Sequence alignment for CL0170

PF05951

Q9CNZ9_PASMU/32-183VSTPKPRILRFRNINT-----GEKFSAEFLPSKGFSSVALKKLDYLM--RDKRNNHMHRMDPKLFLK------------F
Q9A852_CAUCR/63-213KPAVDPRWVHLHNVHT-----GEKLEAVYWENGDYVPDAVSALDKVL--RDYRNDEVHPIDRGLYDL------------L
Q9KSI7_VIBCH/29-179SYAAKPRELALSNLHT-----GESIETRYFNGKNYVRSELKRLNHLC--RDFRRDEVHAMDKLLFDQ------------L
Q989B8_RHILO/15-167SAFAETRALKIQHLHT-----GEKAEIVFKRNGRYDQAGLKKIDFML--RDWRRNEPTRMDPRLLDL------------V
Q92JX1_RHIME/6-158EAAGQTRTLKLYFIHT-----KEKAQITYKRNGRYDQKGLQQINRFL--RDWRRNEPTKMDPRLLDL------------V
Q98H74_RHILO/14-166GASAETRSLKLYHLHT-----HEKAEIVYKRNGRYLPEGLRKINIIL--RDWRRNEPTKMDPRLLDL------------V
Q8EF76_SHEON/32-182RSTKGVRELSLFNRHT-----GEYNNGSYWVDGHYQSEVLADFSHLL--RDHRQNVAAPMDKRLFDL------------L
Q7CT90_AGRT5/14-166EAAAETRSLKLYYIHT-----REKAVITFKRNGKYDQKGLQELNRFL--RDWRRNQPTRMDPRLFDL------------V
Q2YIP2_BRUA2/25-176.ASAETRSLKLYYVHT-----GEKAEIAFKKDGRFLPDGLKRLNVFL--RDWRRNEPTRMDPRLFDL------------I
Q7MJP7_VIBVY/37-186.YPDQPRTLALNNLHT-----GELLETCYFDGSTYLIEELARIDKIC--RDFRQNEVHPMDRRLFDH------------L

PF08291

Q7Y5M4_BPSP6/6-108---------------------------KYFKRNEFACRCGCGTSTVD..............AELLQV------------V
Q5LM88_RUEPO/18-119---------------------------PNFSPEEIACRST.GKVGID..............PQAMDK------------L
Q8YUC7_NOSS1/127-243---------------------------NELVVAGIPLTWGEITKGCDPQRNPESKTIINNIIKAARG------------F
Q5NX34_AROAE/55-166---------------------------AYLQY..LLRDVRANRQGLV..HPQI........VSNLAW------------V
Q88L27_PSEPK/5-119---------------------------PHFTLDEMTVSQLAAREGFD..NAPPLEARA.NLQLLCGA------------L
Q92KB7_RHIME/323-423---------------------------ARLTPSGLILQTEKVETGCF.............KPELLDI------------L
Q8CJR3_STRCO/116-230---------------------------VHFTYAELNKCNSDWSGGAV..SAATAKSN...ALKTMWK------------L
Q7MNT8_VIBVY/105-217---------------------------AHFKWSEFSCNDK......D..NTPVPQDLRTNVKNLASQ------------L
E6UFM5_RUMA7/197-303---------------------------PHFHSREFACDCG.NTHTID..............QNLINK------------L
Q31Q82_SYNE7/73-183---------------------------EHFTVGEVFQFDDFRRQRVT..AENKRRI.....VKLAAR------------L
Q5LCN2_BACFN/2-118---------------------------KYFTIKELSHSDTAVARGID..NTPTGEAVHNLTELVENV------------L
V4IU57_9ACTO/127-240---------------------------.NFTYAELNRCNSDWSGGKV..SAATARAN...ALVTMWK------------L

PF01085

K1R6F4_CRAGI/30-187...PRG.SGRRHRTGN.RTPLVYKQHVPNVSENTLGASGLAEGRISKEDPRFK.KLVTNDNPDIIFRDEEGDGTDRIM.T
F6XBS5_CIOIN/130-291CRPGHGSGGSRMPGRE.LVPFLKGEYVPKMSEQTIGASGPVTGRIRADTPRFRQELVPNWNTDIEFRDEEESNEDRFM.T
H2ZHI5_CIOSA/23-183CGPGPR.HGTRPSERI.LRPLLRQQYVPHLSEGTVGASGPSEGRIYRNTPKYR.KLERNYNPDILFREDEEDGSARIM.T
H2YWW4_CIOSA/21-183CHPGQGNGAPRKPGRE.LVPFLKGEYVPKMSEQTIGASGPSTGRITRTSPRFHHELVPNWNTDIEFRDEEESNEDRFYDA
G3H796_CRIGR/24-184CGPGRG.FGKRRHPKK.LTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFK.ELTPNYNPDIIFKDEENTGADRLM.T
HH_DROME/85-244CGPGRG..LGRHRARN.LYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFK.DLVPNYNRDILFRDEEGTGADRLM.S
W5MLT6_LEPOC/24-184CGPGPG.HGRRPKMRK.LTPIPYKHSVPNFSENNLGASGRAEGKITRSSERFK.DLVANYNPDIIFKDEENTSADRLM.T
M4A9L1_XIPMA/27-187CGPGPG.YGTRSRPRK.LTPMRYKQFFPNFSENTLGASGRAEGKISRNSERFN.QLVCNYNPDIVFKDEENTSADRVM.T
T1K174_TETUR/64-224CGPGRS.GGRRRIPRK.TTPLVLEQHIPNVSENTLSASGPSEGKINETDSRFT.KLVPNYNPDIVFKDEEGTGIDRIM.T
W4Y925_STRPU/27-186CHPGRS.GKTSHRPRN.RTPLQYKQRVPNISEDTFGASGPPEGRINRNDERFN.TLSPNNNDDIVFKDEEGTGADRLM.T
T1ELE5_HELRO/210-371CGPGRSYFSPRKGPRK.MTPFVLKQHVPNLSETTLGASGQPEGKVSRGDPEFK.KLVTNKNPNIIFQNSEGTGADRVM.S
J9K1A2_ACYPI/38-194CGPLRG.PSKFRNPRK.MKPLVFQQHEPNVSEYSITASGPPEGRIQRNDSRFM.ELVPNYNADIEFKDDEGTGADRLM.T
A7RW45_NEMVE/1-161CGPGKA...AFDRDNR.AIPMKIREHIPDTSETSLQASGPSR.KIKRGSNGYK.ELITNADPNIVFR.EDKAGNNRRM.S
K7J545_NASVI/41-201CGPGRG.GGRRPILRK.LTPLVFKQHVPNVSENTLPASGLGEGRVSRNDKRFR.DLVPNYNVDIIFKDEEGTGADRLM.T
E5SNS5_TRISP/58-212RMAGMA.......YKK.YYPLIYNERFPNEPENAPGSAGAAELRIRRSDPGFK.RLVQNNNPDIIFRDEENTGADRMM.T
F1SJ10_PIG/27-189CGPGRGPVGRRRYVRKQLVPLLYKQFVPSVPERTLGASGPAEGRVTRGSERFR.DLVPNYNPDIIFKDEENSGADRLM.T
Q175B3_AEDAE/38-198CGPGRG.IGGPRRTRK.LLPLVFKQHVPNVSENSLGASGMQEGPISRNDSKFR.NLETNYNKDIIFKDEEGTGADRVM.T

PF02557

YODJ_BACSU/120-250--------------------KRYIRKEAADALKTMFDAAKKEGY....ELAA.VSGYRSYDRQKVIF------------.
Q65US8_MANSM/26-185--------------------NHFLQPQALKAFQALQKSAVKNGF....NLQP.ASTFRDFARQQLIW------------N
O83250_TREPA/106-230--------------------SLLLTKIAYEALHQLIQAAARDGV....ALSV.GSAYRSFAYQKKLF------------.
Q8Y645_LISMO/113-243--------------------KAQLRKEAATALEEMFVAANKDGK....KLFA.VSGYRSYKRQQEVF------------.
Q5NHB6_FRATT/26-155--------------------DLLLEKNTYKAWLELKQAATDDGI....SLFI.VSGFRSYEYQQKII------------.
Q7V800_PROMM/59-190--------------------GIELHHEAADALSSMRAAASADGV....DLRL.LSGYRSHDLQERIF------------F
Q7VCA8_PROMA/98-229--------------------GLKVHKDTYSALKKMRAAAAADGI....YLTA.LSGFRSIDLQREIF------------Y
Q55957_SYNY3/161-291--------------------SESLDQEAATAFKKMQADAQVQGV....RLTI.ISGFRSIASQDALF------------.
Q7U788_SYNPX/101-232--------------------GIVLHLDAANALDAMLQAGLAEGV....DLRL.LSGYRSLALQESIF------------F
Q7NI07_GLOVI/108-238--------------------PILLHKGAVESYRQLVQAARAEGV....ILVT.LSGFRSERYQQEVY------------.
Q55454_SYNY3/106-237--------------------RLKLRQAAADQFLLMQRDAKAQGI....SLVP.ISAFRTVTEQEQLF------------F
Q97E20_CLOAB/88-217--------------------VNQMESEAATGLENMFNAASKDGL....TLLA.VSGYRPYSYQQKLY------------.
Q73Q11_TREDE/110-234--------------------DIYLAKIAERPLQKLAEAAKKEGI....EIMI.SSGYRSYIYQANLF------------.
VANY_ENTFA/114-247--------------------GERIDIRISPYLQDLFDAARADGV....YPIV.ASGYRTTEKQQEIM------------.
Q7N3J3_PHOLL/21-178--------------------NHRLQPEAANAFFSMQQAAEKAGI....NLQP.ASTFRDFQRQQAIW------------N
Q5QTZ2_IDILO/20-179--------------------GHKLHPDAAEAYLAMQKAAAAEGI....ELAI.ASGFRSLDRQLSIW------------N
Q8E2A2_STRA5/89-225--------------------NIYLDKRITKQATQFLEAARAIDS....REHL.ISGYRSVAYQEKLF------------.
Q7V1U4_PROMP/94-224--------------------NIQVHIDMSEALLKMREDAIKDGI....YLVF.LSGYRSINLQKEIF------------Y
Q8EEB5_SHEON/50-206--------------------RFKLESQTALAFQAMADSAAKDGI....KLAI.CSAYRPFDRQLAIW------------N
Q67QI3_SYMTH/121-251--------------------RRLMRAEAAAALEEMFAAAEEDGI....YLAG.VSGYRSYEYQEALF------------.
Q87MI5_VIBPA/23-179--------------------AFLMHPDVANDLLNMIEAAKKAGF....KMEI.ASGFRDFSRQRAIW------------N
O51529_BORBU/101-225--------------------TIKVRKILIEDLIRLIKDAKKFGI....EIKI.KSAYRTQEYQKFLF------------.
Q5KZM0_GEOKA/119-249--------------------KRHMRAEAAAALEEMFAAARRDGI....ELVA.VSAYRSYERQQVIF------------.
Q8PBI7_XANCP/80-208--------------------PLWLSAGAARAWRQLRAAALREDV....VLDA.ISGYRSHDYQLGIF------------.
Q5WJW5_BACSK/100-228--------------------RRYLRVEAAEALEALFAAAAEEGY....DLFA.ISGFRSYERQELLY------------.
Q8DWH5_STRMU/90-226--------------------GVKVDSRIAENTRKFLAAAQEIDS....SEHL.ISGYRSVAYQEELY------------.
Q6D7N5_PECAS/20-177--------------------HHRLQPEAVTAFLALQHAAKTVGF....NLQP.ASTFRDFERQRQIW------------N
Q9CM23_PASMU/28-187--------------------HHFLHQDCLVAFQCLQQSAAKHGF....NLQP.ASSFRDFQRQQAIW------------N
Q7VNB4_HAEDU/28-186--------------------NHYLQAEVVTAFLGLQHAAKRADF....NLQP.ASTYRDFNRQMLIW------------N
Q8EZA8_LEPIN/48-196--------------------IHYLRKEVLEKLLELFQAYQRENPSEKQKPFI.VSAFRSFKDQKGIW------------E
Q8YQW0_NOSS1/118-249--------------------RIRMRRNAAQRFQEMAQAARTAGV....ILMP.ISGFRSVKEQEQLF------------F
Q9PEZ7_XYLFA/74-202--------------------PLLLTVDAARAWHAMRQAAVRDGI....VLDA.ISGYRSYAYQFGIF------------.
Q8DQQ1_STRR6/87-213--------------------NPGENPTAKAELVKLIKAMQEAGF....PISDHYSGFRSYETQTKLY------------.
Q7NMR7_GLOVI/149-279--------------------KEYLSNEAAWAFTRMRAAAAKAGV....RLIL.ISGFRDRTRQARIF------------.
Q8XKL5_CLOPE/109-238--------------------RNRVSNVLKKDLENLFSDAKKAGL....DLYL.SCAYRSYEEQEYLY------------.
Q9CGZ2_LACLA/85-226--------------------GIQVDQRIASAVQQFLAAAQQISP....AEHL.ISGYRSVSYQEGLY------------.
Q97KB0_CLOAB/144-267--------------------LSSLNPYVALLAQRFLNLCTANGL....NVRV.IQAFRSWYEQDQLY------------.
Q8DKC7_THEEB/90-221--------------------QIKLRRAAAERFRAMVAAAQQEGV....VLIP.LSGFRSTQDQDYLF------------F
Q8EST6_OCEIH/190-320--------------------KKYMRQAAADALEELFADALEENL....ELYA.QSGYRSYDRQDNIF------------.
Q6LTW9_PHOPR/50-207--------------------QHLLHKDMQPAFAALQQAAQLAGF....DLQL.ASAFRPFERQLLIW------------N
C2X0S1_BACCE/79-219--------------------..KIDSRIATSYQDMVAAAKKEGI....NLYL.RSGYRAIKLQQTYY------------.
Q31ML7_SYNE7/94-224--------------------.IRLRSPAAKAFDELQAAAAREGV....RLVP.LSGFRSKKDQEALF------------F
Q5M6D5_STRT2/106-240--------------------..SVDARIAKNVEEFLAAAQEINP....SYHL.ISGYRSVAYQTELY------------.
Q81L80_BACAN/110-237--------------------..LLRKDAADALENMFEAAKKEGL....ELTA.VSGYRSYKRQKSLH------------.
Q81QA6_BACAN/96-225--------------------.SYLRKEAAEALERLFDLANKEGI....QLNA.VSGFRSYDYQKKLY------------.
Q81RH6_BACAN/99-227--------------------.KKMRKEAAGALEEMFQQADKERI....FLFA.VSGFRSFDRQKALN------------.
Q99YC5_STRP1/89-223--------------------..SVDKRIEQATSDFLAAAQAIDL....QEHL.ISGYRSVDYQTELY------------.
T0U2B5_9ENTE/11-139--------------------..YLQPEVAKQWERLVRATGLEK.....DIRL.VDGYRTEKEQRRLW------------.

PF13539

A8ASL5_BPA50/72-136--------------------------------------------------------------------------------
B1QZK9_CLOBU/207-275--------------------------------------------------------------------------------
Q3J4T3_RHOS4/201-266--------------------------------------------------------------------------------
A1ATB8_PELPD/203-268--------------------------------------------------------------------------------
N8ZX51_ACIBI/194-260--------------------------------------------------------------------------------
D1PEW6_9BACT/147-232--------------------------------------------------------------------------------
A9WTX9_RENSM/144-210--------------------------------------------------------------------------------
A3TM69_9MICO/118-184--------------------------------------------------------------------------------
A4SFK8_PROVI/119-180--------------------------------------------------------------------------------
D4MUA4_9FIRM/428-503--------------------------------------------------------------------------------
Q6LSS8_PHOPR/126-215--------------------------------------------------------------------------------
C4L6K0_EXISA/116-185--------------------------------------------------------------------------------
A0A018PY40_SALET/45-107--------------------------------------------------------------------------------
A8EEH4_BURPE/142-232--------------------------------------------------------------------------------
Q1QI98_NITHX/92-153--------------------------------------------------------------------------------
C4SEH9_YERMO/33-102--------------------------------------------------------------------------------
D5U8W6_BRAM5/259-337--------------------------------------------------------------------------------
A6LVB0_CLOB8/192-260--------------------------------------------------------------------------------
J7JIB9_BACIU/94-164--------------------------------------------------------------------------------
C2N1K8_BACCE/54-120--------------------------------------------------------------------------------
B7RRA8_9RHOB/214-277--------------------------------------------------------------------------------
A0A034URH6_ERWAM/54-123--------------------------------------------------------------------------------
B1IKM8_CLOBK/171-239--------------------------------------------------------------------------------
B5U3R2_9CAUD/70-134--------------------------------------------------------------------------------
A5UGL4_HAEIG/54-128--------------------------------------------------------------------------------
A9G830_SORC5/143-223--------------------------------------------------------------------------------
B3VGP8_9CAUD/82-143--------------------------------------------------------------------------------
C7NA70_LEPBD/121-197--------------------------------------------------------------------------------
E6VS38_DESAO/135-213--------------------------------------------------------------------------------
B7VJV8_VIBSL/123-214--------------------------------------------------------------------------------
C9MVB8_9FUSO/246-328--------------------------------------------------------------------------------
D1CHT9_THET1/273-355--------------------------------------------------------------------------------
Q5DN15_9CAUD/21-99--------------------------------------------------------------------------------
B3VFY1_9CAUD/64-131--------------------------------------------------------------------------------
A0RNH9_CAMFF/569-634--------------------------------------------------------------------------------
A3UWI6_VIBSP/67-136--------------------------------------------------------------------------------
Q8ESQ8_OCEIH/97-167--------------------------------------------------------------------------------
A7XF57_9CAUD/52-120--------------------------------------------------------------------------------
C6LLE4_9FIRM/274-349--------------------------------------------------------------------------------
C4Z3D8_EUBE2/109-193--------------------------------------------------------------------------------
B2U374_SHIB3/219-287--------------------------------------------------------------------------------
E6VQR6_DESAO/135-213--------------------------------------------------------------------------------
Q2SJV2_HAHCH/187-252--------------------------------------------------------------------------------
B5UY55_BACCE/196-257--------------------------------------------------------------------------------
B7GIP5_ANOFW/70-132--------------------------------------------------------------------------------
B4AH26_BACPU/73-136--------------------------------------------------------------------------------
B3VGG0_9CAUD/70-142--------------------------------------------------------------------------------
Q1ZSD0_PHOAS/130-219--------------------------------------------------------------------------------
C8XIK2_NAKMY/139-205--------------------------------------------------------------------------------
D9SKR7_CLOC7/252-312--------------------------------------------------------------------------------
C7R275_JONDD/65-131--------------------------------------------------------------------------------
C3WMV9_9FUSO/63-140--------------------------------------------------------------------------------
A8ATB8_9CAUD/56-121--------------------------------------------------------------------------------
C6ANB6_AGGAN/178-255--------------------------------------------------------------------------------
A6FEU3_9GAMM/129-218--------------------------------------------------------------------------------
A7ILH7_XANP2/449-509--------------------------------------------------------------------------------
Q854X2_9CAUD/66-133--------------------------------------------------------------------------------
C9QJ38_VIBOR/123-214--------------------------------------------------------------------------------
Q7D1F2_AGRT5/53-126--------------------------------------------------------------------------------
Q2P050_XANOM/208-274--------------------------------------------------------------------------------
A5MZT7_CLOK5/187-255--------------------------------------------------------------------------------
B1YFG8_EXIS2/71-136--------------------------------------------------------------------------------
I0WPH3_9NOCA/75-142--------------------------------------------------------------------------------
C4SJV6_YERFR/38-106--------------------------------------------------------------------------------
A6SU28_JANMA/93-182--------------------------------------------------------------------------------
C6RGB5_9PROT/616-681--------------------------------------------------------------------------------
B2S3I3_TREPS/209-287--------------------------------------------------------------------------------
C4ZCU4_EUBR3/194-278--------------------------------------------------------------------------------
Q7NS81_CHRVO/52-121--------------------------------------------------------------------------------
D4J1D4_BUTFI/117-201--------------------------------------------------------------------------------
A9DC71_9RHIZ/63-156--------------------------------------------------------------------------------
B9KTY8_RHOSK/205-268--------------------------------------------------------------------------------
A1UGG7_MYCSK/185-266--------------------------------------------------------------------------------
A3ID77_9BACI/3-33--------------------------------------------------------------------------------
A1SG61_NOCSJ/370-446--------------------------------------------------------------------------------
A7HN00_FERNB/195-263--------------------------------------------------------------------------------
B5EIM6_GEOBB/377-491--------------------------------------------------------------------------------
A9WKC4_CHLAA/591-661--------------------------------------------------------------------------------
C8KCM3_LISMN/56-121--------------------------------------------------------------------------------
C8T4A1_KLEPR/54-122--------------------------------------------------------------------------------
B2FJL7_STRMK/100-166--------------------------------------------------------------------------------
C9S248_GEOSY/68-133--------------------------------------------------------------------------------
A6TN75_ALKMQ/198-278--------------------------------------------------------------------------------
D4E385_SEROD/163-231--------------------------------------------------------------------------------
A3X9V1_9RHOB/202-265--------------------------------------------------------------------------------
D1AMG7_SEBTE/126-206--------------------------------------------------------------------------------
E8WNQ9_GEOS8/380-487--------------------------------------------------------------------------------
D2AZ54_STRRD/158-239--------------------------------------------------------------------------------
B1YI53_EXIS2/118-187--------------------------------------------------------------------------------
C0D0F9_9CLOT/238-322--------------------------------------------------------------------------------
C4K5R3_HAMD5/92-182--------------------------------------------------------------------------------
Q0A7S9_ALKEH/202-267--------------------------------------------------------------------------------
B2K031_YERPB/45-107--------------------------------------------------------------------------------
D2PPJ5_KRIFD/298-379--------------------------------------------------------------------------------
B4SDT7_PELPB/113-173--------------------------------------------------------------------------------
Q2B7L2_9BACI/116-186--------------------------------------------------------------------------------
D1ALL6_SEBTE/63-140--------------------------------------------------------------------------------
B0MC55_9FIRM/144-230--------------------------------------------------------------------------------
A7ZD12_CAMC1/602-665--------------------------------------------------------------------------------
Q3STE6_NITWN/103-162--------------------------------------------------------------------------------
A5ECX3_BRASB/184-253--------------------------------------------------------------------------------
A9KN76_CLOPH/502-575--------------------------------------------------------------------------------
A7FDS7_YERP3/58-127--------------------------------------------------------------------------------
D1B2W5_SULD5/592-657--------------------------------------------------------------------------------
C8X9H1_NAKMY/210-289--------------------------------------------------------------------------------
A0NQA8_9RHOB/173-238--------------------------------------------------------------------------------
B9NP89_9RHOB/203-268--------------------------------------------------------------------------------
B0NZY2_9CLOT/146-232--------------------------------------------------------------------------------
B1JRT0_YERPY/56-124--------------------------------------------------------------------------------
Q5WK03_BACSK/108-178--------------------------------------------------------------------------------
C9XQ42_PEPDC/189-268--------------------------------------------------------------------------------
B3Q3Z4_RHIE6/222-285--------------------------------------------------------------------------------
C4XNT5_DESMR/200-269--------------------------------------------------------------------------------
A5UTX9_ROSS1/590-659--------------------------------------------------------------------------------
D3EJK7_GEOS4/101-171--------------------------------------------------------------------------------
D4BTB0_PRORE/43-105--------------------------------------------------------------------------------
D3ADD3_9CLOT/85-148--------------------------------------------------------------------------------
Q7VJM2_HELHP/173-242--------------------------------------------------------------------------------
Q7MR54_WOLSU/185-254--------------------------------------------------------------------------------
A9DET4_9CAUD/64-132--------------------------------------------------------------------------------
C0CNE7_9FIRM/225-310--------------------------------------------------------------------------------
C6LBK9_9FIRM/257-343--------------------------------------------------------------------------------
B9JYE5_AGRVS/104-165--------------------------------------------------------------------------------
D9QLQ3_BRESC/53-121--------------------------------------------------------------------------------
B0VVC4_ACIBS/347-415--------------------------------------------------------------------------------
C4K6W4_HAMD5/53-119--------------------------------------------------------------------------------
B2UP36_AKKM8/129-194--------------------------------------------------------------------------------
C4L144_EXISA/57-123--------------------------------------------------------------------------------
F0KAF2_CLOAE/198-263--------------------------------------------------------------------------------
G3M4A5_9CAUD/70-151--------------------------------------------------------------------------------
Q5J5L5_9CAUD/70-137--------------------------------------------------------------------------------
D0LWT6_HALO1/218-298--------------------------------------------------------------------------------
A4G1C9_HERAR/140-229--------------------------------------------------------------------------------
Q0FH91_PELBH/197-262--------------------------------------------------------------------------------
D4CCJ4_9CLOT/58-129--------------------------------------------------------------------------------
D0LQS8_HALO1/317-391--------------------------------------------------------------------------------
B6V2R4_BPSP1/74-136--------------------------------------------------------------------------------
A0A038HZ79_BORBO/53-127--------------------------------------------------------------------------------
A9KQC6_CLOPH/237-321--------------------------------------------------------------------------------
C6WMZ1_ACTMD/132-213--------------------------------------------------------------------------------
A3K5D3_9RHOB/148-231--------------------------------------------------------------------------------
A4FKJ2_SACEN/154-235--------------------------------------------------------------------------------
Q5YZK4_NOCFA/71-135--------------------------------------------------------------------------------
Q1DAC7_MYXXD/63-125--------------------------------------------------------------------------------
D1BDT0_SANKS/65-131--------------------------------------------------------------------------------
C7N3P8_SLAHD/215-297--------------------------------------------------------------------------------
A6Q7D6_SULNB/126-212--------------------------------------------------------------------------------
B6VNP6_PHOAA/57-126--------------------------------------------------------------------------------
Q73V53_MYCPA/145-206--------------------------------------------------------------------------------
D7VN70_9SPHI/69-137--------------------------------------------------------------------------------
B5LJL3_9CAUD/69-133--------------------------------------------------------------------------------
A8LRY3_DINSH/108-171--------------------------------------------------------------------------------
C9MWB5_9FUSO/152-227--------------------------------------------------------------------------------
D0LZM8_HALO1/111-191--------------------------------------------------------------------------------
C9DBZ2_9CAUD/70-142--------------------------------------------------------------------------------
D7VVF1_9FLAO/66-136--------------------------------------------------------------------------------
Q2SDK8_HAHCH/53-121--------------------------------------------------------------------------------
C7RR41_ACCPU/164-241--------------------------------------------------------------------------------
A1SCY8_NOCSJ/370-428--------------------------------------------------------------------------------
B6FXG7_9FIRM/394-474--------------------------------------------------------------------------------
B6WQA8_9DELT/218-285--------------------------------------------------------------------------------
A4T1K8_MYCGI/149-230--------------------------------------------------------------------------------
Q7NR04_CHRVO/206-271--------------------------------------------------------------------------------
D4CX41_9FUSO/55-123--------------------------------------------------------------------------------
B8J0M5_DESDA/248-315--------------------------------------------------------------------------------
A8EV90_ARCB4/175-243--------------------------------------------------------------------------------
C6PUE1_9CLOT/429-508--------------------------------------------------------------------------------
D9SMB1_CLOC7/196-264--------------------------------------------------------------------------------
Q73JG3_TREDE/215-293--------------------------------------------------------------------------------
B8ENP1_METSB/622-688--------------------------------------------------------------------------------
C8Q0B7_9GAMM/78-152--------------------------------------------------------------------------------
C0QJJ2_DESAH/140-230--------------------------------------------------------------------------------
Q5DZ88_VIBF1/125-214--------------------------------------------------------------------------------
C9MUL4_9FUSO/1065-1128--------------------------------------------------------------------------------
C6D2R3_PAESJ/123-193--------------------------------------------------------------------------------
D1PX89_9BACT/178-263--------------------------------------------------------------------------------
C3XMD6_9HELI/163-232--------------------------------------------------------------------------------
Q70K75_9ACTO/100-167--------------------------------------------------------------------------------
C3K4K2_PSEFS/131-227--------------------------------------------------------------------------------
Q2LPY2_SYNAS/102-181--------------------------------------------------------------------------------
A8GLN1_SERP5/79-147--------------------------------------------------------------------------------
C0AQZ5_9ENTR/54-123--------------------------------------------------------------------------------
D1RF68_LEGLO/59-140--------------------------------------------------------------------------------
C6BUG1_DESAD/184-249--------------------------------------------------------------------------------
Q2LQQ3_SYNAS/55-131--------------------------------------------------------------------------------
C7PFT3_CHIPD/191-256--------------------------------------------------------------------------------
A8ATR6_9CAUD/73-134--------------------------------------------------------------------------------
C0ZX75_RHOE4/85-149--------------------------------------------------------------------------------
D0DDG3_9RHOB/197-267--------------------------------------------------------------------------------
A6W8P6_KINRD/95-156--------------------------------------------------------------------------------
A7HJ25_FERNB/74-137--------------------------------------------------------------------------------
B4WAV9_9CAUL/53-121--------------------------------------------------------------------------------
D2XRK5_9CAUD/70-137--------------------------------------------------------------------------------
B5EHY6_GEOBB/165-227--------------------------------------------------------------------------------
B1YH87_EXIS2/72-135--------------------------------------------------------------------------------
A7ZFD8_CAMC1/46-110--------------------------------------------------------------------------------
B8KYV5_9GAMM/51-117--------------------------------------------------------------------------------
B2VDM6_ERWT9/41-110--------------------------------------------------------------------------------
B9JF39_AGRRK/850-911--------------------------------------------------------------------------------
E3I7F8_RHOVT/190-269--------------------------------------------------------------------------------
A1K513_AZOSB/150-214--------------------------------------------------------------------------------
B4V6Z2_9ACTO/133-214--------------------------------------------------------------------------------
D0TJH0_9BACE/157-246--------------------------------------------------------------------------------
Q0AVH5_SYNWW/269-331--------------------------------------------------------------------------------
D3VE22_XENNA/59-122--------------------------------------------------------------------------------
A8S209_CLOBW/64-127--------------------------------------------------------------------------------
C6VVI7_DYAFD/85-145--------------------------------------------------------------------------------
C4SXE4_YERIN/30-99--------------------------------------------------------------------------------
A5FFV9_FLAJ1/170-242--------------------------------------------------------------------------------
B2Q011_PROST/55-124--------------------------------------------------------------------------------
Q98H40_RHILO/198-268--------------------------------------------------------------------------------
D1AEC5_THECD/163-244--------------------------------------------------------------------------------
D4DZ54_SEROD/54-122--------------------------------------------------------------------------------
M1GCS0_LAWIN/228-297--------------------------------------------------------------------------------

PF01427

VANX_ENTFA/1-202--------------------MENGFLFLDEMLHGVRWDAKYATWDNFTGKPVDGYEVNRIIGTKAVA------------L
DDPX_SYNY3/31-240--------------------KSLKPHPYAQVGADYQGRSPYVLRTGVLKR...LDQARLTLADIEPS------------W
DDPX_ECOLI/3-187--------------------DTTELVDLAVIFPDLEIELKYACADNITGK..AIYQQARCLLHKDAI------------T
O53850_MYCTU/62-256--------------------RAAGLVDVRGVVPDAAIDLRYATANNFTGT.QLYPPGARCLVHESMA------------E

PF03411

Q7VLX1_HAEDU/37-271--------------------SIGGYSNGCIIGARPLALKGNG............YQVIRSIKNRYYG------------H
G7Z2K9_AZOL4/79-317--------------------SIGGYAAGCVAGARALPPEGVG............YQVIRLSRKRNYG------------H
F2J3L2_POLGS/44-296--------------------AIGSYAKGCLAGAAALPVDGPS............WQVMRLSRNRNWG------------H
A8LNH7_DINSH/41-294--------------------AIGTYAKGCLAGGRQLAETGPT............WQAMRLSRNRNWG------------H
F8JE38_HYPSM/186-434--------------------SIGSYSRGCLAGGVPLPIDGPA............WQEMRLSRNRNWG------------N
D7A2C9_STAND/53-295--------------------AIGFYSKGCLAGGEALPVNGKT............WQAMRLSRNRNWG------------H
G0A1D7_METMM/39-279--------------------SIGTYTNGCISGAVSLPLSGTG............YQVMRLSRNRFYG------------H
B7VJP4_VIBSL/34-277--------------------SIGSYANGCLDGAQALPINGQG............YQVIRPQRERYYG------------H
Q7MNJ8_VIBVY/38-271--------------------SIGSYANGCLDGGVALPLEGAG............YQVVRTERNRYFA------------H
D4ZCJ1_SHEVD/37-278--------------------AIGSYANGCLSGGTALPLEGEG............YQVIRSSRKRYYG------------H
Q89BJ0_BRADU/67-311--------------------VIGSYTKGCIGGAERMPLNGDN............WQVMRLSRNRNFG------------H
V4IED8_9GAMM/46-281--------------------.IGGPSNGCIQGAQALPASGIG............YVSIRRQRNRYYG------------H
A0KJ73_AERHH/30-258--------------------AIGGYSAGCLKNGVALPLTGPG............YQVIRTKRLRYYG------------H
G8AJW0_AZOBR/59-295--------------------SIGGYAAGCITGAQALPGEGTG............YQVIRMSRQRYYG------------H
A3N0A9_ACTP2/37-271--------------------PIGGYSNGCIIGAQPLALKGDG............YQVIRSARNRFYG------------H
E3F225_KETVY/53-297--------------------PVGGYAVGCQAGAMALPETGPT............WQAMRLSRNRNWA------------Q
W6R6D9_9RHIZ/59-306--------------------PFGFYAKGCMSGAVALPTDGPT............WQTMRLSRNRHWG------------N
Q6LU97_PHOPR/36-276--------------------SIGSYSNGCLAGGETLPLEGEG............YQVIRSQRGRYYG------------H
W0DWJ2_MARPU/43-274--------------------VIGAPANGCLAGAVALPASGVG............YLDVRRWRGRYYG------------H
M9RED3_9RHOB/64-306--------------------.FGGYARGCQAGAVQLPETGAT............WQAMRLSRNRNWA------------Q
D8MV06_ERWBE/36-270--------------------SIGQFANGCIVGAEQLPLDAPD............YQVMRQDQRRYFG------------H
C5BAF1_EDWI9/36-270--------------------AIGSYANGCIIGARALPLASEN............YQVMRSEQLRYFG------------H
C3MBY2_RHISN/55-301--------------------SYGFYSKGCLAGGIAIPTDGPT............WQAMRLSRNRRWG------------H
Q98DM3_RHILO/86-328--------------------SFGFYSKGCFAGGVAIPMDGPT............WQVMRPSRNRRWG------------H
E3I638_RHOVT/169-418--------------------SVGFYAKGCLAGAAQLPENGPV............WQGMRVSRNRHWG------------N
Q11CB0_CHESB/47-289--------------------SYGFYSKGCFAGGIAIAPDGNH............WQAMRLSRNRRWG------------H
C5AYD5_METEA/65-307--------------------PFGSYAKGCFSGGEALPLDGAT............WQVMRPSRNRMWG------------T
B2IE79_BEII9/75-315--------------------TIGFYSHGCLSGGQALPVNGPA............WQVMRLSRNRNWG------------H
B9J6R8_AGRRK/59-304--------------------SIGFYAKGCLSGAVALPTDGPT............WQAMRPSRNRRWG------------R
MEPA_PECAS/41-275--------------------SIGSFSNGCIIGAQPLPLQSLD............YQVMRVDQRRYFG------------H
Q65U86_MANSM/44-278--------------------PIGSYSNGCIIGAQAMPARGDG............FQVIRMNKNRFYG------------H
N0B7W2_9RHIZ/170-420--------------------AIGYYARGCLSGAVALPIDGPA............WQEMRLSRNRNWG------------H
Q28VK1_JANSC/50-297--------------------AIGFYSNGCLAGGVELPETGPT............WQAMRLSRDRNWG------------H
B9JYQ7_AGRVS/40-286--------------------PYGSYARGCMSGAVALPTDGPN............WQAMRLSRNRRWG------------N
D5ASU0_RHOCB/43-298--------------------PIGAYSRGCAAGLVALPETGPT............WQAMRLKRNRNWG------------Q
W0HVY1_9ENTR/36-270--------------------AIGSFANGCIIGAQPLPLEAGN............YQVLRPDQRRYFG------------H
B8F448_HAEPS/37-270--------------------SIGGYSNGCIIGAQPLALKGEG............YQVIRSVKNRYYG------------H
Q87S60_VIBPA/36-276--------------------SIGSYANGCLDGASPLPLEGTG............YQVLRSRTNRYYG------------H
B8IRL8_METNO/82-322--------------------SIGSYARGCLAGAVALPIDGAT............WQVMRVSRNRMWG------------H
R5EP69_9GAMM/31-270--------------------VIGEYANGCIKGAVPL.KNGTN............YQVQIWGQGRNYG------------H
L0GX36_9GAMM/44-279--------------------AIGAASNGCLAGARALPAVGRG............FVSIRRERNCFYG------------H
Q3IY41_RHOS4/40-292--------------------PIGSYNRGCAAGLVQMPESGPT............WQVMRLSRNRAWG------------H
A4YL76_BRASO/65-307--------------------VIGTYNRGCIAGAERMPINGDD............WQVMRLSRNRNFG------------H
B8EQJ0_METSB/63-305--------------------TIGFYSRGCLAGGRNLAVNGPA............WQVMRLSRNRNWG------------H
D3RNE7_ALLVD/49-287--------------------..GGAANGCIGGADALPETGPG............YVSIRRYRNRYYG------------H
H2FVL9_OCESG/23-250--------------------AIGGYAAGCQTGAQALPQAGPG............FYVVRAERQRYYG------------Q
H8GG79_METAL/41-278--------------------SIGSYTAGCLSGAVQLPPNGTG............YQVMRLSRHRYYG------------H
S5Y7V8_PARAH/48-289--------------------AIGFYSKGCISGAVQLPETGPS............WQAMRLSRNRNWG------------H
Q1GD71_RUEST/59-305--------------------PLGSYAKGCVAGAAQLPETGPT............WQAMRLSRNRNWG------------H
I7DUV0_PHAIB/60-305--------------------.HGSYAKGCVAGAEQLPQTGPT............WQAMRLSRNRNWG------------H
E3HYM4_RHOVT/58-304--------------------AIGRYDLGCVAGAQKIAMNGDG............WQAMRLSRNRYWG------------H
M4RIZ0_BIBTR/37-269--------------------SIGGYSNGCIIGAQPLELKGEG............YQVIRYQRNRYYG------------H
Q3SVT3_NITWN/101-344--------------------.IGFYARGCIAGAEALPVTGPT............WQVMRLSRNRNWA------------H
H2INY8_RAHAC/45-279--------------------AIGSYANGCQVGAQPLPLNSPA............YQVMRTDQRRYFG------------Q
V6F1Q6_9PROT/42-277--------------------SVGGAAAGCLIGAQSLPADSQG............LQILRPQRNRFWA------------H
A8HVK9_AZOC5/49-304--------------------SIGFYSRGCLAGASELPANGPAATAVRQGAQGPLWQAMRPSRDRAWG------------H
B6JJU0_OLICO/62-305--------------------AIGYYAKGCLAGAQAIPIDGPH............WQVMRLSRNRNWG------------H
Q5LWS6_RUEPO/46-291--------------------.YGSYAKGCAAGLEQLPETGPT............WQAMRLSRNRNWG------------H
I2B718_SHIBC/36-270--------------------SIGSFANGCIIGAQPLALNSPD............YQVMRTDQRRYFG------------H
B0UWQ5_HISS2/37-270--------------------PIGSYNNGCLIGAEALPFNGEG............YQVIRTNKNRYYG------------H
F4HED5_GALAU/40-271--------------------PIGSYSNGCIIGAQALPLQGNG............YQVIRSQKLRFFG------------H
Q16D60_ROSDO/64-307--------------------PFGSYAKGCVAGAAQLPETGPT............WQAMRLSRNRNWA------------H
A7IJY5_XANP2/64-307--------------------SIGFYSKGCLAGAQALAVNGPN............WQVMRLSRNRNFG------------H
G4SVA0_META2/57-295--------------------SIGDYTAGCIRGAISLPFRGEG............YQVMRLSRKRYYG------------H
MEPA_ECOLI/36-270--------------------SIGSFSNGCIVGADTLPIQSEH............YQVMRTDQRRYFG------------H
G8PRI5_PSEUV/75-327--------------------SFGSYARGCVAGAIAIPYDGEN............WQVMRLSRNRNWG------------H
Q607R5_METCA/38-277--------------------AIGETGAGCLAGGVRLPPEGEG............YKVMHLERNRNYG------------H
V5SD71_9RHIZ/87-338--------------------AVGFYAKGCLAGAKALAVDGPG............WQVMRLSRNRNWG------------H
G8AJ70_AZOBR/59-293--------------------PIGGYANGCIRGAQTLPPEGLG............YQAVNLSRNRNHG------------H
A8GH81_SERP5/36-269--------------------AVGGFANGCIIGAQPLPLNSPD............YQVMRPDQRRYFG------------H
B8IJD0_METNO/63-305--------------------AIGSYARGCVAGAEALPVDGPT............WQVMRLSRNRNWG------------H
D0LL99_HALO1/58-299--------------------AIGGYGAGCVQGAEELPVSGPG............FHVVRPRRHRHFG------------H
J7QQ34_METSZ/72-310--------------------PIGFYSRGCLAGGEPLPINGPH............WQVMRLSRNRNWG------------H
B8CUQ4_SHEPW/47-288--------------------AVGSYANGCLAGGKALPSSGPG............FEVIRPERRRYFG------------H
Q2KDT7_RHIEC/59-307--------------------PIGFYAKGCMTGAVALPTDGPT............WQAMRLSRNRRWG------------N
Q2W4C2_MAGSA/42-276--------------------VIGSPAAGCLKGAVPLAEDEHS............FQVLRPSRNRHWG------------H
MEPA_HAEIN/43-277--------------------PIGSYTNGCIIGAQALPPKGEG............YQVIRMNRNRYYG------------H
F7QGC0_9BRAD/50-294--------------------PIGFYAHGCIAGAVALPINGPD............WQVMRLSRNRYWG------------H
A1B5F2_PARDP/45-284--------------------SIGFYSKGCVSGAVQLPESGPT............WQAMRLSRNRNWG------------H
I3YA59_THIV6/50-288--------------------VIGGVSNGCIGGADALPETGAG............YVSIRRYRNRYYG------------H
A9CKL5_AGRT5/53-298--------------------PIGSYAKGCQSGAIAMPTDGPG............WQAMRLSRNRRWG------------Q
Q0BS55_GRABC/32-265--------------------IIGPAGNGCIAGAQRLPDEGPG............WQTIRRDRSSFWS------------A
B1M521_METRJ/66-304--------------------..GFYAKGCFSGGEALPMDGPN............WQVMRPSRNRMWG------------T
Q2YJP1_BRUA2/82-325--------------------SIGFYAKGCLAGAVALPTDGPN............WQVMRLSRNRRWG------------H
Q6NCT0_RHOPA/69-313--------------------PIGFYAKGCMAGGISLPINGPS............WQVMRLSRNRAWA------------L
C4LE77_TOLAT/27-261--------------------AIGGYAAGCLQGAVALPEHGTG............YQILRPRQKRIYG------------H

PF05951

Q9CNZ9_PASMU/32-183YRLQASLGLRNTEIQIICGYRSPVSNAAMHRRSRGV------ASN----------------------------SYHT---
Q9A852_CAUCR/63-213DQIARKTQSKGP.FQVISGYRSPATNRLLSKRSGEV------AKK----------------------------SLHM---
Q9KSI7_VIBCH/29-179CQIQLLLGTQAE.VHIVSGYRSPATNKQLRSKSKGV------AKK----------------------------SYHM---
Q989B8_RHILO/15-167WQAYRASGSSAY.IHVVSAYRSPATNAMLRSRSKGV------ARE----------------------------SQHM---
Q92JX1_RHIME/6-158WEVYQKSGSRDY.IHVVSAYRSPATNGMLRSRSKGV------AKK----------------------------SQHM---
Q98H74_RHILO/14-166WEAYRESGATDY.IQVVCGYRSPATNSMLRSRSRGV------AEK----------------------------SQHM---
Q8EF76_SHEON/32-182YTLKSTLNTDKE.IHVISGYRSPKTNAMLAGKSGGV------AKK----------------------------SYHM---
Q7CT90_AGRT5/14-166WEVYRRSGATDY.INVVSAFRSPETNGLLRTRTKGV------AEK----------------------------SQHM---
Q2YIP2_BRUA2/25-176WQVYQSTGSREY.ITVVSAYRSPATNAMLRSSTRGV------AKK----------------------------SQHM---
Q7MJP7_VIBVY/37-186TQIQKLIGTENE.VQIISGYRSPQTNAALRAKSSGV------AKK----------------------------SYHM---

PF08291

Q7Y5M4_BPSP6/6-108TDVREYFGL..P-VVITSGHRCSDHNRRV-----GG------AAS----------------------------SMHM---
Q5LM88_RUEPO/18-119QALRDRLGA..P-LMLNSAYRSPEHNRAE-----GG------APA----------------------------SEHL---
Q8YUC7_NOSS1/127-243GKIRDKYDS..P-ISINSAYRTSAVNRRI-----GG------ARF----------------------------SQHI---
Q5NX34_AROAE/55-166QAWLAHWGLKAP-IVATSGLRTEVTNREV-----GG------AHQ----------------------------SQHL---
Q88L27_PSEPK/5-119EQVRALFDA..P-IIISSGYRSERVNRLI-----GG------ASD----------------------------SQHV---
Q92KB7_RHIME/323-423KTVEGHYGR..K-VMVTSGLRAIKVNRK.-----..------.RQ----------------------------SLHT---
Q8CJR3_STRCO/116-230EAMRHALGD.VP-ITISSGFRSRACNSAV-----GG------SST----------------------------SRHL---
Q7MNT8_VIBVY/105-217EVIRSEIGK..P-IKITSAYRTPEYNRKI-----GG------ATN----------------------------SLHV---
E6UFM5_RUMA7/197-303EQLYTKLNC.SK-IIVNSGYRDPNCSVAV-----GG------GYD----------------------------DAHT---
Q31Q82_SYNE7/73-183DVLRKQFG...P-LGVTSWFRDPVTNARV-----GG------VDD----------------------------SYHL---
Q5LCN2_BACFN/2-118DPLREKYGK..P-IRVSSGYRSAVLNRSV-----NG------ATS----------------------------SQHR---
V4IU57_9ACTO/127-240QAMRHAMGD.KP-ITVNGGFRSVTCNSNV-----GG------ATN----------------------------SRHL---

PF01085

K1R6F4_CRAGI/30-187QRCKDKLKILA--ISVMNTWQG.VKLRVTEAWDDDG....HHAKD----------------------------SLHY---
F6XBS5_CIOIN/130-291PICRARLDYLA--ILVANQWAR.VKLKVLEAWDDGN....DKAND----------------------------PLHY---
H2ZHI5_CIOSA/23-183KRCKDKVDLLS--TLVRNRWAG.VSLQVISAWDGDG....LHPRG----------------------------SLHY---
H2YWW4_CIOSA/21-183GTCKERLDNLA--IRVANQWVR.VKLKVLEAWDEGN....DRLDD----------------------------PLHY---
G3H796_CRIGR/24-184QRCKDKLNALA--ISVMNQWPG.VKLRVTEGWDEDG....HHSEE----------------------------SLHY---
HH_DROME/85-244KRCKEKLNVLA--YSVMNEWPG.IRLLVTESWDEDY....HHGQE----------------------------SLHY---
W5MLT6_LEPOC/24-184KRCKDCVNALA--IAVMNQWPG.VRLRVTEGWDEDG....HHPPN----------------------------SLHY---
M4A9L1_XIPMA/27-187KRCKDCLNRLA--IAVMNQWPG.VHLRVTEAWDEDG....HHPQG----------------------------SLHY---
T1K174_TETUR/64-224TRLKEKLDILA--SLVQNHWPG.IKLRVIEAWDDGS....QFNPD----------------------------SLHY---
W4Y925_STRPU/27-186QRCKDKLNTLA--ISVMNEWPG.IKLRVVEAWDED.....QPNVE----------------------------PLHA---
T1ELE5_HELRO/210-371KRCSDKLNNLA--SLTMEQWPG.VRLRVVEAWDEDE....THPED----------------------------SLHY---
J9K1A2_ACYPI/38-194QRCKEKLNTLA--ISVMNLWPN.VRLRVIDGWVD.......RAGS----------------------------SLHN---
A7RW45_NEMVE/1-161KRCERKLKILS--SLVRKEWIGDVKVRVIRAYDDGTSKKRHHGPH----------------------------SLHF---
K7J545_NASVI/41-201QRCKEKLNTLA--ISVMNQWPG.VKLRVTEGWDEEG....KHATD----------------------------SLHY---
E5SNS5_TRISP/58-212YRCKQKLDMLA--ILTMNYWPN.VKLRVIDAWYEQN....RYSRS----------------------------ALHY---
F1SJ10_PIG/27-189ERCKERVNALA--IAVMNMWPG.VRLRVTEGWDEDG....HHAQD----------------------------SLHY---
Q175B3_AEDAE/38-198QRCKEKLNILA--VSVMNQWPG.LRLMVTEGWDEDH....MHARE----------------------------SLHY---

PF02557

YODJ_BACSU/120-250.DNEVS..................LKGERKAKEAVA------YPG--E-------------------------SEHQ---
Q65US8_MANSM/26-185GKFNGERKVHDDQGNPLDLTALSCWEKAQAILRWSA------LPG--A-------------------------SRHH---
O83250_TREPA/106-230.SWYAQ..................EHGMQEAMRFSA------REG--T-------------------------SQHQ---
Q8Y645_LISMO/113-243.QAEVN..................AKGDQKAREAVA------YPG--T-------------------------SEHQ---
Q5NHB6_FRATT/26-155DRKLAN..................GQTLEEIIRVNA------LPG--E-------------------------SEHH---
Q7V800_PROMM/59-190DIKSDR..................NQTAAERAKVSA------PPG--Y-------------------------SEHS---
Q7VCA8_PROMA/98-229ENKSIR..................NQIAIERAKVSA------PPG--Y-------------------------SEHS---
Q55957_SYNY3/161-291QNQIKR..................KGGKEAAARFSA------PPG--H-------------------------SEHH---
Q7U788_SYNPX/101-232DIASER..................NQTAEERAQVSA------PPG--Y-------------------------SEHS---
Q7NI07_GLOVI/108-238ARQLGK..................AGTTSTATLINA------PPG--Y-------------------------SEHH---
Q55454_SYNY3/106-237DIKQQR..................NQEARQRAEVSA------PPG--Y-------------------------SEHH---
Q97E20_CLOAB/88-217.NEKVA..................RDGKAEADKYVA------EPG--T-------------------------SEHQ---
Q73Q11_TREDE/110-234.SKYVN..................VYGKKDVQFFSA------PPG--A-------------------------SQHQ---
VANY_ENTFA/114-247.DEKVAEYKA.........KGYTSAQAKAEAETWVA------VPG--T-------------------------SEHQ---
Q7N3J3_PHOLL/21-178GKFRGERPVLDENSQPMDITQLSEGERCKAILRWSA------LPG--G-------------------------SRHH---
Q5QTZ2_IDILO/20-179RKWRGKLPLRSKEGELLDASNLSDVEKMHAILHWSS------LPG--S-------------------------SRHH---
Q8E2A2_STRA5/89-225.NSYVTQEMTS.......NPNLTRGQAEKLVKTYSQ------PAG--A-------------------------SEHQ---
Q7V1U4_PROMP/94-224SLKSMR..................NQIAAERAKVSA------PPG--Y-------------------------SEHS---
Q8EEB5_SHEON/50-206AKASGKRVVLDINEQPVDITPLSESELVDLILLWSA------LPG--A-------------------------SRHH---
Q67QI3_SYMTH/121-251.ASYVS..................TDGLELAERYSA------RPG--H-------------------------SEHQ---
Q87MI5_VIBPA/23-179GKYEGELPILDSNSQPLNKAALSDEEKLKAILRWSA------LPG--G-------------------------SRHH---
O51529_BORBU/101-225.DYNVK..................TYGRKVAETQSA------IPG--H-------------------------SQHH---
Q5KZM0_GEOKA/119-249.AEEVR..................QKGKEKAVQAVA------HPG--Q-------------------------SEHQ---
Q8PBI7_XANCP/80-208ERKFAR..................GLTLAQILAVNA------APG--F-------------------------SEHH---
Q5WJW5_BACSK/100-228.EEALE..................NQGEDQ..DLVA------MPG--H-------------------------SEHQ---
Q8DWH5_STRMU/90-226.NNYIAQEKAN.......NPSLSQEEAQKQVQTYSQ------PPG--S-------------------------SEHQ---
Q6D7N5_PECAS/20-177SKFRGERAVMDANSQPLDISSLDDGERCEAILRWSA------MPG--S-------------------------SRHH---
Q9CM23_PASMU/28-187AKFYGERKVHDDQGNPLDLSTLSDWEKVQAILRWSA------LPG--G-------------------------SRHH---
Q7VNB4_HAEDU/28-186AKFNGKRKIHNDASKQIDITTLTDLAKIKAILRWSA------VPG--A-------------------------SRHH---
Q8EZA8_LEPIN/48-196EKYSGKRKMRES......VKGKTPQEIISLILEFSS------APG--T-------------------------SRHH---
Q8YQW0_NOSS1/118-249AIGAQR..................NQTPAQRAALSA------PPG--H-------------------------SEHH---
Q9PEZ7_XYLFA/74-202ENKLAQ..................GKTLQEILTVNA------APG--F-------------------------SEHH---
Q8DQQ1_STRR6/87-213.QDYVN..................QDGKEAADRYSA------RPG--Y-------------------------SEHQ---
Q7NMR7_GLOVI/149-279AKQIAR..................KGSLAAALKLVA------PPG--F-------------------------SEHH---
Q8XKL5_CLOPE/109-238.GRALE..................KE.KSDSSNLVA------LPG--T-------------------------SEHQ---
Q9CGZ2_LACLA/85-226.QSYVQAEMNGQGTVNSSGNPISEEEAIKNVQTYSQ------PPR--S-------------------------SEHQ---
Q97KB0_CLOAB/144-267....TQ..................GRTMPGNIVTDA------QGG--D-------------------------SYHN---
Q8DKC7_THEEB/90-221EVKEHR..................AQRASERALVSA------PPG--Y-------------------------SEHH---
Q8EST6_OCEIH/190-320.AANAA..................ENGEKHANTFSA------RPG--E-------------------------SEHQ---
Q6LTW9_PHOPR/50-207NKFNGLRPLLDSNSQPLDASALSKLEKIEAILRWSA------LPG--A-------------------------SRHH---
C2X0S1_BACCE/79-219.DASVKSYKS.........QGLSDKEASAKALEYLQ------YPG--A-------------------------SEHH---
Q31ML7_SYNE7/94-224DVKAER..................NQSVTERASVSA------PPG--Y-------------------------SEHH---
Q5M6D5_STRT2/106-240.NSYVQQEMAD.......DPTLTESQAEKKVQTYSQ------PPG--A-------------------------SEHQ---
Q81L80_BACAN/110-237.DTYVR..................RQGKAEADSVSA------IPG--T-------------------------SEHQ---
Q81QA6_BACAN/96-225.ANNVK..................RKGQEHTDRFSA------KPG--H-------------------------SEHQ---
Q81RH6_BACAN/99-227.TMYKK..................QDGEAKTAMSSA------VPG--T-------------------------SEHQ---
Q99YC5_STRP1/89-223.QSYIKKEMAN.......DPTLTQEAAEALVQTYSQ------PPG--A-------------------------SEHH---
T0U2B5_9ENTE/11-139.EYSLK..................ENGLAYTKQFVA------LPG--C-------------------------SEHQ---

PF13539

A8ASL5_BPA50/72-136-------------------------------NA.KG------GQ.--.-------------------------SNHN...
B1QZK9_CLOBU/207-275-------------------------------SG.TG------R..--L-------------------------SPHA...
Q3J4T3_RHOS4/201-266-------------------------------RG.GS------A..--L-------------------------SMHA...
A1ATB8_PELPD/203-268-------------------------------RG.GS------K..--W-------------------------SMHA...
N8ZX51_ACIBI/194-260-------------------------------RA.RG------YQ.--.-------------------------SYHQ...
D1PEW6_9BACT/147-232-------------------------------SH.TH------T..--V-------------------------SKHG...
A9WTX9_RENSM/144-210-------------------------------ISGST------D..--L-------------------------SNHA...
A3TM69_9MICO/118-184-------------------------------ISGST------S..--L-------------------------SNHA...
A4SFK8_PROVI/119-180-------------------------------NA.RG------GR.--.-------------------------SNHN...
D4MUA4_9FIRM/428-503-------------------------------RGKNS------S..--.-------------------------SEHC...
Q6LSS8_PHOPR/126-215-------------------------------SG.QR------S..--L-------------------------SLHA...
C4L6K0_EXISA/116-185-------------------------------NA.KA------GQ.--.-------------------------SYHN...
A0A018PY40_SALET/45-107-------------------------------KK.GS------GIT--N-------------------------SLHT...
A8EEH4_BURPE/142-232-------------------------------TG.RA------E..--W-------------------------SMHA...
Q1QI98_NITHX/92-153-------------------------------RG.SA------TK.--W-------------------------SNHA...
C4SEH9_YERMO/33-102-------------------------------NG.SS------KTL--N-------------------------SRHL...
D5U8W6_BRAM5/259-337-------------------------------SK.SA------S..--R-------------------------SYHS...
A6LVB0_CLOB8/192-260-------------------------------SG.TG------R..--L-------------------------SPHS...
J7JIB9_BACIU/94-164-------------------------------YA.RG------GE.--.-------------------------SYHN...
C2N1K8_BACCE/54-120-------------------------------KG.AS------QTM--R-------------------------SYHL...
B7RRA8_9RHOB/214-277-------------------------------RGAPG------R..--T-------------------------STHA...
A0A034URH6_ERWAM/54-123-------------------------------SG.KS------QTL--N-------------------------SRHL...
B1IKM8_CLOBK/171-239-------------------------------AG.TN------L..--L-------------------------SPHA...
B5U3R2_9CAUD/70-134-------------------------------AENSM------A..--N-------------------------SNHN...
A5UGL4_HAEIG/54-128-------------------------------KK.AT------KTM--N-------------------------SRHL...
A9G830_SORC5/143-223-------------------------------NS.YR------GAE--I-------------------------SNHL...
B3VGP8_9CAUD/82-143-------------------------------KNN..------...--G-------------------------SNHL...
C7NA70_LEPBD/121-197-------------------------------RP.NG------I..--E-------------------------SLHS...
E6VS38_DESAO/135-213-------------------------------VG.EN------R..--L-------------------------SMHA...
B7VJV8_VIBSL/123-214-------------------------------TG.GG------G..--W-------------------------SKHA...
C9MVB8_9FUSO/246-328-------------------------------YA.NG------VTS--K-------------------------SNHQIKS
D1CHT9_THET1/273-355-------------------------------TGRPG------V..--W-------------------------SEHS...
Q5DN15_9CAUD/21-99-------------------------------RG.AS------KTM--N-------------------------SRHLPKV
B3VFY1_9CAUD/64-131-------------------------------PTNSV------A..--T-------------------------SNHL...
A0RNH9_CAMFF/569-634-------------------------------SK.TD------L..--L-------------------------SAHS...
A3UWI6_VIBSP/67-136-------------------------------QL.DG------YSK--K-------------------------SRHQ...
Q8ESQ8_OCEIH/97-167-------------------------------HA.QG------GE.--.-------------------------SYHN...
A7XF57_9CAUD/52-120-------------------------------EG.KS------KTM--K-------------------------SRHL...
C6LLE4_9FIRM/274-349-------------------------------RGG..------...--H-------------------------SEHN...
C4Z3D8_EUBE2/109-193-------------------------------SY.ST------K..--L-------------------------SKHA...
B2U374_SHIB3/219-287-------------------------------TG.KS------QTM--N-------------------------SRHL...
E6VQR6_DESAO/135-213-------------------------------AG.KD------V..--L-------------------------SKHA...
Q2SJV2_HAHCH/187-252-------------------------------T..PA------K..--K-------------------------SQHF...
B5UY55_BACCE/196-257-------------------------------NA.RG------GE.--.-------------------------SYHN...
B7GIP5_ANOFW/70-132-------------------------------NA.KG------GY.--.-------------------------SYHN...
B4AH26_BACPU/73-136-------------------------------NA.KG------GQ.--.-------------------------SNHN...
B3VGG0_9CAUD/70-142-------------------------------QDNSV------D..--T-------------------------SNHP...
Q1ZSD0_PHOAS/130-219-------------------------------EG.TS------S..--L-------------------------SLHA...
C8XIK2_NAKMY/139-205-------------------------------VNNPS------V..--W-------------------------SNHA...
D9SKR7_CLOC7/252-312-------------------------------NA.KA------GQ.--.-------------------------SWHN...
C7R275_JONDD/65-131-------------------------------IRGAS------T..--L-------------------------SNHA...
C3WMV9_9FUSO/63-140-------------------------------NV.DG------YKL--K-------------------------SNHQIKF
A8ATB8_9CAUD/56-121-------------------------------NG.KS------QTM--R-------------------------SYHI...
C6ANB6_AGGAN/178-255-------------------------------SG.TK------R..--R-------------------------SAHA...
A6FEU3_9GAMM/129-218-------------------------------AG.KR------S..--L-------------------------SIHA...
A7ILH7_XANP2/449-509-------------------------------ND.PS------K..--M-------------------------SAHA...
Q854X2_9CAUD/66-133-------------------------------PTNSV------A..--T-------------------------SNHL...
C9QJ38_VIBOR/123-214-------------------------------TG.GT------S..--W-------------------------SKHA...
Q7D1F2_AGRT5/53-126-------------------------------RG.AS------KTM--N-------------------------SRHLKAA
Q2P050_XANOM/208-274-------------------------------RA.GS------WQ.--.-------------------------SCHQ...
A5MZT7_CLOK5/187-255-------------------------------SG.TS------L..--L-------------------------SPHA...
B1YFG8_EXIS2/71-136-------------------------------YA.KG------GK.--.-------------------------SNHN...
I0WPH3_9NOCA/75-142-------------------------------WDNDI------A..--N-------------------------SNHL...
C4SJV6_YERFR/38-106-------------------------------AG.AS------QTL--N-------------------------SRHL...
A6SU28_JANMA/93-182-------------------------------TN.GK------A..--A-------------------------SLHA...
C6RGB5_9PROT/616-681-------------------------------EG.TK------R..--K-------------------------SSHS...
B2S3I3_TREPS/209-287-------------------------------SD.SR------Q..--K-------------------------SNHS...
C4ZCU4_EUBR3/194-278-------------------------------SH.TT------K..--I-------------------------SKHG...
Q7NS81_CHRVO/52-121-------------------------------QG.AS------RTM--N-------------------------SRHL...
D4J1D4_BUTFI/117-201-------------------------------SH.TT------K..--I-------------------------SKHG...
A9DC71_9RHIZ/63-156-------------------------------KS.GK------A..--K-------------------------SLHA...
B9KTY8_RHOSK/205-268-------------------------------RGSTS------S..--I-------------------------SNHS...
A1UGG7_MYCSK/185-266-------------------------------PGSQA------...--W-------------------------SYHA...
A3ID77_9BACI/3-33-------------------------------T....------...--.-------------------------.......
A1SG61_NOCSJ/370-446-------------------------------TGRPG------V..--R-------------------------SPHS...
A7HN00_FERNB/195-263-------------------------------AN.SN------Q..--L-------------------------SMHA...
B5EIM6_GEOBB/377-491-------------------------------PGRPG------V..--F-------------------------STHS...
A9WKC4_CHLAA/591-661-------------------------------RSNPT------T..--L-------------------------SNHA...
C8KCM3_LISMN/56-121-------------------------------SG.AS------QTM--R-------------------------SYHL...
C8T4A1_KLEPR/54-122-------------------------------QG.KS------MTM--N-------------------------SRHL...
B2FJL7_STRMK/100-166-------------------------------QV.GR------GS.--.-------------------------SCHN...
C9S248_GEOSY/68-133-------------------------------NA.RG------GY.--.-------------------------SYHN...
A6TN75_ALKMQ/198-278-------------------------------EG.TQ------R..--I-------------------------SKHG...
D4E385_SEROD/163-231-------------------------------TG.KS------QTL--N-------------------------SRHL...
A3X9V1_9RHOB/202-265-------------------------------RGTTN------S..--L-------------------------STHS...
D1AMG7_SEBTE/126-206-------------------------------TG.KK------S..--F-------------------------SKHA...
E8WNQ9_GEOS8/380-487-------------------------------PGKPG------V..--F-------------------------SRHS...
D2AZ54_STRRD/158-239-------------------------------TGSSS------...--W-------------------------SQHA...
B1YI53_EXIS2/118-187-------------------------------NA.RG------GE.--.-------------------------SMHN...
C0D0F9_9CLOT/238-322-------------------------------TG.GG------K..--L-------------------------SNHA...
C4K5R3_HAMD5/92-182-------------------------------TG.GA------S..--W-------------------------SKHA...
Q0A7S9_ALKEH/202-267-------------------------------RG.GS------S..--W-------------------------STHA...
B2K031_YERPB/45-107-------------------------------RA.GT------GIR--N-------------------------SLHT...
D2PPJ5_KRIFD/298-379-------------------------------TGNPY------A..--L-------------------------SPHS...
B4SDT7_PELPB/113-173-------------------------------NA.KG------GF.--.-------------------------SNHN...
Q2B7L2_9BACI/116-186-------------------------------NA.KG------GE.--.-------------------------SYHN...
D1ALL6_SEBTE/63-140-------------------------------SL.DG------YNK--K-------------------------SNHQAKS
B0MC55_9FIRM/144-230-------------------------------EG.TS------H..--L-------------------------SKHA...
A7ZD12_CAMC1/602-665-------------------------------AG.TN------R..--L-------------------------SAHS...
Q3STE6_NITWN/103-162-------------------------------AG.SK------N..--W-------------------------SNHS...
A5ECX3_BRASB/184-253-------------------------------AD.TG------R..--M-------------------------SMHG...
A9KN76_CLOPH/502-575-------------------------------LS.QS------TL.--L-------------------------SIHS...
A7FDS7_YERP3/58-127-------------------------------NG.HS------KTM--N-------------------------SRHL...
D1B2W5_SULD5/592-657-------------------------------AG.TN------R..--L-------------------------SAHS...
C8X9H1_NAKMY/210-289-------------------------------TGGVG------...--F-------------------------SEHS...
A0NQA8_9RHOB/173-238-------------------------------RG.GS------N..--Y-------------------------SMHS...
B9NP89_9RHOB/203-268-------------------------------RG.GN------T..--L-------------------------STHA...
B0NZY2_9CLOT/146-232-------------------------------SG.TT------K..--L-------------------------SNHS...
B1JRT0_YERPY/56-124-------------------------------KG.AS------QTM--N-------------------------SRHI...
Q5WK03_BACSK/108-178-------------------------------NA.KG------GQ.--.-------------------------SYHN...
C9XQ42_PEPDC/189-268-------------------------------AG.TN------V..--V-------------------------SNHG...
B3Q3Z4_RHIE6/222-285-------------------------------RGSAK------S..--V-------------------------SSHA...
C4XNT5_DESMR/200-269-------------------------------AG.TR------R..--L-------------------------SVHA...
A5UTX9_ROSS1/590-659-------------------------------DDTAD------S..--L-------------------------SNHA...
D3EJK7_GEOS4/101-171-------------------------------NA.KA------GE.--.-------------------------SLHN...
D4BTB0_PRORE/43-105-------------------------------AN.GS------GIS--N-------------------------SLHK...
D3ADD3_9CLOT/85-148-------------------------------NA.PG------SSY--S-------------------------SYHQ...
Q7VJM2_HELHP/173-242-------------------------------AD.SP------N..--L-------------------------SPHS...
Q7MR54_WOLSU/185-254-------------------------------AG.SS------I..--L-------------------------SMHS...
A9DET4_9CAUD/64-132-------------------------------KG.AS------KTM--R-------------------------SRHL...
C0CNE7_9FIRM/225-310-------------------------------TG.GG------A..--L-------------------------SNHA...
C6LBK9_9FIRM/257-343-------------------------------SG.SR------S..--L-------------------------SNHA...
B9JYE5_AGRVS/104-165-------------------------------RG.KS------A..--L-------------------------SMHA...
D9QLQ3_BRESC/53-121-------------------------------AG.AS------RTL--N-------------------------SRHL...
B0VVC4_ACIBS/347-415-------------------------------NA...------GPL--Q-------------------------SYHQ...
C4K6W4_HAMD5/53-119-------------------------------KG.AS------KTM--N-------------------------SRHL...
B2UP36_AKKM8/129-194-------------------------------IG.GK------A..--T-------------------------SMHA...
C4L144_EXISA/57-123-------------------------------KG.VS------GTM--K-------------------------SYHL...
F0KAF2_CLOAE/198-263-------------------------------DA.QG------GD.--.-------------------------SYHN...
G3M4A5_9CAUD/70-151-------------------------------EDNSV------Y..--T-------------------------SNHK...
Q5J5L5_9CAUD/70-137-------------------------------PTNSV------P..--S-------------------------SNHL...
D0LWT6_HALO1/218-298-------------------------------RH.DP------KRP--L-------------------------SFHS...
A4G1C9_HERAR/140-229-------------------------------TN.GD------A..--P-------------------------SLHA...
Q0FH91_PELBH/197-262-------------------------------RG.GS------S..--W-------------------------SMHA...
D4CCJ4_9CLOT/58-129-------------------------------NA.KG------SSY--S-------------------------SQHQ...
D0LQS8_HALO1/317-391-------------------------------QDADK------RAR--L-------------------------ARVVEFW
B6V2R4_BPSP1/74-136-------------------------------NA.RG------GY.--.-------------------------SNHN...
A0A038HZ79_BORBO/53-127-------------------------------QG.VS------QTL--R-------------------------SLHIPQP
A9KQC6_CLOPH/237-321-------------------------------EG.TT------T..--L-------------------------SKHA...
C6WMZ1_ACTMD/132-213-------------------------------TGGTA------...--W-------------------------SNHS...
A3K5D3_9RHOB/148-231-------------------------------AG.TS------R..--L-------------------------SQHA...
A4FKJ2_SACEN/154-235-------------------------------PGSGR------...--W-------------------------SQHA...
Q5YZK4_NOCFA/71-135-------------------------------RENLV------R..--N-------------------------SNHL...
Q1DAC7_MYXXD/63-125-------------------------------K..AS------PAG--L-------------------------SAHN...
D1BDT0_SANKS/65-131-------------------------------IAGST------D..--I-------------------------SNHA...
C7N3P8_SLAHD/215-297-------------------------------PG.TT------V..--M-------------------------SYHA...
A6Q7D6_SULNB/126-212-------------------------------TG.SK------N..--W-------------------------SRHS...
B6VNP6_PHOAA/57-126-------------------------------DG.HS------QTL--N-------------------------SRHL...
Q73V53_MYCPA/145-206-------------------------------PG.SD------R..--W-------------------------SEHA...
D7VN70_9SPHI/69-137-------------------------------NA.KG------GQ.--.-------------------------SIHN...
B5LJL3_9CAUD/69-133-------------------------------ATNDV------W..--N-------------------------SNHL...
A8LRY3_DINSH/108-171-------------------------------RNSRS------A..--I-------------------------SNHS...
C9MWB5_9FUSO/152-227-------------------------------R..GS------F..--K-------------------------SLHS...
D0LZM8_HALO1/111-191-------------------------------AG.TE------R..--L-------------------------SQHS...
C9DBZ2_9CAUD/70-142-------------------------------QDNTV------D..--T-------------------------SNHP...
D7VVF1_9FLAO/66-136-------------------------------NA.KA------GQ.--.-------------------------SIHN...
Q2SDK8_HAHCH/53-121-------------------------------AR.KS------KTM--R-------------------------SRHL...
C7RR41_ACCPU/164-241-------------------------------QG.TK------R..--T-------------------------SSHS...
A1SCY8_NOCSJ/370-428-------------------------------AG.ST------T..--L-------------------------SNHA...
B6FXG7_9FIRM/394-474-------------------------------AG.TK------V..--L-------------------------SKHG...
B6WQA8_9DELT/218-285-------------------------------AG.EQ------R..--L-------------------------SPHS...
A4T1K8_MYCGI/149-230-------------------------------PGSDS------...--W-------------------------SLHA...
Q7NR04_CHRVO/206-271-------------------------------QA.KG------GE.--.-------------------------SKHQ...
D4CX41_9FUSO/55-123-------------------------------QG.KS------KTL--K-------------------------SYHL...
B8J0M5_DESDA/248-315-------------------------------AG.ET------R..--L-------------------------SPHA...
A8EV90_ARCB4/175-243-------------------------------SR.TN------R..--L-------------------------SVHS...
C6PUE1_9CLOT/429-508-------------------------------RD.SD------S..--C-------------------------INHP...
D9SMB1_CLOC7/196-264-------------------------------SG.TG------R..--L-------------------------SPHS...
Q73JG3_TREDE/215-293-------------------------------AD.SG------K..--L-------------------------SNHS...
B8ENP1_METSB/622-688-------------------------------RGSTT------T..--L-------------------------SNHA...
C8Q0B7_9GAMM/78-152-------------------------------TW.LN------NPF--A-------------------------SKHV...
C0QJJ2_DESAH/140-230-------------------------------AG.GS------R..--W-------------------------SLHA...
Q5DZ88_VIBF1/125-214-------------------------------VG.KS------S..--L-------------------------SLHA...
C9MUL4_9FUSO/1065-1128-------------------------------KA.AP------GK.--.-------------------------SYHN...
C6D2R3_PAESJ/123-193-------------------------------NV.KG------GA.--.-------------------------SYHN...
D1PX89_9BACT/178-263-------------------------------KG.SR------K..--L-------------------------SAHA...
C3XMD6_9HELI/163-232-------------------------------AN.TD------R..--L-------------------------SAHS...
Q70K75_9ACTO/100-167-------------------------------PPTNA------T..--Y-------------------------SNHS...
C3K4K2_PSEFS/131-227-------------------------------TG.RP------G..--W-------------------------SIHA...
Q2LPY2_SYNAS/102-181-------------------------------FI.AG------TRR--L-------------------------SRHA...
A8GLN1_SERP5/79-147-------------------------------TG.KS------QTL--K-------------------------SRHL...
C0AQZ5_9ENTR/54-123-------------------------------EG.KS------KTL--N-------------------------SRHL...
D1RF68_LEGLO/59-140-------------------------------TDRPG------E..--Y-------------------------SQHS...
C6BUG1_DESAD/184-249-------------------------------RQ.GS------R..--F-------------------------STHS...
Q2LQQ3_SYNAS/55-131-------------------------------KI.VT------WTR--K-------------------------SKHI...
C7PFT3_CHIPD/191-256-------------------------------RGSRK------T..--L-------------------------SNHS...
A8ATR6_9CAUD/73-134-------------------------------NA.KG------GQ.--.-------------------------SNHN...
C0ZX75_RHOE4/85-149-------------------------------AANDV------A..--N-------------------------SNHL...
D0DDG3_9RHOB/197-267-------------------------------SG.TD------R..--L-------------------------SAHS...
A6W8P6_KINRD/95-156-------------------------------RN.PK------Y..--L-------------------------SNHS...
A7HJ25_FERNB/74-137-------------------------------KI.VT------YLK--N-------------------------SPHC...
B4WAV9_9CAUL/53-121-------------------------------AG.AS------RTL--R-------------------------SRHL...
D2XRK5_9CAUD/70-137-------------------------------PTNSV------P..--S-------------------------SNHL...
B5EHY6_GEOBB/165-227-------------------------------RGSPR------...--I-------------------------SSHS...
B1YH87_EXIS2/72-135-------------------------------NA.RG------GQ.--.-------------------------SNHN...
A7ZFD8_CAMC1/46-110-------------------------------TG.KS------KTM--Q-------------------------SNHL...
B8KYV5_9GAMM/51-117-------------------------------SV.GA------FS.--.-------------------------SCHN...
B2VDM6_ERWT9/41-110-------------------------------SG.KS------HTL--Q-------------------------SRHL...
B9JF39_AGRRK/850-911-------------------------------AG.TN------K..--L-------------------------SNHA...
E3I7F8_RHOVT/190-269-------------------------------AR.TT------R..--L-------------------------SVHS...
A1K513_AZOSB/150-214-------------------------------AA.RA------WE.--.-------------------------SRHQ...
B4V6Z2_9ACTO/133-214-------------------------------VGDPA------K..--L-------------------------SRHA...
D0TJH0_9BACE/157-246-------------------------------TGSTT------K..--I-------------------------SKHG...
Q0AVH5_SYNWW/269-331-------------------------------DS.AK------G..--L-------------------------SRHS...
D3VE22_XENNA/59-122-------------------------------AK.KS------QTM--K-------------------------SRHL...
A8S209_CLOBW/64-127-------------------------------NA.PG------SNY--S-------------------------SYHQ...
C6VVI7_DYAFD/85-145-------------------------------RG.SS------G..--I-------------------------STHA...
C4SXE4_YERIN/30-99-------------------------------TD.KS------QTL--N-------------------------SRHL...
A5FFV9_FLAJ1/170-242-------------------------------SG.TN------R..--L-------------------------SMHS...
B2Q011_PROST/55-124-------------------------------NG.QS------QTM--N-------------------------SRHL...
Q98H40_RHILO/198-268-------------------------------AG.TD------Q..--L-------------------------SVHS...
D1AEC5_THECD/163-244-------------------------------TG.SG------N..--W-------------------------SQHA...
D4DZ54_SEROD/54-122-------------------------------EG.KS------QTM--N-------------------------SRHI...
M1GCS0_LAWIN/228-297-------------------------------AG.EK------R..--L-------------------------SPHS...

PF01427

VANX_ENTFA/1-202ALREAQIHAAALGYGLLLWDGYRPKSAVDCFLRWAA------QPE--DNLTKEKYYPNIERAELITKGYVASQSSHS---
DDPX_SYNY3/31-240EILVFDAYRPIAVQQFMVDHTFAEIVARDGLQGQVL------TPE--QKENIYHQVYQIWAVPNNN...PLTPPPHS---
DDPX_ECOLI/3-187ALAKSISIAQLSGLQLVIYDAYRPQQAQ..AMLWQA------CPD--PQYVVDVTVG................SNHS---
O53850_MYCTU/62-256GLAAAAAVLRPHGQVLVFWDCYRPHDVQ..VRMFDV------VPN--PAWVARPGKYAHSHEAG.....RSVDVTFA---

PF03411

Q7VLX1_HAEDU/37-271PQLLSYLTDLAKRTRTA.GLPPILIGDMGMPAGGRF------ASG..H-------------------------ASHQ---
G7Z2K9_AZOL4/79-317PVLVDMLRDFGQRVALA.GLGTALIGDMGQARGGPM------PSG..H-------------------------ASHQ---
F2J3L2_POLGS/44-296PELIRFLERLAADAPAL.GWRGLLVGDLAQPRGGPM------TSG..H-------------------------SSHQ---
A8LNH7_DINSH/41-294PEAIAFVERLSRFAATQPGWKGLYIGDISQPRGGPM------TSG..H-------------------------QSHQ---
F8JE38_HYPSM/186-434PVLIALIERFAKDAQKLDGWPGLLVGDIAQPRGGPM------VTG..H-------------------------ASHQ---
D7A2C9_STAND/53-295PRLVAFLERFSAQVPTVSTWPGILVGDMAQPRGGPM------LSG..H-------------------------ASHQ---
G0A1D7_METMM/39-279ATLIQFIQQLGQVAADQ.QLGTLLIGDLGQARGGPT------PSG..H-------------------------RSHQ---
B7VJP4_VIBSL/34-277TESIQFIERLGLTTSKQ.LNTNLLVGDISLPRGGRF------SSG..H-------------------------SSHQ---
Q7MNJ8_VIBVY/38-271PETVNFIQELGYYADTH.LASTLMIADVSLPRGGRF------SFG..H-------------------------ASHQ---
D4ZCJ1_SHEVD/37-278PDLIEFIEDFSRQIHKL.SNQDLLIGDVSMPRGGDF------TSG..H-------------------------ASHQ---
Q89BJ0_BRADU/67-311PEMIALIKRLAARAHKDAGWPGILVGDIAQPRGGPA------LSG..H-------------------------ASHQ---
V4IED8_9GAMM/46-281PQTNALIRKLGKAMDRR.NGKLIMVGDLAQPRGGRM------SSS..H-------------------------VSHQ---
A0KJ73_AERHH/30-258PELIAYLTTLANQTRMA.GMPDLYIADLAMAHGGPF------TSG..H-------------------------RSHQ---
G8AJW0_AZOBR/59-295PELIDYLKGFGRKVAAA.GLGTALIGDMGQARGGPM------SFG..H-------------------------ASHQ---
A3N0A9_ACTP2/37-271PDLLSFLQRLAKNTKAA.GLPPILIGDMGMPAGGRF------SSG..H-------------------------ASHQ---
E3F225_KETVY/53-297PETLAFVQDLSRYAATLPGWEGLYVGDMSQPRGGPM------LSG..H-------------------------ASHQ---
W6R6D9_9RHIZ/59-306PAMISLLERLSRDAAKYDGWPGLLVGDISQPRGGPM------FNG..H-------------------------ASHQ---
Q6LU97_PHOPR/36-276SEMIQFLKGLSSDVQKL.RLGNMLVGDISMPRGGRF------SSG..H-------------------------ASHQ---
W0DWJ2_MARPU/43-274PRLLALIETLGRAQQAR.DERLVMVGDLSQPRGGRM------SGG..H-------------------------RSHQ---
M9RED3_9RHOB/64-306PDTVDYVQDLSRFAAMMDGWDGIYVGDMSQPRGGPM------LTG..H-------------------------ASHQ---
D8MV06_ERWBE/36-270PDLIMFIQRLSTQVHNL.QLGEVLIGDMGMAAGGRF------SSG..H-------------------------ASHQ---
C5BAF1_EDWI9/36-270PTLLAFVERLGTEVRAQ.HLGTLLIGDMAMPAGGSF------NGG..H-------------------------ASHQ---
C3MBY2_RHISN/55-301PEMIALVERFSHDAAEKIGWPGLLLGDISQPRGGPM------LSG..H-------------------------ASHQ---
Q98DM3_RHILO/86-328PAMIALIEKLSRDADAD.GWPGLLIGDISQPRGGPM------MTG..H-------------------------ASHQ---
E3I638_RHOVT/169-418PVLVTFIEKFAKDAKAKDGWPGLLIGDMSMPRGGPM------PFG..H-------------------------ASHQ---
Q11CB0_CHESB/47-289PDLIHLLERFSRDAAAD.GWPGLLVGDISQPRGGPM------LTG..H-------------------------ASHQ---
C5AYD5_METEA/65-307PHLVDFIERLAARAPQA.GWPGLLVGDMSQPRGGPM------LTG..H-------------------------ASHQ---
B2IE79_BEII9/75-315PALLAFLESFARKVPSVSHWAGILVGDMSQPRGGPM------ITG..H-------------------------ASHQ---
B9J6R8_AGRRK/59-304PEMIGLLERLSRDAAKYDGWPGLLVGDMAQPRGGPM------FNG..H-------------------------ASHQ---
MEPA_PECAS/41-275PDLLAFIHRLSTEVKRT.TSGNVLVGDMGMPVGGRF------SSG..H-------------------------ASHQ---
Q65U86_MANSM/44-278PEMISYLQRLGKKVEQA.GLPTMLIGDIAMPGGGRF------LTG..H-------------------------ASHQ---
N0B7W2_9RHIZ/170-420PQLISLIERFAKDAQKLDGWPGLLVGDIAQPRGGPM------ITG..H-------------------------ASHQ---
Q28VK1_JANSC/50-297TELIDYIETLTANVARNTSWNGLYVGDMAQPRGGPM------LTG..H-------------------------ASHQ---
B9JYQ7_AGRVS/40-286PAMIQTIEQLSRDAPKI.GWPGLLVGDIAQPRGGPM------ANG..H-------------------------ASHQ---
D5ASU0_RHOCB/43-298PELVAYLQDLSAFAATLPGWRGLYIGDLSQPRGGPM------TGG..H-------------------------ASHQ---
W0HVY1_9ENTR/36-270PDLLLFIQRLSNQVKHL.GLGEVLVGDMAMPAGGRF------SSG..H-------------------------ASHQ---
B8F448_HAEPS/37-270PQLLSYLKTLAKNAKAS.GIPPILIGDMGMPAGGRF------SSG..H-------------------------ASHQ---
Q87S60_VIBPA/36-276PNTIDFVESLALKANQK.LKTTLLIGDLSLPRGGRF------SSG..H-------------------------SSHQ---
B8IRL8_METNO/82-322PHLIAFLERFSKAVPAINGWPGLMVGDIAQPRGGPM------LTG..H-------------------------ASHQ---
R5EP69_9GAMM/31-270PELIDYIQKLVLKAKHY.NLPDLLIGDLSKRQGGSF------GGGSSH-------------------------GSHQ---
L0GX36_9GAMM/44-279PVLLDFVTDLGASLARH.SDRRLMVGDLAQPRGGLM------ASR..H-------------------------VSHQ---
Q3IY41_RHOS4/40-292PEMIEFLQALSVAARQI.GWAGLYVGDISQPRGGPM------TSG..H-------------------------ASHQ---
A4YL76_BRASO/65-307PLLIALLKRLAARAHKDAGWPGILVGDIGQPRGGPA------LSG..H-------------------------ASHQ---
B8EQJ0_METSB/63-305PKLIAFLEEFARKVPRVSNWPGILVGDMSQPRGGPM------LTG..H-------------------------ASHQ---
D3RNE7_ALLVD/49-287PDLIRFVHDLGRGQQQR.GSQFVMIGDLSQPRGGRM------SSS..H-------------------------RSHQ---
H2FVL9_OCESG/23-250PELIDYLHTLAQRAQQA.GLPPLLVADMAKEHGGPF------AYG..H-------------------------RSHQ---
H8GG79_METAL/41-278PDLKNFIETLGQSAVSR.HLGVLLIGDMGQPRGGPA------PSG..H-------------------------RSHQ---
S5Y7V8_PARAH/48-289PQMIDFLIGLSQAAQKS.GWRGLYIGDIGQPRGGPA------SSG..H-------------------------ASHQ---
Q1GD71_RUEST/59-305PETIDFIQDLSRVAARQPGWQGLYVGDISQPRGGPM------LSG..H-------------------------RSHQ---
I7DUV0_PHAIB/60-305PETIDFIKDLSRVAARQSGWNGLYVGDISQPRGGPM------LSG..H-------------------------RSHQ---
E3HYM4_RHOVT/58-304PALISYIETLARDVKRLDGLPGILVGDMAQPIGGPL------LGG..H-------------------------ASHQ---
M4RIZ0_BIBTR/37-269PNLLAYLQNLGKKAKQA.GLPPILIGDMGMAAGGRF------SSG..H-------------------------ASHQ---
Q3SVT3_NITWN/101-344PAMVALLERVSAKARRDAGWPGLLIGDMAQPRGGPM------LTG..H-------------------------ASHQ---
H2INY8_RAHAC/45-279PDLLAFITRLGTQAQQK.GLGTMLVGDMAMPAGGRF------SSG..H-------------------------ASHQ---
V6F1Q6_9PROT/42-277PRTVEFIEQLGRTAHHQ.GLGPLLIGDMSQPRGGPM------AYG..H-------------------------GSHQ---
A8HVK9_AZOC5/49-304PALIDFLERFAASVPQVSRWPGILVGDMSQPRGGPM------RTG..H-------------------------ASHQ---
B6JJU0_OLICO/62-305PELVALLERLAAKANKL.GWPGLLIGDMSQPRGGPM------FTG..H-------------------------ASHQ---
Q5LWS6_RUEPO/46-291PETIDFIRDLSGFAARQKGWSGLYIGDISQPRGGPM------LTG..H-------------------------RSHQ---
I2B718_SHIBC/36-270PDLLAFIGRLSSQSRQQ.GLGTLLIGDMGMAAGGRF------SSG..H-------------------------ASHQ---
B0UWQ5_HISS2/37-270PDMIAYLQRLGKKAKQA.GLPTILIGDIAMPGGGRF------LTG..H-------------------------ASHQ---
F4HED5_GALAU/40-271PEMLSYLQRLGQKVKNA.GLPTMLVGDIAMPAGGRF------ATG..H-------------------------ASHQ---
Q16D60_ROSDO/64-307PETVSFVKDLSRIAAQQPGWNGLYVGDLSQPRGGPM------LSG..H-------------------------ASHQ---
A7IJY5_XANP2/64-307PDLVVFLERFSAQVPKVSSWQGILVGDMSQPRGGPM------LTG..H-------------------------ASHQ---
G4SVA0_META2/57-295PDLIQFIENMGSEAMAQ.GWGTLLIGDLGQPRGGPT------LTG..H-------------------------RSHQ---
MEPA_ECOLI/36-270PDLVMFIQRLSSQVSNL.GMGTVLIGDMGMPAGGRF------NGG..H-------------------------ASHQ---
G8PRI5_PSEUV/75-327PVLINFLKRLAADAPSL.GWNGLLVGDLSQPRGGPM------LTG..H-------------------------ASHQ---
Q607R5_METCA/38-277PDLIRSIIDLGHATAQG.HWGELHVGDLSQPRGGPM------RFG..H-------------------------RSHQ---
V5SD71_9RHIZ/87-338PKLVSLVERLARETTDAKEWPGLLVGDISQPRGGPM------VSG..H-------------------------TSHQ---
G8AJ70_AZOBR/59-293PDTIAFVQELARRAQAE.RLGRLAIGDISKLYGGRM------ESG..H-------------------------ASHQ---
A8GH81_SERP5/36-269PDLLAFIQRLSSKANQK.NLGTVLIGDMAMPAGGRF------SSG..H-------------------------ASHQ---
B8IJD0_METNO/63-305PALVAFLERIAAKAPTRAGWPGLLVGDMSQPRGGPM------LTG..H-------------------------ASHQ---
D0LL99_HALO1/58-299PVLIAYLRDLASRVRAA.GGRDLLLGDLGQPRGGPA------PSG..H-------------------------SSHQ---
J7QQ34_METSZ/72-310PNLIAFLKNYSSKAARESGWPGLLIGDLSQPRGGPM------LSG..H-------------------------ASHQ---
B8CUQ4_SHEPW/47-288PTLISFIEDYSSHFRQY.SKSNLLIADMSMPRGGNF------THG..H-------------------------SSHQ---
Q2KDT7_RHIEC/59-307PAMIALLERFSQDAVKYAGWPGILVGDVAQPRGGPM------LNG..H-------------------------SSHQ---
Q2W4C2_MAGSA/42-276PATIRFVGDLARATKGEGISGPLLIGDMAQPRGGPM------PAG..H-------------------------GSHQ---
MEPA_HAEIN/43-277PNMIQYLERLGQRAKAA.GLPTMLVGDIAMPGGGRF------LTG..H-------------------------ASHQ---
F7QGC0_9BRAD/50-294PDLIALVERVAAKAKKNAGWPGILVGDMSQPRGGPM------LTG..H-------------------------ASHQ---
A1B5F2_PARDP/45-284PELVGFLIGLSQAARQV.GWQGLYIGDMGQPRGGPM------TSG..H-------------------------ASHQ---
I3YA59_THIV6/50-288PELLRFIQEMGRAQQRR.RGLAMMVGDLSQPRGGLM------STS..H-------------------------RSHQ---
A9CKL5_AGRT5/53-298PQLISFLERFSQDAQKI.GWPGLLLGDISQPRGGPM------LTG..H-------------------------ASHQ---
Q0BS55_GRABC/32-265PVTINGVKTLATRLHAQ.GLPDLYVGDMSAPHGGRL------PGG..H-------------------------GSHQ---
B1M521_METRJ/66-304PYLIDFIERLSQKAARV.GWPGLLVGDMAQPRGGPM------ITG..H-------------------------ASHQ---
Q2YJP1_BRUA2/82-325PRMIALLEKLSHDAARD.GWPGLLVGDISQPRGGPM------LTG..H-------------------------ASHQ---
Q6NCT0_RHOPA/69-313PATVRLIERVADKAREQAGWNGILVGDMSQPRGGPM------LTG..H-------------------------ASHQ---
C4LE77_TOLAT/27-261PIMQQYVLDLARQSKKA.GLPDILVGDMAMAKGGPF------SSG..H-------------------------RSHQ---

PF05951

Q9CNZ9_PASMU/32-183-------RG-----QAI------D--FRIDGV-PLAKLRQAAEK------------------------------------
Q9A852_CAUCR/63-213-------DG-----KAM------D--IFLEDV-ELKHVRAAALD------------------------------------
Q9KSI7_VIBCH/29-179-------SG-----QAI------D--FRLDGV-SLKKIREAAIS------------------------------------
Q989B8_RHILO/15-167-------VG-----RAM------D--FFLPDV-PLKKLRDIGLK------------------------------------
Q92JX1_RHIME/6-158-------LG-----KAM------D--FYIPDV-KLKTLREVGMK------------------------------------
Q98H74_RHILO/14-166-------LG-----KAM------D--FYIPGV-PLKKLRNIGLK------------------------------------
Q8EF76_SHEON/32-182-------QG-----MAM------D--IAIPGV-NLKTIRDAALS------------------------------------
Q7CT90_AGRT5/14-166-------LG-----KAM------D--FYIPGV-KLATLREIGMQ------------------------------------
Q2YIP2_BRUA2/25-176-------LG-----RAM------D--YFIPGV-PLAKLRAIGMR------------------------------------
Q7MJP7_VIBVY/37-186-------LG-----RAI------D--FRLDGV-KLSTVRDAALS------------------------------------

PF08291

Q7Y5M4_BPSP6/6-108-------TG.....KAA------D--IKVKGK.DASAIASYLEH------------------------------------
Q5LM88_RUEPO/18-119-------KA.....RAF------D--VSMINH.DPAEFEAAARA------------------------------------
Q8YUC7_NOSS1/127-243-------NG.....LAL------D--IAPVDG.NFGKLLQICRA------------------------------------
Q5NX34_AROAE/55-166-------PDNNGVFRAV------D--FWVPGA.NSEDVARMLEW------------------------------------
Q88L27_PSEPK/5-119-------QG.....LAA------D--FTVIEVSPRETVRRISKS------------------------------------
Q92KB7_RHIME/323-423-------RC.....EAA------D--IQVAGV.SKWELANFLRN------------------------------------
Q8CJR3_STRCO/116-230-------YG.....DAA------D--LTGSP..SFCRLAQQART------------------------------------
Q7MNT8_VIBVY/105-217-------TG.....KAA------D--LQVSGV.KPKDLYEKIIS------------------------------------
E6UFM5_RUMA7/197-303-------RG.....LAA------D--VVCYDK.NGNVIPCLTVA------------------------------------
Q31Q82_SYNE7/73-183-------TG.....GAA------D--VFPLQF.NPLEFEQWCEQ------------------------------------
Q5LCN2_BACFN/2-118-------LG.....QAA------D--ITVGSKEGNRRLFEIIRK------------------------------------
V4IU57_9ACTO/127-240-------YG.....HAA------D--LGAGSQ.GFCALAKAARN------------------------------------

PF01085

K1R6F4_CRAGI/30-187-------EG-----RAV------D--ITTSDK-DRAKYGMLAKL------------------------------------
F6XBS5_CIOIN/130-291-------EG-----RAV------D--ITTDDA-DRNKYPILARL------------------------------------
H2ZHI5_CIOSA/23-183-------EG-----RAV------D--IKTSDD-DTTKYGLLARL------------------------------------
H2YWW4_CIOSA/21-183-------EG-----RAV------D--ITTNDQ-DRRKYPMLARL------------------------------------
G3H796_CRIGR/24-184-------EG-----RAV------D--ITTSDR-DRSKYGMLARL------------------------------------
HH_DROME/85-244-------EG-----RAV------T--IATSDR-DQSKYGMLARL------------------------------------
W5MLT6_LEPOC/24-184-------EG-----RAV------D--ITTSDR-DPRKYGTLAQL------------------------------------
M4A9L1_XIPMA/27-187-------EG-----RAV------D--ITTDDR-ETKKYGILAQL------------------------------------
T1K174_TETUR/64-224-------EG-----RAA------D--ITTSDK-DNSKYGVLARL------------------------------------
W4Y925_STRPU/27-186-------EG-----RAV------D--ITTSDR-DKNKYGALARL------------------------------------
T1ELE5_HELRO/210-371-------EG-----RAV------D--VTTSDK-DKSKYGMLARL------------------------------------
J9K1A2_ACYPI/38-194-------EG-----RAV------D--ITTSDR-DKSKYGMLARL------------------------------------
A7RW45_NEMVE/1-161-------SG-----RAL------D--ITTSDE-KRDKLPMLGRL------------------------------------
K7J545_NASVI/41-201-------EG-----RAV------D--VTTSDR-DRAKYGMLARL------------------------------------
E5SNS5_TRISP/58-212-------EG-----RAV------D--ITTSDR-DRNKLGMLARL------------------------------------
F1SJ10_PIG/27-189-------EG-----RAL------D--ITTSDR-DRNKYGLLARL------------------------------------
Q175B3_AEDAE/38-198-------EG-----RAV------D--IMTSDK-DRSKIGMLARL------------------------------------

PF02557

YODJ_BACSU/120-250-------TG-----LAM------D--ISSRSNGF....EL....------------------------------------
Q65US8_MANSM/26-185-------WG-----TEI------D--FFDPDLLPQ.HQQLQLE.------------------------------------
O83250_TREPA/106-230-------LG-----TVV------D--FGSI..............------------------------------------
Q8Y645_LISMO/113-243-------TG-----LAM------D--ISSENQSY....EL....------------------------------------
Q5NHB6_FRATT/26-155-------TG-----RAI------D--LTTGDEKE...V.L....------------------------------------
Q7V800_PROMM/59-190-------TG-----YAI------D--LGDGTLPE...ANL....------------------------------------
Q7VCA8_PROMA/98-229-------TG-----YAI------D--LGDGDMRE...TDF....------------------------------------
Q55957_SYNY3/161-291-------TG-----YAL------D--IGDGANPA...NDL....------------------------------------
Q7U788_SYNPX/101-232-------TG-----YAI------D--LGDGEAPE...TNL....------------------------------------
Q7NI07_GLOVI/108-238-------TG-----YAI------D--FGDGTVPG...ANL....------------------------------------
Q55454_SYNY3/106-237-------TG-----YAV------D--IGDGSAQA...THL....------------------------------------
Q97E20_CLOAB/88-217-------TG-----LAM------D--LLSTEYS.....SL....------------------------------------
Q73Q11_TREDE/110-234-------LG-----TVI------D--LGSI..............------------------------------------
VANY_ENTFA/114-247-------LG-----LAV------D--INAD..............------------------------------------
Q7N3J3_PHOLL/21-178-------WG-----TDL------D--VYDPTMLPA.NQMLLLE.------------------------------------
Q5QTZ2_IDILO/20-179-------WG-----SDF------D--IYDPRPFQDSELKLQLVP------------------------------------
Q8E2A2_STRA5/89-225-------TG-----LAM------D--MSTVD.............------------------------------------
Q7V1U4_PROMP/94-224-------TG-----FAI------D--IGDADKRE...TDF....------------------------------------
Q8EEB5_SHEON/50-206-------WG-----TDI------D--VFDAEKIEVKSLRLVE..------------------------------------
Q67QI3_SYMTH/121-251-------TG-----LAM------D--ISGSTGEC....AA....------------------------------------
Q87MI5_VIBPA/23-179-------WG-----CDF------D--VYARNLLPP.DTKLQLE.------------------------------------
O51529_BORBU/101-225-------MG-----TAI------D--FINI..............------------------------------------
Q5KZM0_GEOKA/119-249-------TG-----LAV------D--ISSRSAGC....QL....------------------------------------
Q8PBI7_XANCP/80-208-------SG-----DAV------D--IGTPGEPP...A......------------------------------------
Q5WJW5_BACSK/100-228-------TG-----LAM------D--ISSASVDY....GL....------------------------------------
Q8DWH5_STRMU/90-226-------TG-----LAI------D--MSTVD.............------------------------------------
Q6D7N5_PECAS/20-177-------WG-----SDL------D--IYDPDLLPA.GSSLQLE.------------------------------------
Q9CM23_PASMU/28-187-------WG-----TEI------D--VFDPHLLPP.HQTLQLE.------------------------------------
Q7VNB4_HAEDU/28-186-------WG-----TEI------D--IFDPDLLPQ.GQHLQLE.------------------------------------
Q8EZA8_LEPIN/48-196-------WG-----TDV------D--LNALENSY...F......------------------------------------
Q8YQW0_NOSS1/118-249-------TG-----YAV------D--IGDGAAPT...TNL....------------------------------------
Q9PEZ7_XYLFA/74-202-------SG-----EAL------D--IGMPGEPP...V......------------------------------------
Q8DQQ1_STRR6/87-213-------TG-----LAF------D--VIGTD.............------------------------------------
Q7NMR7_GLOVI/149-279-------TG-----YAM------D--LGDALYPK...THL....------------------------------------
Q8XKL5_CLOPE/109-238-------LG-----LAV------D--LTTRSIGF....QL....------------------------------------
Q9CGZ2_LACLA/85-226-------TG-----LAI------D--MSNI..............------------------------------------
Q97KB0_CLOAB/144-267-------WG-----LAF------D--CAPVENG...........------------------------------------
Q8DKC7_THEEB/90-221-------TG-----YAV------D--IGDGAQPQ...THL....------------------------------------
Q8EST6_OCEIH/190-320-------TG-----LAM------D--VTSPEVNF....NL....------------------------------------
Q6LTW9_PHOPR/50-207-------WG-----TDV------D--VYAKNCLPV.NTSLQLE.------------------------------------
C2X0S1_BACCE/79-219-------TG-----LAL------D--IISVEWQNT.VEDL....------------------------------------
Q31ML7_SYNE7/94-224-------TG-----YAI------D--IGAADQPA...THL....------------------------------------
Q5M6D5_STRT2/106-240-------TG-----LAI------D--MSTVDS............------------------------------------
Q81L80_BACAN/110-237-------TG-----LAM------D--ISSKSA.K...FQL....------------------------------------
Q81QA6_BACAN/96-225-------TG-----LTM------D--VSSKSANN....EL....------------------------------------
Q81RH6_BACAN/99-227-------TG-----LAM------D--ITSQSA.K...FQL....------------------------------------
Q99YC5_STRP1/89-223-------TG-----LAI------D--MSTVD.............------------------------------------
T0U2B5_9ENTE/11-139-------IG-----LAI------D--VGLKKQED...DDL....------------------------------------

PF13539

A8ASL5_BPA50/72-136.......YG-----VAV......D..LC........L.YTNDGK....................................
B1QZK9_CLOBU/207-275.......YG-----ITI......D..LKSD....KRDYWKWASK....................................
Q3J4T3_RHOS4/201-266.......WG-----IAV......D..LDPE....RNPLRWGRDR....................................
A1ATB8_PELPD/203-268.......WG-----IAI......D..YDPE....RNQLTWGRER....................................
N8ZX51_ACIBI/194-260.......FG-----LAA......D..VA........F..KRNGK....................................
D1PEW6_9BACT/147-232.......RG-----LAV......D..INTL....YNPYHKRLKN......G.............................
A9WTX9_RENSM/144-210.......SG-----TAI......D..CNAP....QHPLGKA.......................................
A3TM69_9MICO/118-184.......SG-----TAI......D..CNAP....RHPLGAS.......................................
A4SFK8_PROVI/119-180.......FG-----IAW......D..IG........IFTAEGGY....................................
D4MUA4_9FIRM/428-503.......EG-----LAF......D..INSN....ENYMIQGKKV....................................
Q6LSS8_PHOPR/126-215.......YG-----LAI......D..INPV....QNPFVEFSTT......N.............................
C4L6K0_EXISA/116-185.......YG-----LAV......D..FV........I.IHNNKT....................................
A0A018PY40_SALET/45-107.......RR-----LAV......D..FN..........LFVNGQ....................................
A8EEH4_BURPE/142-232.......YG-----VAI......D..VNPV....QNPYVSFGED......G.............................
Q1QI98_NITHX/92-153.......YA-----AAI......D..LNAA....ENGFGAGHGT....................................
C4SEH9_YERMO/33-102.......TG-----HAV......D..LA........P.L.INNK....................................
D5U8W6_BRAM5/259-337.......YG-----VAF......D..TLPKKNNGKQIYWAWTRV....................................
A6LVB0_CLOB8/192-260.......YG-----IAI......D..LKSD....KRDYWKWSSE....................................
J7JIB9_BACIU/94-164.......YG-----LAI......D..FA........L.QKKDGS....................................
C2N1K8_BACCE/54-120.......VG-----QAL......D..FV........P.IQSNGT....................................
B7RRA8_9RHOB/214-277.......FG-----LSL......D..LN.........IDGKLDQ....................................
A0A034URH6_ERWAM/54-123.......TG-----HAV......D..LA........P.W.VNHS....................................
B1IKM8_CLOBK/171-239.......FG-----IAI......D..LVRD....NRDYWKWATE....................................
B5U3R2_9CAUD/70-134.......SA-----TAI......D..YNWN....KHPYQKW.......................................
A5UGL4_HAEIG/54-128.......TG-----HAV......D..LV........P.L....P....................................
A9G830_SORC5/143-223.......FG-----IAI......D..IDPD....RNP...CCGC....................................
B3VGP8_9CAUD/82-143.......SG-----VAV......D..VNAP....KYPWGTY.......................................
C7NA70_LEPBD/121-197.......LG-----RAI......D..INPD....ENPQLSPDGV....................................
E6VS38_DESAO/135-213.......LG-----LAI......D..INPR....LNPYV.........................................
B7VJV8_VIBSL/123-214.......YG-----VAI......D..INPV....QNPFLEFDSN......G.............................
C9MVB8_9FUSO/246-328DG.....FG-----HAV......D..IF........PCGVVENG....................................
D1CHT9_THET1/273-355.......YG-----WAI......D..INPV....QNPYV....T......A.............................
Q5DN15_9CAUD/21-99PKGGGEPVA-----HAV......D..LG........A.Y.VDGE....................................
B3VFY1_9CAUD/64-131.......NG-----TAM......D..LNWN....SHPFKVL.......................................
A0RNH9_CAMFF/569-634.......WG-----IAI......D..INVN....MSDYWQW.......................................
A3UWI6_VIBSP/67-136.......SG-----CAV......D..FV........V.YDENGK....................................
Q8ESQ8_OCEIH/97-167.......YG-----LAI......D..YA........I.KNNNGN....................................
A7XF57_9CAUD/52-120.......HG-----FAV......D..VV........A.Y.PKDK....................................
C6LLE4_9FIRM/274-349.......TG-----TAI......D..INWT....ENYMVNVRTG....................................
C4Z3D8_EUBE2/109-193.......LG-----LAV......D..INTL....YNPYVKYV.D......G.............................
B2U374_SHIB3/219-287.......TG-----HAV......D..VV........A.Y.IGSQ....................................
E6VQR6_DESAO/135-213.......YG-----RAI......D..INPQ....LNPYI.........................................
Q2SJV2_HAHCH/187-252.......IG-----HAI......D..CNLMDGDNWNSSATFSQG....................................
B5UY55_BACCE/196-257.......WG-----LAF......D..AA........P.YENNSI....................................
B7GIP5_ANOFW/70-132.......FG-----LAF......D..FA........I.LNANGS....................................
B4AH26_BACPU/73-136.......YG-----LAI......D..YV........L.LSADGK....................................
B3VGG0_9CAUD/70-142.......GG-----TGA......D..FNWN....GEDGRTF.......................................
Q1ZSD0_PHOAS/130-219.......YG-----AAI......D..LNPV....QNPFVTFARA......G.............................
C8XIK2_NAKMY/139-205.......SG-----TAI......D..LNSA....LHPNGAK.......................................
D9SKR7_CLOC7/252-312.......FG-----LAI......D..VV........EIVNGAAQ....................................
C7R275_JONDD/65-131.......SG-----TAV......D..FNAP....RHPLGAW.......................................
C3WMV9_9FUSO/63-140DG.....LG-----YAA......D..IG..........VIVNGE....................................
A8ATB8_9CAUD/56-121.......VG-----QAF......D..FV..........MAKGKT....................................
C6ANB6_AGGAN/178-255.......FG-----IAI......DFTLPNG....LGTYWQWSGC....................................
A6FEU3_9GAMM/129-218.......YG-----LAI......D..INPK....QNPFVEFGEQ......G.............................
A7ILH7_XANP2/449-509.......YG-----MAI......D..VNPS....ANPNGTTQSDLP..................................
Q854X2_9CAUD/66-133.......GG-----TAM......D..LNWS....DHPMGKA.......................................
C9QJ38_VIBOR/123-214.......YG-----VAI......D..INPV....QNPFLAFGKN......G.............................
Q7D1F2_AGRT5/53-126NG.....YS-----HAV......D..LA........A.L.VGGS....................................
Q2P050_XANOM/208-274.......YG-----LAV......D..SA........P..LRDGK....................................
A5MZT7_CLOK5/187-255.......FG-----IAI......D..LARD....RRDYWKWVSK....................................
B1YFG8_EXIS2/71-136.......FG-----VAV......D..LF........V.YADGGK....................................
I0WPH3_9NOCA/75-142.......SG-----TAV......D..LNAT....RLPWKVR.......................................
C4SJV6_YERFR/38-106.......TG-----HAV......D..IV........P.L.PDGK....................................
A6SU28_JANMA/93-182.......YG-----VAI......D..INPV....QNPFLQFEAD......G.............................
C6RGB5_9PROT/616-681.......YG-----IAI......D..INTD....KSDYWRW.......................................
B2S3I3_TREPS/209-287.......WG-----IAL......D..LMPKNWQRHTMYWNWEAA....................................
C4ZCU4_EUBR3/194-278.......MG-----MAV......D..INTL....YNPYVKTV.D......G.............................
Q7NS81_CHRVO/52-121.......TG-----HAI......D..LA........P.W.MDGA....................................
D4J1D4_BUTFI/117-201.......YG-----LAM......D..INTL....YNPYVKTV.N......G.............................
A9DC71_9RHIZ/63-156.......YG-----IAL......D..INWK....TNPYIDHAGQ....................................
B9KTY8_RHOSK/205-268.......WG-----TAI......D..LT.........LEGVLDP....................................
A1UGG7_MYCSK/185-266.......YG-----RAI......D..LNPL....LNPYI....G......G.............................
A3ID77_9BACI/3-33.........-----..................................................................
A1SG61_NOCSJ/370-446.......YG-----RSL......D..VNTW....ENPYRSARGT..............................VPNRWW
A7HN00_FERNB/195-263.......FG-----LAV......D..LAPK....RESYWLNASY....................................
B5EIM6_GEOBB/377-491.......YG-----AAI......D..INPR....QNPYLQVNPE......AYPVPSGDAASGSSGDTALAAADFCRNNGS
A9WKC4_CHLAA/591-661.......YG-----TAF......D..INAQ....WNGFYKPAAL....................................
C8KCM3_LISMN/56-121.......VG-----QAL......D..FA..........MTKGKT....................................
C8T4A1_KLEPR/54-122.......TG-----DAI......D..VV........A.Y.IDGK....................................
B2FJL7_STRMK/100-166.......HG-----WAA......D..MV........I..YKRGR....................................
C9S248_GEOSY/68-133.......FG-----LAF......D..IC........VCNVFKGT....................................
A6TN75_ALKMQ/198-278.......YG-----LAI......D..INPI....QNPYIKGD......................................
D4E385_SEROD/163-231.......TG-----HAV......D..VV........A.M.PAGV....................................
A3X9V1_9RHOB/202-265.......YG-----LAV......D..LN.........IDGQLDN....................................
D1AMG7_SEBTE/126-206.......YG-----FAV......D..INPV....QNPYIKNN......................................
E8WNQ9_GEOS8/380-487.......YG-----VAI......D..VNPL....QNPYLMLEGS......A.......REKGAAVTEAAAASDFCLANPG
D2AZ54_STRRD/158-239.......YG-----RAV......D..INPR....ENPYL....S......A.............................
B1YI53_EXIS2/118-187.......YG-----LAI......D..F.........V.QMIDGD....................................
C0D0F9_9CLOT/238-322.......YG-----FAI......D..INPQ....QNPYVSYR.D......G.............................
C4K5R3_HAMD5/92-182.......YG-----VAI......D..INPL....QNPYISYPEE......G.............................
Q0A7S9_ALKEH/202-267.......WG-----VAI......D..WDPD....QNKLRWGRDR....................................
B2K031_YERPB/45-107.......QR-----LAV......D..FN..........LFINGV....................................
D2PPJ5_KRIFD/298-379.......YG-----HAI......D..INTV....ENPYLAA.......................................
B4SDT7_PELPB/113-173.......FG-----IAF......D..IG...........VFEGN....................................
Q2B7L2_9BACI/116-186.......FG-----LAI......D..FA........L.LSLNGA....................................
D1ALL6_SEBTE/63-140DA.....YG-----YAV......D..LY........P..YINGS....................................
B0MC55_9FIRM/144-230.......YG-----RAI......D..INPR....VNPFVKRN......................................
A7ZD12_CAMC1/602-665.......YG-----IAI......D..INVK....KSHYWQWSKG....................................
Q3STE6_NITWN/103-162.......WA-----CAV......D..LSPR....SNGFNM........................................
A5ECX3_BRASB/184-253.......YA-----AAI......D..LNLD....YSDYWLWNAR....................................
A9KN76_CLOPH/502-575.......FG-----AAI......D..INPG....DYDNDYFLGK....................................
A7FDS7_YERP3/58-127.......TG-----HAV......D..LA........P.M.VNNR....................................
D1B2W5_SULD5/592-657.......YG-----IAI......D..LETR....YSRYWQW.......................................
C8X9H1_NAKMY/210-289.......YG-----TAI......D..VNPV....QNPYLR........................................
A0NQA8_9RHOB/173-238.......WG-----IAI......D..FDPE....RNRLSWKRPQ....................................
B9NP89_9RHOB/203-268.......YG-----AAL......D..LNPA....KNQLRWGADR....................................
B0NZY2_9CLOT/146-232.......YG-----MAI......D..INPR....INPWVKGN......................................
B1JRT0_YERPY/56-124.......TG-----HAI......D..VF........A.Y.PAAS....................................
Q5WK03_BACSK/108-178.......FG-----LAI......D..FA........L.LDEGGE....................................
C9XQ42_PEPDC/189-268.......KG-----RAI......D..INPL....QNPQVSGN......................................
B3Q3Z4_RHIE6/222-285.......WG-----AAV......D..LT.........LKKNLDN....................................
C4XNT5_DESMR/200-269.......FA-----AAV......D..VSPK....GNPYWRNLPR....................................
A5UTX9_ROSS1/590-659.......FG-----TAF......D..INYDPATNLNGLNAVPAL....................................
D3EJK7_GEOS4/101-171.......YG-----LAI......D..FA........L.RLKDGS....................................
D4BTB0_PRORE/43-105.......HR-----LAV......D..FN..........LFKDGK....................................
D3ADD3_9CLOT/85-148.......WG-----TAF......D..FF...........RNDGR....................................
Q7VJM2_HELHP/173-242.......FG-----IAL......D..INTQ....FSKYWLWDKK....................................
Q7MR54_WOLSU/185-254.......FG-----IAL......D..LDPK....ASRYWLWDRE....................................
A9DET4_9CAUD/64-132.......TG-----HAV......D..IS........P.L.VDGK....................................
C0CNE7_9FIRM/225-310.......YG-----CAI......D..LNPM....ENPYVVYDGD......T.............................
C6LBK9_9FIRM/257-343.......YG-----MAI......D..LNPM....VNPYVKNG......................................
B9JYE5_AGRVS/104-165.......YG-----CAV......D..LDPS....HNGLGD........................................
D9QLQ3_BRESC/53-121.......TG-----HAV......D..LA........A.L.VDGR....................................
B0VVC4_ACIBS/347-415.......YG-----LAI......D..VV..SVRNGKITYLSDGK....................................
C4K6W4_HAMD5/53-119.......TG-----HAV......D..LG........A.C.LDGS....................................
B2UP36_AKKM8/129-194.......WG-----IAV......D..IDPD....RNGLNIPAPK....................................
C4L144_EXISA/57-123.......VG-----QAI......D..FV........P.ANPEGK....................................
F0KAF2_CLOAE/198-263.......WG-----LAF......D..CA........P..VENGQ....................................
G3M4A5_9CAUD/70-151.......GA-----TAF......D..YNWS....DHPLGYAAPD....................................
Q5J5L5_9CAUD/70-137.......SG-----TAM......D..LNWN....THPFQIP.......................................
D0LWT6_HALO1/218-298.......YG-----IAL......D..LNPR......ENFGWVPR....................................
A4G1C9_HERAR/140-229.......YG-----AAI......D..INPV....QNPFVQFEDA......G.............................
Q0FH91_PELBH/197-262.......YG-----CAI......DFYAAPNALRMNCPQALFCGP....................................
D4CCJ4_9CLOT/58-129.......WG-----IAF......D..FF........LKMDINGN....................................
D0LQS8_HALO1/317-391SYSKAWIEG-----RAVR.....D........................................................
B6V2R4_BPSP1/74-136.......FG-----LAV......D..YF........L.YDDNGK....................................
A0A038HZ79_BORBO/53-127DG.....WA-----HAV......D..LA........P.L.VEGT....................................
A9KQC6_CLOPH/237-321.......YG-----LAI......D..INPK....YNPYVRTI.N......G.............................
C6WMZ1_ACTMD/132-213.......YG-----RAI......D..LNPV....QNPYV....S......A.............................
A3K5D3_9RHOB/148-231.......LG-----KAI......D..INPV....HNPYVQGR......................................
A4FKJ2_SACEN/154-235.......LG-----RAV......D..VNPL....INPYV....D......D.............................
Q5YZK4_NOCFA/71-135.......SG-----TAI......D..LNAP....KYPWGRR.......................................
Q1DAC7_MYXXD/63-125.......YG-----LAFDFVC..D..AS........P..RPGVQ....................................
D1BDT0_SANKS/65-131.......SG-----TAI......D..LNAP....RHPLGAV.......................................
C7N3P8_SLAHD/215-297.......QG-----LAI......D..INPY....YNPYVKVA......................................
A6Q7D6_SULNB/126-212.......YG-----KAI......D..LNSI....ENPYI....S......H.............................
B6VNP6_PHOAA/57-126.......TG-----HAV......D..LA........P.L.INST....................................
Q73V53_MYCPA/145-206.......YG-----RAI......D..LNPR....LNPCLYPT......................................
D7VN70_9SPHI/69-137.......YG-----LAF......D..IV........ILYDKDSN....................................
B5LJL3_9CAUD/69-133.......SG-----TAL......D..LCAD....ELPWQRR.......................................
A8LRY3_DINSH/108-171.......WG-----TAI......D..LT.........LEGKLDR....................................
C9MWB5_9FUSO/152-227.......TG-----RAI......D..LNPE....ENPQVNSNGK....................................
D0LZM8_HALO1/111-191.......FG-----NAI......D..INPV....QNPWL....S......G.............................
C9DBZ2_9CAUD/70-142.......GG-----TGM......D..LNWN....GADQKTF.......................................
D7VVF1_9FLAO/66-136.......YG-----LAV......D..IC........L..MIDGK....................................
Q2SDK8_HAHCH/53-121.......TG-----HAV......D..LG........A.L.INGA....................................
C7RR41_ACCPU/164-241.......FG-----IAI......DFRLPHG....LGHYWRWAGC....................................
A1SCY8_NOCSJ/370-428.......FG-----LAL......D..LNVP....GN............................................
B6FXG7_9FIRM/394-474.......KG-----VAI......D..INPL....YNPQVK...N......G.............................
B6WQA8_9DELT/218-285.......FG-----IAI......D..LSPQ....RAPYWRWAKV....................................
A4T1K8_MYCGI/149-230.......YG-----RAI......D..VNPK....LNPYV....P......R.............................
Q7NR04_CHRVO/206-271.......YG-----LAA......D..LA........P..VRNGK....................................
D4CX41_9FUSO/55-123.......KG-----KAV......D..IA........V.W.INGK....................................
B8J0M5_DESDA/248-315.......YG-----IAV......D..LSPR....LAPYWRWNKL....................................
A8EV90_ARCB4/175-243.......FG-----IAI......D..INLD....FSNYWQWDEK....................................
C6PUE1_9CLOT/429-508.......AG-----AAI......D..INPD....ENYYIQLDKD....................................
D9SMB1_CLOC7/196-264.......FG-----IAI......D..LASN....PKDYWQWASL....................................
Q73JG3_TREDE/215-293.......WG-----SAI......D..LLPANYKTKKIYWFWEAA....................................
B8ENP1_METSB/622-688.......FG-----TAF......D..INAR....FNPLKARPAL....................................
C8Q0B7_9GAMM/78-152.......SG-----KAV......D..LV........P.Y....P....................................
C0QJJ2_DESAH/140-230.......YG-----SAI......D..INPV....QNPFIDISED......G.............................
Q5DZ88_VIBF1/125-214.......YG-----AAI......D..INPL....QNPFVEFTSW......G.............................
C9MUL4_9FUSO/1065-1128.......YG-----LAI......D..IV........Q.ITNNGK....................................
C6D2R3_PAESJ/123-193.......YG-----LAV......D..FA........L.VKPDGD....................................
D1PX89_9BACT/178-263.......RG-----MAV......D..INTL....YNPYYRRSAN......G.............................
C3XMD6_9HELI/163-232.......FG-----IAI......D..INVA....KSRYWLWDLK....................................
Q70K75_9ACTO/100-167.......SG-----TAV......D..LNLE....IHGGQGF.......................................
C3K4K2_PSEFS/131-227.......YG-----AAI......D..INPV....QNPYVSFMRDEKGEYTG.............................
Q2LPY2_SYNAS/102-181.......SG-----LAV......D..FNPF....QNPVVYENGA....................................
A8GLN1_SERP5/79-147.......TG-----HAV......D..VV........A.Y.VGGK....................................
C0AQZ5_9ENTR/54-123.......TG-----HAV......D..IV........P.L.VNGA....................................
D1RF68_LEGLO/59-140.......YG-----RAI......D..INPL....INPYIKGK......................................
C6BUG1_DESAD/184-249.......WG-----IAV......D..YDPD....RNRRTWGRDK....................................
Q2LQQ3_SYNAS/55-131.......DG-----KAFDIAILRD..FK........P..CWDVK....................................
C7PFT3_CHIPD/191-256.......FG-----SAF......D..INVA....WNPLGAVPAL....................................
A8ATR6_9CAUD/73-134.......FG-----VAV......D..FA........IDLIDDGK....................................
C0ZX75_RHOE4/85-149.......SG-----TAL......D..FNAV....QYPWGQR.......................................
D0DDG3_9RHOB/197-267.......YG-----IAV......D..LNAD....LGGYWRWSGA....................................
A6W8P6_KINRD/95-156.......WG-----LAV......D..LNAG....ANPMGSPVRS....................................
A7HJ25_FERNB/74-137.......YG-----LAF......D..FV........P..IINGK....................................
B4WAV9_9CAUL/53-121.......SG-----HAV......D..VA........A.L.VEGQ....................................
D2XRK5_9CAUD/70-137.......SG-----TAM......D..LNWN....SHPFKVS.......................................
B5EHY6_GEOBB/165-227.......WG-----TAI......D..IN.........IKGALDE....................................
B1YH87_EXIS2/72-135.......RG-----IAV......D..LF........Q.YSMDGT....................................
A7ZFD8_CAMC1/46-110.......KR-----CAI......D..LH..........IFKNGV....................................
B8KYV5_9GAMM/51-117.......FG-----LAL......D..AA........V..FINGE....................................
B2VDM6_ERWT9/41-110.......TG-----HAI......D..LA........P.W.INHT....................................
B9JF39_AGRRK/850-911.......FG-----DAI......D..INPQ....QNPMGKNLVT......D.............................
E3I7F8_RHOVT/190-269.......FG-----IAF......D..INPE....HGGYWQYGLP....................................
A1K513_AZOSB/150-214.......YG-----LAA......D..LA........P..VRDGA....................................
B4V6Z2_9ACTO/133-214.......WG-----DAV......D..INPV....ENPYV....D......V.............................
D0TJH0_9BACE/157-246.......LG-----LAI......D..INAL....YNPYVKRKDD......G.............................
Q0AVH5_SYNWW/269-331.......WG-----TAI......D..INAA.....NHFRRVDPE....................................
D3VE22_XENNA/59-122.......HG-----FAV......D..LY........P...........................................
A8S209_CLOBW/64-127.......WG-----TAF......D..IY...........RNDGA....................................
C6VVI7_DYAFD/85-145.......WG-----IAV......D..LNAN....WNPFRGKVTW....................................
C4SXE4_YERIN/30-99.......TG-----HAV......D..LA........P.W.INQS....................................
A5FFV9_FLAJ1/170-242.......YG-----MTI......D..INVK....NSNYWQWDCK....................................
B2Q011_PROST/55-124.......TG-----HAV......D..CA........P.L.IHRQ....................................
Q98H40_RHILO/198-268.......FG-----AAF......D..INVG....YSDYWFWSKP....................................
D1AEC5_THECD/163-244.......YG-----LAI......D..INPC....QNPYVSASG.....................................
D4DZ54_SEROD/54-122.......SG-----HAV......D..VF........A.Y.PTPA....................................
M1GCS0_LAWIN/228-297.......YG-----IAI......D..LHPK....KGIYWRLVKD....................................

PF01427

VANX_ENTFA/1-202-------RG-----STI------D--LTLYHLDTGELVSMGSNF------------------------------------
DDPX_SYNY3/31-240-------TG-----AAL------D--ITLL.DDLGQPVDMGGEI------------------------------------
DDPX_ECOLI/3-187-------RG-----TAI------D--LTLR.DEHGNILDMGAGF------------------------------------
O53850_MYCTU/62-256-------SA-----QRQ------C--PSVRRSGELCLADMGTDF------------------------------------

PF03411

Q7VLX1_HAEDU/37-271-------TG-----LDA------D--IWLRFGPMD.....DKTA------------------------------------
G7Z2K9_AZOL4/79-317-------IG-----LDA------D--VWLRLDLPP.....MGRA------------------------------------
F2J3L2_POLGS/44-296-------IG-----LDA------D--IWLT....PMPDRRLSSR------------------------------------
A8LNH7_DINSH/41-294-------MG-----LDI------D--IWML....PPKRLNLSRA------------------------------------
F8JE38_HYPSM/186-434-------IG-----LDA------D--FWLT....PMPKKRLTRK------------------------------------
D7A2C9_STAND/53-295-------IG-----LDA------D--IWLT....PMPRREFTRD------------------------------------
G0A1D7_METMM/39-279-------TG-----LDV------D--IWFLLSK.QLDNRLLSAN------------------------------------
B7VJP4_VIBSL/34-277-------TG-----LDI------D--IWLRLTDKK.....LSEN------------------------------------
Q7MNJ8_VIBVY/38-271-------TG-----LDI------D--VWLKLNTSP.....LNKY------------------------------------
D4ZCJ1_SHEVD/37-278-------IG-----LDV------D--IWFRRATKA.....LTQE------------------------------------
Q89BJ0_BRADU/67-311-------IG-----LDA------D--IWLT....PMPDHRLSRE------------------------------------
V4IED8_9GAMM/46-281-------NG-----LDV------D--IWLTLADSPAQAVRDTPE------------------------------------
A0KJ73_AERHH/30-258-------TG-----LDA------D--IWFRMANQP.....ISTW------------------------------------
G8AJW0_AZOBR/59-295-------IG-----LDA------D--VWLRLDHPP.....MGRN------------------------------------
A3N0A9_ACTP2/37-271-------TG-----LDA------D--IWFRFGPMD.....EQTA------------------------------------
E3F225_KETVY/53-297-------SG-----LDM------D--IWML....PPSRLDLTRS------------------------------------
W6R6D9_9RHIZ/59-306-------IG-----LDA------D--VWLT....PMPAHPMSVE------------------------------------
Q6LU97_PHOPR/36-276-------TG-----LDA------D--IWLKMTDTP.....LEKE------------------------------------
W0DWJ2_MARPU/43-274-------HG-----LDV------D--LWLTLAASPADARALLDE------------------------------------
M9RED3_9RHOB/64-306-------TG-----LDA------D--IWML....PPNRLNLNRQ------------------------------------
D8MV06_ERWBE/36-270-------SG-----LDV------D--IWLQLPKSR.....WSSA------------------------------------
C5BAF1_EDWI9/36-270-------SG-----LDV------D--IWLQLPQVR.....WTQQ------------------------------------
C3MBY2_RHISN/55-301-------IG-----LDA------D--IWLT....PMPQRTLTYQ------------------------------------
Q98DM3_RHILO/86-328-------IG-----LDA------D--IWLT....PMPDRTMTRA------------------------------------
E3I638_RHOVT/169-418-------VG-----LDV------D--IWYK....PMPGRTLAVD------------------------------------
Q11CB0_CHESB/47-289-------IG-----LDA------D--IWFT....PMPNRRLSIE------------------------------------
C5AYD5_METEA/65-307-------LG-----LDV------D--VWLT....PMPDHRMTRA------------------------------------
B2IE79_BEII9/75-315-------IG-----LDA------D--IWLA....PMPNHELTRQ------------------------------------
B9J6R8_AGRRK/59-304-------IG-----LDA------D--VWLT....PMPSRTLTAA------------------------------------
MEPA_PECAS/41-275-------SG-----LDV------D--IWLQLPRQR.....WSEQ------------------------------------
Q65U86_MANSM/44-278-------MG-----LDA------D--IWLRMGSMS.....DQDA------------------------------------
N0B7W2_9RHIZ/170-420-------VG-----LDA------D--IWLT....PMPKRRLTRK------------------------------------
Q28VK1_JANSC/50-297-------SG-----IDV------D--MWML....PARDLTLTEE------------------------------------
B9JYQ7_AGRVS/40-286-------IG-----LDA------D--IWLT....PMPAKRLTVQ------------------------------------
D5ASU0_RHOCB/43-298-------IG-----LDA------D--IWML....PATRLDLSAK------------------------------------
W0HVY1_9ENTR/36-270-------SG-----LDA------D--IWLQTPRQR.....WSAS------------------------------------
B8F448_HAEPS/37-270-------TG-----LDA------D--IWLRFGPMD.....DETA------------------------------------
Q87S60_VIBPA/36-276-------TG-----LDI------D--IWLRLADSP.....LSYN------------------------------------
B8IRL8_METNO/82-322-------IG-----LDA------D--IWLT....PMPDHRLSRA------------------------------------
R5EP69_9GAMM/31-270-------SG-----LDV------D--ISFDFSTPKKSFYELSH.------------------------------------
L0GX36_9GAMM/44-279-------NG-----LDV------D--IWFTLASSATEARRETAN------------------------------------
Q3IY41_RHOS4/40-292-------IG-----LDA------D--VWML....PPRRLDLTVA------------------------------------
A4YL76_BRASO/65-307-------IG-----LDA------D--IWLT....PMPEHRLSRN------------------------------------
B8EQJ0_METSB/63-305-------IG-----LDA------D--IWLT....PMPGRELSRA------------------------------------
D3RNE7_ALLVD/49-287-------NG-----LDV------D--VWFTLANSPTAARQLMDD------------------------------------
H2FVL9_OCESG/23-250-------TG-----LDA------D--IWLRPGDTGLPAE.....------------------------------------
H8GG79_METAL/41-278-------NG-----LDV------D--IWFLLSK.QAETRTLADH------------------------------------
S5Y7V8_PARAH/48-289-------MG-----LDA------D--IWML....PPSSLKLSAA------------------------------------
Q1GD71_RUEST/59-305-------IG-----LDA------D--IWML....PPDRLDLSRE------------------------------------
I7DUV0_PHAIB/60-305-------MG-----LDA------D--IWML....PAKRLDLSVA------------------------------------
E3HYM4_RHOVT/58-304-------SG-----IDV------D--LWYN....LMPARTLSAE------------------------------------
M4RIZ0_BIBTR/37-269-------TG-----LDA------D--VWLRFGPMD.....DKTA------------------------------------
Q3SVT3_NITWN/101-344-------IG-----LDA------D--VWLT....PMPNRLLSRN------------------------------------
H2INY8_RAHAC/45-279-------SG-----LDV------D--IWLQLPRQR.....WSEQ------------------------------------
V6F1Q6_9PROT/42-277-------NG-----LDV------D--IWFRLPGKM.....LNAR------------------------------------
A8HVK9_AZOC5/49-304-------VG-----LDA------D--IWLT....PSPGRAFTPQ------------------------------------
B6JJU0_OLICO/62-305-------VG-----LDA------D--IWLT....PMPNRTLTRA------------------------------------
Q5LWS6_RUEPO/46-291-------LG-----LDI------D--IWML....QANNLRLSGQ------------------------------------
I2B718_SHIBC/36-270-------IG-----LDV------D--IFLQLPQVR.....WSQA------------------------------------
B0UWQ5_HISS2/37-270-------MG-----LDA------D--IWLRLGKLS.....AKDA------------------------------------
F4HED5_GALAU/40-271-------MG-----LDA------D--IWLKMGAMS.....AKQA------------------------------------
Q16D60_ROSDO/64-307-------IG-----LDA------D--IWLR....PATNLSLSVA------------------------------------
A7IJY5_XANP2/64-307-------IG-----LDA------D--IWLT....PSPGRELSRE------------------------------------
G4SVA0_META2/57-295-------TG-----LDV------D--IWYLISH.KATLRSLTME------------------------------------
MEPA_ECOLI/36-270-------TG-----LDV------D--IFLQLPKTR.....WTSA------------------------------------
G8PRI5_PSEUV/75-327-------IG-----LDA------D--IWLR....QMPDYRFSTK------------------------------------
Q607R5_METCA/38-277-------TG-----IDA------D--VWFAL...DPNLIRNADG------------------------------------
V5SD71_9RHIZ/87-338-------IG-----LDA------D--VWLT....PMPDRTLTKR------------------------------------
G8AJ70_AZOBR/59-293-------IG-----LDV------D--VWFDLDQPP.....LVRE------------------------------------
A8GH81_SERP5/36-269-------SG-----LDV------D--IWLQLPRQR.....WSAQ------------------------------------
B8IJD0_METNO/63-305-------LG-----LDA------D--IWLT....PMPDRRLSRA------------------------------------
D0LL99_HALO1/58-299-------TG-----LDV------D--VWYRDPGHD.EQRPLRRR------------------------------------
J7QQ34_METSZ/72-310-------IG-----LDA------D--IWLA....PMPDRELTRE------------------------------------
B8CUQ4_SHEPW/47-288-------IG-----LDV------D--IWFKLAEQA.....LTVM------------------------------------
Q2KDT7_RHIEC/59-307-------IG-----LDA------D--IWFT....PMPARRMTAQ------------------------------------
Q2W4C2_MAGSA/42-276-------NG-----LDV------D--IWFRLPAKP.....LSRA------------------------------------
MEPA_HAEIN/43-277-------MG-----LDA------D--IWLRMGEMS.....DADA------------------------------------
F7QGC0_9BRAD/50-294-------VG-----LDA------D--IWLT....PMPNRQFSRE------------------------------------
A1B5F2_PARDP/45-284-------SG-----LDA------D--IWML....PPQSLQLSAA------------------------------------
I3YA59_THIV6/50-288-------NG-----LDV------D--IWFTLAASPADARRRMDQ------------------------------------
A9CKL5_AGRT5/53-298-------IG-----LDV------D--VWWR....PMPSPRLTVE------------------------------------
Q0BS55_GRABC/32-265-------NG-----LDV------D--LYLDLTPRPA....LTPD------------------------------------
B1M521_METRJ/66-304-------IG-----IDA------D--VWLT....PMPDHRMSRA------------------------------------
Q2YJP1_BRUA2/82-325-------VG-----LDA------D--IWLT....PMPKKRFTNA------------------------------------
Q6NCT0_RHOPA/69-313-------VG-----LDA------D--IWLT....PMPNRQLSRN------------------------------------
C4LE77_TOLAT/27-261-------SG-----LDT------D--FWFRFAAKP.....LSAR------------------------------------

PF05951

Q9CNZ9_PASMU/32-183------------------------------------------------------------------LNNG----------
Q9A852_CAUCR/63-213------------------------------------------------------------------LSVG----------
Q9KSI7_VIBCH/29-179------------------------------------------------------------------LQAG----------
Q989B8_RHILO/15-167------------------------------------------------------------------MQGG----------
Q92JX1_RHIME/6-158------------------------------------------------------------------FQVG----------
Q98H74_RHILO/14-166------------------------------------------------------------------MQGG----------
Q8EF76_SHEON/32-182------------------------------------------------------------------LKLG----------
Q7CT90_AGRT5/14-166------------------------------------------------------------------MQIG----------
Q2YIP2_BRUA2/25-176------------------------------------------------------------------YQIG----------
Q7MJP7_VIBVY/37-186------------------------------------------------------------------LEAG----------

PF08291

Q7Y5M4_BPSP6/6-108------------------------------------------------------------------KYPD----------
Q5LM88_RUEPO/18-119------------------------------------------------------------------VGFT----------
Q8YUC7_NOSS1/127-243------------------------------------------------------------------SDCT----------
Q5NX34_AROAE/55-166------------------------------------------------------------------ARTG----------
Q88L27_PSEPK/5-119------------------------------------------------------------------AVPF----------
Q92KB7_RHIME/323-423------------------------------------------------------------------VPGR----------
Q8CJR3_STRCO/116-230------------------------------------------------------------------HGFS----------
Q7MNT8_VIBVY/105-217------------------------------------------------------------------LINN----------
E6UFM5_RUMA7/197-303------------------------------------------------------------------WAAE----------
Q31Q82_SYNE7/73-183------------------------------------------------------------------NWNG----------
Q5LCN2_BACFN/2-118------------------------------------------------------------------ELPF----------
V4IU57_9ACTO/127-240------------------------------------------------------------------HGFT----------

PF01085

K1R6F4_CRAGI/30-187------------------------------------------------------------------AVEA----------
F6XBS5_CIOIN/130-291------------------------------------------------------------------AVVA----------
H2ZHI5_CIOSA/23-183------------------------------------------------------------------AVEA----------
H2YWW4_CIOSA/21-183------------------------------------------------------------------AVEA----------
G3H796_CRIGR/24-184------------------------------------------------------------------AVEA----------
HH_DROME/85-244------------------------------------------------------------------AVEA----------
W5MLT6_LEPOC/24-184------------------------------------------------------------------AVEA----------
M4A9L1_XIPMA/27-187------------------------------------------------------------------AVEA----------
T1K174_TETUR/64-224------------------------------------------------------------------AVIA----------
W4Y925_STRPU/27-186------------------------------------------------------------------AVEA----------
T1ELE5_HELRO/210-371------------------------------------------------------------------AVEA----------
J9K1A2_ACYPI/38-194------------------------------------------------------------------AVEA----------
A7RW45_NEMVE/1-161------------------------------------------------------------------AYRA----------
K7J545_NASVI/41-201------------------------------------------------------------------AVEA----------
E5SNS5_TRISP/58-212------------------------------------------------------------------AIQA----------
F1SJ10_PIG/27-189------------------------------------------------------------------AVEA----------
Q175B3_AEDAE/38-198------------------------------------------------------------------AVEA----------

PF02557

YODJ_BACSU/120-250------------------------------....NEAFGSTADGKWVQDNAY----------KYG-FIIR----------
Q65US8_MANSM/26-185------------------------------PWEYEQDGYFFELSRFLQQNLP----------QFD-FVLP----------
O83250_TREPA/106-230------------------------------....TPAFARSDAGRWTQRNAH----------RFG-WSLS----------
Q8Y645_LISMO/113-243------------------------------....TEAFGTTPEGKWLQENAH----------NYG-FILR----------
Q5NHB6_FRATT/26-155------------------------------....TEDFEKTYAFEWLVKNAH----------KYG-FKLS----------
Q7V800_PROMM/59-190------------------------------....SESFEATRAFRWLQDHAA----------SYH-FVLS----------
Q7VCA8_PROMA/98-229------------------------------....EVSFEETPAFSWLQRNAA----------KYH-FVLS----------
Q55957_SYNY3/161-291------------------------------....KINFENTSAYQWLARNAN----------QYG-FELS----------
Q7U788_SYNPX/101-232------------------------------....SQSFEQTRAFRWLQDNAA----------RYH-FILS----------
Q7NI07_GLOVI/108-238------------------------------....RPRFEQTVAFRWLTANAR----------KFG-FEMS----------
Q55454_SYNY3/106-237------------------------------....SASFAQTKAFNWLQNNAA----------KYS-FELS----------
Q97E20_CLOAB/88-217------------------------------....DDGFMNTNSYKWLQQNCG----------KYG-FIIR----------
Q73Q11_TREDE/110-234------------------------------....DDSYADTAEGKWMFKNAW----------KYG-WSLS----------
VANY_ENTFA/114-247------------------------------....GIHSTGNEVYRWLDENSY----------RFG-FIRR----------
Q7N3J3_PHOLL/21-178------------------------------PWEYENGGYFAPLTHWLTENMA----------HFG-FYRP----------
Q5QTZ2_IDILO/20-179------------------------------GEYIDQSGPCHELWQWLTRHAH----------ESG-FFFP----------
Q8E2A2_STRA5/89-225------------------------------....SLNESDPRVVSQLKKIAP----------QYG-FVLR----------
Q7V1U4_PROMP/94-224------------------------------....EVQFENTDAFRWLKKNAA----------KYH-FKLS----------
Q8EEB5_SHEON/50-206------------------------------.AEYRDGGPCAQLHQWLVANAK----------DFG-FYFP----------
Q67QI3_SYMTH/121-251------------------------------....DDCFAGTPEAEWLAAHAH----------EFG-FIVR----------
Q87MI5_VIBPA/23-179------------------------------.PWEYLEGHQLAFYCWLKDHID----------EFG-FFFP----------
O51529_BORBU/101-225------------------------------....DDNLLNTKEGKWLYENSL----------KYG-FSVS----------
Q5KZM0_GEOKA/119-249------------------------------....TQSFGATKEGQWVAAHAH----------EYG-FIIR----------
Q8PBI7_XANCP/80-208------------------------------....EESFESTAAVAWLQTHAG----------RFG-FRLS----------
Q5WJW5_BACSK/100-228------------------------------....IEAFGLTAEGQWVAEHAH----------QFG-FIIR----------
Q8DWH5_STRMU/90-226------------------------------....SLNQSDANVVAKVAAIAP----------KYG-FVLR----------
Q6D7N5_PECAS/20-177------------------------------PWEYEEGGYFAALNGWLSAHMH----------EYG-FYRP----------
Q9CM23_PASMU/28-187------------------------------PWEYEQGGYFFELSDWLQQNLA----------HFD-FALP----------
Q7VNB4_HAEDU/28-186------------------------------PWEYQSNGYFAPLIKWLHQHSA----------SFG-FY..----------
Q8EZA8_LEPIN/48-196------------------------------....EKGGKGEKFYNWMFKNAK----------RFG-FCQP----------
Q8YQW0_NOSS1/118-249------------------------------....QAIFENTRAFKWLEANAA----------RFG-FEMS----------
Q9PEZ7_XYLFA/74-202------------------------------....EENFEGSSAFAWLQGHAG----------RFG-FHLS----------
Q8DQQ1_STRR6/87-213------------------------------....GDLVTEEKAAQWLLDHAA----------DYG-FVVR----------
Q7NMR7_GLOVI/149-279------------------------------....ETTFENTPAFRWLSRNAA----------RFG-FELS----------
Q8XKL5_CLOPE/109-238------------------------------....EESFEDTKEGQWLLENSH----------KYG-FVLR----------
Q9CGZ2_LACLA/85-226------------------------------.....DSLNESQYAKQVAAIAP----------KYG-FVLR----------
Q97KB0_CLOAB/144-267------------------------------....QVSWNDITSFNEMGRLGQ----------QVG-LEWG----------
Q8DKC7_THEEB/90-221------------------------------....KETFEDTPAFRWLAKNAA----------RFS-FELS----------
Q8EST6_OCEIH/190-320------------------------------....VTEFGETKEGKWVKENAA----------NYG-FIIR----------
Q6LTW9_PHOPR/50-207------------------------------PWEYQTNGHQAEFNQWLSAHMG----------EYG-FYLP----------
C2X0S1_BACCE/79-219------------------------------....NAKFETTDAFKWLDKNAA----------EYG-FTLR----------
Q31ML7_SYNE7/94-224------------------------------....ETTFEQTAAFRWLQANAK----------RFS-FELS----------
Q5M6D5_STRT2/106-240------------------------------.....LDEADPATVAKVKKIAP----------KYG-FVLR----------
Q81L80_BACAN/110-237------------------------------....EPIFGETAEGKWVAKHAH----------EFG-FVIR----------
Q81QA6_BACAN/96-225------------------------------....ELTFANTKEGKWLKENAH----------RAG-FIIR----------
Q81RH6_BACAN/99-227------------------------------....ETIFGETKEGQWLSENAH----------KFG-FVIR----------
Q99YC5_STRP1/89-223------------------------------....TLNASDPSVAKAVQKIAP----------DYG-FVLR----------
T0U2B5_9ENTE/11-139------------------------------...ICPHFRDSAAADLFMQQMM----------NYG-FILR----------

PF13539

A8ASL5_BPA50/72-136...DV.I.....-------...........W.E.......STTSRWKK..VV----------..A.AMKA......----
B1QZK9_CLOBU/207-275............-------................EQGESRIREYPEE..LV----------..S.AFEK......----
Q3J4T3_RHOS4/201-266............-------.....................ASFAAPAY..EP----------FWT.IVET......----
A1ATB8_PELPD/203-268............-------.....................AAFSRPEY..AA----------WWR.FWEE......----
N8ZX51_ACIBI/194-260VVISERD.....-------...........P.........WAMRGYQL..YG----------..E.VAES......----
D1PEW6_9BACT/147-232KEVVEPATARPY-------L.DRSK..N......HA.Y...MIKKGDL..CY----------..R.LFKA......----
A9WTX9_RENSM/144-210............-------................GTFRAAQVKAIHK..II----------..A.DC........----
A3TM69_9MICO/118-184............-------................GTFSSAQVSRIRS..IL----------..T.YC........----
A4SFK8_PROVI/119-180............-------....................VTGRDDYDE..AA----------..R.IGLT......----
D4MUA4_9FIRM/428-503............-------.........LAGSFWKPKKNRYSIPLNCK..LV----------..K.ILEK......----
Q6LSS8_PHOPR/126-215TAIFKPQAGIK.-------YANRMK..Y......RF.GKTERGGMAEE..VI----------..E.LFAK......----
C4L6K0_EXISA/116-185......D.....-------...........Y.DLNTDRNRNDIPDWQE..LG----------..E.LGKA......----
A0A018PY40_SALET/45-107............-------...................YQTRTEDYLP..LG----------..E.YWES......----
A8EEH4_BURPE/142-232EARVLPASAAKT-------SMNRLD..E......RP.GKPARPGMAER..VV----------..D.VFAD......----
Q1QI98_NITHX/92-153............-------.........................MPQP..VI----------..D.AFKR......----
C4SEH9_YERMO/33-102IP..........-------...........WED...WGAFHQVAKAMK..QA----------..A.LEME......----
D5U8W6_BRAM5/259-337NNKAWYAVPYE.-------.....................KRWHPPKS..VV----------..K.TFEK......----
A6LVB0_CLOB8/192-260............-------................KAGKERLSDYPKE..LV----------..E.AFEK......----
J7JIB9_BACIU/94-164....I.I.....-------...........W.DMEYDGNQNGKSDWLE..VV----------..E.IAKT......----
C2N1K8_BACCE/54-120ED..........-------...........W.N...GYNKEPWASAIR..YA----------..K.Q.........----
B7RRA8_9RHOB/214-277............-------.................LGDGRTQLGLTI..LA----------..D.FFRT......----
A0A034URH6_ERWAM/54-123IP..........-------...........WQD...WDAFVLIAKAMK..KA----------..S.AQSE......----
B1IKM8_CLOBK/171-239............-------................SQGQERIASYPKE..IV----------..E.TFEK......----
B5U3R2_9CAUD/70-134............-------................GTWPNR..AAVDK..IV----------..D.DF........----
A5UGL4_HAEIG/54-128VN..........-------...........WND...REPFKNVASAMF..QA----------..A.KQLG......----
A9G830_SORC5/143-223VDP.........-------...........WPT.......SPLCQEKKRSAY----------..ERTALSRCWIKA----
B3VGP8_9CAUD/82-143............-------.................RMSADKIAKVEE..GL----------..R.LF........----
C7NA70_LEPBD/121-197............-------........VLVGKKWEPYQNPYSITPEGD..VV----------..R.AFTS......----
E6VS38_DESAO/135-213RGDLALPPGATY-------...............DP.AVAGTLTADHP..VV----------..L.GFRR......----
B7VJV8_VIBSL/123-214RITVKPSQSATR-------YVNRTR..F......RARDEIERRGMAED..VV----------..E.LFAY......----
C9MVB8_9FUSO/246-328VYRKFT......-------...........SEEGYDEKKLKLIANHIL..AV----------..A.KSKN......----
D1CHT9_THET1/273-355SGVVLPPAGQRY-------L.DRTQ..D......LP.G...MIKPGDV..VV----------..R.AFER......----
Q5DN15_9CAUD/21-99VR..........-------...........W.D...WPLYHKIAKAVK..QA----------..A.RELN......----
B3VFY1_9CAUD/64-131............-------.........NAGFTPE......QIAIIRE..LL----------..A.FY........----
A0RNH9_CAMFF/569-634....SKDGK...-------.....................YHNNIPKD..IV----------..E.VFEK......----
A3UWI6_VIBSP/67-136VT..........-------...........W.G...FSYYEQVSWAFK..QA----------..A.DELG......----
Q8ESQ8_OCEIH/97-167....V.L.....-------...........W.DIHYDGNNNGESDWFE..VA----------..E.IAKE......----
A7XF57_9CAUD/52-120DT..........-------...........W.N...MKYYRMIADAFK..QA----------..G.RELG......----
C6LLE4_9FIRM/274-349............-------.......AITAGKYWKPGTDPYSIPKDGV..VA----------..K.IFKK......----
C4Z3D8_EUBE2/109-193RRNVEPANAEKY-------T.DRSI..E......FP.H...KIDHDDL..CY----------..K.VFAE......----
B2U374_SHIB3/219-287VS..........-------...........W.E...WPLYEKIAAAFR..QA----------..S.RELN......----
E6VQR6_DESAO/135-213LNGVSQPAGAVY-------EPGKPG................VFTSDSP..LV----------..V.YLRK......----
Q2SJV2_HAHCH/187-252............-------.....................KESENAKK....----------....FIAS......----
B5UY55_BACCE/196-257......P.....-------...........W.........NNIKKFKQ..MG----------..Y.IGEQ......----
B7GIP5_ANOFW/70-132............-------.........VNW.........NVDDKWKR..VG----------..A.IGKS......----
B4AH26_BACPU/73-136...KA.L.....-------...........W.........TVNEKWRR..VA----------..Q.IGKS......----
B3VGG0_9CAUD/70-142............-------.........RYGITEARAYPGDKARRLRE..LL----------..D.FY........----
Q1ZSD0_PHOAS/130-219QAKYSPVEGTK.-------YANREI..Y......RY.GKPDRKGMAET..VV----------..D.IFAR......----
C8XIK2_NAKMY/139-205............-------................GSFTSSQVSAIRN..IL----------..S.FF........----
D9SKR7_CLOC7/252-312............-------.....................YTDASYAK..IA----------..V.IGKQ......----
C7R275_JONDD/65-131............-------................GTFKPVQVTAIRR..IL----------..K.DL........----
C3WMV9_9FUSO/63-140............-------.......YKGTWKD...FHYYQDIYNTAK..NA----------..G.LLEK......----
A8ATB8_9CAUD/56-121VD..........-------...........W.G...GYKTAKAKKVIA..KA----------..K.A.........----
C6ANB6_AGGAN/178-255KANAPCAYPQKF-------.....................IQDPKLKQ..IV----------..G.IFEK......----
A6FEU3_9GAMM/129-218SASFKPVDGAK.-------YANRMQ..F......RY.GKEQRQGFAED..VV----------..A.TFAD......----
A7ILH7_XANP2/449-509............-------...............................IG----------TGE.LAKK......----
Q854X2_9CAUD/66-133............-------.........YTGYTQA......EIAAVRE..LL----------..A.FY........----
C9QJ38_VIBOR/123-214TITVKPTQSATQ-------YINRTQ..F......RARSELSRTGMAEE..VV----------..D.LFAH......----
Q7D1F2_AGRT5/53-126VV..........-------...........W.D...WPLYAKLAKAMK..QA----------..A.KELG......----
Q2P050_XANOM/208-274LQWDMGD.....-------...........P.........WTRRAYFL..YG----------..E.LAQQ......----
A5MZT7_CLOK5/187-255............-------................EEGDSRLKEYPKE..IV----------..E.IFEK......----
B1YFG8_EXIS2/71-136............-------...............RAEFPAPPDPRLKR..IV----------..A.AMKR......----
I0WPH3_9NOCA/75-142............-------..............ASVNMPADKIAAVRQ..ML----------..T.EF........----
C4SJV6_YERFR/38-106IS..........-------...........W.E...WRYFYPMADAMK..QA----------..A.AELG......----
A6SU28_JANMA/93-182KAAYSPPIGSK.-------YANRLA..V......RP.GKATRQGMAED..VV----------..E.VFAQ......----
C6RGB5_9PROT/616-681....SKDGR...-------.....................YSNQIPEE..IV----------..R.VFEK......----
B2S3I3_TREPS/209-287HNEDWMHIPIK.-------.....................KRWAPPAE..II----------..S.LFES......----
C4ZCU4_EUBR3/194-278ELSIEPANGADY-------V.DRSK..D......FS.H...KIDHDDL..CY----------..K.LFTE......----
Q7NS81_CHRVO/52-121IP..........-------...........WEN...WPAFEEVGLAMK..KA----------..A.SELK......----
D4J1D4_BUTFI/117-201KLSIEPANAADY-------V.DRSQ..D......FP.Y...KIDENDL..AY----------..Q.LFIA......----
A9DC71_9RHIZ/63-156....RKPRFSDN-------VTQSGRAQDVRLGRADTDMTRGMVDAALA..IK----------..T.VAGK......----
B9KTY8_RHOSK/205-268............-------.................FADGGTQAGLLY..LA----------..E.YFND......----
A1UGG7_MYCSK/185-266SGAVEPANAGPY-------V.DRTR..T......DP.G...ILHAGDP..AV----------..L.VFTD......----
A3ID77_9BACI/3-33............-------..........................LSR..VG----------..A.IARK......----
A1SG61_NOCSJ/370-446QGHSHPRVA...-------......................WRSRSHP..VV----------..A.LMAR......----
A7HN00_FERNB/195-263............-------................EQGLKLLRLYPKQ..LV----------..E.IFES......----
B5EIM6_GEOBB/377-491LCSILPAASASF-------L.DRGD..L......RP.G...MLQADDP..LL----------..S.AFRQ......----
A9WKC4_CHLAA/591-661............-------....................VGDRGSVRE..LV----------..P.IANA......----
C8KCM3_LISMN/56-121VD..........-------...........W.G...AYRSDKGKKFVA..KA----------..K.S.........----
C8T4A1_KLEPR/54-122VS..........-------...........W.D...WLLYEIISRAFK..QA----------..A.AEYG......----
B2FJL7_STRMK/100-166PSWDLKD.....-------...........E.........QVRQGYQR..FG----------..E.LAQQ......----
C9S248_GEOSY/68-133...LIPS.....-------...........W.........SLDRRWFR..VG----------..Q.IGKS......----
A6TN75_ALKMQ/198-278..TIVPLQGGDY-------V.NRLD..V......RK.G...MITKGDA..CY----------..H.AFMS......----
D4E385_SEROD/163-231VS..........-------...........W.Q...WDYYAQIAVAVR..RA----------..A.RELG......----
A3X9V1_9RHOB/202-265............-------.................FTDGKTQLGLTI..MA----------..D.FFFA......----
D1AMG7_SEBTE/126-206..VIEPKNSIDY-------L.DRKS..I......RK.G...MIVKGDV..CY----------..N.AFKK......----
E8WNQ9_GEOS8/380-487ICQVLPASSASY-------L.DRQN..Q......RP.G...MLQPGDP..LL----------..T.PFRQ......----
D2AZ54_STRRD/158-239DGSVAHKNARKF-------A.RRPL..D......EP.G...VINPGDR..VV----------..R.AFER......----
B1YI53_EXIS2/118-187....I.S.....-------...........Y.DLEYDGNQSGKSDWRE..VA----------..A.VGKA......----
C0D0F9_9CLOT/238-322KARWSHENANDY-------I.DRST..G......LP.H...VITHEDL..AF----------..K.VFSA......----
C4K5R3_HAMD5/92-182SANILPPSSSKF-------FVNRNN..N......RP.NKKQRVGMAEN..VI----------..D.VFAR......----
Q0A7S9_ALKEH/202-267............-------.....................ARLARPEY..DP----------WWR.FWEE......----
B2K031_YERPB/45-107............-------...................YQTKTEAYAP..LG----------..E.YWEK......----
D2PPJ5_KRIFD/298-379NNVWYPSNGLSY-------R.NRSW..V......RP.G...MLFTNST..AT----------..R.SLVG......----
B4SDT7_PELPB/113-173............-------..................KYLGDSPKYKA..VG----------..V.IGTD......----
Q2B7L2_9BACI/116-186....V.I.....-------...........W.DMNYDGNGNSRADWDE..VV----------..E.IAKG......----
D1ALL6_SEBTE/63-140VR..........-------...........VEYERYKKETNAIAEHIL..ST----------..A.KRLG......----
B0MC55_9FIRM/144-230..SITPENGKIY-------A.QRDV..KKCKGKYKY.N...MIHRNDR..VY----------..R.IFRK......----
A7ZD12_CAMC1/602-665............-------.....................YENLIPEK..IV----------..R.VFEK......----
Q3STE6_NITWN/103-162............-------......................KATLSRV..VI----------..D.VFKA......----
A5ECX3_BRASB/184-253S...SVSIP...-------.....................YKNRFPQQ..IV----------..E.IFER......----
A9KN76_CLOPH/502-575G........NDL-------R.................NRSNPYCIPDE..VI----------..E.IFAS......----
A7FDS7_YERP3/58-127IP..........-------...........WDD...WHAFAHVAKAMK..QA----------..A.KVME......----
D1B2W5_SULD5/592-657....DKTYA...-------.....................FQNEFPKE..II----------..D.IFEK......----
C8X9H1_NAKMY/210-289GSLVLPAAGRAF-------V.DRPD.........AP.G...VIHAGDA..VV----------..T.VFAD......----
A0NQA8_9RHOB/173-238............-------.....................ARLSLDDA..IP----------FWR.AWEA......----
B9NP89_9RHOB/203-268............-------.....................AQFAHPDY..EP----------FWN.IVMA......----
B0NZY2_9CLOT/146-232..KVSPANGKVY-------K.QRKT..SKCKGKYKR.Y...MIHKNDT..AY----------..K.IFKK......----
B1JRT0_YERPY/56-124GS..........-------...........W.E...WKYYEQIATAFK..LA----------..A.KDVG......----
Q5WK03_BACSK/108-178....P.L.....-------...........W.DIAYDGNENGEPDWFE..VA----------..E.LAKE......----
C9XQ42_PEPDC/189-268..DVTPKISTVY-------A.DRSS.........TKFG...MIKKGDD..CY----------..N.AFVS......----
B3Q3Z4_RHIE6/222-285............-------.................MGDNSTQFGLVV..LA----------..E.FFND......----
C4XNT5_DESMR/200-269G...TNMLA...-------.....................TRQAFPVA..IV----------..T.AFEA......----
A5UTX9_ROSS1/590-659............-------....................VGQPGSVRE..LA----------..A.IARH......----
D3EJK7_GEOS4/101-171....V.I.....-------...........W.DMEYDGNGNGKADWME..VV----------..E.IAKD......----
D4BTB0_PRORE/43-105............-------...................YLTATSDYKE..LG----------..E.YWES......----
D3ADD3_9CLOT/85-148............-------.................GAYYDNDGFFTK..VG----------..K.IGVS......----
Q7VJM2_HELHP/173-242E...RNEYQ...-------.....................YENQIPLE..IV----------..Q.AFEE......----
Q7MR54_WOLSU/185-254K...KGQVR...-------.....................YENTIPLE..IV----------..E.IFER......----
A9DET4_9CAUD/64-132VS..........-------...........W.D...WKYYYPMADAMK..QA----------..A.KELN......----
C0CNE7_9FIRM/225-310PVEWAHSNADPY-------I.DRNS..G......AE.H...VITHDDV..CY----------..Q.IFAK......----
C6LBK9_9FIRM/257-343..RVSPANGKLY-------K.ERNV..SKCRGKYKK.N...MIHKNDK..VY----------..K.IFKK......----
B9JYE5_AGRVS/104-165............-------.....................PTPDMDPR..VV----------..D.AFKA......----
D9QLQ3_BRESC/53-121IR..........-------...........W.D...WPLYPRIAAHIK..AT----------..A.AARG......----
B0VVC4_ACIBS/347-415............-------.....................QSIADSKA..IG----------..L.IGES......----
C4K6W4_HAMD5/53-119VR..........-------...........W.D...WPLYYPIADAMK..QA----------..A.EELG......----
B2UP36_AKKM8/129-194............-------.....................AVLSGPEY..AA----------FWQ.FVEA......----
C4L144_EXISA/57-123VS..........-------...........W.N...WYDRDDIQKAVK..EA----------..K.R.........----
F0KAF2_CLOAE/198-263.....VS.....-------...........W.........NDITSFNE..MG----------..R.LGQQ......----
G3M4A5_9CAUD/70-151............-------........PRAGWNGSVLIKGDQTPAVRE..LL----------..A.WYTF......----
Q5J5L5_9CAUD/70-137............-------.........DAGFDSA......KLARVRE..LL----------..A.FY........----
D0LWT6_HALO1/218-298GIEKAIAPFSEQ-------W.................CEKYPRGLGET..VV----------..R.CFKK......----
A4G1C9_HERAR/140-229KASYLPAAGST.-------YANRLA..V......RP.GKAARKGMAEE..VV----------..D.VFAE......----
Q0FH91_PELBH/197-262............-------...............DYRDFLDIMEAHQWLPAI----------..R...........----
D4CCJ4_9CLOT/58-129............-------............GAVTDDAFNDSTGMFER..AA----------..S.VAEK......----
D0LQS8_HALO1/317-391............-------...........RLEKQDKTLVGMIPIHES..LL----------..Q.IFLD......----
B6V2R4_BPSP1/74-136....A.H.....-------...........W.........NVNSDWKR..VA----------..Q.IAKD......----
A0A038HZ79_BORBO/53-127IP..........-------...........WED...WASFKRLAEVMK..ES----------..A.ARLE......----
A9KQC6_CLOPH/237-321ETIIVPENGAEY-------E.DRTL..E......NE.Y...YIMKDDV..CQ----------..K.AFAK......----
C6WMZ1_ACTMD/132-213SGAVHPPSGAPY-------V.DRTV..R......AP.G...LIVAGDV..VV----------..T.AFES......----
A3K5D3_9RHOB/148-231..HTSPDAGVDY-------D.EASE..RRAD...VP.G...VILSGDA..VV----------..T.AFEK......----
A4FKJ2_SACEN/154-235TGAFQPANAAPY-------L.DRAR..R......DP.G...VLHDGDP..AV----------..R.AFTD......----
Q5YZK4_NOCFA/71-135............-------.................VMARDLIDRVRA..GL----------..L.LF........----
Q1DAC7_MYXXD/63-125PD..........-------...........WRE.......SA...YRV..LG----------..D.ESTK......----
D1BDT0_SANKS/65-131............-------................GTFTPAQVAVIRD..IL----------..R.DV........----
C7N3P8_SLAHD/215-297QGSIAPASAAQY-------A.DRSR............DFDYKINRGDL..CF----------..Q.LFAE......----
A6Q7D6_SULNB/126-212SGRIAHKESLQY-------R.KRVHKKS......TP.ADRAVLLRNDR..AV----------..K.IFKK......----
B6VNP6_PHOAA/57-126IP..........-------...........WDN...WQAFIELATTVK..QA----------..A.QRLN......----
Q73V53_MYCPA/145-206............-------.................................----------..G.AFQP......----
D7VN70_9SPHI/69-137GSFETAS.....-------...........W.........ALDINFMK..VV----------..N.FFKS......----
B5LJL3_9CAUD/69-133............-------.................TMPQNQVEITNR..GI----------..A.LF........----
A8LRY3_DINSH/108-171............-------.................RGDGRTQEGLLR..IY----------..K.IFNA......----
C9MWB5_9FUSO/152-227............-------........AIVGKSWEPNSNPYSIKPDGD..VV----------..R.AFTK......----
D0LZM8_HALO1/111-191.GRVLPEAGRAY-------I.ERAG..Q......HP.G...MIVRPGP..VT----------..D.AFDA......----
C9DBZ2_9CAUD/70-142............-------.........RYGITKERAYPGDKARKLDE..LL----------..A.FY........----
D7VVF1_9FLAO/66-136....TAS.....-------...........W.DTVKDWDNDKVADWYE..CV----------..K.IFAR......----
Q2SDK8_HAHCH/53-121IT..........-------...........W.E...TRYYQILADAVK..QA----------..A.EELG......----
C7RR41_ACCPU/164-241LSEKSCAYPERV-------.....................LQDRALRD..IV----------..T.IFEA......----
A1SCY8_NOCSJ/370-428............-------..QRGT................VGQIDRG..VV----------..A.IFKH......----
B6FXG7_9FIRM/394-474K..VYPSISKPY-------A.DRSK..N......VK.G...MIKKGDA..CY----------..K.AFTS......----
B6WQA8_9DELT/218-285E...RHPL....-------......................QQSYDSE..IV----------..R.AFEA......----
A4T1K8_MYCGI/149-230SGVHEPANAGPW-------V.DRSR..S......EP.G...MLHDGDA..AV----------..L.AFTD......----
Q7NR04_CHRVO/206-271VVISERD.....-------...........P.........WAMQAYNA..LG----------..E.EAQA......----
D4CX41_9FUSO/55-123VT..........-------...........W.D...FKYYKEVADCVK..EV----------..A.RKLG......----
B8J0M5_DESDA/248-315R...PHPM....-------......................QHGYPFA..IV----------..D.AMEQ......----
A8EV90_ARCB4/175-243....DGKIE...-------.....................YKNKIPLE..IV----------..E.IFEK......----
C6PUE1_9CLOT/429-508............-------....GKVQSQVGNYYKPNEDPYSITPE....IV----------..K.VFQK......----
D9SMB1_CLOC7/196-264............-------................EQGNQRIKEYPKE..LP----------..Q.VFEN......----
Q73JG3_TREDE/215-293RNDYWMKIMPY.-------.....................RRWIPPKA..VI----------..E.AFES......----
B8ENP1_METSB/622-688............-------....................KGQPGSVRD..LV----------..Q.IANQ......----
C8Q0B7_9GAMM/78-152VD..........-------...........WND...LKKFDAIAKAML..QS----------..A.KELG......----
C0QJJ2_DESAH/140-230TALISPVKSAHY-------SVNRLN..H......RP.GKPRRQGMAED..VV----------..D.LFAE......----
Q5DZ88_VIBF1/125-214TATFKPLKGHE.-------YSNRML..Q......RL.GKEDRKGFAEE..VI----------..N.IFAQ......----
C9MUL4_9FUSO/1065-1128....SDS.....-------...........Y.K.......LLENPNNK..IA----------..K.IGKE......----
C6D2R3_PAESJ/123-193....V.I.....-------...........W.DMEYDGNGNGKSDWME..VV----------..S.AAKK......----
D1PX89_9BACT/178-263RVTVQPSNALKY-------C.DRSA..S......FP.Y...KIERGDL..LH----------..K.LFVK......----
C3XMD6_9HELI/163-232Q...KTFKD...-------.....................FTPKIPLE..II----------..L.AFEQ......----
Q70K75_9ACTO/100-167............-------...............SGTFTPEQTAKIRA..KL----------..A.SM........----
C3K4K2_PSEFS/131-227MAKIEPKSATPV-------GLNRLN..V......RA.DEPVYPGRTED..VI----------..D.LFAN......----
Q2LPY2_SYNAS/102-181IL..........-------.....................PPGALYRPEAPG----------..A.LTESSPVVQA----
A8GLN1_SERP5/79-147VS..........-------...........W.D...WGPYEQIAKAFK..LA----------..G.SQLG......----
C0AQZ5_9ENTR/54-123IP..........-------...........WQD...WSAFESVSKAMK..QA----------..S.SQLG......----
D1RF68_LEGLO/59-140..TIIPPQGALY-------A.ERTQ..P......AP.G...KITKESL..VY----------..Q.EFIK......----
C6BUG1_DESAD/184-249............-------.....................AVFAQPEY..DK----------WWE.IWTD......----
Q2LQQ3_SYNAS/55-131VD..........-------...........VNE.......NEIPDYEE..AG----------..R.IGES......----
C7PFT3_CHIPD/191-256............-------....................VGQKGSVRE..LV----------..Q.IANK......----
A8ATR6_9CAUD/73-134...ID.S.....-------...........W.QPS...........AT..IV----------..N.MMKR......----
C0ZX75_RHOE4/85-149............-------.................TMPTSRKQKIRE..GL----------..N.LF........----
D0DDG3_9RHOB/197-267TE..GQVGA...-------.....................YDNRIPPE..VI----------..E.AFEA......----
A6W8P6_KINRD/95-156............-------......................DFPRDET..YA----------....IAAK......----
A7HJ25_FERNB/74-137VV..........-------...........WNN.......DKI..WEK..CG----------..K.IAET......----
B4WAV9_9CAUL/53-121VR..........-------...........W.D...WPLYGRIASAFK..AA----------..A.LELK......----
D2XRK5_9CAUD/70-137............-------.........YAGFDET......KIATMRE..LL----------..A.FY........----
B5EHY6_GEOBB/165-227............-------.................RGDGRVQYGLTL..IA----------..P.FFNR......----
B1YH87_EXIS2/72-135...EA.I.....-------...........F.........NTDENFQQ..IV----------..H.AMKR......----
A7ZFD8_CAMC1/46-110............-------...................WLQSKQDLQE..IG----------..N.YWES......----
B8KYV5_9GAMM/51-117PSWNLDD.....-------...........A.........HVMAGYQR..FG----------..E.LAEI......----
B2VDM6_ERWT9/41-110IP..........-------...........WED...WNAFALLAKAMK..QA----------..A.AQLS......----
B9JF39_AGRRK/850-911....LPSNVGEL-------A................................----------......AK......----
E3I7F8_RHOVT/190-269RAMDEAAVREKG-------I.................ALVYRNKVPPE..IV----------..R.VFEK......----
A1K513_AZOSB/150-214ASF.ETD.....-------...........G.........LGMEAYRL..LG----------..E.EAEA......----
B4V6Z2_9ACTO/133-214RGVVHPPTGREF-------L.RRDR..S......RP.G...MVEDGGA..FV----------..T.AFRT......----
D0TJH0_9BACE/157-246TWHIEPATAEPY-------AFDRESRTD......IP.Y...KIDHDDL..AY----------..K.LFTE......----
Q0AVH5_SYNWW/269-331............-------.....................QEANDPNL..IL----------WEK.AFKP......----
D3VE22_XENNA/59-122GS..........-------...........W.E...WTEFYKLEKAMK..TA----------..A.SELG......----
A8S209_CLOBW/64-127............-------.................GAYNDSALFFQR..VG----------..A.IGMS......----
C6VVI7_DYAFD/85-145............-------.................S........PEF..LA----------AWR....Q......----
C4SXE4_YERIN/30-99IP..........-------...........WDN...WSAFKVVADAMK..IS----------..A.EKLN......----
A5FFV9_FLAJ1/170-242CKNEEVTLS...-------.....................YRNQIPLK..LV----------..S.IFEK......----
B2Q011_PROST/55-124IP..........-------...........WND...WSKFELVARAMK..KA----------..A.AELN......----
Q98H40_RHILO/198-268DA..KGRIP...-------.....................FKNRIPLS..IV----------..A.LFEK......----
D1AEC5_THECD/163-244..HVAHKDCVKF-------K.DRSR..K......DP.G...VIHKGDA..VV----------..K.AFAA......----
D4DZ54_SEROD/54-122GS..........-------...........W.D...WKYYQQISEAFK..QA----------..G.KELN......----
M1GCS0_LAWIN/228-297R...EKYLQ...-------.....................IQKEYPSE..LV----------..G.IFEQ......----

PF01427

VANX_ENTFA/1-202----------------------------DFMDERSHHTAKG.IGNAEAQNRR..........CLR-KIME----------
DDPX_SYNY3/31-240----------------------------DELSARSLPNYYQTVEPNSDRQRKEFEQYQRRRELLN-TIME----------
DDPX_ECOLI/3-187----------------------------DEMHERSHAYHPS.VPPAAQRNRL..........LLN-AIMT----------
O53850_MYCTU/62-256----------------------------DDFSSRATAFATQGVSAEAQANRA..........HLR-AAMQ----------

PF03411

Q7VLX1_HAEDU/37-271RNPAGLATIMVN.......RTL.QRVDEKRWTNQHTTLIRLAAQDQRVNRIF----------VNP-AIKLKLCQTA...G
G7Z2K9_AZOL4/79-317GRERLEEIKYVD.......YDR.MRVTED.WSDRQAKMVQIAASDARVSRIF----------VSP-AIKLAMCQRN...W
F2J3L2_POLGS/44-296EREEISAISMLKGPLDIAGADR..RVDRKKWTDGHARLIRKAAQAPEVARIF----------VNP-TIKKALCDFE...T
A8LNH7_DINSH/41-294EREKISSVSVRS.......QDQ.RRVNGN.WTPQHMEILKAAAEDPAVDRIF----------VTA-PAKIAMCNAA...R
F8JE38_HYPSM/186-434ERETLDATSMLD.......DTG.LKVDPKVFTSKQVALIKRAASYPEVERIF----------VHP-AIKKALCERA...G
D7A2C9_STAND/53-295EREKLSATMIVR.......PDR.LDVDKRVWTPSLVNVIRAAAQDDEVERVL----------VNA-AIKKALCRAA...T
G0A1D7_METMM/39-279ERETWGAPSVVD.......ANS.DTVDYRQWTQAHEKVLEAAARHPDVDRIF----------VNP-SIKQELCTHK...T
B7VJP4_VIBSL/34-277ELAVPKPLSVVD.......LTN.YKLRESNWTDDHFQVIRYAAKDEKVVRIF----------VHP-VIKHTLCEQENSDA
Q7MNJ8_VIBVY/38-271ELEQAKTESVVN.......FDT.MTIRADEWRDEQFELIRAAAENGRVARIF----------VHA-VIKQRLCQME...T
D4ZCJ1_SHEVD/37-278QKESPTELNVVT.......QEK.FKLNAN.WHQDLAEMIRLAAQDPRVARVF----------VNP-VIKQELCRKSLQTS
Q89BJ0_BRADU/67-311EREEMSAVMMVR.......PDR.LDIDPKVFTPSHVLVLRDAAQEPAVQRIF----------VNA-AIKKALCREA...K
V4IED8_9GAMM/46-281RRD...PPSMLG.......TGA.LGLNDN.WGPDQLFLMRMAAEHPSVDRIL----------VNP-SIKRALCQQQ....
A0KJ73_AERHH/30-258EQDAPKEWALID.......EPS.YRVLPGRFGPQQLNLLRLAASKPEVARIF----------INP-VLKAEVCKRA....
G8AJW0_AZOBR/59-295ARESLTEIKYVD.......YGR.VRVTED.WSERQAQLVRIAASDPRVTRIF----------VNP-AIKLAMCRHS...W
A3N0A9_ACTP2/37-271KNPAGLATLMVN.......RDA.QVVDESVWTSQHAMMVKLAAQDARVDRIF----------VNP-AIKVKLCNTA...G
E3F225_KETVY/53-297EREAISSRDMQR.......AGG.AYVNSS.WTPQHAALVQRAAQDPRTARIF----------IFG-GAKVELCRTA...T
W6R6D9_9RHIZ/59-306ARETLPFTTMLQ.......KGAFLTINPDVWTESRARLLMRAASYPQVERIF----------VNP-AIKKKMCDTW...R
Q6LU97_PHOPR/36-276SLVEVQPLPMVH.......IKD.YKINNENWSNKQALLIQLAATDDRVARIF----------VHP-VIKEQLCKSE...W
W0DWJ2_MARPU/43-274GD....PPSLVS.........G.DRVNRR.WGEDARFLIEWAARRPEVDRLF----------VNP-AIKRALCDAT....
M9RED3_9RHOB/64-306EREDLSSISMRR.......DRG.AFTNSS.WTEQHMQLLRAAASDPRTARIF----------VFP-GAKIAMCNWE...T
D8MV06_ERWBE/36-270MLLKPQPLDLVA.......ADG.KNVVARHWQPEIDSLIKLAAKDDDVTRIF----------VNP-AIKKQLCADA...G
C5BAF1_EDWI9/36-270QLRQPVPQDLVA.......VGA.DRVIPSRWTPQIGKLIRLAAQDPQVVRIF----------VNP-AIKRQLCDTA...D
C3MBY2_RHISN/55-301ERESISATSMLD.......KSRFLTIDPSVWTPSHARLIMMAASYPEVERVF----------VNP-AIKKKLCDTW...R
Q98DM3_RHILO/86-328QRESMSATLMVD.......EKT.HLVKDALWTPQHTALLKRAASYPEVERIL----------VNP-GIKKKLCDTV...K
E3I638_RHOVT/169-418EREQMKMDSVLL........DP.VHVNEQSWTPDHVKLLRRAVSYPEVTRVF----------VNP-AIKKWMCDNV...T
Q11CB0_CHESB/47-289EREKVSAISMIR.......KDS.LYVDENRWTAAHANLLRRAASYPQVERIL----------VHP-GIKKKLCDTV...Q
C5AYD5_METEA/65-307EREETSATDMVR.......SDR.LDIDPDVWTRQHTALIRMTAKQPEVARIF----------VNA-AIKKALCREA...G
B2IE79_BEII9/75-315ERENMSSTNVVR.......ADR.LDIDPATWTPDHLAVIRAAAQSSEVQRIF----------VNA-AIKKAICRQA...T
B9J6R8_AGRRK/59-304ERESLPFTSMLA.......KDKFLTINDRVWTPAHARLLMRAASYPEVQRIF----------VNP-AIKKKMCDSW...T
MEPA_PECAS/41-275QLLKPQPIDLVN.......ASG.LNVNPRVWRPEVTTLIKTAALDSDVTRIF----------VNP-AIKKQLCAEA...G
Q65U86_MANSM/44-278LNSDGKGLLVVD.......RAE.QRVDENIWNQNHFNLIKLAAQDSKVSRIF----------VNP-AIKVKLCQTE...R
N0B7W2_9RHIZ/170-420EREDLEATSMLD.......KTG.VAVDPKVFTDKQVALIKRAASYPEVERIF----------VHP-AIKKALCKAA...G
Q28VK1_JANSC/50-297ERENLSSISVRA.......NRG.ATVNEN.WTADHAEVLRLAASDPRVARIF----------VTT-GVKVWLCQNV...E
B9JYQ7_AGRVS/40-286QREDLPFTSMIL.......KDKFLTINPQTWTPTHARLLMLAASYPQVERLF----------VNP-TIKKKLCESW...T
D5ASU0_RHOCB/43-298QREKISSISIRT.......EDQ.IRVNRN.WTPQHAALLRAAASDPRVDRVF----------VAA-AAKLAMCATA...T
W0HVY1_9ENTR/36-270QLLKPQPLDLVS.......ANG.RGVVPRLWQPQTAALIKLAAEDDQVTRIF----------VNP-AIKKQLCLDA...G
B8F448_HAEPS/37-270RNPAGLATIMVD.......RKA.NVVDERLWTANHTKLLKLAASDPRVDRIF----------VNP-AIKVKLCNTA...G
Q87S60_VIBPA/36-276ELQLPKPMSVVD.......LQD.YSILNHRWDKRHFELIRYAAKSDEVARIF----------VHP-VIKEQLCAQE...G
B8IRL8_METNO/82-322EREEISATNVVR.......ADG.LDIDPTTWTRQHRLLIQAAAEQPEVARIF----------VNP-AIKKALCREA...T
R5EP69_9GAMM/31-270......PVDVYL.......VDTHNRVTKN.FDKRRVALIYLAASDSRVERIF----------VAP-GIKKTLCQVY...E
L0GX36_9GAMM/44-279HRD...PPSMVA.......PDG.LTLSPH.WGAEQRLLLKTAAEDWRVDRIL----------VNP-AIKQALCETE...R
Q3IY41_RHOS4/40-292DRERISSIPVRS.......ADQ.RSVTAN.WTRAHHTLLRSAASDDRVDRIF----------VAA-AVKLEMCKTA...T
A4YL76_BRASO/65-307EREDMSAVMMVR.......PDR.LDVDPRVFTPGHLAVIRAAAREPSVQRIF----------VNA-AIKKALCRDA...K
B8EQJ0_METSB/63-305EREEMSATMVVR.......ADR.LDVDPARWTPDHLAVIKAAAQDNQVQRIF----------VNA-AIKKAICREA...V
D3RNE7_ALLVD/49-287RAD...PASMVA.......PGG.RTVSRH.WGASQFALIESAARHPRVDRIF----------VNA-AIKQELCQSA...R
H2FVL9_OCESG/23-250......EQDMVD........HR.LYILNRHFGDDQRQLIALAAQDPRVSRIF----------VHP-LIKQAMCRAY....
H8GG79_METAL/41-278EREQWSAPSVLR.......DHS.DLIDSRQWSQANERILQIAAEMPEVERIF----------VNA-GIKRELCRTH....
S5Y7V8_PARAH/48-289QREDVSSVSVVN.......KAG.TQLTEY.WNPGTFSIIRAAASDPRVERLF----------VDP-VVKVAMCEQE...T
Q1GD71_RUEST/59-305ARENISSISLRR.......ASG.AYVNDN.WSAQHHAILKAAASDPRVARIF----------VFP-GAKVKMCDTE...T
I7DUV0_PHAIB/60-305EREKISSISLRR.......AKG.AYTNSN.WTPQHHAILRAAAKDDRVARIF----------VFP-GAKVQMCNDE...K
E3HYM4_RHOVT/58-304DREKFAATNYVD.......QTT.LTVDPARWTDAQTKLVKRAASYPEVSRIF----------VHP-AIKKALCDSA...G
M4RIZ0_BIBTR/37-269AKPDGLGLLVVD.......REK.QVINSN.WKPEHAKLIKIAAQDPQVDRIF----------VNP-AIKVQLCSTA...G
Q3SVT3_NITWN/101-344EREEMSAVMMVR.......RDR.LDIDPRAWTPSHLGVIRAAAREPSVERIF----------VNA-AIKKALCREA...K
H2INY8_RAHAC/45-279MLLRPQPIDLVS.......ANG.KSIVPAQWQPRIETLIKMAAQDKDVVRIF----------VNP-AIKQQLCLDA...G
V6F1Q6_9PROT/42-277ELGNPTPVSMVR.........G.RNVDSRTWSARQLKVLELAANSSEVDRIF----------VNP-AIKAAACKAA...R
A8HVK9_AZOC5/49-304ERESVSATMIVR.......PDR.LDVDRKVWTADHLAVIRAAAQDANVERIF----------VNA-AIKKALCRDA...Q
B6JJU0_OLICO/62-305ERENMSAVQMVR.......KDR.LDIDPRVWTPAHLKVIRAAAEAPQVERIF----------VNA-AIKKALCREA...T
Q5LWS6_RUEPO/46-291HRENISSISLRR.......AKG.AYVNDN.WTRQHHAIMREAARDKRVARIF----------VFP-GAKVWMCNNE...K
I2B718_SHIBC/36-270QLLKPQALDLVN.......ASG.KNVSDRLWQPEIGQLIKLAAEDQDVTRIF----------VSP-AIKQRLCEEA...G
B0UWQ5_HISS2/37-270QDPSGMGLLVVD.......RKK.QRVIDKLWSKDHENLIRLATQDPQVSRIF----------VNP-AIKLKLCQTV...K
F4HED5_GALAU/40-271LNPT..AILMVD.......RKA.QRVDERVWTSNQTELIRLAAQDDKVARVF----------VNP-AIKLKLCQTV...K
Q16D60_ROSDO/64-307ERENISSISLRR.......NAG.AFVNDN.WTPQHAAILKAAASDPRVARIF----------IFP-GAKVQLCNTA...T
A7IJY5_XANP2/64-307EREKLSASMMVR.......ADR.RDIDPANWRPDHWKVIRAAALDPRVERIF----------VNA-AIKKALCREA...S
G4SVA0_META2/57-295EREKWSAPSVVR.......TAI.DRIDDTQWTQRHDRILETAARMPEVERIF----------VNA-AIKRHLCENS....
MEPA_ECOLI/36-270QLLRPQALDLVS.......RDG.KHVVSTLWKPEIFSLIKLAAQDKDVTRIF----------VNP-AIKQQLCLDA...G
G8PRI5_PSEUV/75-327QRETESAISMLNGNLSKPGADR..KVNPNRWTDAHAKLIRRAAQDDGVARIF----------VNP-TIKKALCDFE...T
Q607R5_METCA/38-277LRSNIPAPSLLT.......PDQ.TRLNHMLWDIRHARVLETAARDPHVDRIF----------VNA-HIKQELCRSV...R
V5SD71_9RHIZ/87-338EREDMSAVSMLA.......ADR.VSVNRKVWGEGQEKLIKRAASYPEVERVL----------VHP-ALKKALCESP...G
G8AJ70_AZOBR/59-293ARERTDFPTMVN.......RQT.QRVLPERFGPRQARLLQLAATSPKVARVF----------VNP-AIKLALCQSE...Q
A8GH81_SERP5/36-269QLLKPQPIDLVS.......SDG.KQVVARQWQPQIETLIKAAAQDQEVTRIF----------VNP-AIKQRLCLDA...G
B8IJD0_METNO/63-305EREEMSATNVVR.......PDR.RDIDPAVWQSEHGRLIRMVAEQSEVARIF----------VNP-AIKLALCREA...G
D0LL99_HALO1/58-299ERRALRDRSVVV...........DGALSAEMAPRVMRVLSLAADDERVARIF----------VNP-VIKRDLCAQA...G
J7QQ34_METSZ/72-310EREELMSTDVVR.......DDG.LDVRPEVWSAGHIAVIRAAAMEPAVQRIF----------VNA-AIKRALCRSA...Q
B8CUQ4_SHEPW/47-288QLAQPEPFDIVH.......TKQ.FRLDSKLWQAQHTRMVQLAAEDSRVARIF----------ISP-VIKQHLCDMD...L
Q2KDT7_RHIEC/59-307EREDLPFTSMLQ.......KDKFLTVNPKVWTESRARLLMLAASYPEVERIF----------VNP-AIKKKMCDTW...T
Q2W4C2_MAGSA/42-276EIETPKPVSMVY.........G.TEIDEDAWTPAQARLLELAARAPQVDRIF----------VNP-AIKKAMCRAVP..A
MEPA_HAEIN/43-277LNSDGKGLLVVD.......RKA.QRVDERVWNSNHATLIKLAAQDPNVTRIF----------VNP-AIKVKLCQTA...G
F7QGC0_9BRAD/50-294EREETSAVMMVR.......KDR.LDIDPNTWTPTHLTVIRAAAQEPQVERIF----------VNA-AIKKALCREA...K
A1B5F2_PARDP/45-284QREKISSQSVVN.......KAG.TAPSGL.WSGGHMAIMRAAARDPRVERIF----------VDP-VAKVAMCQME...T
I3YA59_THIV6/50-288QPD...PRSMVR.......PGG.LSVSDA.WGEDQRFLIETAARHRSVDRIF----------VNP-AIKRELCRSA...T
A9CKL5_AGRT5/53-298QRETVPFISMLD.......KSKFLTVDDRKWSPLNARLVMMAASYPQVERVF----------VNP-AIKQKLCQTW...T
Q0BS55_GRABC/32-265ERNVLEPPSMVS.......ADG.NSLSPA.WTQDTVTLLHMAATLPNVDRVL----------VNP-VIKRALCEQV...S
B1M521_METRJ/66-304EREETSATDMVR.......RDR.LDIDPEVWTPTHLQLIKITAEQPEVERIF----------VNA-AIKKALCRDA...A
Q2YJP1_BRUA2/82-325ERESVSAVSMLK.......PDS.LYVDPKKWTPARTALLKHAASYPEVERIF----------VHP-GIKKQLCDTV...T
Q6NCT0_RHOPA/69-313EREEMSAVMMVR.......SDR.LDIEPSAWTPTHWKVIRAAALEPQVDRIF----------VNA-AIKKALCREA...K
C4LE77_TOLAT/27-261TRNTIKPLDMVD.......FRR.NKVNKN.FGQQQVTLLKLAAQDPRVERIF----------VNP-PIKQAMCDQF...G

PF05951

Q9CNZ9_PASMU/32-183--------GV----GYYPRS----N..F-------------------------------------IHVDTGPVRTW----
Q9A852_CAUCR/63-213--------GV----GYYPTS----N..F-------------------------------------VHVDVGPVRKW----
Q9KSI7_VIBCH/29-179--------GV----GYYPK.----.SQF-------------------------------------IHIDTGPVRQW----
Q989B8_RHILO/15-167--------GV----GYYPTS----GSPF-------------------------------------IHMDVGNVRHW----
Q92JX1_RHIME/6-158--------GV----GYYPTS----GSPF-------------------------------------VHMDVGGVRAW----
Q98H74_RHILO/14-166--------GV----GYYPTS----GSPF-------------------------------------VHMDVGNVRHW----
Q8EF76_SHEON/32-182--------GV----GYYPKS----G..F-------------------------------------VHVDCGPVRHW----
Q7CT90_AGRT5/14-166--------GV----GFYPTS----GSPF-------------------------------------VHMDVGGVRAW----
Q2YIP2_BRUA2/25-176--------GV----GYYPRS----GSPF-------------------------------------VHMDVGNVRHW----
Q7MJP7_VIBVY/37-186--------GV----GYYPGS----N..F-------------------------------------VHIDTGPVRSW----

PF08291

Q7Y5M4_BPSP6/6-108--------KY....GIGRYN....S--F-------------------------------------THID-----------
Q5LM88_RUEPO/18-119--------GF....GFYRRN....N--F-------------------------------------IHVD-----------
Q8YUC7_NOSS1/127-243--------GL....GRGMHR....G--F-------------------------------------IHCD-----------
Q5NX34_AROAE/55-166--------GV....GFYRSS....K--H-------------------------------------IHLD-----------
Q88L27_PSEPK/5-119--------DQ....LILEFD....R--W-------------------------------------VHLS-----------
Q92KB7_RHIME/323-423--------GG...VGTYCHT....N--S-------------------------------------VHID-----------
Q8CJR3_STRCO/116-230--------EIL.GPGYPGHN....D--H-------------------------------------THVA-----------
Q7MNT8_VIBVY/105-217--------GKITQGGVGLYT....S--F-------------------------------------VHYD-----------
E6UFM5_RUMA7/197-303--------QI....GFTGIGLMYGG--A-------------------------------------IHLD-----------
Q31Q82_SYNE7/73-183--------GVG..RGIKAGR....R--F-------------------------------------VHLD-----------
Q5LCN2_BACFN/2-118--------DQ...LIDEKDF....S--W-------------------------------------VHVS-----------
V4IU57_9ACTO/127-240--------EIL.GPGYPGHD....D--H-------------------------------------THV.-----------

PF01085

K1R6F4_CRAGI/30-187--------GF----DWVYFE----SRGH-------------------------------------IHCS-----------
F6XBS5_CIOIN/130-291--------GF----DWVKYD----GKV.-------------------------------------VHCS-----------
H2ZHI5_CIOSA/23-183--------GF----DWVFYE----SKFH-------------------------------------VHAS-----------
H2YWW4_CIOSA/21-183--------GF----DWVYYN----DNI.-------------------------------------VHCS-----------
G3H796_CRIGR/24-184--------GF----DWVYYE----SKAH-------------------------------------IHCS-----------
HH_DROME/85-244--------GF----DWVSYV----SRRH-------------------------------------IYCS-----------
W5MLT6_LEPOC/24-184--------GF----DWVYYE----SKSH-------------------------------------VHCS-----------
M4A9L1_XIPMA/27-187--------GF----DWVHYE----SRYH-------------------------------------IHCS-----------
T1K174_TETUR/64-224--------GF----DWVLYE----SRYH-------------------------------------VHVS-----------
W4Y925_STRPU/27-186--------GF----DWVNYE----SKAW-------------------------------------VHCS-----------
T1ELE5_HELRO/210-371--------GF----DWVHYE----YRSH-------------------------------------IHCS-----------
J9K1A2_ACYPI/38-194--------GF----DWVNY.----NRRY-------------------------------------IHCS-----------
A7RW45_NEMVE/1-161--------GF----DWV.YR----AKAY-------------------------------------IHAS-----------
K7J545_NASVI/41-201--------GF----DWVYYE----SRSH-------------------------------------IHCS-----------
E5SNS5_TRISP/58-212--------GF----DWVYYE----SHLH-------------------------------------VHAS-----------
F1SJ10_PIG/27-189--------GF----DWVYYE----SRNH-------------------------------------VHVS-----------
Q175B3_AEDAE/38-198--------GF----DWVYYE----SRSH-------------------------------------IHCS-----------

PF02557

YODJ_BACSU/120-250------Y.PK----NKEDIT----KYEY-----------------------------------EPWHLRY.VGK------
Q65US8_MANSM/26-185------F.M.----QTPKGK----EIGR-----------------------------------EPWHISY.LPL------
O83250_TREPA/106-230------F.PP----GYEQVT----GYVW-----------------------------------EPWHFRY.VGV------
Q8Y645_LISMO/113-243------Y.MK----GREAIT----KYQY-----------------------------------ESWHYRY.VGK------
Q5NHB6_FRATT/26-155------F.PC----NNDY..----GFIY-----------------------------------EPWHWCY.HNE------
Q7V800_PROMM/59-190------F.PL----DNPQ..----GVTY-----------------------------------EPWHWRF.EGS------
Q7VCA8_PROMA/98-229------F.PK----GNTQ..----GVSY-----------------------------------EPWHWRF.EGT------
Q55957_SYNY3/161-291------F.PP----NNSQ..----GVSY-----------------------------------EPWHWRY.VAS------
Q7U788_SYNPX/101-232------F.PR----GNQQ..----GVMY-----------------------------------EPWHWRF.QGT------
Q7NI07_GLOVI/108-238------F.PK----DNPQ..----RVSY-----------------------------------EPWHWRY.VGD------
Q55454_SYNY3/106-237------F.PP----DNPQ..----GIAY-----------------------------------EPWHWRY.VGD------
Q97E20_CLOAB/88-217------Y.PK----DKENIT----KYNF-----------------------------------EPWHVRY.IGL------
Q73Q11_TREDE/110-234------Y.PK----DMEHIT----GYKW-----------------------------------ESWHYRY.LGV------
VANY_ENTFA/114-247------Y.PP----DKTEIT----GVSN-----------------------------------EPWHYRY.VGI------
Q7N3J3_PHOLL/21-178------F.V.----GNCGS.----.VAD-----------------------------------EPWHISY.QPF------
Q5QTZ2_IDILO/20-179------Y.A.----..RYQG----GVAQ-----------------------------------EPWHLSF.RAV------
Q8E2A2_STRA5/89-225------F.PD----GKTAET----GVGY-----------------------------------EDWHYRY.VGV------
Q7V1U4_PROMP/94-224------F.TQ----.NNK..----NVDY-----------------------------------EPWHWRY.EGS------
Q8EEB5_SHEON/50-206------F.QR----GQSA..----.VSA-----------------------------------EPWHISY.FPV------
Q67QI3_SYMTH/121-251------Y.PK----GKEHIT----GYMY-----------------------------------EPWHVRY.LGR------
Q87MI5_VIBPA/23-179------Y.L.----..QDLG----GVAI-----------------------------------EPWHISH.KAI------
O51529_BORBU/101-225------Y.PK----GYETDT----GYKA-----------------------------------EPWHYLY.IGP------
Q5KZM0_GEOKA/119-249------Y.PK----GKEAVT----GYKY-----------------------------------EPWHLRY.VGR------
Q8PBI7_XANCP/80-208------Y.PR----DNPH..----GIVY-----------------------------------EPWHWRW.WPA------
Q5WJW5_BACSK/100-228------Y.PA----EKEGIT----GYGY-----------------------------------EPWHLRY.VGD------
Q8DWH5_STRMU/90-226------F.PE----GKKDAT----GIDY-----------------------------------EDWHYRY.VGV------
Q6D7N5_PECAS/20-177------Y.A.----..HDLG----GVAV-----------------------------------EPWHISY.YPL------
Q9CM23_PASMU/28-187------F.T.----QLSQDK----EIGY-----------------------------------EPWHISY.LPI------
Q7VNB4_HAEDU/28-186------F.PF----DGIQNS----QVGE-----------------------------------EPWHLSY.RPI------
Q8EZA8_LEPIN/48-196------YTPK----SSRGNK----GYKE-----------------------------------EKWHWSY.API------
Q8YQW0_NOSS1/118-249------F.PM----DNSQ..----GVSY-----------------------------------EPWHWRF.VGD------
Q9PEZ7_XYLFA/74-202------Y.PR----NNPH..----GIVY-----------------------------------EPWHWRW.RAR------
Q8DQQ1_STRR6/87-213------Y.LK----GKEKET----GYMA-----------------------------------EEWHLRY.VGK------
Q7NMR7_GLOVI/149-279------Y.PP----GNAV..----GVGY-----------------------------------EPWHWRW.VGS------
Q8XKL5_CLOPE/109-238------Y.LK----GKEDIT----GYSY-----------------------------------EPWHYRY.IGD------
Q9CGZ2_LACLA/85-226------F.PE----GKKAET----GIGY-----------------------------------EDWHFRY.VGL------
Q97KB0_CLOAB/144-267------..GN----WTSYAI----TLVD-----------------------------------AP.HFQYTFGL------
Q8DKC7_THEEB/90-221------F.PR----NNPQ..----GVSY-----------------------------------EPWHWRF.VGD------
Q8EST6_OCEIH/190-320------F.PE----GKEDIT----KYQF-----------------------------------EPWHLRY.VGH------
Q6LTW9_PHOPR/50-207------Y.A.----..EDKG----GVAL-----------------------------------EPWHISY.HPI------
C2X0S1_BACCE/79-219------Y.PK----DKENIT----GIKY-----------------------------------EPWHYRY.VGK------
Q31ML7_SYNE7/94-224------F.PR----NNLQ..----QVSY-----------------------------------EPWHWRF.VGD------
Q5M6D5_STRT2/106-240------F.PD----GKTSST----GVGY-----------------------------------EDWHFRY.VGK------
Q81L80_BACAN/110-237------Y.LE----DKTETT----EYSY-----------------------------------EPWHLRY.VG.------
Q81QA6_BACAN/96-225------Y.PK----GKESIT----GYAY-----------------------------------EPWHIRY.VGD------
Q81RH6_BACAN/99-227------Y.TK----EKESLT----GYRY-----------------------------------EPWHVRY.VG.------
Q99YC5_STRP1/89-223------F.PE----GKKTST----GVDY-----------------------------------EDWHYRY.VGK------
T0U2B5_9ENTE/11-139------Y.PE----DKQEIT----GISY-----------------------------------EPWHFRY.VG.------

PF13539

A8ASL5_BPA50/72-136---...E-GF----...KWG----GD.W........KS.....F..K.--------------.DYPHFEL----------
B1QZK9_CLOBU/207-275---...N-N.----.F.VWG----GK.W.....G.........Y..F.--------------.DILHFEY----------
Q3J4T3_RHOS4/201-266---...A-G.----.ATSLG----RA....................CN--------------RDWMHFQF----------
A1ATB8_PELPD/203-268---...E-G.----.WVSLG----RR....................KN--------------YDWMHVQA----------
N8ZX51_ACIBI/194-260---...V-GL----...TWG----GR.W........KS.....I..Q.--------------.DYGHTEY----------
D1PEW6_9BACT/147-232---...K-G.----.F.RWG----GD.W.....K.H.......S..K.--------------.DYQHFEK----------
A9WTX9_RENSM/144-210---...N-G.----.VVRWG----GD.Y.....N.G.......R..K.--------------.DEMHFEI----------
A3TM69_9MICO/118-184---...N-G.----.VVRWG----GD.Y.....S.G.......R..K.--------------.DEMHFEI----------
A4SFK8_PROVI/119-180---...P-DI----...EWG----GH.W........KS.....F..P.--------------.DRPHYQL----------
D4MUA4_9FIRM/428-503---...Y-GF----NRGLWG----SR....................R.--------------.DYMHFSY----------
Q6LSS8_PHOPR/126-215---...N-G.----.FQYWG----GF.W.....D.T.......P..I.--------------.DYQHFQV----------
C4L6K0_EXISA/116-185---...L-GF----...EWG----GD.W........NS.....F..P.--------------.DYPHLQM----------
A0A018PY40_SALET/45-107---...L-GG----...SWG----GR.F........KS.....R..P.--------------.DGNHFSL----------
A8EEH4_BURPE/142-232---...N-G.----.LLRWG----GY.W.....D.D.......P..I.--------------.DYQHFEV----------
Q1QI98_NITHX/92-153---...Q-G.----.A.RWG----GD.Y.....R.G.......R..T.--------------.DPMHFEF----------
C4SEH9_YERMO/33-102---...L-PL----...QWG----GD.W........KS.....F..K.--------------.DGPHFEL----------
D5U8W6_BRAM5/259-337---...Y-G.----.F.IWG----GK.W.....H.........N..Y.--------------.DTIHFEY----------
A6LVB0_CLOB8/192-260---...N-N.----.F.VWG----GK.W.....G.........H..F.--------------.DILHFEY----------
J7JIB9_BACIU/94-164---...L-GF----...EWG----GD.W........KR.....F..K.--------------.DYPHLEM----------
C2N1K8_BACCE/54-120---...I-GF----...EWG----GD.W........KG.....F..V.--------------.DSPHLQY----------
B7RRA8_9RHOB/214-277---...E-G.----.W.YWG----AG.F.....S.........R..E.--------------.DSMHFEV----------
A0A034URH6_ERWAM/54-123---...I-PL----...VWG----GD.W........KT.....L..K.--------------.DGPHFEL----------
B1IKM8_CLOBK/171-239---...N-N.----.F.IWG----GK.W.....N.........H..F.--------------.DTLHFEY----------
B5U3R2_9CAUD/70-134---...R-G.----.IIEFG----GD.W.....T.S.......P..R.--------------.DEMHFEL----------
A5UGL4_HAEIG/54-128---...V-AI----...RWG----GD.WNMNESSDDEH.....F..Y.--------------.DGPHFEL----------
A9G830_SORC5/143-223---FERY-GF----...DWL----GH..........DD.....L..E.--------------.DTMHFEF----------
B3VGP8_9CAUD/82-143---...E-G.----.TVFWG----RR.W.......S.......K..P.--------------.DEMHYDL----------
C7NA70_LEPBD/121-197---...R-GW----...VWG----AN.Y..................TR--------------PDYMHFDF----------
E6VS38_DESAO/135-213---...L-G.----.W.KWG----GH.W.....G.SRG.....R..V.--------------.DPMHFQK----------
B7VJV8_VIBSL/123-214---...H-G.----.FMIWG----GD.W.....N.S.......P..I.--------------.DTQHFEV----------
C9MVB8_9FUSO/246-328---...I-NI----...EWG----GN.W..................KM--------------KDTPHFEL----------
D1CHT9_THET1/273-355---...I-G.----.W.RWG----GY.W.....S.D.......P..K.--------------.DYQHFSA----------
Q5DN15_9CAUD/21-99---...V-PI----...EWG----GD.W........RT.....F..K.--------------.DGPHWQL----------
B3VFY1_9CAUD/64-131---...E-G.----.TVFWG----ND.W.....N.S.......P..K.--------------.DAMHWNL----------
A0RNH9_CAMFF/569-634---...N-G.----.F.IWG----GR.W.....E.........H..F.--------------.DTMHFEY----------
A3UWI6_VIBSP/67-136---...I-PI----...VWG----GD.W........VS.....F..K.--------------.DGPHIEL----------
Q8ESQ8_OCEIH/97-167---...I-GF----...EWG----GD.W........QH.....F..K.--------------.DYPHLQM----------
A7XF57_9CAUD/52-120---...V-PV----...EWG----GD.W........VS.....F..K.--------------.DGPHLQL----------
C6LLE4_9FIRM/274-349---...Y-GF----SQGDWG----DS....................K.--------------.DYMHFSY----------
C4Z3D8_EUBE2/109-193---...H-G.----.F.EWG----GD.W.....E.H.......A..K.--------------.DYQHFEM----------
B2U374_SHIB3/219-287---...I-PV----...EWG----GD.W........KT.....L..K.--------------.DGPHFQL----------
E6VQR6_DESAO/135-213---...Q-G.----.W.SWG----GD.W.....V.APR.....P..Q.--------------.DNHHFQK----------
Q2SJV2_HAHCH/187-252---...V-KA----QLIRWG----GD....................FQ--------------TLLESKDD----------
B5UY55_BACCE/196-257---...L-GL----...TWG----GR.F........TT.....I..V.--------------.DYPHFEY----------
B7GIP5_ANOFW/70-132---...L-GL----...EWG----GD.W........TS.....F..K.--------------.DYPHFQY----------
B4AH26_BACPU/73-136---...L-GF----...SWG----GD.W........KS.....F..K.--------------.DYPHLEM----------
B3VGG0_9CAUD/70-142---...E-D.----.NVFCG----GF.W.......D.......I..R.--------------.DWMHFQM----------
Q1ZSD0_PHOAS/130-219---...N-G.----.FLYWG----GF.W.....N.S.......P..I.--------------.DYQHFQL----------
C8XIK2_NAKMY/139-205---...G-D.----.VIYWG----GD.Y.....R.G.......T..T.--------------.DEMHFEI----------
D9SKR7_CLOC7/252-312---...H-GF----...VWG----GD.W........TS.....F..K.--------------.DKPHFEK----------
C7R275_JONDD/65-131---...D-G.----.VVRWG----GD.Y.....T.G.......R..K.--------------.DEMHFEI----------
C3WMV9_9FUSO/63-140---...Y-SI----...EWG----GNCW........RT.....F..K.--------------.DAPHWQI----------
A8ATB8_9CAUD/56-121---...L-GF----...SWG----GD.W........SG.....F..V.--------------.DCPHMQY----------
C6ANB6_AGGAN/178-255---...H-G.----.F.IWG----GK.W.....Y.........H..Y.--------------.DSVHFEY----------
A6FEU3_9GAMM/129-218---...N-G.----.FLYWG----GF.W.....N.T.......P..I.--------------.DYQHFQV----------
A7ILH7_XANP2/449-509---...W-GL----...GWG----MN.W...............SKTK.--------------.DPMHFST----------
Q854X2_9CAUD/66-133---...E-G.----.MIFWG----ND.W.....N.S.......P..K.--------------.DSMHFQM----------
C9QJ38_VIBOR/123-214---...H-G.----.FLIWG----GD.W.....N.T.......P..I.--------------.DTQHFEI----------
Q7D1F2_AGRT5/53-126---...I-PL----...EWG----GD.W........KS.....F..K.--------------.DGPHFQL----------
Q2P050_XANOM/208-274---...A-GL----...EWG----GS.W........RS.....I..K.--------------.DYVHLEK----------
A5MZT7_CLOK5/187-255---...N-N.----.F.VWG----GK.W.....S.........H..F.--------------.DILHFEY----------
B1YFG8_EXIS2/71-136---...Y-QM----...QWG----GD.W........GS.....F..P.--------------.DYPHFQL----------
I0WPH3_9NOCA/75-142---...E-G.----.TVFWG----ED.W.......A.......T..K.--------------.DPMHTQI----------
C4SJV6_YERFR/38-106---...I-AV----...EWG----GN.W........TT.....F..K.--------------.DGPHFQL----------
A6SU28_JANMA/93-182---...H-G.----.FLGWG----GN.W.....D.A.......P..I.--------------.DYQHFQV----------
C6RGB5_9PROT/616-681---...H-G.----.F.IWG----GR.W.....V.........S..F.--------------.DTMHFEY----------
B2S3I3_TREPS/209-287---...E-G.----.F.IWG----GH.W.....M.........L..W.--------------.DTMHFEY----------
C4ZCU4_EUBR3/194-278---...H-G.----.F.EWG----GD.W.....T.H.......S..K.--------------.DYQHFEK----------
Q7NS81_CHRVO/52-121---...I-PI----...VWG----GD.W........KN.....F..R.--------------.DGPHFEL----------
D4J1D4_BUTFI/117-201---...H-G.----.F.QWG----GA.W.....K.N.......S..K.--------------.DYQHFEV----------
A9DC71_9RHIZ/63-156---...Q-V.----.F.GWG----GD.W.....R.T.......I..K.--------------.DAMHFQI----------
B9KTY8_RHOSK/205-268---...E-G.----.W.YWG----AA.Y.....N.........R..E.--------------.DSMHFEV----------
A1UGG7_MYCSK/185-266---...R-G.----.W.RWG----GD.W.....R.T.......P..K.--------------.DYQHFEL----------
A3ID77_9BACI/3-33---...L-DI----...EWG----GD.W........TG.....N..I.--------------.DRPHFEV----------
A1SG61_NOCSJ/370-446---...H-G.----.F.RWT----YG.L.....G..............--------------.DTQHFDY----------
A7HN00_FERNB/195-263---...N-G.----.F.IWG----GK.W.....A.........H..F.--------------.DLMHFEY----------
B5EIM6_GEOBB/377-491---...R-G.----.F.SWG----GA.W.....R.F.......P....--------------.DYQHLEY----------
A9WKC4_CHLAA/591-661---...L-G.----.F.FWG----GH.WNYDGRG.........A..S.--------------.DGMHFEW----------
C8KCM3_LISMN/56-121---...L-GF----...EWG----GD.W........SG.....F..V.--------------.DNPHLQF----------
C8T4A1_KLEPR/54-122---...V-TI----...EWG----GD.W........EK.....L..K.--------------.DGVHFQL----------
B2FJL7_STRMK/100-166---...A-GL----...RWG----GA.W........KS.....F..K.--------------.DMPHVEM----------
C9S248_GEOSY/68-133---...L-GL----...EWG----GD.W........KS.....F..K.--------------.DYPHFQY----------
A6TN75_ALKMQ/198-278---...R-G.----.W.TWG----GE.W.....N.S.......L..K.--------------.DYHHFQK----------
D4E385_SEROD/163-231---...I-QV----...EWG----GA.W........QS.....L..R.--------------.DGPHFQL----------
A3X9V1_9RHOB/202-265---...E-G.----.W.VWG----AG.F.....R.........R..E.--------------.DSMHFEI----------
D1AMG7_SEBTE/126-206---...R-G.----.W.TWG----GE.W.....K.S.......L..K.--------------.DYQHFEK----------
E8WNQ9_GEOS8/380-487---...R-G.----.F.TWG----GS.W.....R.F.......P....--------------.DYQHIEF----------
D2AZ54_STRRD/158-239---...V-D.----.W.EWG----GY.W.....S.G.......I..K.--------------.DYQHFSK----------
B1YI53_EXIS2/118-187---...L-GF----...EWG----GD.W........KR.....F..V.--------------.DYPHFEM----------
C0D0F9_9CLOT/238-322---...H-G.----.F.SWG----GD.W.....N.N.......P..K.--------------.DYQHFEK----------
C4K5R3_HAMD5/92-182---...H-G.----.FIIWG----GD.W.....D.T.......P..I.--------------.DYQHFEV----------
Q0A7S9_ALKEH/202-267---...E-G.----.WVSLG----RA....................RN--------------FDWMHVQA----------
B2K031_YERPB/45-107---...L-GG----...TWG----GR.F........KS.....N..P.--------------.DGNHFSL----------
D2PPJ5_KRIFD/298-379---...Q-G.----.Y.FWG----AG.W.....S.K.......P....--------------.DYQHFQP----------
B4SDT7_PELPB/113-173---...L-GL----...EWG----GN.W........KT.....I..V.--------------.DEPHFQL----------
Q2B7L2_9BACI/116-186---...L-GF----...EWG----GD.W........RS.....F..K.--------------.DYPHLQY----------
D1ALL6_SEBTE/63-140---...I-KV----...ECG----GY.W........KSP....F....--------------.DPPHFEL----------
B0MC55_9FIRM/144-230---...H-G.----.F.QWG----GD.W.....I.T.......Y..K.--------------.DYQHFEK----------
A7ZD12_CAMC1/602-665---...H-K.----.F.IWG----GR.W.....K.........H..F.--------------.DTMHFEY----------
Q3STE6_NITWN/103-162---...H-G.----.A.RWG----GD.Y...............RGRK.--------------.DPMHFEF----------
A5ECX3_BRASB/184-253---...H-G.----.F.IWG----GR.W.....Y.........H..Y.--------------.DTMHFEY----------
A9KN76_CLOPH/502-575---...Y-G.----.W.FWG----GD.F.....E.I.......S..A.--------------.DTMHFQY----------
A7FDS7_YERP3/58-127---...L-PL----...LWG----GD.W........KN.....F..R.--------------.DGPHFEL----------
D1B2W5_SULD5/592-657---...H-G.----.F.IWG----GR.W.....Y.........H..Y.--------------.DTMHFEY----------
C8X9H1_NAKMY/210-289---...H-G.----.F.SWG----GS.W.....R.E.......P..V.--------------.DYQHFSV----------
A0NQA8_9RHOB/173-238---...E-E.----.WVSLG----RA....................RN--------------FDWMHVQA----------
B9NP89_9RHOB/203-268---...H-G.----.GTPAG----YA....................WG--------------ADWMHFQF----------
B0NZY2_9CLOT/146-232---...Y-G.----.F.SWG----GE.W.....R.S.......S..K.--------------.DYQHFEV----------
B1JRT0_YERPY/56-124---...V-SI----...EWG----GD.W........KT.....L..K.--------------.DGPHFQL----------
Q5WK03_BACSK/108-178---...L-GF----...EWG----GD.W........AN.....F..T.--------------.DYPHLQM----------
C9XQ42_PEPDC/189-268---...R-G.----.W.SWG----GY.W.....K.N.......P....--------------.DYQHFEK----------
B3Q3Z4_RHIE6/222-285---...A-G.----.W.YWG----AG.Y.....S.........R..E.--------------.DSMHFEV----------
C4XNT5_DESMR/200-269---...E-G.----.F.IWG----GK.W.....S.........E..F.--------------.DLMHFEY----------
A5UTX9_ROSS1/590-659---...F-G.----.F.YWG----GH.F.....P.........R..L.--------------.DGMHFEV----------
D3EJK7_GEOS4/101-171---...L-GF----...QWG----GD.W........AN.....F..P.--------------.DYPHLQI----------
D4BTB0_PRORE/43-105---...L-GG----...SWG----GR.F........KT.....R..P.--------------.DGNHFSL----------
D3ADD3_9CLOT/85-148---...L-GL----...EWG----GN.W........KS.....P..V.--------------.DKPHFQL----------
Q7VJM2_HELHP/173-242---...E-G.----.F.IWG----GR.W.....W.........H..Y.--------------.DTMHFEY----------
Q7MR54_WOLSU/185-254---...E-G.----.F.IWG----GK.W.....G.........H..Y.--------------.DTMHFEY----------
A9DET4_9CAUD/64-132---...I-PV----...EWG----GD.W........KT.....F..K.--------------.DGPHFQL----------
C0CNE7_9FIRM/225-310---...Y-G.----.Y.SWG----GD.W.....S.N.......P..K.--------------.DFQHFEK----------
C6LBK9_9FIRM/257-343---...Y-G.----.F.TWG----GD.W.....S.S.......P..K.--------------.DYQHFEA----------
B9JYE5_AGRVS/104-165---...E-G.----.W.IWG----GD.W.....SPQ.......R..R.--------------.DGMHFQA----------
D9QLQ3_BRESC/53-121---...V-AL----...VWG----GD.W........PR.....L..R.--------------.DGPHFEL----------
B0VVC4_ACIBS/347-415---...L-GL----...VWG----GR.F........KT.....KNGP.--------------.DYPHFEL----------
C4K6W4_HAMD5/53-119---...I-RV----...YWG----AC.W........SC.....I..N.--------------.DEDN..L----------
B2UP36_AKKM8/129-194---...E-G.----.AVSLG----RS....................RD--------------YDWMHFQF----------
C4L144_EXISA/57-123---...L-GF----...TWG----GD.W........WN.....F..V.--------------.DKPHLQY----------
F0KAF2_CLOAE/198-263---...V-GL----...EWG----GN.W........TS.....YAITL--------------VDAPHFQY----------
G3M4A5_9CAUD/70-151---...E-GL----QLVWWG----ND.W.....N.S.......P..K.--------------.DSMHFQM----------
Q5J5L5_9CAUD/70-137---...E-G.----.MVFWG----ND.W.....T.S.......P..K.--------------.DAMHFQL----------
D0LWT6_HALO1/218-298---...A-G.----.Y.AWG----GD.W.....P.S.......F..R.--------------.DPMHFEL----------
A4G1C9_HERAR/140-229---...H-G.----.FLIWG----GD.W.....D.A.......P..I.--------------.DYQHFQI----------
Q0FH91_PELBH/197-262---....-..----...LWG----G.......................--------------.DAMHFQR----------
D4CCJ4_9CLOT/58-129---...L-GL----...GWG----GR.W........TS.....I..V.--------------.DKPHLYL----------
D0LQS8_HALO1/317-391---...A-GW----...EWG----GD.W...............NRVK.--------------.DYMHFED----------
B6V2R4_BPSP1/74-136---...L-GF----...EWG----GD.W........KS.....F..Y.--------------.DAPHLEM----------
A0A038HZ79_BORBO/53-127---...I-PL----...EWG----GD.W........TT.....L..K.--------------.DGPHFQL----------
A9KQC6_CLOPH/237-321---...R-G.----.F.TWG----GD.W.....Q.T.......S..K.--------------.DYQHFQK----------
C6WMZ1_ACTMD/132-213---...R-G.----.W.TWG----GR.W.....Q.T.......P..L.--------------.DYQHFEL----------
A3K5D3_9RHOB/148-231---...R-S.----.W.GWG----GT.W.....S.S.......A..K.--------------.DYQHFSE----------
A4FKJ2_SACEN/154-235---...R-G.----.W.TWG----GH.W.....T.T.......P..I.--------------.DYQHFEM----------
Q5YZK4_NOCFA/71-135---...E-G.----.CVFWG----AD.W.......T.......R..A.--------------.DEMHYQI----------
Q1DAC7_MYXXD/63-125---...A-GL----...VWG----GR.................F..G.--------------.DSPHVQW----------
D1BDT0_SANKS/65-131---...S-P.----.AVRWG----GD.Y.....S.G.......R..K.--------------.DEMHFEI----------
C7N3P8_SLAHD/215-297---...A-G.----.F.VWG----GD.W.....T.D.......P..I.--------------.DYQHFEY----------
A6Q7D6_SULNB/126-212---...Y-G.----.W.KWG----GD.W.....S.G.......V..K.--------------.DYQHFSK----------
B6VNP6_PHOAA/57-126---...I-PI----...IWG----GD.W........KS.....L..K.--------------.DGPHFEL----------
Q73V53_MYCPA/145-206---...Q-N.----.ARGLS----GP.RPHRPGPAARR.....R..P.--------------.GRARLHR----------
D7VN70_9SPHI/69-137---...K-GW----...TWG----GD.W........KS.....F..K.--------------.DYPHFEK----------
B5LJL3_9CAUD/69-133---...E-G.----.TVFWG----RN.W.......S.......R..V.--------------.DEMHFQI----------
A8LRY3_DINSH/108-171---...H-G.----.F.FWG----AA.F.....P.........T..E.--------------.DAMHFEV----------
C9MWB5_9FUSO/152-227---...R-GW----...VWG----AN.F..................RT--------------RDYMHFGF----------
D0LZM8_HALO1/111-191---...V-G.----.W.DWG----GD.W.....S.D.......Y..K.--------------.DYHHFAK----------
C9DBZ2_9CAUD/70-142---...E-D.----.VIYCG----GY.W.......S.......I..R.--------------.DWMHFQM----------
D7VVF1_9FLAO/66-136---...Y-GW----...DWG----GN.W........KT.....F..K.--------------.DLPHFEK----------
Q2SDK8_HAHCH/53-121---...I-PI----...EWG----GD.F........NG.....F..F.--------------.DGPHYQL----------
C7RR41_ACCPU/164-241---...N-G.----.F.IWG----GK.W.....F.........H..F.--------------.DTIHFEY----------
A1SCY8_NOCSJ/370-428---...W-G.----.F.TWG----GD.W.....R.Y.......T....--------------.DPMHFEM----------
B6FXG7_9FIRM/394-474---...R-G.----.W.KWG----GN.W.....K.N.......S..K.--------------.DYQHFEK----------
B6WQA8_9DELT/218-285---...E-G.----.F.IWG----GK.W.....H.........E..Y.--------------.DLMHFEY----------
A4T1K8_MYCGI/149-230---...R-G.----.W.RWG----GH.W.....R.S.......P..L.--------------.DYQHFEI----------
Q7NR04_CHRVO/206-271---...A-GL----...TWG----GV.W.........S.....F..R.--------------.DYGHIER----------
D4CX41_9FUSO/55-123---...Y-II----...TWG----GD.W........KT.....F..K.--------------.DGPHFQI----------
B8J0M5_DESDA/248-315---...A-G.----.F.IWG----GK.W.....H.........E..Y.--------------.DIMHFEY----------
A8EV90_ARCB4/175-243---...Y-G.----.F.IWG----GR.W.....Y.........H..F.--------------.DTMHFEY----------
C6PUE1_9CLOT/429-508---...Y-KW----...DWG----GN.F.....K.N.......P..K.--------------.DYMHFSY----------
D9SMB1_CLOC7/196-264---...N-Y.----.F.IWG----GK.W.....S.........H..F.--------------.DILHYEY----------
Q73JG3_TREDE/215-293---...E-G.----.F.IWG----GK.W.....T.........L..W.--------------.DNMHFEY----------
B8ENP1_METSB/622-688---...F-G.----.F.YWG----GH.F...............R..SR--------------PDGMHFEV----------
C8Q0B7_9GAMM/78-152---...V-PV----...RWG----AD.WDGDGKPRERG.....E..S.--------------.DSPHFEI----------
C0QJJ2_DESAH/140-230---...H-G.----.FFVWG----GY.W.....N.Y.......P..V.--------------.DYQHFQV----------
Q5DZ88_VIBF1/125-214---...N-G.----.FIYWG----GY.W.....D.T.......P..I.--------------.DFQHFQT----------
C9MUL4_9FUSO/1065-1128---...I-GF----...EWG----GH.W........KT.....R....--------------.DLPHFEM----------
C6D2R3_PAESJ/123-193---...L-GF----...AWG----GD.W........TS.....F..K.--------------.DYPHLQM----------
D1PX89_9BACT/178-263---...H-G.----.F.RWG----GA.W.....R.T.......V..K.--------------.DYQHFEK----------
C3XMD6_9HELI/163-232---...E-G.----.F.IWG----GR.W.....W.........H..Y.--------------.DTMHFEY----------
Q70K75_9ACTO/100-167---...G-G.----.QIVWG----GE.W.....S.T.......L..P.--------------.DDPHFEV----------
C3K4K2_PSEFS/131-227---...N-G.----.FLTWG----GY.W.....D.T.......R..I.--------------.DYHHFQI----------
Q2LPY2_SYNAS/102-181---FLRL-GW----...RWG----GL.F........LH.....I..R.--------------.DYHHFEK----------
A8GLN1_SERP5/79-147---...I-KI----...EWG----GD.W........KT.....L..K.--------------.DGPHFQL----------
C0AQZ5_9ENTR/54-123---...V-SI----...NWG----GN.W........VS.....F..R.--------------.DGPHYEL----------
D1RF68_LEGLO/59-140---...H-G.----.W.DWA----GD.W.....H.D.......L..Q.--------------.DYQHFEK----------
C6BUG1_DESAD/184-249---...E-G.----.WTSLG----LA....................KN--------------YDWMHIQA----------
Q2LQQ3_SYNAS/55-131---...V-GL----...RWG----GR.F........RNSKGKPR..P.--------------.DYPHFEI----------
C7PFT3_CHIPD/191-256---...N-G.----.F.YWG----GH.F.....T.........R..K.--------------.DGMHFEV----------
A8ATR6_9CAUD/73-134---...R-GF----...KWG----GD.W........KS.....F..T.--------------.DLPHFEA----------
C0ZX75_RHOE4/85-149---...E-N.----.NIFWG----AD.W.......S.......R..A.--------------.DEMHYQL----------
D0DDG3_9RHOB/197-267---...Y-G.----.F.IWG----GK.W.....H.........H..F.--------------.DGMHFEY----------
A6W8P6_KINRD/95-156---...W-SL----...SWG----RE.W..................SR--------------PDPMHFEA----------
A7HJ25_FERNB/74-137---...F-GL----...EWG----GR.W........KN.....F..P.--------------.DKPHIQM----------
B4WAV9_9CAUL/53-121---...T-PI----...VWG----GD.W........KS.....L..R.--------------.DGPHFEL----------
D2XRK5_9CAUD/70-137---...E-G.----.TVFWG----QD.W.....N.S.......P..K.--------------.DPMHAQC----------
B5EHY6_GEOBB/165-227---...Y-G.----.W.VWG----AA.F.....R.........K..E.--------------.DGMHFEA----------
B1YH87_EXIS2/72-135---...Q-GF----...SWG----GD.W........SG.....F..K.--------------.DYPHFEL----------
A7ZFD8_CAMC1/46-110---...L-NS----.LNRWG----GN.F........TS.....F..L.--------------.DTPHFER----------
B8KYV5_9GAMM/51-117---...V-GL----...NWG----GR.W........TS.....P..K.--------------.DYPHVEL----------
B2VDM6_ERWT9/41-110---...T-PI----...VWG----GD.W........KT.....L..K.--------------.DGPHFEL----------
B9JF39_AGRRK/850-911---...N-G.----.L.SWG----GA.W.....N.S.......K..K.--------------.DAMHFEV----------
E3I7F8_RHOVT/190-269---...H-G.----.F.IWG----GS.W.....Y.........H..F.--------------.DGMHFEY----------
A1K513_AZOSB/150-214---...A-GL----...TWG----GR.W.........D.....I..R.--------------.DYGHVEM----------
B4V6Z2_9ACTO/133-214---...A-G.----.W.YWG----GR.W.....G.N.......P....--------------.DYQHFSA----------
D0TJH0_9BACE/157-246---...A-G.----.F.EWG----GD.W.....T.S.......L..K.--------------.DYQHFEI----------
Q0AVH5_SYNWW/269-331---...A-G.----.F.SWG----NS.Y.....S..............--------------.DSMHYEL----------
D3VE22_XENNA/59-122---...I-PI----...EWG----GD.W........KS.....F..K.--------------.DGPHFQL----------
A8S209_CLOBW/64-127---...L-GL----...EWG----GN.W........KS.....I..M.--------------.DNPHFQL----------
C6VVI7_DYAFD/85-145---...N-G.----.WICGA----DW.S.....E.R.......S..K.--------------.DGMHFQW----------
C4SXE4_YERIN/30-99---...I-LI----...VWG----GD.W........KT.....L..K.--------------.DGPHFEL----------
A5FFV9_FLAJ1/170-242---...Y-G.----.F.IWG----GN.W.....K.........H..Y.--------------.DTMHFEY----------
B2Q011_PROST/55-124---...V-EI----...EWG----GD.W........VN.....F..K.--------------.DGPHFQL----------
Q98H40_RHILO/198-268---...Q-G.----.F.IWG----GR.W.....Y.........H..Y.--------------.DTMHFEY----------
D1AEC5_THECD/163-244---...I-G.----.W.GWG----GD.W.....T.G.......T..K.--------------.DYQHFSS----------
D4DZ54_SEROD/54-122---...I-PV----...EWG----GD.W........KT.....L..K.--------------.DGPHFQL----------
M1GCS0_LAWIN/228-297---...R-G.----.F.IWG----GK.W.....Y.........E..Y.--------------.DFMHFEY----------

PF01427

VANX_ENTFA/1-202--------SS----GFQSYR----FE-W-------------------------------------WHYKLIDEP....--
DDPX_SYNY3/31-240--------SA----GFLRHP----GE-W-------------------------------------WHFSQGDQLWAWQ--
DDPX_ECOLI/3-187--------GG----GFVGIS----SE-W-------------------------------------WHFELPQAASYPL--
O53850_MYCTU/62-256--------AG----GLTVYS----GE-W-------------------------------------WHFDGPGAG....--

PF03411

Q7VLX1_HAEDU/37-271.K.NRAWLQK----IRPWYA----HDSHFHVRLSCPSDARNCENQPPI.....AAGDGCGD.ELHSWFLPAPANTTAAKP
G7Z2K9_AZOL4/79-317.S.DRAFLNK----LRPWHG----HDGHMHIRLNCPAGSPLCEQQTAP.....PDGDGCDD.ELMSWLSSASPAIERPLG
F2J3L2_POLGS/44-296.G.DRAWLRK----VRPWWG----HDYHFHVRISCPPGSVGCSDQDAP.....PPGDGCGS.ELAWWLSD..EPWVPK..
A8LNH7_DINSH/41-294.G.NKKWLQK----IRPLWG----HHYHFHVRLKCPSGMGGCQTQTPSVRDLSKGGTGCDE.TLNWWVTD...ALDPPKK
F8JE38_HYPSM/186-434.T.DRAWLGK----VRPWYG----HYYHFHMRIKCPPGSAGCTPQVPP.....TGDDGCGK.EVTQWLAK..VIPAKG..
D7A2C9_STAND/53-295.G.ERSWLQK----VRPYWG----HDYHMHVRLSCPKDSPDCRPQDPV.....VPGEGCGS.ELDWWFSD..ANLHPK..
G0A1D7_METMM/39-279AA.SAVWLRK----IRPWWK----HDDHFHVRLKCPKGNPYCQGQPAV.....PETDGCDA.SLAWWFSA..EAKAPSKP
B7VJP4_VIBSL/34-277.N.GRAWLGK----IRPWWG----HHSHFHVRLKCPKGSSNCIAQASP.....PKGDGCGD.ELASWAPKTIPVPPPKKV
Q7MNJ8_VIBVY/38-271ST.HRSWLRK----VRPWWG----HSSHMHVRLSCPQGSDDCIEQALP.....PEGDGCGE.EVLSWIERPTPTAKKAQE
D4ZCJ1_SHEVD/37-278VSKDNDWLNK----VRPWWG----HSYHMHVRLRCPKGDSQCKNQQAP.....KQGNGCE..DIAWWKRQLYGVKLVDDK
Q89BJ0_BRADU/67-311.G.DRSWLSK----IRPWWG----HDYHFHIRMRCPPGAGECEGQPSQ.....SEDEGCKEADLAYWFSD..AVLHPK..
V4IED8_9GAMM/46-281.G.NADWLRK----LRPWWG----HDAHMHVRLKCPKDSPACKQQAPI.....ARGSGCGA.ELAWWFSS..EARSPKKS
A0KJ73_AERHH/30-258.P.DEPWVGK----LRPWVG----HFSHFHVRLRCPAGSPDCQPQAPI.....PPGNGCGA.ELASWLKDKPQLPKVSMA
G8AJW0_AZOBR/59-295.P.DRAFLRK----LRPWHG----HDGHMHIRLGCPAGSPQCEDQRDI.....PDGDGCGD.EVASWLGSVYPVVERHNG
A3N0A9_ACTP2/37-271.S.DRSWLRK----VRPWYG----HDSHMHVRLSCPQNAPNCENQAPI.....PAGDGCGA.ELYSWFEPAPAGSTVSKP
E3F225_KETVY/53-297.G.DRSWLNK----VRPWAG----HNTHFHVRLNCPAGARYCEDQVPP.....PPGDGCAE.AEE.FVAN...ILNPP..
W6R6D9_9RHIZ/59-306.G.DRTNLGK----LRPIYG----HDSHFHIRIKCPPGAASCKPQAPV.....PADDGCGK.SLAWWFTK..EPWAPP..
Q6LU97_PHOPR/36-276.Q.NRDWLRK----VRPWWG----HYYHFHVRLSCPDGSTNCKAQNPP.....PPGDGCGA.ELASWKPQKKVKQTAQSK
W0DWJ2_MARPU/43-274.G.GADWLRK----VRPWWG----HDAHTHVRLACPEDSPACEPQSPI.....PAGPGCGA.ELDWWFSA..EARSPGSG
M9RED3_9RHOB/64-306.G.DRAWLNR----IRPWYG----HHYHFHVRLRCPDGDNGCENQAPP.....PAGDGCGD.AQN.WVND...ILNPP..
D8MV06_ERWBE/36-270.A.DRDWLRK----VRPWFG----HRAHMHVRLRCPAGSLQCQDQPAP.....PAGDGCGA.ELQSWFLPAKPGSGAPVK
C5BAF1_EDWI9/36-270.G.DRGWLHK----VRPWFA----HRAHMHVRLRCPPGSAACEAQTPP.....PPGDGCGA.ELASWFLPPPSRSAPSRP
C3MBY2_RHISN/55-301.G.DRTALGK----VRPIYG----HDYHFHIRIKCPAGSKGCKDQAAV.....RAGDGCDK.SLAWWFTD..EPWAKP..
Q98DM3_RHILO/86-328.G.DRSWLRK----IRPFWG----HDYHFHMRIGCQRGSPDCKGQEAT.....PDDDGCGK.PLAWWFTQ..EPWRPN..
E3I638_RHOVT/169-418.D.DRGFLHK----IQPIMG----HDAHFHVRLACPAGDEGCRNQPPL.....PAGDGCGG.GLDKWIAKLSKPVVPV..
Q11CB0_CHESB/47-289.G.DRSWLRK----IRPFWG----HDYHFHVRIGCPKGSVGCKSQAAV.....PQSEGCDK.SLAWWFTE..EPWRPA..
C5AYD5_METEA/65-307.G.DRGWLTK----VRPMYG----HNYHYHIRLACPAGDNACDDQAPP.....PSGDGCGS.ELDYWFSA..AVLNPP..
B2IE79_BEII9/75-315.G.DRSWLNK----VRPYFG----HDYHFHVRLACPAGEPACRDQDPV.....PPGDGCDA.SLAWWFSD..EVLHP...
B9J6R8_AGRRK/59-304.G.DRTNLGK----LRPEYG----HDSHFHIRLSCPAGSVGCTPQAPV.....TVGDGCDK.TLAWWLGP..EPWAKP..
MEPA_PECAS/41-275.H.DRDWLRK----VRPWFA----HRAHMHVRLRCPADSLECQEQSEP.....PIGDGCGA.ELTSWFQPKQPSSEAPEK
Q65U86_MANSM/44-278.Q.DRSWLQK----IRPWFG----HDSHIHVRLTCPYGANYCENQPAI.....PRGDGCGA.ELYSWFEPQKPSSGATTK
N0B7W2_9RHIZ/170-420.T.DRHWLGK----VRPYYG----HYYHFHVRIKCPAGFGGCKAQTPP.....TGDDGCGK.EVDQWLAK....VIPA..
Q28VK1_JANSC/50-297.G.DRSWLSH----IRPANG----HHYHFHVRLNCPSGDRNCQNQ.PL.....PQGDGCQE.AYD.RAAR...IINPP..
B9JYQ7_AGRVS/40-286.G.DRTNMGK----IRPIYG----HDAHFHIRLSCPPGAAGCKPQAPV.....APGDGCDK.SLAWWFTK..EPWEQK..
D5ASU0_RHOCB/43-298RA.DTAWLQK----IRPIYG----HNEHFHVRLKCPPGARLCEGQKPTVAELSKGGNGCDE.TLTWWVTT...YLEELRH
W0HVY1_9ENTR/36-270.S.DRDWLRK----VRPWFG----HRAHMHVRLRCPPGSRDCVDQPAP.....PPGDGCGA.ELESWFLPAKPGTGAPVK
B8F448_HAEPS/37-270.T.DRNWLRK----IRPWYA----HDSHFHVRLTCPADAANCENQAPV.....PAGDGCGE.ELYSWFEPAPPSAT.PKA
Q87S60_VIBPA/36-276GK.DRSWLRK----VRPWWG----HHYHFHVRLSCPDSSSNCVDQAPP.....PSGDGCGS.ELASWKPKTVVPAKPQPA
B8IRL8_METNO/82-322.G.DRDWLTK----VRPMFG----HNYHFHIRISCPAGEEGCADQDPP.....PAGDGCGE.DLARWFRP..AMLHPR..
R5EP69_9GAMM/31-270GH.DRSWLQK----LRPWFG----HRGHMHVRLACPLDSPLCVNQSKP.....PKGDGCGQ.ELDSWLYPHKYAQKPAKK
L0GX36_9GAMM/44-279.G.DRHWLRK----VRPWYR----HDAHFHVRLRCPGDSPDCQPQAPP.....PAGDGCDA.TLAWWFSD..EARHPARS
Q3IY41_RHOS4/40-292RA.DRAWLQK----IRPVPG----HDTHFHIRLKCPRGAVACQTQTPTVAELSKGGDGCDE.TLTWWVTD...YLNPP..
A4YL76_BRASO/65-307.G.DRGWLTK----VRPWWG----HDYHFHIRMMCPPGNPDCHGQTDQ.....EGGDGCG..DLDYWFSD..AVLHPP..
B8EQJ0_METSB/63-305.G.DRSWLTK----VRPYYG----HDYHFHIRLACPPGEESCRDQDPV.....PPGDGCDA.SLNYWFSD..AVLHPK..
D3RNE7_ALLVD/49-287.G.DRAWLRK----VRPWWG----HDAHFHVRLACPADSPSCEDQSPV.....PPGDGCGE.DLAWWLSD..EVLSGRAR
H2FVL9_OCESG/23-250.G.DAPWLNR----LRPWFG----HSGHFHVRLHCPAASQHCEPQQAV.....PPGTGCGR.ELASWIDDRSGELAAGPR
H8GG79_METAL/41-278.A.GRSWLRK----IRPWWK----HDDHFHVRLKCPKNGRYCESQENL.....PAGDGCDA.SLAWWFSA..EAKAPAKK
S5Y7V8_PARAH/48-289.G.NRAYLRK----IRPINA----HNFHFHVRLSCPAGSV.CQKQDPP.....PAGDGCAE.AME.WIKN...RIDPSRV
Q1GD71_RUEST/59-305.G.DRSYLRK----IRPWWG----HHYHFHVRLNCPRGTRGCVEQDPP.....PRGDGCDD.ARQ.WVAN...ILNPP..
I7DUV0_PHAIB/60-305.G.NRDWLRK----IRPWYG----HHYHFHVRLKCPDGARGCVNQDPP.....PRGDGCDD.ARQ.WVKD...ILSPP..
E3HYM4_RHOVT/58-304.S.DRVWLQK----IRPWYK----HDDHLHVRLSCPAGSNGCVSQPAI.....KADDGCGE.ELDAWFRK...LRAPRPK
M4RIZ0_BIBTR/37-269.Q.DREWLRK----IRPWYY----HDSHFHVRLRCPADAPHCENQAPV.....PTGDGCGA.ELYSWFEPAKPSST.PKS
Q3SVT3_NITWN/101-344.G.DRSWLSK----VRPMYG----HDYHFHIRIKCPPGSPQCESQPPP.....GPAEGCGAQDLAYWFSD..AVLHPK..
H2INY8_RAHAC/45-279.T.DREWLHK----VRPWFG----HRAHMHVRLRCPVGNLECENQAPP.....PPGDGCGA.ELQSWFLPPKPGSGIPVK
V6F1Q6_9PROT/42-277.G.NTDWLAK----LRPWWG----HDEHFHVRLACSIGDINCVTQAPV.....PPGDGCGA.ELSSWLAKSTVLPDHGRD
A8HVK9_AZOC5/49-304.G.DRAWLAK----VRPYWG----HDYHMHVRLFCPKDSPDCRPQEPP.....PVGDGCGS.ELAWWFTD..EVLHPK..
B6JJU0_OLICO/62-305.G.NRQWLSK----VRPMYG----HDYHFHIRIKCPPGSVGCESQRPP.....DDHEHCSGPDLAYWFSD..AVLHPK..
Q5LWS6_RUEPO/46-291.G.DRSYLRK----IRPWWG----HHYHFHVRLSCPRGSRGCVDQTPP.....PQGDGCAE.AQE.WVNN...ILNPP..
I2B718_SHIBC/36-270.S.ERDWLHK----VRPWFG----HRAHMHVRLRCPAGSLECQDQPAP.....PPGDGCGA.ELQSWFEPPKPGSTSPVK
B0UWQ5_HISS2/37-270.G.DRNWLQK----IRPWFG----HDSHFHVRLTCPKDAKYCENQLPI.....PAGEGCGE.ELYSWFKPAKPSEFKPK.
F4HED5_GALAU/40-271.G.DRSWLRK----LRPWFG----HDAHFHVRLHCPKGAQYCEEQAPI.....PAGDGCGE.ELMSWFK.LRSATAPSSP
Q16D60_ROSDO/64-307.G.DRSWLRK----IRPWFG----HHYHFHVRLSCPSGSTGCVDQTPP.....PAGDGCAD.AQA.WVNN...ILNPP..
A7IJY5_XANP2/64-307.G.DRSFLAK----VRPYWG----HDYHMHVRLTCPPGNPDCRPQEAP.....PAGEGCGS.ELDWWFTD..EVLHPK..
G4SVA0_META2/57-295.A.ERDWLGK----IRPWWG----HHDHFHVRLKCPESNPDCRSQEPI.....SKGDGCDA.TLDWWFTA..EAKTPAAP
MEPA_ECOLI/36-270.T.DRDWLRK----VRPWFQ----HRAHMHVRLRCPADSLECEDQPLP.....PSGDGCGA.ELQSWFEPPKPGTTKPEK
G8PRI5_PSEUV/75-327.G.DRDWLRK----VRPWWG----HHYHFHVRMACPADSKRCKNQAIP.....PAGDGCGK.ELTYWLSD..EPWVPK..
Q607R5_METCA/38-277.G.DRSWLRK----IRPWHR----HDDHFHMRLACPTDSPDCVPQKPL.....EPGDGCDA.SLDWWLSLPPLRPLPDNH
V5SD71_9RHIZ/87-338.A.DPSWLRK----VRPVFG----HFYHFHIRMRCPANSTSCQAQHAV.....GEDDGCGK.ELDQWLKR..VAPKPP..
G8AJ70_AZOBR/59-293.G.DRSWLNA----VRPWGG----HDSHFHVRMNCPAGSTACVPQAPI.....PPGDGCGQ.ELLSWFEPPKEAPVPRPP
A8GH81_SERP5/36-269.A.DRDWLHK----VRPWFG----HRAHMHVRLRCPAGSLECKEQDTP.....PPGDGCGA.ELASWFIPHQP.SAKPGK
B8IJD0_METNO/63-305.A.DRRWLTK----VRPMYG----HNYHFHIRLECPSGDHACKDQEPP.....PAGDGCGA.ELDYWFSD..AVLHPK..
D0LL99_HALO1/58-299.E.ERDWLRK----LRPWWG----HDAHFHVRLECPDDSPECKAQAAL.....PAGDGCD..EVSWWLDEERQAERKEER
J7QQ34_METSZ/72-310.G..QNWMHK----VRPMWG----HNYHFHIRLHCPNGS.NCRDQDPT.....PAGDGCDA.SLAWWFQD..GVLHAK..
B8CUQ4_SHEPW/47-288.A.NDAWLNK----VRPWWG----HTYHMHVRLHCPEDDVDCIEQAPI.....PKGNGCN..ELSWWKQQYTQPKLKPKT
Q2KDT7_RHIEC/59-307.G.DRTNLGK----LRPIYG----HDSHFHIRIKCPPGAAGCTPQAPV.....ASGDGCDK.SLAYWFTP..APWAPP..
Q2W4C2_MAGSA/42-276DG.DRSWLRK----LRPWWG----HDEHFHVRLSCPADSPDCERQKPM.....PEGDGCGE.ELESWSARPTWPAPPSRP
MEPA_HAEIN/43-277.N.DRGWLHK----IRPWHG----HNSHFHVRLTCPADASYCENQAPV.....PAGDGCGD.ELYSWFEPPKPGTSVSKP
F7QGC0_9BRAD/50-294.G.DRSWLSK----IRPMYG----HDYHFHIRMKCPPGSTNCESQPPP.....GDSEGCSAGDLAYWFSD..RVLHPK..
A1B5F2_PARDP/45-284.G.DRTWLRK----VRPLNG----HDYHFHVRMACPAGSI.CQQQDAP.....PPGDGCAE.AAE.WIKN...RIDPGRV
I3YA59_THIV6/50-288.A.DRGWLRK----VRPWKG----HDAHFHVRLVCPPGSPQCERQSAL.....PAGDGCGE.ELAWWFSE..EARKPVKK
A9CKL5_AGRT5/53-298.G.DRTFMGK----IRPIYG----HDEHFHIRLECPPGAPNCKPQAEV.....GKGDGCDK.SLAWWFTK..EPWAPP..
Q0BS55_GRABC/32-265.G.DRSWLHL----IRPWWG----HKAHMHVRFRCPAGQTLCVQAPPP.....PTGDGCDT.TLAWWFQPHPAPPAAPPR
B1M521_METRJ/66-304.G.SR.WMSK----VRPMYG----HNYHYHIRLACPAGQEDCQPQGAP.....PPGDGCD..DLSYWFSD..AVLHPK..
Q2YJP1_BRUA2/82-325.G.DRSWLGK----VRPYWG----HFYHFHVRLTCQPGSPECKPQPKV.....APGDGCDK.SLAWWFTD..EPWKPA..
Q6NCT0_RHOPA/69-313.G.DRSWLHK----VRPMYG----HDYHFHIRLRCPAGIEGCEAQAEP.....PPGEGCDASDFAYWFSD..AVLHPK..
C4LE77_TOLAT/27-261AT.DPTWLGK----LRPWFG----HSAHFHVRLHCPVGSKDCEPQKPY.....PEGSGCGA.ELQSWLTKPAMVSSKPLP

PF05951

Q9CNZ9_PASMU/32-183------------------------------------------
Q9A852_CAUCR/63-213------------------------------------------
Q9KSI7_VIBCH/29-179------------------------------------------
Q989B8_RHILO/15-167------------------------------------------
Q92JX1_RHIME/6-158------------------------------------------
Q98H74_RHILO/14-166------------------------------------------
Q8EF76_SHEON/32-182------------------------------------------
Q7CT90_AGRT5/14-166------------------------------------------
Q2YIP2_BRUA2/25-176------------------------------------------
Q7MJP7_VIBVY/37-186------------------------------------------

PF08291

Q7Y5M4_BPSP6/6-108------------------------------------------
Q5LM88_RUEPO/18-119------------------------------------------
Q8YUC7_NOSS1/127-243------------------------------------------
Q5NX34_AROAE/55-166------------------------------------------
Q88L27_PSEPK/5-119------------------------------------------
Q92KB7_RHIME/323-423------------------------------------------
Q8CJR3_STRCO/116-230------------------------------------------
Q7MNT8_VIBVY/105-217------------------------------------------
E6UFM5_RUMA7/197-303------------------------------------------
Q31Q82_SYNE7/73-183------------------------------------------
Q5LCN2_BACFN/2-118------------------------------------------
V4IU57_9ACTO/127-240------------------------------------------

PF01085

K1R6F4_CRAGI/30-187------------------------------------------
F6XBS5_CIOIN/130-291------------------------------------------
H2ZHI5_CIOSA/23-183------------------------------------------
H2YWW4_CIOSA/21-183------------------------------------------
G3H796_CRIGR/24-184------------------------------------------
HH_DROME/85-244------------------------------------------
W5MLT6_LEPOC/24-184------------------------------------------
M4A9L1_XIPMA/27-187------------------------------------------
T1K174_TETUR/64-224------------------------------------------
W4Y925_STRPU/27-186------------------------------------------
T1ELE5_HELRO/210-371------------------------------------------
J9K1A2_ACYPI/38-194------------------------------------------
A7RW45_NEMVE/1-161------------------------------------------
K7J545_NASVI/41-201------------------------------------------
E5SNS5_TRISP/58-212------------------------------------------
F1SJ10_PIG/27-189------------------------------------------
Q175B3_AEDAE/38-198------------------------------------------

PF02557

YODJ_BACSU/120-250------------------------------------------
Q65US8_MANSM/26-185------------------------------------------
O83250_TREPA/106-230------------------------------------------
Q8Y645_LISMO/113-243------------------------------------------
Q5NHB6_FRATT/26-155------------------------------------------
Q7V800_PROMM/59-190------------------------------------------
Q7VCA8_PROMA/98-229------------------------------------------
Q55957_SYNY3/161-291------------------------------------------
Q7U788_SYNPX/101-232------------------------------------------
Q7NI07_GLOVI/108-238------------------------------------------
Q55454_SYNY3/106-237------------------------------------------
Q97E20_CLOAB/88-217------------------------------------------
Q73Q11_TREDE/110-234------------------------------------------
VANY_ENTFA/114-247------------------------------------------
Q7N3J3_PHOLL/21-178------------------------------------------
Q5QTZ2_IDILO/20-179------------------------------------------
Q8E2A2_STRA5/89-225------------------------------------------
Q7V1U4_PROMP/94-224------------------------------------------
Q8EEB5_SHEON/50-206------------------------------------------
Q67QI3_SYMTH/121-251------------------------------------------
Q87MI5_VIBPA/23-179------------------------------------------
O51529_BORBU/101-225------------------------------------------
Q5KZM0_GEOKA/119-249------------------------------------------
Q8PBI7_XANCP/80-208------------------------------------------
Q5WJW5_BACSK/100-228------------------------------------------
Q8DWH5_STRMU/90-226------------------------------------------
Q6D7N5_PECAS/20-177------------------------------------------
Q9CM23_PASMU/28-187------------------------------------------
Q7VNB4_HAEDU/28-186------------------------------------------
Q8EZA8_LEPIN/48-196------------------------------------------
Q8YQW0_NOSS1/118-249------------------------------------------
Q9PEZ7_XYLFA/74-202------------------------------------------
Q8DQQ1_STRR6/87-213------------------------------------------
Q7NMR7_GLOVI/149-279------------------------------------------
Q8XKL5_CLOPE/109-238------------------------------------------
Q9CGZ2_LACLA/85-226------------------------------------------
Q97KB0_CLOAB/144-267------------------------------------------
Q8DKC7_THEEB/90-221------------------------------------------
Q8EST6_OCEIH/190-320------------------------------------------
Q6LTW9_PHOPR/50-207------------------------------------------
C2X0S1_BACCE/79-219------------------------------------------
Q31ML7_SYNE7/94-224------------------------------------------
Q5M6D5_STRT2/106-240------------------------------------------
Q81L80_BACAN/110-237------------------------------------------
Q81QA6_BACAN/96-225------------------------------------------
Q81RH6_BACAN/99-227------------------------------------------
Q99YC5_STRP1/89-223------------------------------------------
T0U2B5_9ENTE/11-139------------------------------------------

PF13539

A8ASL5_BPA50/72-136------------------------------------------
B1QZK9_CLOBU/207-275------------------------------------------
Q3J4T3_RHOS4/201-266------------------------------------------
A1ATB8_PELPD/203-268------------------------------------------
N8ZX51_ACIBI/194-260------------------------------------------
D1PEW6_9BACT/147-232------------------------------------------
A9WTX9_RENSM/144-210------------------------------------------
A3TM69_9MICO/118-184------------------------------------------
A4SFK8_PROVI/119-180------------------------------------------
D4MUA4_9FIRM/428-503------------------------------------------
Q6LSS8_PHOPR/126-215------------------------------------------
C4L6K0_EXISA/116-185------------------------------------------
A0A018PY40_SALET/45-107------------------------------------------
A8EEH4_BURPE/142-232------------------------------------------
Q1QI98_NITHX/92-153------------------------------------------
C4SEH9_YERMO/33-102------------------------------------------
D5U8W6_BRAM5/259-337------------------------------------------
A6LVB0_CLOB8/192-260------------------------------------------
J7JIB9_BACIU/94-164------------------------------------------
C2N1K8_BACCE/54-120------------------------------------------
B7RRA8_9RHOB/214-277------------------------------------------
A0A034URH6_ERWAM/54-123------------------------------------------
B1IKM8_CLOBK/171-239------------------------------------------
B5U3R2_9CAUD/70-134------------------------------------------
A5UGL4_HAEIG/54-128------------------------------------------
A9G830_SORC5/143-223------------------------------------------
B3VGP8_9CAUD/82-143------------------------------------------
C7NA70_LEPBD/121-197------------------------------------------
E6VS38_DESAO/135-213------------------------------------------
B7VJV8_VIBSL/123-214------------------------------------------
C9MVB8_9FUSO/246-328------------------------------------------
D1CHT9_THET1/273-355------------------------------------------
Q5DN15_9CAUD/21-99------------------------------------------
B3VFY1_9CAUD/64-131------------------------------------------
A0RNH9_CAMFF/569-634------------------------------------------
A3UWI6_VIBSP/67-136------------------------------------------
Q8ESQ8_OCEIH/97-167------------------------------------------
A7XF57_9CAUD/52-120------------------------------------------
C6LLE4_9FIRM/274-349------------------------------------------
C4Z3D8_EUBE2/109-193------------------------------------------
B2U374_SHIB3/219-287------------------------------------------
E6VQR6_DESAO/135-213------------------------------------------
Q2SJV2_HAHCH/187-252------------------------------------------
B5UY55_BACCE/196-257------------------------------------------
B7GIP5_ANOFW/70-132------------------------------------------
B4AH26_BACPU/73-136------------------------------------------
B3VGG0_9CAUD/70-142------------------------------------------
Q1ZSD0_PHOAS/130-219------------------------------------------
C8XIK2_NAKMY/139-205------------------------------------------
D9SKR7_CLOC7/252-312------------------------------------------
C7R275_JONDD/65-131------------------------------------------
C3WMV9_9FUSO/63-140------------------------------------------
A8ATB8_9CAUD/56-121------------------------------------------
C6ANB6_AGGAN/178-255------------------------------------------
A6FEU3_9GAMM/129-218------------------------------------------
A7ILH7_XANP2/449-509------------------------------------------
Q854X2_9CAUD/66-133------------------------------------------
C9QJ38_VIBOR/123-214------------------------------------------
Q7D1F2_AGRT5/53-126------------------------------------------
Q2P050_XANOM/208-274------------------------------------------
A5MZT7_CLOK5/187-255------------------------------------------
B1YFG8_EXIS2/71-136------------------------------------------
I0WPH3_9NOCA/75-142------------------------------------------
C4SJV6_YERFR/38-106------------------------------------------
A6SU28_JANMA/93-182------------------------------------------
C6RGB5_9PROT/616-681------------------------------------------
B2S3I3_TREPS/209-287------------------------------------------
C4ZCU4_EUBR3/194-278------------------------------------------
Q7NS81_CHRVO/52-121------------------------------------------
D4J1D4_BUTFI/117-201------------------------------------------
A9DC71_9RHIZ/63-156------------------------------------------
B9KTY8_RHOSK/205-268------------------------------------------
A1UGG7_MYCSK/185-266------------------------------------------
A3ID77_9BACI/3-33------------------------------------------
A1SG61_NOCSJ/370-446------------------------------------------
A7HN00_FERNB/195-263------------------------------------------
B5EIM6_GEOBB/377-491------------------------------------------
A9WKC4_CHLAA/591-661------------------------------------------
C8KCM3_LISMN/56-121------------------------------------------
C8T4A1_KLEPR/54-122------------------------------------------
B2FJL7_STRMK/100-166------------------------------------------
C9S248_GEOSY/68-133------------------------------------------
A6TN75_ALKMQ/198-278------------------------------------------
D4E385_SEROD/163-231------------------------------------------
A3X9V1_9RHOB/202-265------------------------------------------
D1AMG7_SEBTE/126-206------------------------------------------
E8WNQ9_GEOS8/380-487------------------------------------------
D2AZ54_STRRD/158-239------------------------------------------
B1YI53_EXIS2/118-187------------------------------------------
C0D0F9_9CLOT/238-322------------------------------------------
C4K5R3_HAMD5/92-182------------------------------------------
Q0A7S9_ALKEH/202-267------------------------------------------
B2K031_YERPB/45-107------------------------------------------
D2PPJ5_KRIFD/298-379------------------------------------------
B4SDT7_PELPB/113-173------------------------------------------
Q2B7L2_9BACI/116-186------------------------------------------
D1ALL6_SEBTE/63-140------------------------------------------
B0MC55_9FIRM/144-230------------------------------------------
A7ZD12_CAMC1/602-665------------------------------------------
Q3STE6_NITWN/103-162------------------------------------------
A5ECX3_BRASB/184-253------------------------------------------
A9KN76_CLOPH/502-575------------------------------------------
A7FDS7_YERP3/58-127------------------------------------------
D1B2W5_SULD5/592-657------------------------------------------
C8X9H1_NAKMY/210-289------------------------------------------
A0NQA8_9RHOB/173-238------------------------------------------
B9NP89_9RHOB/203-268------------------------------------------
B0NZY2_9CLOT/146-232------------------------------------------
B1JRT0_YERPY/56-124------------------------------------------
Q5WK03_BACSK/108-178------------------------------------------
C9XQ42_PEPDC/189-268------------------------------------------
B3Q3Z4_RHIE6/222-285------------------------------------------
C4XNT5_DESMR/200-269------------------------------------------
A5UTX9_ROSS1/590-659------------------------------------------
D3EJK7_GEOS4/101-171------------------------------------------
D4BTB0_PRORE/43-105------------------------------------------
D3ADD3_9CLOT/85-148------------------------------------------
Q7VJM2_HELHP/173-242------------------------------------------
Q7MR54_WOLSU/185-254------------------------------------------
A9DET4_9CAUD/64-132------------------------------------------
C0CNE7_9FIRM/225-310------------------------------------------
C6LBK9_9FIRM/257-343------------------------------------------
B9JYE5_AGRVS/104-165------------------------------------------
D9QLQ3_BRESC/53-121------------------------------------------
B0VVC4_ACIBS/347-415------------------------------------------
C4K6W4_HAMD5/53-119------------------------------------------
B2UP36_AKKM8/129-194------------------------------------------
C4L144_EXISA/57-123------------------------------------------
F0KAF2_CLOAE/198-263------------------------------------------
G3M4A5_9CAUD/70-151------------------------------------------
Q5J5L5_9CAUD/70-137------------------------------------------
D0LWT6_HALO1/218-298------------------------------------------
A4G1C9_HERAR/140-229------------------------------------------
Q0FH91_PELBH/197-262------------------------------------------
D4CCJ4_9CLOT/58-129------------------------------------------
D0LQS8_HALO1/317-391------------------------------------------
B6V2R4_BPSP1/74-136------------------------------------------
A0A038HZ79_BORBO/53-127------------------------------------------
A9KQC6_CLOPH/237-321------------------------------------------
C6WMZ1_ACTMD/132-213------------------------------------------
A3K5D3_9RHOB/148-231------------------------------------------
A4FKJ2_SACEN/154-235------------------------------------------
Q5YZK4_NOCFA/71-135------------------------------------------
Q1DAC7_MYXXD/63-125------------------------------------------
D1BDT0_SANKS/65-131------------------------------------------
C7N3P8_SLAHD/215-297------------------------------------------
A6Q7D6_SULNB/126-212------------------------------------------
B6VNP6_PHOAA/57-126------------------------------------------
Q73V53_MYCPA/145-206------------------------------------------
D7VN70_9SPHI/69-137------------------------------------------
B5LJL3_9CAUD/69-133------------------------------------------
A8LRY3_DINSH/108-171------------------------------------------
C9MWB5_9FUSO/152-227------------------------------------------
D0LZM8_HALO1/111-191------------------------------------------
C9DBZ2_9CAUD/70-142------------------------------------------
D7VVF1_9FLAO/66-136------------------------------------------
Q2SDK8_HAHCH/53-121------------------------------------------
C7RR41_ACCPU/164-241------------------------------------------
A1SCY8_NOCSJ/370-428------------------------------------------
B6FXG7_9FIRM/394-474------------------------------------------
B6WQA8_9DELT/218-285------------------------------------------
A4T1K8_MYCGI/149-230------------------------------------------
Q7NR04_CHRVO/206-271------------------------------------------
D4CX41_9FUSO/55-123------------------------------------------
B8J0M5_DESDA/248-315------------------------------------------
A8EV90_ARCB4/175-243------------------------------------------
C6PUE1_9CLOT/429-508------------------------------------------
D9SMB1_CLOC7/196-264------------------------------------------
Q73JG3_TREDE/215-293------------------------------------------
B8ENP1_METSB/622-688------------------------------------------
C8Q0B7_9GAMM/78-152------------------------------------------
C0QJJ2_DESAH/140-230------------------------------------------
Q5DZ88_VIBF1/125-214------------------------------------------
C9MUL4_9FUSO/1065-1128------------------------------------------
C6D2R3_PAESJ/123-193------------------------------------------
D1PX89_9BACT/178-263------------------------------------------
C3XMD6_9HELI/163-232------------------------------------------
Q70K75_9ACTO/100-167------------------------------------------
C3K4K2_PSEFS/131-227------------------------------------------
Q2LPY2_SYNAS/102-181------------------------------------------
A8GLN1_SERP5/79-147------------------------------------------
C0AQZ5_9ENTR/54-123------------------------------------------
D1RF68_LEGLO/59-140------------------------------------------
C6BUG1_DESAD/184-249------------------------------------------
Q2LQQ3_SYNAS/55-131------------------------------------------
C7PFT3_CHIPD/191-256------------------------------------------
A8ATR6_9CAUD/73-134------------------------------------------
C0ZX75_RHOE4/85-149------------------------------------------
D0DDG3_9RHOB/197-267------------------------------------------
A6W8P6_KINRD/95-156------------------------------------------
A7HJ25_FERNB/74-137------------------------------------------
B4WAV9_9CAUL/53-121------------------------------------------
D2XRK5_9CAUD/70-137------------------------------------------
B5EHY6_GEOBB/165-227------------------------------------------
B1YH87_EXIS2/72-135------------------------------------------
A7ZFD8_CAMC1/46-110------------------------------------------
B8KYV5_9GAMM/51-117------------------------------------------
B2VDM6_ERWT9/41-110------------------------------------------
B9JF39_AGRRK/850-911------------------------------------------
E3I7F8_RHOVT/190-269------------------------------------------
A1K513_AZOSB/150-214------------------------------------------
B4V6Z2_9ACTO/133-214------------------------------------------
D0TJH0_9BACE/157-246------------------------------------------
Q0AVH5_SYNWW/269-331------------------------------------------
D3VE22_XENNA/59-122------------------------------------------
A8S209_CLOBW/64-127------------------------------------------
C6VVI7_DYAFD/85-145------------------------------------------
C4SXE4_YERIN/30-99------------------------------------------
A5FFV9_FLAJ1/170-242------------------------------------------
B2Q011_PROST/55-124------------------------------------------
Q98H40_RHILO/198-268------------------------------------------
D1AEC5_THECD/163-244------------------------------------------
D4DZ54_SEROD/54-122------------------------------------------
M1GCS0_LAWIN/228-297------------------------------------------

PF01427

VANX_ENTFA/1-202-------------------------------YPDTYFNFAVS
DDPX_SYNY3/31-240-------------------------------YNQRHPDHQKI
DDPX_ECOLI/3-187-------------------------------LADQFSCFISP
O53850_MYCTU/62-256-------------------------------VDRPILEVPVD

PF03411

Q7VLX1_HAEDU/37-271.KVIP..........................MVPVQCQMILS
G7Z2K9_AZOL4/79-317YKPEPRVVR......................KMPAACAPVLN
F2J3L2_POLGS/44-296.KPKDPNDKEPV......VKKRP..LALA..ALPKACEQVL.
A8LNH7_DINSH/41-294.TVKPAKPAPKR........PNARDFVLA..DLPQQCQTVLA
F8JE38_HYPSM/186-434.PPAPRPPGPPR......APSPP..IMLS..DLPKECQAVLA
D7A2C9_STAND/53-295.PPK.....EPP......KPKPP..MMLK..DLPAACREVV.
G0A1D7_METMM/39-279GKPTPPP........................PLPALCEQVLN
B7VJP4_VIBSL/34-277AKSKKKKRVN.....................VMPSQCLALIS
Q7MNJ8_VIBVY/38-271PE.............................PISEACVTVLN
D4ZCJ1_SHEVD/37-278VEKPHAKSTK.....................VKPRQCAQL..
Q89BJ0_BRADU/67-311.PPP.....EPP......KPKPP..MTLA..QMPAACKVVLH
V4IED8_9GAMM/46-281.SARPKARR......................QPPAACQTLLQ
A0KJ73_AERHH/30-258.YHKP..........................RLPARC.....
G8AJW0_AZOBR/59-295.KPQPRYV.......................SMPPACTPVLR
A3N0A9_ACTP2/37-271.KVLP..........................TPPVQCQMILS
E3F225_KETVY/53-297.PPRPRDPNAPP.........PRGPLRVN..ELPAQCSLVLA
W6R6D9_9RHIZ/59-306.KPPKPGTKPAK.......PRE...VMVS..DLPNACSSVLA
Q6LU97_PHOPR/36-276.KKETKPKKKLK...................IPPPQCLALI.
W0DWJ2_MARPU/43-274RRVAEP.........................TPPAACARLLN
M9RED3_9RHOB/64-306.PPTPVDPNATP.......RAPRGPLTMA..RLPVQCLA...
D8MV06_ERWBE/36-270.REPP..........................PLPPSCQALLD
C5BAF1_EDWI9/36-270.QTPP..........................PLPPTCQALLA
C3MBY2_RHISN/55-301.KK.KPGEKPPK.......PKF...ATLA..DLPKACAVVLN
Q98DM3_RHILO/86-328........KNPD......APKARDLMTMA..NLPKECRAVLD
E3I638_RHOVT/169-418.APKPAVASAPA......KPKAG..ITMA..QLPPACVAVLN
Q11CB0_CHESB/47-289........TGPQ......EPKARDVMTMS..ALPAACRVVLA
C5AYD5_METEA/65-307.KPK.....TPP......KPRPP..MTLA..GLPDACRAVLH
B2IE79_BEII9/75-315.PPR......PY......KPKPP..LTLA..QLPAECALVL.
B9J6R8_AGRRK/59-304....KPSTKPPV......KPRE...VMVS..DLPKACQAVLD
MEPA_PECAS/41-275.TTPP..........................PLPPSCQALLD
Q65U86_MANSM/44-278.KTLP..........................PEPFLCQQVLN
N0B7W2_9RHIZ/170-420.KPSPPVAKPPS..ISVRPPRPP..IMLA..DLPPECRALLA
Q28VK1_JANSC/50-297.PPGPPNNDPPV.......ASPPRGMRVALGDMPNQCVGVLS
B9JYQ7_AGRVS/40-286.KR.DPNAKPPP......PPRP...LMVS..DLPKACAAVLD
D5ASU0_RHOCB/43-298.PPKRQKPSGPA.......PKNAKTYVMS..DLPAQCQNVLS
W0HVY1_9ENTR/36-270.KTPP..........................PLPAACQALLD
B8F448_HAEPS/37-270.KTIP..........................QPPQLCQMILS
Q87S60_VIBPA/36-276.KVAAKPKKKK....................AIPPQCQPLI.
B8IRL8_METNO/82-322.PGG..............KPRPP..LTMA..QLPVECRRVLA
R5EP69_9GAMM/31-270GKPQVKKKR......................VMPAQCRALFA
L0GX36_9GAMM/44-279.KPQPPA........................PMPAACHKVLE
Q3IY41_RHOS4/40-292.KSPPKKPSGPR.......PKGARDYTLS..DLPAQCREVLA
A4YL76_BRASO/65-307.PPK.....EPP......KPPQP..ITMA..QLPPACRAVLH
B8EQJ0_METSB/63-305.PGP......PT......RPKPP..LTMA..QLPAECRMVLN
D3RNE7_ALLVD/49-287.SKGKTTRAAEP...................EMPFACRAVLT
H2FVL9_OCESG/23-250.QPWRP.........................VLPAACRVLLA
H8GG79_METAL/41-278.QPPPKAP.......................VLPARCDQVL.
S5Y7V8_PARAH/48-289.KPVPPDPN..........YRHPRTYRLS..EMPEQCQAI..
Q1GD71_RUEST/59-305.PPKPVDPNAPK.......PKPRRDYTLS..DLPQQCAAVLS
I7DUV0_PHAIB/60-305.PPKPRDPNAPR.......PKPRREHTLS..DLPQQCAAVLQ
E3HYM4_RHOVT/58-304.PPKPPKPQP........KPKP...MLVT..DLPGECQALLD
M4RIZ0_BIBTR/37-269.KTLP..........................QPPAQCQMLLS
Q3SVT3_NITWN/101-344.PPK.....TPP......KPKPP..ITLS..QLPTACRQVLA
H2INY8_RAHAC/45-279.KEPP..........................PLPPSCQALLD
V6F1Q6_9PROT/42-277.KPNTRRP.......................NLPSLCSQVLD
A8HVK9_AZOC5/49-304.PSP.....TPQ......KPKPP..LTLA..DLPAACTAVLD
B6JJU0_OLICO/62-305.PPK.....VPP......KPKPP..LTLA..DLPAACRTVLT
Q5LWS6_RUEPO/46-291.PPKPRDPNAPP.......PKKRREYVLA..DLPKQCASVLR
I2B718_SHIBC/36-270.KSPP..........................PLPPSCQALLD
B0UWQ5_HISS2/37-270.KVVP..........................EAPFLCQQLIS
F4HED5_GALAU/40-271.KKPP..........................QLPFLCQQLLD
Q16D60_ROSDO/64-307.PP...DPNAKP.......RKPRPPVRLA..DLPAQCADVLQ
A7IJY5_XANP2/64-307.PEK.....EPA......KPKPP..LTLA..DLPEACAAVLG
G4SVA0_META2/57-295.AAPAKAP.......................ELPALCEAVLN
MEPA_ECOLI/36-270.KTPP..........................PLPPSCQALLD
G8PRI5_PSEUV/75-327.KPKPGEKPKPR......KPKPP..LSVA..DLPNSCMTVL.
Q607R5_METCA/38-277HGPAPSP........................ALPRVCRAVLN
V5SD71_9RHIZ/87-338.APPAQAKKPPAKPAPPRLPKPE..MTLA..DLPDECST...
G8AJ70_AZOBR/59-293.KAIP..........................EPPAACLEVLA
A8GH81_SERP5/36-269.PVPP..........................PLPPTCQALLN
B8IJD0_METNO/63-305.PGPAG............KPKPP..MTMA..ALPEACRAVLK
D0LL99_HALO1/58-299.GRYRKNVRGLP...................ELPAACAPLLD
J7QQ34_METSZ/72-310.KSG..............KSWPP..MTMA..GLPAACREVLR
B8CUQ4_SHEPW/47-288KAADKAIKKKSK...................AKPKQCAQLLS
Q2KDT7_RHIEC/59-307.KPPKTSAKPPK......PPRE...MMVS..DLPKACAAVLD
Q2W4C2_MAGSA/42-276HHQSR..........................PLPEACAGL..
MEPA_HAEIN/43-277.KVTP..........................PEPFLCQQILN
F7QGC0_9BRAD/50-294.PPT.....KPP......KPKPP..LTMA..NLPAECRQVLQ
A1B5F2_PARDP/45-284.KPVPPDPN..........YRHPRSFRLS..EMPRQCQ....
I3YA59_THIV6/50-288.KPGQGSGAP.....................VPPASCRAILN
A9CKL5_AGRT5/53-298.KK.DPNAKPVK.......PRQ...VMVS..DLPAACAAVAA
Q0BS55_GRABC/32-265.PPE...........................APPAACRPILA
B1M521_METRJ/66-304.PPK.....TPP......KPKPA..MTMA..ALPAACRAVLK
Q2YJP1_BRUA2/82-325....KPSGKPAK......KPKP...VMVS..DLPKACAAVLN
Q6NCT0_RHOPA/69-313.PPL.....KPP......PPRHQ..LTLS..ELPAECRTVLN
C4LE77_TOLAT/27-261.NRMP..........................DLPDRCEILLS

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window