228.................................GEKT...........................................

PF03432

Q9WW30_PEDPE/8-248EYREKL------------------------VHNTDEISQEHGLEVTQVD.....PNRYEKRTMAEIKMQA..........
D2JCN4_STAEP/8-236KALHDI------------------------RQANDEICVSHNLSIPEE.......KAKLRYTQAEYSVLN..........
Q56424_BACFG/7-242.DFYRN------------------------EKVCKMLTAKYRLHFANG...........KDNIKEERLRP..........
VIRD2_RHIRD/16-264LNYDGL------------------------RKKMAEISLRHGIVLDAT.............SRAERGIAER.........
A0A015PKP4_BACFG/7-242.IGKKA------------------------TEAANAIAKERNFVQSQ.................DIGKVN..........
Q9ZIP2_FUSNU/13-276NEYNQK------------------------KENNVELKSHEFYLEDLKKSSDEICLANNLSVIPQKEKAESQNIYN....
A6H977_9ZZZZ/12-252.AYRAL------------------------ADLCATLERDYGLERDN.......HETRQRVSENRANDMER.........
Q4FIJ3_SALCE/61-315.SQEKL------------------------SRACRELELKHGFAPDNGCW...VHAPGNRIVRKTAVERDRQ........
Q9Z361_STAEP/8-242QALRNV------------------------RNFNDEVCMEHGLSVPDKD......TARLRYTQTEKAIAD..........
LTRB_LACLM/34-307VTKNNF------------------------EKVSDKIASRYGAKIIEK.......SPGN..SHLKYTKWQ..........
Q9XAW2_PSEAC/12-285.DYFKL------------------------DKTMREMELRQGWSHDKGPY...AVHERNGQKVVDWAKDEPSHRQPDREK
B3H352_ACTP7/14-247RADRPL------------------------AENFKQVINHEYSLSDPN.......NPIKQKNLIDRKDLP..........
TRAI5_ECOLX/12-252.PHRAL------------------------AELCTALERDYGLERDN.......HEPRKRGAEGRAADMER.........
Q54883_STREE/11-264KAEHNL------------------------RMVSDRLSKIAGAKIIEN...........RYSHRQYEVYR..........
RLX1_STAAU/8-238EQRDFI------------------------KKANDQLCEERGLSVPEK.......SSEIRYTLAEQNMI...........
A9CQY2_STAAU/8-239KQRDLV------------------------KKENDNICREHGLSVTERG......IAKMRYTQAEKGIVF..........
K7VR95_LACLC/9-280ESVQRA------------------------REMNDRLASRENWHILEP........PKERQTETEKELIA..........

PF01076

65KD_ZYMMA/1-192--------------------------------------------------------------------------------
O87277_9STAP/1-193--------------------------------------------------------------------------------
P71098_BACTI/20-220--------------------------------------------------------------------------------
O32791_9LACT/1-193--------------------------------------------------------------------------------
Q45448_BACIU/1-193--------------------------------------------------------------------------------
PRE_STRAG/1-194--------------------------------------------------------------------------------
PRE1_STAAU/1-198--------------------------------------------------------------------------------
A0A0F6IVM1_BACTU/1-192--------------------------------------------------------------------------------
Q52058_9ZZZZ/3-190--------------------------------------------------------------------------------
Q09026_OENOE/1-199--------------------------------------------------------------------------------
Q53618_STAAU/1-198--------------------------------------------------------------------------------
Q48524_LACCA/1-194--------------------------------------------------------------------------------
B6FKS6_9FIRM/6-219--------------------------------------------------------------------------------
Q52050_BUTFI/1-198--------------------------------------------------------------------------------
PREA_LACPN/1-194--------------------------------------------------------------------------------
P71520_MARHA/20-221--------------------------------------------------------------------------------
Q53620_STAAU/1-198--------------------------------------------------------------------------------

PF01446

G8PF48_PEDCP/80-316------------------------------ERNLVVIKNLEYALAGTR--------------------------------

PF02217

LT_POVBO/129-222--------------------------------------------------------------------------------
LT_POVMK/151-247--------------------------------------------------------------------------------
Q80FI2_9VIRU/134-228--------------------------------------------------------------------------------
Q9DPC0_POVJC/137-230--------------------------------------------------------------------------------
LT_POVLY/200-298--------------------------------------------------------------------------------
Q20HY2_9VIRU/139-233--------------------------------------------------------------------------------
Q9J7C9_SV40/136-229--------------------------------------------------------------------------------
Q20HX6_9VIRU/120-214--------------------------------------------------------------------------------
LT_POVHA/261-354--------------------------------------------------------------------------------
B9A7H1_BFPYV/111-204--------------------------------------------------------------------------------
LT_POVMC/285-377--------------------------------------------------------------------------------

PF00799

REP_TPCTV/8-120------------------------------------DLVSPTRST.............HFHPNIQ.....GAKS---SSD
REPA_MSVS/10-117------------------------------------DING...................FHPNIQ.....SAKS---VNR
REP_BGYMJ/7-119------------------------------------DLVSTTRSA.............HFHPNIQ.....GAKS---SSD
REP_BCTVC/7-119------------------------------------DLVSPTRSA.............HFHPNIQ.....GAKS---SSD
U9TRZ4_RHIID/23-135------------------------------------DIVDGDGET.............VYHPSVE.....ECKN---FNA
REPE_ONYPE/14-143------------------------------------NIPKNIKEKKLIDHENIKIKDFFYSPHIEPRPGNPIKD---TTD

PF05840

VGA_BPG4/115-441--------------KYVNKKSDID............MAVKGLGNK-------------EWNNSLKTKINLIPKK---VFR
A0A0E2J468_CHLPS/74-400--------------KYVNKKSDMD............LAAKGLGAK-------------EWNNSLKTKLSLLPKK---LFR
VGA_BPPHK/49-381--------------KYVAKQSDQR............QKAITERQK-------------KCKNPLMA...ICLKK---EFR
A9ZT18_9CAUD/122-510--------------KYISKNIDGYAMDG........DISDET.GK-------------PVKDMARN..VSAWKS---RWS
VPA_BP186/139-507--------------KYISKNIDGYALDG........ETDDES.GE-------------LLKETAPA..VSAWAA---RWH
VPA_BPP2/133-515--------------KYISKNIDGYALDG........QLDNDT.GR-------------PLKDTAAA..VTAWAS---TWR
ENDP2_SALTI/193-568--------------KYISKNIDGRGLAK........EISKET.GR-------------SLRDSAEH..VSAWAS---LHR
Q8XBG0_ECO57/179-564--------------TYIGKNLDSRAVDGIDPKTGKPRVDHET.GK-------------SMTESVER..AIGWAR---LHR
P12_BPPM2/101-478--------------KYISKNINANHIEG........EKDNETGGE-------------FNNENGLVLNVGAWAS---RWR
REP_BPHC1/204-578--------------KYIAKNIDGFALAG........EVSDEDPTL-------------SLHDNALR..VRAWAS---RWG
O80256_9VIRU/150-506--------------KYLSKNIDGQHI..........DFDRNS.NK-------------SGTEAAQS..VVSFNR---LNG

PF02407

MREP_SCSVF/5-83------------------------------------R.TSLVQMK-------------KLLPG..AHLEKRRGS---QGE
REP6_SCSVF/6-86------------------------------------RNTTLRQAK-------------YIFNGLNPHLEIAR.D---VEK
REP2_SCSVF/2-88------------------------------------K.IRLGGLK-------------KKFGN.RAHWEIARGS---DSQ
MREP_BBTVA/6-83------------------------------------R.SSLKQMR-------------GFFPG..AHLEKRKGS---QEE

PF07232

Y35K_HALSI/1-316--------------AYMAGEYGSEPSEMPENVRAFYATMWASGRQ-------------WFRPSNGAQELMQPEEDDEGDS
Y36K_HALSN/1-328--------------AYMAGEYGVEALAMPAHVRAFYAAMWATGTQ-------------WFRPSNGAQRHMQPES.DDEES

PF08724

A7LIB2_9VIRU/14-197--------------TKTKR..GGQNK----------TVTAAYILH-------------YLIPKKQPELQWAFTN------
Q9WKM1_PAVHB/3-177--------------GMTTK...GKYF----------RDGEQFIEN-------------YLMKKIPLNVVWCVTN------
Q8JQG1_9VIRU/4-192--------------TKTRNGAGGGNK----------VVDECYIPN-------------YLLPKTQPELQWAWTN------
Q7TG44_9VIRU/4-191--------------TKTKN.FGGANK----------VRAESYIPA-------------YLIPKQQPEVQWAWTN------
Q9J0X5_9VIRU/3-177--------------AISKK...GKYA----------RDGFDFVTN-------------YLMPKLYPNVVYSVTN------
Q9J0X7_9VIRU/3-177--------------AVSKK...GEYY----------RDGFDFVTN-------------YLMPKLYPNVIYSVTN------
Q6JL80_9VIRU/4-189--------------TKVKK..GGANK----------VVDSGYIPA-------------YLLPKVQPELQWAWTN------
VU94_HHV6Z/17-203--------------AKTKK.NGGGTQ----------VFSLSYIPF-------------ALLQIIRPQFQWAWTN------
Q88271_9VIRU/3-177--------------AVSKK...GKYH----------RDGFDFVTY-------------YLMPKLYPNVIYSVTN------

PF03389

C4YZP3_9RICK/17-222..................SRRK............FLANLRHQCEV-------------EINKVYEEA---GLPF---..K
TRAA_AGRFC/17-243...............YELWAGSTD..........DFNVVRDGWFE-------------RLNHHLTLG---GIDL---..K
D4LKI8_9FIRM/17-286DKHPKSTRYGRQNPISEQWNSE....E.......QLCLWRANWAD-------------AVNKMLALN---QINA---..A
B0T9A7_CAUSK/17-219...............AREWDNP....D.......AVKALRLEWAQ-------------IQNLHLRQH---LGPE---APQ
R5L7A7_9FIRM/19-253...............QNQWNSK....E.......QLKEWRKNWAD-------------YCNKFLIE.---..EQ---..K
TRAA_RHISN/17-243...............YELWAGSLD..........DFNAFRDGWFA-------------CQNRHLALA---GLDI---..R
Q2KC95_RHIEC/17-258...............NRVWAGDRE..........TMKAWKIAWAE-------------TANRHLALA---GHEI---..R
B7KN07_CYAP7/17-212...............VRDLDKK....D.......FLLQIRESWAN-------------YTNEALSNA---GNTE---..R
D5HHM6_9FIRM/55-279...............TTDWNDK....G.......NVEIWRAAWAA-------------YTNRVLESA---GRPE---..R
D6DI62_CLOSC/17-286DKHPKSTRYGRQNPISERWNSE....D.......QLAAWREAWAD-------------VSNRCLERA---GREE---..H
A9HLM3_GLUDA/17-229...............TFELENRERQRRGLPSTMQEMKGIRREWAD-------------MVNHALELA---GSTE---..R
D4LM09_9FIRM/19-247...............TTGWNDP....E.......LLKEWRKAWTE-------------KVNDKFREC---HMAA---..R
D4JZW7_9FIRM/17-288SKYPKSTKYGRQNPIAERWNSE....E.......QLVLWRAAWAD-------------VTNRHLERA---GHKE---..R
Q11MR5_CHESB/17-249...............YRLWAGDKD..........TMKAWKIGWAE-------------TANKHLALA---GHDI---..R
B1X3B9_CYAA5/17-213...............DRSLDKK....D.......FLLKLRESWAT-------------YTNDALESI---GSSE---..K
D4JZZ9_9FIRM/19-243...............TVDWNDQ....K.......YAEVWRHSWET-------------ITNRYLEAA---GRPE---..R
Q8KIN6_RHIEC/17-249...............YKVWAGDKE..........TMKAWKIAWAE-------------TANRHLALA---GHDI---..R
A4YML6_BRASO/18-217...............VRDWNRT....E.......LVERWRKRWAE-------------LANERLAEL---DIDA---..R
I4DCV2_DESAJ/17-214...............NREWNDR....E.......LLKDWRKEWAE-------------RTNQALEKA---DISE---..R
C7JJ99_ACEP3/17-217...............ERSWNDK....E.......LLLTWRERWAS-------------LANERLAEL---DLDV---..R
F8C170_OLICO/17-243...............YKLWAGDKN..........DFLSVRQGWID-------------LQNHHLALA---GLDV---..R
B0S201_FINM2/20-247...............LNDWNEP....D.......KAKEWRENFSK-------------KANEYLARN---NINK---..R
D4JD91_9FIRM/17-307...............ATGWNNP....K.......NCELWRSEWAK-------------VCNEHLPLH---N...---..Q
G2SZV4_ROSHA/17-288SKYPKSTKYGRQNPITEHWNSD....E.......QLVLWRAAWAD-------------VANRHLERT---GHEE---..R
G2I8U9_KOMMN/17-219...............TRVLDVASTAST.......EIEHMRGVWAR-------------QVNMALERH---QVEQ---..R
B0T9Q2_CAUSK/17-219...............NRDWNHA....S.......FIPQLRAAWSD-------------VQNRHLRHH---LGPD---APQ
C4YZX3_9RICK/17-223..................WKRG............FLCNLMEQCAI-------------EINKVYEEA---GLPY---..V
D6GRF6_FILAD/17-241...............TTDWNEQ....D.......KAEEWRKAWAD-------------ITNKYLEEN---SIQE---..K
D4KAU2_9FIRM/17-241...............TVDWNDR....K.......YGEIWRHEWEV-------------IQNRYLEAN---NRPE---..R
D4MXT5_9FIRM/18-307...............ATGWNNP....K.......NCELWRSEWAR-------------MCNQHLSVD---N...---..Q
C0QML1_DESAH/17-230...............EREWSDKNRKEAGLCYRNVELKQEREEWGT-------------LANKALALA---GEEA---..R
R6LS79_9FIRM/20-249...............TTDWGSP....E.......TLEHWRQAWAD-------------LCNQKFAEK---GLDC---..R
K9SN36_9CYAN/17-213...............VKAWDQK....Q.......TLKLHHKAWAD-------------YVNDALERA---GHDV---..R
Q1QF79_NITHX/18-243...............YALWAGDTP..........DFLAQRARWID-------------LQNQHLALA---GLDV---..R
G2ILJ4_9SPHN/17-216...............ERDWNRT....E.......LVEQWRERWAD-------------HVNARLAEL---DIDA---..R
E8RPW5_ASTEC/17-230...............DLERENKWLKAHDKPTTDAQLKALRLEWEE-------------RTNQALALA---GHDV---..R
R7B4C7_9CLOT/17-288NKHPKSTKFGRQNPIAERWNSE....E.......QLIEWRKAWAD-------------VTNRYLERY---GHDE---..R
G9WII5_9LACT/17-241...............LIDWDKK....E.......KIDEWRHNWAT-------------SVNQVLAQK---NLPD---..R
A5V2N3_SPHWW/17-216...............VRDWNAT....A.......LLQHWREAWAE-------------HVNERCAAL---RIDA---..R
MOBA_BIFLO/19-253...............RRQWKRTSVSLNPLDRKA.KLQSLRESWAK-------------TCNARLDET---A...---..R
C5B6Q9_METEA/17-230...............AIERENKWLLSHDQPTAPMQLRDIRQSWEG-------------IANERMAAA---GLDL---..R
C5B6U1_METEA/17-216...............ERSWNAR....E.......ELVGWRERWAG-------------HVNTRLAEL---GHDV---..R
B9K371_AGRVS/17-242...............YKLWAGDKT..........DFLDLRDAWYA-------------MQNKHLRLN---GHDI---..H
G8PF77_PEDCP/12-236...............LVDWDKK....E.......KINQWRHNWAV-------------SVNQVLEQK---NIPD---..R
A1VX68_POLNA/17-235...............TRELDDRKTGAD.......QVVECRALFAE-------------MTNAALAKA---GHSA---..R
Q03N47_LACBA/17-240...............LVDWDKK....E.......KINEWRHNWAT-------------SVNQSLAQK---NIPD---..R
C7RI54_ANAPD/18-245...............LTTWNDK....G.......NVEKWRENFSD-------------LCNEYLAKN---NIEK---..R
D4KA38_9FIRM/17-241...............TVDWNDQ....K.......YGEIWRQGWAA-------------TANRYLEAN---GRPE---..R
Q7CW18_AGRFC/17-228...............CLEHKNARLLANGMATTDMQLRDIRQSWEG-------------IANRQLQHE---GLDV---..R

PF03432

Q9WW30_PEDPE/8-248............KGQPTWKDQIRQAVDKTMANR.LVTDFQTFRDD-------------LKQKTVDVW...ERGK-----D
D2JCN4_STAEP/8-236........K....GKTSWKDEIRHAIDQSQ.....AASYEELGND-------------LQQNGIKIE..RITDK-----T
Q56424_BACFG/7-242..............YDKAKHEVYKALKGELP...HARSWNELKEA-------------LSERDIELKFKVSRTT-----K
VIRD2_RHIRD/16-264..............PITYAEHRRLERMQAQK.....IQFEDTDFD-------------ETSPEEDRR...DLSQ-----S
A0A015PKP4_BACFG/7-242..............KAEIKEAMDGVLKKMQG.....FDFTKFKEE-------------LGKRGFKVREARASTG-----K
Q9ZIP2_FUSNU/13-276.....RREYNVVMNKTSYKMELAKDIKRASKN...CKSKEDFIKA-------------LDEKGVIVD.WEDHKK-----H
A6H977_9ZZZZ/12-252..........HAGVESLVGWIKRECLPELQA....AQSWEDLHRV-------------LRENGLKLR..ERGNG-----F
Q4FIJ3_SALCE/61-315......NAWTRGKKQTFREYIAQTAVAGLRSE..PVHDWLSLHRR-------------LAEDGLYLS..QMDGK-----F
Q9Z361_STAEP/8-242.......PNTKSTAQYSWKDEIREAIDQSQ.....ATNMNEFKDH-------------LNQHGIEIE..RVTPK-----S
LTRB_LACLM/34-307.............TQSIYKSQIKQRLDYLLE...MSSDIEDFKRK-------------ATALNLSFD...FSGK-----W
Q9XAW2_PSEAC/12-285LPGKARQMEVMTGNESLTTYAQGQPKKDALEALNKGGGWHELHEA-------------LGRHGLEIR..QKGQG-----F
B3H352_ACTP7/14-247...........TDKKQALQAITDGLTALANAG..QINDRQDVINA-------------LERAGFEIA..RITPK-----N
TRAI5_ECOLX/12-252..........HAGVESLVGWIKRECLDEIKG....AQSWQELHQV-------------MRDNGMELR..VRANG-----L
Q54883_STREE/11-264..............KTNYKYEIKQRVYFLIE...NSKNFEDLKKK-------------AKALHLKID...FRHK-----H
RLX1_STAAU/8-238...........DKDKRSWKNDIRMAVEETKD...NAVAFEEFNTL-------------LKEKGVEIT..RVTKN-----N
A9CQY2_STAAU/8-239...........DRDEYSWKDELRDLIENAKT...HTSNLETFSEH-------------LEEKGVGV...KLRGE-----T
K7VR95_LACLC/9-280............KNEYSYMDDLRERINKSLQDV.SVSSYETFKER-------------LSDNGVILSERGQTFS-----Y

PF01076

65KD_ZYMMA/1-192--------------ASRWFDGRKALSALQT....GYAASMEPLG.-------------.LARGVKG.------------.
O87277_9STAP/1-193--------------GKNVFN.RQELLWLQD....KFPEHMKKQGF-------------ELKRGERG.------------.
P71098_BACTI/20-220--------------DRAITQQDATLDKTRPFDDWREKEVQLLEKA-------------LKERGI...------------.
O32791_9LACT/1-193--------------AKTVFN.RQALQAVQD....ELPKYLNERGF-------------ELERGEKG.------------.
Q45448_BACIU/1-193--------------AKDFFNGKLKMKAIQD....DFHRHMVENGF-------------DLVRGEP..------------.
PRE_STRAG/1-194--------------SKAMFD.REELKHIQE....DLPRYMSDHGF-------------ELERGKLN.------------.
PRE1_STAAU/1-198--------------AKEQLGNKKDFTQLQD....RFNEYVNEKGY-------------ELERGTSKE------------.
A0A0F6IVM1_BACTU/1-192--------------AKDMFT.RKELISLQQ....DFPLEMREKGF-------------DVDRGEG..------------.
Q52058_9ZZZZ/3-190--------------NYYIGGSKHKMIELQD....DFYKNVGQK.F-------------KMDRGRPAA------------.
Q09026_OENOE/1-199--------------SDALWD.RKELFDFHT....YMAKGLQANGF-------------QLERGEEY.------------.
Q53618_STAAU/1-198--------------AKEVLGNKKALTEFQD....RFNEHINSCGY-------------DLSRGITRG------------.
Q48524_LACCA/1-194--------------AKRVFN.RTALRDVQD....QLPAYLPQHGL-------------NIQRGVQE.------------.
B6FKS6_9FIRM/6-219--------------DEKLRGTVKEVVHQIS....HSKKWKSDIPL-------------TDEKGNP..------------.
Q52050_BUTFI/1-198--------------AKELMGNIKQYHQRQN....EFHEEVGLK.Y-------------GLERGQVQD------------R
PREA_LACPN/1-194--------------AKRIFN.REALQHIQE....ELPQYLKENGF-------------DVQRGNKN.------------.
P71520_MARHA/20-221--------------DRAIKQQDATLNQTHPFEDWREREIGFLEEK-------------INARGI...------------.
Q53620_STAAU/1-198--------------AKEVVGNKKALTAFQD....RFNEHVKQRGY-------------DLERGQSRQ------------.

PF01446

G8PF48_PEDCP/80-316--------------QISYGGLFKQIKQ-------DLKLEDVENGD-------------LIHVGDEDYTKEQMEA---AEE

PF02217

LT_POVBO/129-222----------------------------------NLCSKKCTVSF-------------LQAKGVLKP-------------
LT_POVMK/151-247----------------------------------NYCATYCSVSF-------------IVVKGVIKE-------------
Q80FI2_9VIRU/134-228----------------------------------NFCCKHCTVSP-------------YVVRGVKKH-------------
Q9DPC0_POVJC/137-230----------------------------------NYCQKLCTFSF-------------LICKGVNKE-------------
LT_POVLY/200-298----------------------------------HFCVSQCTFSF-------------IHCKAVVKP-------------
Q20HY2_9VIRU/139-233----------------------------------NFCKKHCTVSP-------------LCVRGLKKH-------------
Q9J7C9_SV40/136-229----------------------------------NYAQKLCTFSF-------------LICKGVNKE-------------
Q20HX6_9VIRU/120-214----------------------------------NFCKKHCTVSL-------------CIVRGIKKN-------------
LT_POVHA/261-354----------------------------------SYCCKFCTVSF-------------LLCKAVTKP-------------
B9A7H1_BFPYV/111-204----------------------------------NFCKKYCTISI-------------CSVRGIKKN-------------
LT_POVMC/285-377----------------------------------NYCSKLCSVSF-------------LMCKAVTKP-------------

PF00799

REP_TPCTV/8-120VNSYVDKDGDTI.EWGE--------------FQID-------
REPA_MSVS/10-117VRDYILKEPLAVFERGT--------------FIPR-------
REP_BGYMJ/7-119VKEYIDKDGVTI.EWGQ--------------FQVD-------
REP_BCTVC/7-119VKSYVDKDGDTI.EWGE--------------FQID-------
U9TRZ4_RHIID/23-135ARDYIRKE.....YKEN--------------LDAG-------
REPE_ONYPE/14-143VRNYVKKDGDFI.EEGT--------------FK.H-------

PF05840

VGA_BPG4/115-441IRMSRNFGM.......K--------------LLSMAHL----
A0A0E2J468_CHLPS/74-400IRMSRNFGM.......K--------------MLTMTNL----
VGA_BPPHK/49-381VRSSRKLGM.......E--------------LPSMAHL----
A9ZT18_9CAUD/122-510IRQFQFFGGAPVTTYRE--------------LRRLANQ----
VPA_BP186/139-507IRQFQFIGGAPVTVYRE--------------LRRMADP----
VPA_BPP2/133-515IPQFKTVGLPTMGAYRE--------------LRKLPRG----
ENDP2_SALTI/193-568VQQFRFFGIPGRQAYRE--------------LRLLAGQ----
Q8XBG0_ECO57/179-564VRQFQFFGIPSRQVWRE--------------LRRLASQ----
P12_BPPM2/101-478IRQFQFVGGASVGVWRE--------------IRRAKPE----
REP_BPHC1/204-578IRQFQFYGGASICVWRE--------------LRRLISG----
O80256_9VIRU/150-506VRQFQFYGGCSVSVWRE--------------MRRLRDE----

PF02407

MREP_SCSVF/5-83ARAYAMKE----------------------------------
REP6_SCSVF/6-86AQLYAMKE----------------------------------
REP2_SCSVF/2-88NRDYCCKE----------------------------------
MREP_BBTVA/6-83ARSYCMKE----------------------------------

PF07232

Y35K_HALSI/1-316IEEWEMVGIAPEGDLGD.IIEVDPSEPRSDPYRRLRTPPPGG
Y36K_HALSN/1-328VEEWEMVGIAPEGDLEDEIIEVDPEQPRDDPYRRLRTPPPGG

PF08724

A7LIB2_9VIRU/14-197MPLFTAAALCLQKRQEL--------------LDAF-------
Q9WKM1_PAVHB/3-177IDGYIDTCISATFRKGA--------------CHAK-------
Q8JQG1_9VIRU/4-192MEEYISACLNLAERKRL--------------VAQH-------
Q7TG44_9VIRU/4-191VPEYIKACLHRELRASL--------------ARLH-------
Q9J0X5_9VIRU/3-177FSEYEYVCNSLAYRRNM--------------HKKA-------
Q9J0X7_9VIRU/3-177LEEYQYVCNSLCYRKNM--------------HKQH-------
Q6JL80_9VIRU/4-189LEEYKLAALNLEERKRL--------------VAQF-------
VU94_HHV6Z/17-203INELGDVCDEI.HRKHI--------------ISHF-------
Q88271_9VIRU/3-177LEEYQYVCNSLCYRRTM--------------HKRQ-------

PF03389

C4YZP3_9RICK/17-222VTAKSYKALGIDQE.PTKHRGAT--------.......----
TRAA_AGRFC/17-243IDGRSYEKQGIDLE.PTIHLGVG--------AKAISRK----
D4LKI8_9FIRM/17-286IDHRSFAAQGITEQ.PTIHEGYI--------AQNMEKK----
B0T9A7_CAUSK/17-219VTHLSLADQGQGRE.PTIHLGPS--------ASGMERR----
R5L7A7_9FIRM/19-253IDHRSFEEQGLDIE.PTIHEGYA--------ARQMEQK----
TRAA_RHISN/17-243IDGRSFEKQGIELT.PTIHLGVG--------TKAIERK----
Q2KC95_RHIEC/17-258LDGRSYAEQNLGGI.AQRHLGSV--------KA.....----
B7KN07_CYAP7/17-212IDHRTLSEQGINRI.PQIHLGPD--------VAAMMD.----
D5HHM6_9FIRM/55-279IDHRSYKRQGIDKI.PSVHLGPA--------ASQMEKR----
D6DI62_CLOSC/17-286IDHRSNAARGIDEI.PTIHEGVT--------AQALERK----
A9HLM3_GLUDA/17-229IDHRSHADRGLDEA.PSRHLGPA--------ATAIERK----
D4LM09_9FIRM/19-247IDHRSYKEQGIDLI.PTIHEGYE--------VRAMEKK----
D4JZW7_9FIRM/17-288IDHRSHADRGLSEQ.PTIHEGVV--------ARALEKK----
Q11MR5_CHESB/17-249LDGRSYAEQGLDGI.AQSHLGPA--------KAALARK----
B1X3B9_CYAA5/17-213IDHRSLKEQNISRI.PQIHLGAN--------VAAMMKR----
D4JZZ9_9FIRM/19-243VDLRSFERQGLQQI.PTVHLGPA--------AHQMEKR----
Q8KIN6_RHIEC/17-249LDGRSYAEQGLDGI.AQKHLGPE--------KAALARK----
A4YML6_BRASO/18-217IDHRSLEAQGIALE.PQSQIGAP--------AKRIEGR----
I4DCV2_DESAJ/17-214IDHRSLKDQGIKNRLPQKHIGVH--------ASAMEKR----
C7JJ99_ACEP3/17-217IDHRSFAAQGIDLE.PQNKIGPA--------GMRREER----
F8C170_OLICO/17-243VDGRSYAERGIDVV.PTTHIGVA--------AKAIERR----
B0S201_FINM2/20-247IDPRTFKEQGREEL.PQIHLGTS--------SYQMEKK----
D4JD91_9FIRM/17-307VDHRSYEKQGKLQI.PTIHEGAD--------ARKIEQK----
G2SZV4_ROSHA/17-288IDHRSHAERALLER.PTVHEGVV--------ARAMEKK----
G2I8U9_KOMMN/17-219VDHRSFERQGREQE.PTRHMGVS--------ATAMER.----
B0T9Q2_CAUSK/17-219VSHLSLAARGVDRA.PTVHLGPA--------ATALERK----
C4YZX3_9RICK/17-223ITEKSFKDRGIDQI.PKLHIGPA--------H......----
D6GRF6_FILAD/17-241VDHRSYQRQGIEQI.PTIHMGVS--------ASQMEKK----
D4KAU2_9FIRM/17-241VDLRSYERQGLDII.PTVHEGAA--------VRQMEKR----
D4MXT5_9FIRM/18-307IDHRSYERQGKLKV.PTIHEGPD--------ARKIEEK----
C0QML1_DESAH/17-230IDHRSLKDQGIDRE.PQIHVGPT--------ASAMHKK----
R6LS79_9FIRM/20-249IDHRSYARQGIEQI.PTVHEGPS--------VRAMEAK----
K9SN36_9CYAN/17-213VDHRSYAERNIFRI.PQIHLGAK--------IIELENR----
Q1QF79_NITHX/18-243VEGRSYAERGIAIV.PTTHIGVA--------TKAIDRR----
G2ILJ4_9SPHN/17-216IDHRSLEAQGIDLE.PQDKIGPA--------ASRMGE.----
E8RPW5_ASTEC/17-230IDHRSHQERGLEIE.PTQHVGVH--------ATQMDRR----
R7B4C7_9CLOT/17-288IDHRSHADRGLTEQ.PTIHEGVV--------ARALEKK----
G9WII5_9LACT/17-241ISEKSFAGQGIDAV.PTQHIGIN--------SKRQERR----
A5V2N3_SPHWW/17-216IDHRSYEAQGIGLE.PQHKIGAA--------GARREA.----
MOBA_BIFLO/19-253IDHRSLEDQGSDLE.PTIHEGYA--------ARAIER.----
C5B6Q9_METEA/17-230IDHRSHQERGLELQ.PTEHMGIH--------ATQMERR----
C5B6U1_METEA/17-216IDHRSLADQGLALE.PQHKIGPA--------GARREA.----
B9K371_AGRVS/17-242VDGRSYAERGIGLV.PTPHIGVS--------TKNIQR.----
G8PF77_PEDCP/12-236ISEKSFVDQGIDEV.ATQHEGIN--------SKRYERK----
A1VX68_POLNA/17-235VDHRSLVAQGIDDRDAGIHLGPI--------ATAIERR----
Q03N47_LACBA/17-240ISEKSFVDQGIQET.PTQHEGIN--------SQRQNRK----
C7RI54_ANAPD/18-245VDHRSFKRQGIKQI.PTIHLGAS--------ASAMERK----
D4KA38_9FIRM/17-241LDLRSYERQGLDKI.PTVHMGPA--------VSQMEKR----
Q7CW18_AGRFC/17-228IDHRSHIERGLELS.PTEHMGVH--------ASQM..R----

PF03432

Q9WW30_PEDPE/8-248LTYQLTGTN..YKA-RGNKLGTA..YEKGEIYHELERR----
D2JCN4_STAEP/8-236ITYRHLEED..KKV-RGKKLGED..YDKGGLEIGFNRQ----
Q56424_BACFG/7-242EVQGVKFEYGGISF-SGSKVSRE..FSYMNIDYRLRRN----
VIRD2_RHIRD/16-264FDPFRSDPS..TGE-PDRATRHD..KQPLEQHARFQES----
A0A015PKP4_BACFG/7-242LNGYYVTARSGTEY-KASEIGKG..YTLAHIERTQSKL----
Q9ZIP2_FUSNU/13-276ITFKFKDEKK.KSI-RLANLEKT..FQDETFKKEYLEQ----
A6H977_9ZZZZ/12-252IFEAGDG....TTV-KASTVSRD..LSKPKLEARFGAF----
Q4FIJ3_SALCE/61-315LVMDGWDRNR.EGV-QLDSFGPS..WCAEKLMKKMGDY----
Q9Z361_STAEP/8-242ITYRHLVED..KKV-RGRKLGED..YNKGGIEDGFERQ----
LTRB_LACLM/34-307TTYRLLDEPQMKNT-RGRNLDKN..RPEKYNLESIIER----
Q9XAW2_PSEAC/12-285AIHSKTDPEQ.TPI-KASTMAQE..LGGGKLTKRIGPY----
B3H352_ACTP7/14-247LSIKTDGQN..LRL-KGAFYEQD.FRFSTDLSADITER----
TRAI5_ECOLX/12-252VFEAGDG....TMV-KASTVARD..LSKPSLEARLGPF----
Q54883_STREE/11-264VTYFMTDSNMKQVV-RDSKLSRKQPYNETYFEKKFVQR----
RLX1_STAAU/8-238VTYRHIEED..KKV-RGNKLGDS..YDKGVIENGFAIE----
A9CQY2_STAAU/8-239ISYKPENEN..KWV-RGRTLGSE..YEKGAIDHEHERH----
K7VR95_LACLC/9-280AFLDANNKQ..RRA-RETRLGSD..FGRETILHELEKR----

PF01076

65KD_ZYMMA/1-192.SKATHQRVQRHYG----------------------------
O87277_9STAP/1-193.SDRKHIETAKFKK----------------------------
P71098_BACTI/20-220..ERKLVGTNEYKD----------------------------
O32791_9LACT/1-193.SERKNLTVPEYKK----------------------------
Q45448_BACIU/1-193.SEKKHENVHQYKI----------------------------
PRE_STRAG/1-194.SEAKHKTVAEFKR----------------------------
PRE1_STAAU/1-198VTEREHKAMDQYKK----------------------------
A0A0F6IVM1_BACTU/1-192.SEKKHLSPQAFKE----------------------------
Q52058_9ZZZZ/3-190ITKAKHLNSRDYLA----------------------------
Q09026_OENOE/1-199.SRTKHLDPNVYKA----------------------------
Q53618_STAAU/1-198VTPRRHEQISRYKN----------------------------
Q48524_LACCA/1-194.SGRKSLAVPGYKA----------------------------
B6FKS6_9FIRM/6-219.LLRKNGKPMFRAS----------------------------
Q52050_BUTFI/1-198EERREHLDTLEFKT----------------------------
PREA_LACPN/1-194.KERKNLSVPEYKA----------------------------
P71520_MARHA/20-221..DRELVGTNDYED----------------------------
Q53620_STAAU/1-198VTNAKHEQISQYKQ----------------------------

PF01446

G8PF48_PEDCP/80-316VVAKWDFKKQNYFI----------------------------

PF02217

LT_POVBO/129-222------------------------------------------
LT_POVMK/151-247------------------------------------------
Q80FI2_9VIRU/134-228------------------------------------------
Q9DPC0_POVJC/137-230------------------------------------------
LT_POVLY/200-298------------------------------------------
Q20HY2_9VIRU/139-233------------------------------------------
Q9J7C9_SV40/136-229------------------------------------------
Q20HX6_9VIRU/120-214------------------------------------------
LT_POVHA/261-354------------------------------------------
B9A7H1_BFPYV/111-204------------------------------------------
LT_POVMC/285-377------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window