Sequence alignment for CL0173

PF01582

B9N1N5_POPTR/14-194--KYDVFL.......SFR---GEDTRVC-FVS--------HL---YAA---L.....KR----K----QI---S---TF-
B9S6Z7_RICCO/19-198--KYDVFI.......SFR---GKDTRDS-FTN--------YL---YKD---L.....YQ----K----GI---E---TF-
B9S9D9_RICCO/12-191--KYDVFL.......SFR---GLDTRNG-FVS--------HL---FKA---L.....SE----K----QI---I---TF-
B9SBW2_RICCO/15-195--KYDVFV.......SFR---GEDTRDN-FTS--------HL---YAA---L.....HQ----K----QI---K---AF-
D7KR54_ARALL/8-188--KYDVFL.......SFR---GLDTRRN-FIS--------FL---YKE---L.....VR----R----NI---R---TF-
D7MRD9_ARALL/8-185--DYDVFP.......SFR---GADVRKT-FLS--------HF---LKE---L.....DL----K----SI---K---PF-
D7UDZ7_VITVI/24-202--KYDVFL.......SFR---GEDTRNN-FTA--------HL---YHA---L.....CQ----K----GI---Y---TF-
F4IFF6_ARATH/55-233--KHDVFP.......SFH---GADVRKS-FLS--------HI---LKE---F.....KR----K----GI---D---TF-
F6I7C7_VITVI/9-189--KYDVFL.......SFR---GEDTRNN-FTA--------HL---YDA---L.....HC----K----GI---N---AF-
I1KE95_SOYBN/20-200--EYDVFV.......SFR---GEDTRNS-FTA--------FL---FEA---L.....KK----Q----GI---E---AF-
I1MD01_SOYBN/13-191--KYDVFI.......SFR---GTDVRCG-FLS--------HL---KKE---L.....RQ----K----QV---D---AF-
TLR4_HUMAN/676-839--AFVIYS..........---.SQDEDW-VRN--------EL---VKN---L...EEGV----P----PF---Q---LC-
TLR5_HUMAN/695-858--AYLCFS..........---.SKDFTW-VQN--------AL---LKH---LDTQYSDQ----N----RF---N---LC-
I18RA_HUMAN/410-598--AFVSYAKWSSFPSEAT---SSLSEEH-LAL--------SL---FPD---V...LENK----Y----GY---S---LC-
ILRL1_MOUSE/384-567--AYIIYPRV..FRGSAA---GTHSVEY-FVH--------HT---LPD---V...LENK----C----GY---K---LC-
IL18R_HUMAN/377-541--AFVSYLK.....ECRP---ENGEEHT-FAV--------EI---LPR---V...LEKH----F----GY---K---LC-
ILRL2_HUMAN/385-575--AYVLYPK....PHKES---QRHAVDA-LVL--------NI---LPE---V...LERQ----C----GY---K---LF-
IL1AP_HUMAN/407-570--IYVSYA..........---RNAEEEE-FVL--------LT---LRG---V...LENE----F----GY---K---LC-
I18RA_MOUSE/409-597--AFVSYSNWSSPETDAV---GSLSEEH-LAL--------NL---FPE---V...LEDT----Y----GY---R---LC-
Q9ZVX6_ARATH/11-188--NYRVFA.......SFH---GPDVRKS-FLS--------HF---RKQ---F.....IC----N----GI---T---MF-
F4J361_ARATH/93-270--KHHVFP.......SFH---GADVRKT-ILS--------HI---LES---F.....RR----K----GI---D---PF-
M4E4G7_BRARP/12-187--KYDVFL.......SFR---GEDVRKG-FLS--------HV---RKG---L.....ER----K----GI---I---AF-
Q9SSN5_ARATH/8-185--KYDVFL.......SFR---GHDTRQN-FIS--------FL---YKE---L.....VR----R----SI---R---TF-
RPS4C_ARATH/16-186--.HQVFI.......NFR---GADLRRR-FVS--------HL---VTA---L.....KL----N----NI---N---VF-

PF13676

Q47BW0_DECAR/4-104--IFLSYT-------..E...K.D..RE.QAR--------RV...AAM...L......E....S..G.GW...T...VW.
C3Y619_BRAFL/689-797--IFISYQ-------..W...D.I..QD.QVK--------LI...KEH...L......Q....M..A.GY...E...SW.
C3Y619_BRAFL/881-989--VFLSYQ-------..W...G.H..QP.QVK--------AL...YSQ...L......T....S..R.GF...T...CW.
E3I8M0_RHOVT/4-107--VFIAYA-------..R...P.E..RP.IAE--------AL...AKI...I......N....D..R.GH...S...TW.
C3ZXI7_BRAFL/383-491--VYLVYD-------..P...A.D..VR.LAQ--------NM...KAD...L......L....K..K.NI...Q...VD.
A7S5P1_NEMVE/555-656--VMLSYQ-------..W...G.Y..QD.VVL--------KV...RDE...L......R....A..A.GY...K...VW.
A7S5P1_NEMVE/1014-1115--IMISYQ-------..W...D.N..QK.AML--------AV...NKR...L......K....E..A.GH...K...VW.
A8L2Q4_FRASN/29-136--FFISYT-------..Q...A.D..RQ.WAE--------WV...AWQ...L......E....Q..V.GW...R...VL.
E3JD12_FRASU/19-126--FFVSYT-------..G...V.D..QP.WAE--------WI...AWQ...L......E....D..A.GY...R...VL.
E3IW96_FRASU/15-122--FFVSYT-------..G...K.D..RA.WAE--------WL...AWQ...L......E....D..A.GH...S...VL.
Q0REH0_FRAAA/6-113--FFLSYA-------..A...E.D..RL.WAE--------WL...AWQ...L......E....S..A.HY...R...VL.
A1BEX3_CHLPD/90-190--IFISYA-------..R...E.D..MK.RVE--------PI...VRE...L......E....K..H.GW...S...VF.
E3J785_FRASU/17-124--FFISYT-------..G...A.D..LA.WAE--------WV...AWH...L......E....D..A.GY...R...VL.
Q2JBL6_FRASC/19-126--FFVSYT-------..A...V.D..RE.WAE--------WI...SWQ...L......E....A..D.GY...R...VL.
Q0RGM6_FRAAA/6-113--FFVSYT-------..A...A.D..RG.WAE--------WI...AWH...L......E....V..A.GY...T...VL.
C6XNE0_HIRBI/4-104--IFISYK-------..K...E.D..AG.RVV--------RI...VEG...L......R....E..A.GF...S...VW.
Q0RIN9_FRAAA/22-129--FFVSYT-------..H...A.D..AK.WAE--------WI...AWQ...L......E....A..A.GY...R...VK.
E3J7J7_FRASU/27-134--FFVSYT-------..G...R.D..QA.WAE--------WV...AWQ...L......E....T..A.GY...R...VL.
Q0RPX4_FRAAA/13-120--FFISYT-------..A...V.D..SP.WAE--------WL...AWQ...L......E....S..A.DY...R...VL.
A8L235_FRASN/21-128--FFVSYT-------..Q...P.D..RA.WAE--------WI...AWT...L......E....E..A.GW...R...VL.
Q82CN6_STRAW/36-142--VFLSYA-------..A...A.D..AV.WAT--------KL...AEH...L......A....G..H.GL...S...VF.
Q0RPX3_FRAAA/13-120--FFISYT-------..K...A.D..QR.WAE--------WV...AWQ...L......E....A..A.DY...R...VL.
Q21Z38_RHOFT/11-111--VFVSYA-------..R...E.D..RP.LAE--------QL...AQA...L......S....A..S.GL...Q...VW.
Q0RFT3_FRAAA/25-132--FFISYT-------..A...R.D..RA.WAE--------WI...AWQ...L......E....A..A.GF...R...VL.
E3IX94_FRASU/15-122--FFISYG-------..P...S.D..QA.WAE--------WV...AWQ...L......E....A..A.DY...R...VL.
B3S2N0_TRIAD/460-568--VYIIYD-------..P...M.D..KK.VVR--------SL...VED...L......S....K..K.HY...Q...IL.
A8LGL3_FRASN/20-127--FFVSYA-------..T...A.D..EA.WAE--------WI...AWN...L......E....E..A.GY...S...TR.
E3IX60_FRASU/26-133--FFVSYA-------..H...G.D..EA.WAE--------WI...SWQ...L......E....E..A.GY...R...VV.
B4SC53_PELPB/96-199--IFISYA-------..Q...E.D..RQ.RVE--------PI...VQE...L......E....K..L.GW...C...IF.
Q0RTF6_FRAAA/29-136--FFVSYT-------..G...V.D..QG.WAE--------WV...AWQ...L......E....A..A.GY...T...VR.
Q0RIT4_FRAAA/69-176--FFVSYH-------..A...S.D..RT.WAE--------WV...AWQ...L......E....D..A.GY...R...VL.
A8KXQ9_FRASN/9-116--FFVSYA-------..A...D.D..VE.WAE--------WI...AWH...L......E....A..A.GY...R...VL.
E3J7Y1_FRASU/19-126--FFVSYV-------..Q...S.D..RA.WAE--------WA...AWQ...L......E....D..V.GY...A...VL.
D2SAJ1_GEOOG/13-119--FFISHA-------..G...R.D..TG.WAE--------WL...AWQ...L......Q....Q..A.GY...T...VE.
A8L102_FRASN/20-127--FFVSYT-------..G...V.D..EA.WAE--------WI...AWV...L......E....E..A.GY...T...TR.
Q028E9_SOLUE/5-105--IFVSYA-------..R...Q.D..RE.EVA--------KL...VAF...L......Q....A..Q.GW...T...VW.
A7ST59_NEMVE/24-124--VAISFH-------..S...R.N..YE.KAK--------EL...GEL...L......R....D..N.GY...T...AF.
A7ST59_NEMVE/413-519--IMLSYN-------..W...G.I..QS.FVR--------EV...YME...L......S....Q..Q.TF...Q...TW.
Q2JEN2_FRASC/35-142--FFVSYT-------..G...A.D..QG.WAE--------WI...AWV...L......E....D..A.GY...R...VR.
A7HHI0_ANADF/4-104--VAILYS-------..R...E.D..RD.TVE--------LL...DRA...L......S....A..R.GW...S...VW.
D2B0U4_STRRD/14-121--FFVTYN-------..G...K.D..EP.WAT--------WI...AAT...L......E....T..A.GY...T...TT.
E3JD26_FRASU/17-124--FFISYS-------..P...A.D..QL.WAE--------WI...AWQ...L......E....D..V.GH...R...VA.
A8DUR5_NEMVE/387-495--VYIIYD-------..P...T.D..AR.FSN--------NL...KED...I......K....R..K.CP...K...VA.
C3Z670_BRAFL/206-314--VFLSYQ-------..W...D.H..QK.QVI--------QL...HDM...L......E....E..M.GH...S...CW.
A8L472_FRASN/36-137--FFVSYT-------..G...A.D..EA.WAT--------WV...AEV...L......E....A..A.GR...T...VA.
O86768_STRCO/8-114--FFISYA-------..G...T.D..RA.WAE--------WV...GWH...L......E....Q..A.GH...R...VI.
C3YB32_BRAFL/1078-1172--VVISFA-------..T...K.D..LR.RVQ--------NI...ATE...L......T....S..K.GY...V...VT.
Q2W1R2_MAGSA/34-139--FFISYT-------..Y...T.D..LE.WAR--------WV...DFV...L......R....E..A.GY...D...TV.
E3IUH8_FRASU/87-194--FFVSYA-------..P...V.D..EA.WAE--------WI...AWQ...L......E....R..D.QH...R...VL.
E3JB70_FRASU/15-122--IFLSVA-------..G...P.D..ER.WGS--------WL...DHV...L......R....D..A.GY...E...VD.
D9SFF3_GALCS/4-108--VFISHS-------..Q...V.D..LP.LAE--------FL...HRH...L......T....Q..E.GL...E...VY.
C6XQ37_HIRBI/5-107--IFLSYR-------..R...V.D..QE.LAR--------AL...VTA...L......E....A..R.GV...G...VW.
Q3SW17_NITWN/99-207--VFLSYT-------..S...D.D..AA.LAE--------RI...ATA...L......Q....A..N.GI...D...TW.
C4ZIJ8_THASP/6-119--LFYSYA-------..H...E.D..EK.LRD--------EL...DGH...LA...LLR....R..K.GV..IR...PW.
C7RV87_ACCPU/4-106--IFLSYS-------..T...K.D..HY.FAE--------LA...SIK...L......A....E..S.GI...M...LW.
B6JHA2_OLICO/99-207--AFLSYA-------..R...E.D..RQ.LAE--------QV...AAA...L......Q....A..N.GI...D...TW.
D2B0U5_STRRD/10-115--FFVSHA-------..D...A.D..AQ.WAE--------WI...AAE...L......K....G..A.GY...G...VI.
C7RQ25_ACCPU/133-235--VFISYS-------..R...S.D..RQ.IAD--------RL...FAD...L......Q....Q..A.GH...A...CW.
Q2J5A8_FRASC/18-127--FFVSYA-------..G...V.D..QA.WAE--------WI...ADT...L......E....R..A.GR...R...VL.
Q2NDU5_ERYLH/20-120--AFVSYS-------..R...E.D..RP.AAL--------KV...IEA...L......K....A..A.GI...A...VW.
A8L863_FRASN/19-126--FFVSYA-------..A...A.D..QE.WAE--------WI...GWQ...L......E....A..A.GY...R...IR.
Q2JGC9_FRASC/4-109--VFVSHA-------..G...S.D..AE.LAD--------RV...HQT...L......T....L..L.GH...R...VF.
Q9L0M8_STRCO/8-114--IFLSYA-------..G...P.D..QA.WAE--------WV...GWQ...L......Q....Q..A.GH...Q...VE.
Q0RFV3_FRAAA/13-120--FLVSYV-------..V...D.D..AE.WAE--------WV...AWT...L......E....S..A.GH...R...AL.
B3QZ81_CHLT3/7-115--FFISYT-------..G...A.D..EQ.IAS--------WI...AYV...L......E....E..A.HF...G...VI.
Q0RPP6_FRAAA/10-118--IFVSNL-------..P...Q.D..NE.WAA--------WI...AWQ...L......E....D.IA.GY...S...VL.
Q8CJY8_STRCO/19-125--VFVSYA-------..G...P.D..RA.WAE--------WA...AWH...L......R....E..V.GH...A...VE.
C3ZQ01_BRAFL/737-845--VFLSYQ-------..W...D.H..QD.KVL--------LL...HDR...L......Q....E..R.GY...S...CW.
Q0RIR9_FRAAA/18-121--FFVSYV-------..R...E.N..EA.WAE--------WI...AWQ...L......R....E..A.GW...Q...VD.
B0CFH1_ACAM1/694-807--LFYSYS-------..H...K.D..EG.IRD--------QL...ETH...LK...VLQ....R..R.GL..IQ...NW.
E3J0G5_FRASU/353-460--FLISAA-------..P...D.D..DG.WGG--------WI...AWY...L......K....G..E.GY...T...VR.
D3B3K4_POLPA/805-907--VFLSYA-------..H...K.D..IG.FVR--------EL...RIA...M......E....Q..Y.SI...R...CW.
Q0RRH7_FRAAA/33-134--VFVSHV-------..S...D.D..AP.WAT--------WV...AAV...L......E....Q..R.GL...S...AR.
E3J6F2_FRASU/4-111--VFVSHR-------..G...V.D..AV.PAE--------RL...ARD...L......Q....A..A.GH...E...VW.
A9FJE9_SORC5/5-116--VFISYA-------..P...A.D..RS.HLE--------AL...EAH...LA...SLK....R..Q.GL..VS...TW.
A8LGX9_FRASN/19-119--LFISYA-------..H...A.D..AM.YVE--------RL...ARC...L......D....G..F.GL...P...VW.
B3S8Y4_TRIAD/187-291--ILISYV-------..R...A.E..AALHAL--------SL...KEE...F......E....K..L.GF...S...VY.
B3E9D8_GEOLS/5-116--VFISYA-------..K...E.D..RE.SAE--------HY...YEL...L......A....K..E.GV...S...PW.
C3YRI2_BRAFL/372-473--VMLSYQ-------..W...D.N..QE.LVK--------KI...KTM...L......E....A..S.GY...N...VW.
D2QTN1_SPILD/23-136--IFYSYS-------..H...R.D..EE.LRE--------RFEVHMAG...L......K....R..K.GL..IE...EW.
A9VAD9_MONBE/378-481--IMISYN-------..W...R.H..QP.LAL--------KL...AQT...L......Q....A..H.RF...R...VW.
C3YBW8_BRAFL/463-564--IMISYQ-------..W...D.H..QK.TLV--------KV...KDR...L......Q....S..Y.GY...R...VW.
B2IVL0_NOSP7/8-109--VCLLYS-------..E...S.D..KA.IAS--------LL...EDA...L......N....Y..Y.SI...D...VW.
Q0RIX3_FRAAA/21-122--LFLSYA-------..G...P.D..EN.WVT--------WI...SDI...L......E....S..A.GR...T...VR.
E3I8Q6_RHOVT/4-115--VFISHS-------..S...R.D..NA.QAI--------AL...RDF...L......V....A..E.GW..SD...LF.
Q01GF4_OSTTA/482-587--VMLSYE-------..W...H.H..QA.QVM--------QL...KEQ...L......N....A..R.GF...N...VW.
Q8YVL7_NOSS1/8-109--VCLLYS-------..E...S.N..QA.TAN--------LL...KDA...L......N....Y..Y.SI...D...IW.
A8WVG1_CAEBR/367-484--VFISYR-------..R...S.T.GNQ.LAS--------LI...KVL...L......Q....L..R.GY...R...VF.
A9GSK2_SORC5/1147-1260--LFFSYS-------..H...K.D..EA.FRD--------EL...ETHFALL......E....R..E.GL..LQ...SW.
D1A5Y5_THECD/4-128--VFINYR-------..T...G.D..GD.EAA--------AL...LEQ...A......L....S..H.RFGDDR...IF.
A9GWR7_SORC5/353-464--VFFSYS-------..E...S.N..RE.LRD--------KL...ETH...LA...ILK....R..K.GV..IR...GW.
E3I131_RHOVT/20-126--FFISRS-------..G...A.D..AA.IAE--------RI...AHI...L......E....D..A.GY...Q...VI.
Q488J9_COLP3/4-122--VFISYS-------..S...S.D..RP.AVK--------LL...KEA...L......E....Q..L.SY...D...VW.
C4ZM27_THASP/14-137--VFISYR-------..R...D.D..SAGFAG--------RL...ADA...L......E....R..RFGA..DS...VF.
D2SB43_GEOOG/12-118--CFVSYT-------..L...A.D..RA.WGE--------WL...AWQ...L......R....E..A.GY...T...VF.
Q0RSZ9_FRAAA/6-111--VFVSHA-------..S...S.D..VE.LAD--------RI...YRT...L......A....D..L.GH...R...AF.
D2SB14_GEOOG/4-110--LFISHS-------..N...Q.D..RV.STE--------RV...GSW...L......Q....R..A.GF..TT...VF.
B0C5U4_ACAM1/223-330--IFISYK-------..RDAVP.D..EQ.LAL--------AI...YQH...L...........G..Q.SH...E...VF.
B4HIY9_DROSE/842-958--VFVSYR-------..R...S.N.GSQ.LAS--------LL...KVH...L......Q....L..R.GF...S...VF.
A7SAI7_NEMVE/4-114--VMLSYQ-------..W...D.I..QD.LVK--------KV...YDG...L......R....A..Y.GI...R...VW.
B1ZSG7_OPITP/145-246--VFLSHK-------..S...V.V..KR.QTA--------AL...KER...L......S....L..Y.GI...S...AF.
C1EBU5_MICSR/479-580--VMLSYE-------..W...H.S..QA.QAK--------AL...RDE...L......V....E..E.GF...T...VW.
C3ZH48_BRAFL/391-492--VMISYQ-------..W...D.V..QP.KML--------VV...KER...L......T....Q..A.GY...R...VW.
Q099H8_STIAD/11-117--VFLNHN-------..S...Q.D..KP.LVE--------KL...AHR...L......L....E..Q.GI...R...PW.
C1N563_MICPC/155-256--VMLSYE-------..W...R.T..QQ.RAL--------AL...RDE...L......M....A..R.GF...T...VW.
A8KZ03_FRASN/14-119--YYISYT-------..A...P.D..EA.WAE--------WV...AWL...L......D....A..S.GY...R...VT.
C3YRI0_BRAFL/374-476--VMLSYQ-------..W...D.N..QE.VVK--------KI...KAA...L......E....A..A.GY...K...VW.
Q08W08_STIAD/272-383--LFFSYT-------..H...A.D..TP.HRI--------AL...ERH...LFP..LIR....S..G.RI...K...LS.
B5GMC1_STRC2/51-156--VFISYT-------..E...A.D..AE.VAE--------TL...ASR...L......R....A..E.QL...R...VF.
A9GWR0_SORC5/11-122--VFFSYS-------..P...R.D..ED.LRP--------KI...ETH...LD...ALK....R..Q.GV..IR...NY.
C3ZI71_BRAFL/547-647--IMISYS-------..W...A.Q..QE.VII--------KV...KEH...L......N....K..V.GY...R...VW.
B2IT96_NOSP7/9-118--IFLCHN-------..S...K.D..KP.EVI--------EI...AHE...L......T....R..Q.GI...K...PW.
B9M1H6_GEODF/3-109--VFLSHA-------..S...S.E..KK.MAK--------TL...RRK...L......E....V..A.GH...E...VS.
A1W966_ACISJ/133-236--VFVSYR-------..R..GE.A..RE.AAL--------QL...FDA...L......S....A..R.LF...D...VF.
A8ZZH8_DESOH/82-183--VFLSHK-------..S...E.V..KK.ETA--------GL...KDK...L......K....L..Y.GI...S...CF.
D5SSN8_PLAL2/117-218--LFVSHL-------..S...S.N..KT.RMS--------AL...KAG...L......A....T..W.GI...S...AF.
A8L7D9_FRASN/338-442--MVVSHA-------..S...T.D..RP.WAE--------WV...AAE...L......E....A..A.GF...Q...VI.
B9M1I3_GEODF/4-102--IYIVYA-------..K...E.N..KK.IAI--------ML...FEL...L...........S..Q.QW...D...VW.
B7KBK1_CYAP7/4-116--IFISHS-------..H...S.D..KE.IAE--------RL...VDF...LLSALEIE....E..K.DL...L...CTS
C3XYH4_BRAFL/100-210--VFIIHA-------..G...E.D..KESFVR--------PL...VAT...L......Q....Q..E.GLAEKD...VF.
Q10WW3_TRIEI/118-233--IFISYN-------..R...Q.DPDQE.LAR--------QF...ETA...L......A....A..A.GH...Q...VF.
A8IF66_CHLRE/788-889--IMVSYE-------..W...G.S..QQ.KAL--------LI...KEA...L......E....R..R.GL...V...TW.
Q0C4A7_HYPNA/4-101--VYISHS-------..G...K.D..PD.ALL--------AL...HEA...L......R....A..A.SV...T...VF.
Q7NE51_GLOVI/173-287--CFISHI-------..S...R.D..QA.FVD--------RL...SRD...L......Q....T..M.GV...R...CW.
B1W250_STRGG/340-445--LFLSYV-------..A...E.N..RM.WAD--------WL...ESI...L......T....R..A.GF...R...V..
Q0RNC1_FRAAA/414-526--VVVSYV-------..G...A.D..QQ.WAD--------WL...EQL...L......R....R..G.CH...E...VQ.
Q8TM16_METAC/5-107--VYISHC-------..E...Q.D..EP.LAQ--------EL...ARA...LW...TVE....L..E.SF...S...AL.
B1ZQ16_OPITP/12-113--VFVSYS-------..V...H.D..TS.LVD--------TI...NGH...L......L....P..H.AR...A...LF.
E3J6T1_FRASU/274-377--FFISAV-------..R...A.E..SN.WAE--------WI...ASL...L......T....D..E.GY...R...VY.
Q0RUF2_FRAAA/4-111--VFISHR-------..A...A.D..IA.SAE--------RL...GRA...V......N....A..V.GH...A...VH.
B2J3V1_NOSP7/6-112--VFLAYN-------..S...L.D..KP.EVQ--------DI...AAA...L......R....R..R.NL...E...PW.
Q47DY5_DECAR/7-118--VALSFA-------..G...E.E..RV.YVD--------AV...AKA...L......Q....A..E.GI...D...VF.
C3YU72_BRAFL/10-119--VFICHA-------..G...E.S..KP.FVR--------QL...VDR...L......K....T..D.GLEEDQ...IF.
C9YT07_STRSW/352-458--VYVSFV-------..P...Q.D..RS.WAH--------WA...GAV...L......E....Q..A.GF...K...VH.
Q7MX37_PORGI/356-463--IAISFA-------..G...E.K..RE.LAE--------EI...ADQ...L......Q....R..S.DY...E...VF.
Q1QLK5_NITHX/3-113--IFLGYP-------..S...E.R..LS.DAR--------AI...WDF...L......T....N..L.GL...T...VW.
A4G5B3_HERAR/134-239--IFISYR-------..R..IG.S..QP.LAD--------LL...YEE...L......D....K..R.GF...D...VF.
A9GS07_SORC5/7-118--LFISSV-------..A...E.D..AA.SRA--------EL...EAH...L......KPLARQ..R.LI...E...VW.
Q2JGW8_FRASC/4-114--VFISHR-------..A...A.D..IA.PAE--------RL...GRA...I......G....A..A.GH...A...VH.
A0B6K5_METTP/5-107--IYVSHC-------..H...S.D..AD.LAG--------DL...CTA...L......Y....R..I.CI...E...SL.
A8WVG6_CAEBR/253-355--VYISYR-------..N..SP.G..AE.LAS--------LI...KLY...L......E....K..Y.GY...R...VR.
A8L8G2_FRASN/4-112--IFVSFH-------..A...A.E.GGA.LAD--------RV...VRA...L......E....A..A.GY...T...DY.
B4SA08_PELPB/9-120--VLLSFA-------..G...K.E..RH.FAR--------AI...HDI...A......S....A..N.GL...R...VF.
C7PX42_CATAD/13-123--ALVVHC-------..D...A.D..ET.WVS--------WI...DEA...L......A....D..Q.GF...Q...TH.
Q479U9_DECAR/327-433--FALSFA-------..G...S.D..RD.IAE--------AI...FNC...L......S....E..N.EL...E...VF.
Q0C0W9_HYPNA/5-105--VFLVSA-------..V...A.D..RD.IAK--------LV...VRR...L......R....S..L.KF...R...VA.
B7KMX7_CYAP7/356-465--FALSFA-------..G...P.E..RD.IAE--------AI...ANK...L......S....D..A.EI...A...VF.
C6XN50_HIRBI/11-116--VYICCA-------..Q...A.D..LS.FAN--------EL...LTG...L......T....T..C.GF...E...VI.
Q82BJ3_STRAW/346-445--VVVAYA-------..A...E.N..RM.WAD--------WI...EAV...L......K....H..S.GC...N...VT.
C7RUX1_ACCPU/310-422--VALSFA-------..G...E.H..RL.YVR--------DV...ASA...L......T....E..KLGR..EA...VF.
D5SMM7_PLAL2/3-112--VFISWS-------..G...E.R..SRAIAE--------IL...NDW...I......K....CVLQ.AT...R...PW.
YDDK_BACSU/116-233--IFISHS-------..S...K.D..KI.VCN--------AF...VEL...L......E....D..I.GV...SSEDII.
C7PT18_CHIPD/9-118--IAISVA-------..E...E.D..KH.VAD--------QI...AAA...L......K....K..L.GI...R...YY.
C6XK34_HIRBI/4-106--IYLIYS-------..K...D.D..ID.KVR--------DI...ITP...L......T....A..A.GH...S...IW.
Q7UFB2_RHOBA/254-366--VAVSFP-------..G...E.K..RR.YVS--------RV...VDA...L......R....DPLG.ND...S...VF.
B7KLQ5_CYAP7/3-111--IFISWS-------..K...QPS..QD.IAV--------YL...RDW...L......Q....DLFE.NI...N...PF.
F1QWA8_DANRE/556-669--VFISYR-------..R...T.T.GSQ.LAS--------LL...KVH...L......Q....L..R.GF...S...VF.
K1QKT6_CRAGI/9-119--.FVIYN-------PHG...Q.D..QE.FVS--------LM...TQV...L......T....SPPY.NL...RLYVPW.
Q2YN91_BRUA2/146-256--..LSFP-------..G...E.A..RG.LVE--------QV...ARE...L......E....A..RVGP..NA...YF.
Q6N9F4_RHOPA/4-114--VFFSYS-------..H...A.D..EA.LRD--------QI...ETQ...LA...LLK....R..Q.GI..ID...VW.

PF08937

Q12I74_SHEDO/3-119RKVFFSFH---------Y---ERDV..R-RVV........QI---RNS---WVVRPGGEAQ...--..PFYDKA---EFE
A7HHH7_ANADF/34-147RNVFLSFA---------Y---EDIN...-EVN........LL---RGQ---AQS.......ERS--DIEFNDWS---VQE
Q6LJM5_PHOPR/2-127KRIFISHN---------H---RDSK...-TIN........LI---KSI---YCNPNHNLNFANK--SLAAPIFN---DHQ
A4G5B5_HERAR/3-116KKCFLSFH---------Y---KDDN..W-RVS........QV---RQI---GAIE....KQ...--..PLLDSN---KWE
A0LCB5_MAGMM/7-121YQLFISHS---------W---TYRD...-TYE........KL---VEL---FDE......HPNF--IWVNHSIP---KDD
A4G5B4_HERAR/2-119RRTFFSFH---------Y---APDV..W-RAW........NV---RNS---WVVQNEKNSE...--..GFFDGS---VFE
A3N1I6_ACTP2/3-115RKVFYSFH---------F---DNDA..W-RAG........QV---RNM---GVIE....GN...--..QPVNGN---EWE
A1SXM2_PSYIN/2-127KRIFISHN---------H---RDTA...-SIN........LI---KSL---NSNPNNNLLFKNK--SLSSPIYN---DYN
Q122C0_POLSJ/18-136HKVFVTYH---------H---GGDQ..S-YYD........DF---SNA---FHDIYDVIYDNSL--........---...
A6LX77_CLOB8/3-127HKTFISYK---------Y---SEAQ..K-LRD........DI---IKA---LGDDAQYYKGETS--D.......---...
Q9A8E1_CAUCR/8-195YKAFISYS---------H---HDRKAAE-WLH..........---..R---SLESYRPPAGLRA--GLGEASGN---ALK
Q6MN07_BDEBA/5-124DQVYVCFD---------A---DEDM..D-YYR........TM---KMW---VGN.......KNI--NFDFNNAH---DLN
Q2NGB5_METST/3-120SNIFLSYY---------H---EDKE...-YSD........KF---QEL---FQNLNTKTIR...--........---...
A1W964_ACISJ/3-116RKIFYSFH---------Y---QRDS..W-RAS........KI---RNI---GVVE....GN...--..QPASDN---KWE
Q21ZJ7_RHOFT/6-120KNVFISHV---------H---ADDA...-GLG........KL---KTL---LAKSGMDIRDSSI--NS......---...
A3N1I7_ACTP2/3-151NKVFISYK---------Y---SDDSVKQ-LTNPNDLFAAYRQ---VKT---TARDYVDIIQKKF--ERDGIHIN---KGE
Q82T32_NITEU/4-119RKCFYSFH---------Y---QPDN..W-RAS........TV---RQI---GAIE....GN...--..QPAKDN---DWE
Q6F1E6_MESFL/3-131KKVFISYW---------H---SGHQ..I-QKD........EL---EKT---VRASRNINNSVHI--........---...
Q0RX23_RHOJR/5-119HNIFISHR---------H---EDDA...-LVD........RL---KDL---LDARGCDVRDSSI--YS......---...
A3DI79_CLOTH/7-123YDLFISHA---------W---KYND...-DYY........RL---VDL---LNK......APNF--KWRNYSVP---QHD
A6LX79_CLOB8/4-117RQVFFSFE---------Y---NKDC..W-RAG........QV---RNM---GKVD....SS...--..STFSDN---DWE
Q1IIP2_KORVE/3-120RSVFFSFH---------Y---DRDI..M-RVQ........QV---KQH---YITKGTYTET...--..GFFDGS---LEE
A6QC47_SULNB/3-134HKVFVSYH---------H---ANDQ..Y-YRN........KF---EEL---FSNQYDIMVSRSV--QI......---...
Q122B7_POLSJ/5-119RNIFISHI---------H---ADDS...-RLQ........PL---KDL---LNQSGFEARDGSI--NS......---...
Q03QQ3_LACBA/2-119SDLFISYQ---------S---ADPLAQS-FQV........QL---HEW---AAQ..........--NWAFPTVS---FHE
Q8FTW2_COREF/4-118KTVFYSFH---------Y---KRDV..Y-RVQ........MV---RNI---NAIQ....GD...--..PILGAQ---EWE
Q3Y0J6_ENTFC/3-117RRVFFSFH---------Y---A.DV..T-RAM........VV---RNS---WTLR.GTKEA...--..GFVDKA---EFE
Q3A0F5_PELCD/2-120RRTFFSFH---------Y---EPDV..W-RAW........NV---RNC---WVIKPEEQSD...--.RGFFDSS---VFE
Q31IQ3_THICR/3-119RKVFFSFK---------Y---E.DV..K-RSM........VV---RNS---WVAQ.DKQSA...--..GFIDKA---DFE
O86760_STRCO/8-131RKCFISYH---------H---EDER...-EVH........QF---IQK---FDHVRDIFIARGI--GAGMP...---...
Q2LRS2_SYNAS/24-142HRVFVSYH---------H---NGDQ..A-YYD........KF---TKL---FANGYEIITDTSI--........---...

PF10137

C6W705_DYAFD/4-121-RVFIGSS-------------R..EGLP-KAK--------LL---KGY---L-----------...S-GVADCQ---IW-
Q21MV2_SACD2/143-262-.VFIVHG-------------...HDDA-AKV--------TV---ARF---V-----------EK.L-G.LKAI---IL-
D2QVU6_SPILD/4-126-KIFLVHG-------------...HNEE-MKQ--------SV---ARV---L-----------EK.L-G.FEPV---IL-
F8B4J3_FRADG/196-328-NVFVVHG-------------...RDTG-ARD--------AM---FAF---L-----------RA.V-G.LRPI---EW-
A3CWB8_METMJ/141-285-RVFIVHG-------------...HNEQ-TKD--------EV---EKF---L-----------TK.Y-S.LEPI---IL-
B1M988_METRJ/155-274-.VFLFSS-------------S..EALP-VAR--------AI---ENA---L-----------A..D-DPFLTV---VW-
Q8TKX7_METAC/9-127-..FIGSS-------------K..EGLG-IAQ--------AI---QLE---L-----------E..E-YA.TCT---IW-
Q24ZU3_DESHY/13-134-.IFLGSS-------------SSQKAKD-DML--------KI---AML---I-----------E..E-EGHTPF---PW-
E3J264_FRASU/144-263-.IFLVHG-------------...RDNA-ARL--------QV---QRV---L-----------EK.A-TPLEVI---VL-
I3UFW1_ADVKW/147-263-RVFLVHG-------------...HDEA-VRE--------TV---ARF---I-----------EK.L-G.IEVI---IL-
A1SX31_PSYIN/148-267-QIFIVHG-------------...HDDS-AKL--------EV---ARF---I-----------EK.L-G.FEPI---II-
B0UTQ9_HISS2/135-254-KVFIVHG-------------...RDNE-TKQ--------EV---ARF---I-----------EK.M-G.FEPI---IL-
M4NKT6_9GAMM/158-276-.VFVMSS-------------V..EALP-VTR--------LL---VQH---F-----------E..H-DPFLTV---VW-
C5BHR5_TERTT/6-125-.LFIASS-------------S..ESLA-IAE--------AV---NVN---L-----------D..H-E.FEIT---VW-
Q8XW61_RALSO/85-207-KVFVVYG-------------...HDNA-ART--------EL---EAM---L-----------RR.W-R.LEPL---IL-
L0HBG8_METFS/245-360-RVFISHG-------------...KNKQ-IVD--------QL---KEI---I-----------K..F-GKYEPI---IS-
F0ZMV3_DICPU/57-185-KVFIVHG-------------...HNDE-ARQ--------KV---HNV---L-----------NG.L-G.FEPI---VL-
B0UF11_METS4/156-275-KVFIVHG-------------...HDDA-ALQ--------GL---ARF---I-----------EK.L-G.LEAI---VL-
Q12JL6_SHEDO/5-125-RVFIGSS-------------V..ESLP-IAD--------AI---AEN---L-----------E..F-D.AEVT---IW-
Q81W84_BACAN/128-251-KVFIVHG-------------...HDDN-LKQ--------QL---EIF---L-----------NS.I-G.IKPV---VL-
C7PYD3_CATAD/410-541-.VFVIHG-------------...RDER-ARV--------AT---FDL---L-----------RA.F-G.LHPV---EW-
C5CLS7_VARPS/123-235-.AFISHG-------------...RSKD-WY.--------EV---QAH---I-----------ERDL-K.LRTL---EL-
R5R263_9FIRM/4-124-RIFIGSS-------------K..ESVK-IAE--------KV---KSL---L-----------D..G-EY.VCQ---LW-
R7K6B0_9FIRM/70-191-KVFVVYG-------------...HDEI-ART--------QL---EAM---L-----------RR.W-D.LDPI---IL-
C4ZIE6_THASP/167-285-.IFLGYC-------------S..SSAS-TAA--------QI---KRY---L-----------AS.Q-N.ASVL---DW-
B4S624_PROA2/362-481-KVFVVHG-------------...HNVD-ARD--------AI---EKY---L-----------ED.L-D.LEPI---TI-
K0AW63_CLOA9/134-254-KIFLGSS-------------K..EAEE-VMD--------EI---AVI---I-----------E..S-YKHDAL---PW-
C7RC53_KANKD/229-343-NVFISHG-------------...KNKK-VVQ--------QL---KEL---L-----------T..F-GKFNPV---VS-
C7R666_KANKD/7-127-.VFIASS-------------V..EGLS-VAE--------AV---NIK---M-----------E..Y-D.AQVK---QW-
I4BA92_TURPD/15-129-KVFVSHG-------------...RSPL-WN.--------EV---ERF---V-----------RTQL-E.IDVV---IL-
D5V4Y7_ARCNC/166-284-QVFIVHG-------------...HDSV-TKM--------EV---SDF---V-----------KE.L-G.LEPI---IL-
Q6D353_PECAS/127-247-KVFIVHG-------------...RNNE-VKQ--------EV---SRF---I-----------SD.L-G.LEPI---IL-
Q2K8S5_RHIEC/205-324-KVFIVHG-------------...HDEA-ALE--------KL---ARF---L-----------EK.V-G.LEII---IL-
R5V068_9FIRM/111-228-KVFIVHG-------------...HDTN-LKL--------EV---ARL---L-----------EN.Q-G.IEAI---IL-
V6KJV2_STRRC/56-188-NVFVVHG-------------...RDEE-ARL--------KV---FDL---L-----------RL.L-D.LRPL---EW-
D0LNL0_HALO1/453-571-KVFVVHG-------------...HDKG-VRE--------SV---ARF---L-----------EK.L-G.FDAV---IL-
E1W054_ARTAR/175-307-RVFIVHG-------------...RDLD-SKN--------TL---ERF---L-----------KH.V-D.ALPL---TW-
C1DBI6_LARHH/98-222-QVFIVHG-------------...HDDT-ARE--------QL---ELV---L-----------HK.L-G.LDPY---VL-
Q9X882_STRCO/76-207-.VFVVHG-------------...RDDQ-VRR--------EM---YEL---L-----------RR.L-D.LRPK---EW-
B9TGA1_RICCO/4-125-KIFIGSS-------------R..EGLD-IAN--------AI---HAN---L-----------T..R-D.AECT---VW-
R6JZ57_9CLOT/29-145-.IFIVHG-------------...HDTL-ARI--------EL---KDY---L-----------QNTL-GFPAPV---IL-
R5IEF5_9BACT/151-269-NVFIVHG-------------...HDNG-LKN--------EV---ARF---I-----------TD.M-G.YNPI---IL-
D5C5H2_NITHN/120-239-NVFVIHG-------------...RDEA-KWR--------EL---KDI---L-----------RTEF-R.LNPI---IL-
Q47ER9_DECAR/134-252-KVFIVHG-------------...RDDL-AKT--------EA---ARF---I-----------EK.L-G.FSAI---IL-
Q027G3_SOLUE/4-122-RIFIGSS-------------T..EGLP-HAC--------HI---KEL---L-----------TS.F-GDIEPV---LW-
Q9A4X3_CAUCR/154-272-RVFVISS-------------V..EALP-IAR--------AI---QTA---F-----------E..Y-DPFTVI---VW-
C1F5N0_ACIC5/154-273-RVFIISS-------------A..EALD-IAR--------TI---QNA---F-----------D..H-DPFNVT---VW-
Q8EDI5_SHEON/128-249-KVLIVHG-------------...HDEA-AKY--------RT---EAF---L-----------RK.H-G.FDPI---IL-
A5I3L4_CLOBH/140-260-KIFIGSS-------------K..EHLD-VAY--------SL---QEA---L-----------E..Y-S.AEPT---VW-
B1ZZI8_OPITP/123-242-.VFLVHG-------------...HDEG-AKH--------AV---ARF---L-----------EQ.L-G.ITPV---IL-
B2FIX1_STRMK/122-235-.VFIGHG-------------...RSPA-WK.--------DL---RDH---L-----------RDQH-D.YRIE---SY-
Q6AL85_DESPS/128-241-.VFIGHG-------------...GSSQ-WR.--------DL---KDH---L-----------QDKH-N.IKIE---AY-
D4LTG4_9FIRM/2-122-RIFIASS-------------G..ERLN-MAI--------EV---GSW---L-----------E..G-MNVEPV---LW-
C5CLS5_VARPS/5-125-RVFIGSS-------------V..EGLP-VAY--------AV---QQN---L-----------L..H-D.AEST---VW-
TIRC_DICDI/55-184-KVFIVHG-------------...HNNI-VRE--------KV---SKF---L-----------FE.M-G.FEPI---LL-
Q98RD6_MYCPU/91-212-KVFIVHG-------------...HDKI-ALL--------EL---KDL---L-----------RD.L-K.LNVV---IS-
J9R4G8_RIEAN/5-130-RIFIGSS-------------S..EELD-LAS--------AA---KSI---L-----------EL.E-KEFEVT---IW-
R6SAH6_9BACE/4-122-RIFIGSS-------------T..EGLA-VAQ--------RI---KTF---F-----------E..P-D.YDCY---IW-
Q7MKB6_VIBVY/8-129-KLFIGSS-------------V..EGLE-VAY--------AI---QSE---L-----------E..H-D.SEPT---VW-

PF08357

CIKS_HUMAN/410-552RKVFITYS---------M---.DTAME...VV--------KF---VNF---L-----------L----VN...GFQTAID
I17RC_HUMAN/584-737RAALLLYS---------A---DDSGFE.RLVG--------AL---ASA---L-----------C----QL...PLRVAVD
I17RD_DANRE/355-520PKIFICYS---------S---RDGAKHLAVIQ--------SF---AFF---L-----------Q----DFC..GCEVSLD
I17RA_MOUSE/380-539RKVWIVYS---------A---.DHPLYVEVVL--------KF---AQF---L-----------I----TAC..GTEVALD
Q8VUX6_STAHO/2-124KKIFISYA---------W---.DEIED.EKVI--------KL---AEM---L-----------E----DYK..EFEVSFD
Q7UT52_RHOBA/13-152RKVFVSYA---------H---.TSEPHIEWIL--------AF---VAD---L-----------Q----AN...GIEVVVD
Q8BPI5_MOUSE/107-257RTALLLHS---------A---.DGAGYERLVG--------AL---ASA---L-----------S----QM...PLRVAVD
I17RB_HUMAN/332-479IKVLVVYP---------S---.EICFH.HTIC--------YF---TEF---L-----------Q----NHC..RSEVILE
Q69HQ3_CIOIN/391-538SNLFLVYW---------D---.DHKLHRDVVL--------KL---ASY---L-----------Q----HL...GFNVFCE
YSO2_CAEEL/415-566VKVMIVYA---------D---.DNDLHTDCVK--------KL---VEN---L-----------R----NCA..SCDPVFD
I17RD_HUMAN/356-511PKVFLCYS---------S---KDGQNHMNVVQ--------CF---AYF---L-----------Q----DFC..GCEVALD
Q543U7_MOUSE/329-476IKVLVVYP---------S---.EICFH.HTVC--------RF---TDF---L-----------Q----NYC..RSEVILE
I17RE_RAT/448-585RPVLLLHA---------A---.DSEAQRRLVG--------AL---AEL---L-----------R----TALGGGRDVIVD
I17RD_CHICK/358-512PKVFICYS---------S---KDCQKHINVIQ--------CF---AYF---L-----------Q----DFC..GCEVALD
Q73LP6_TREDE/1-127MKVFISYA---------W---.TNNEYTSKIL--------LL---AER---L-----------M----SD...GVETIID

PF01582

B9N1N5_POPTR/14-194I-D-----.YKL-N---R--GEEI--SP.SLLKA-I---E-D--SKLSVVVFSDN-------------------------
B9S6Z7_RICCO/19-198I-D-----.NKL-N---R--GEEI--TP.ELLKA-I---Q-E--SMVAVVVFSHN-------------------------
B9S9D9_RICCO/12-191K-D-----.ENL-D---R--GEQI--SD.TLSQT-I---K-E--SYVSVVIFSKN-------------------------
B9SBW2_RICCO/15-195V-D-----.DKL-S---R--GEEI--SA.ALVKV-I---E-E--SMVSVIIFSEN-------------------------
D7KR54_ARALL/8-188K-D-----DKEL-E---N--GRRI--SP.ELKRA-I---E-E--SKFAVVVVSVN-------------------------
D7MRD9_ARALL/8-185K-D-----.SEI-E---R--SHSI--AP.ELIQA-I---R-G--SRIAVVVFSEN-------------------------
D7UDZ7_VITVI/24-202I-D-----DDKL-E---R--GEVI--SS.ALVEA-I---E-N--SMFSIIVLSEN-------------------------
F4IFF6_ARATH/55-233I-D-----.NNI-E---R--SKSI--GP.ELIEA-I---K-G--SKIAVVLLSKD-------------------------
F6I7C7_VITVI/9-189I-D-----ADKL-R---I--GEII--SP.ALLSA-I---E-G--SRFSIVVLSEN-------------------------
I1KE95_SOYBN/20-200K-D-----DKDI-R---K--GESI--AP.ELIRA-I---E-G--SHVFLVVFSKD-------------------------
I1MD01_SOYBN/13-191V-D-----.DRL-E---G--GDEI--SH.SLDKA-I---E-G--SLISLVIFSKD-------------------------
TLR4_HUMAN/676-839L-H-----YRDF-I---P--GVAI--AANIIHEG-F---H-K--SRKVIVVVSQH-------------------------
TLR5_HUMAN/695-858F-E-----ERDF-V---P--GENR--IA.NIQDA-I---W-N--SRKIVCLVSRH-------------------------
I18RA_HUMAN/410-598L-L-----ERDV-A---P--GGVY--AE.DIVSI-I---K-R--SRRGIFILSPN-------------------------
ILRL1_MOUSE/384-567I-Y-----GRDL-L---P--GQDA--AT.VVESS-I---Q-N--SRRQVFVLAPH-------------------------
IL18R_HUMAN/377-541I-F-----ERDV-V---P--GGAV--VD.EIHSL-I---E-K--SRRLIIVLSKS-------------------------
ILRL2_HUMAN/385-575I-F-----GRDE-F---P--GQAV--AN.VIDEN-V---K-L--CRRLIVIVVPE-------------------------
IL1AP_HUMAN/407-570I-F-----DRDS-L---P--GGIV--TD.ETLSF-I---Q-K--SRRLLVVLSPN-------------------------
I18RA_MOUSE/409-597L-L-----DRDV-T---P--GGVY--AD.DIVSI-I---K-K--SRRGIFILSPS-------------------------
Q9ZVX6_ARATH/11-188D-D-----.QKI-V---R--SQTI--AP.SLTQG-I---R-E--SKISIVILSKN-------------------------
F4J361_ARATH/93-270I-D-----.NNI-E---R--SKSI--GH.ELKEA-I---K-G--SKIAIVLLSKN-------------------------
M4E4G7_BRARP/12-187V-D-----.DKI-E---R--GESV--GP.VLVGA-I---R-Q--SRVAVVLLSRN-------------------------
Q9SSN5_ARATH/8-185K-D-----DKEL-E---N--GQRI--SS.ELKRT-I---E-V--SRFAVVVVSET-------------------------
RPS4C_ARATH/16-186I-D-----DYE.-D---R--GQPL--.D.VLLKR-I---E-E--SKIVLAIFSGN-------------------------

PF13676

Q47BW0_DECAR/4-104W.D.....R.RI.P...A..GETW..RT-VLEKA.L...E.D..MRCMIVLWSAR-------------------------
C3Y619_BRAFL/689-797M.D.....IGQM.G...G..GDQL..YA-KIDKG.M...R.G..AKVVLAMVTPK-------------------------
C3Y619_BRAFL/881-989M.D....IQ.QM.G...G..GDAL..YG-KIDKG.I...R.S..AKVVVSCVTPK-------------------------
E3I8M0_RHOVT/4-107W.D.....T.DL.L...A..GEDF..NR-VIQDR.L...N.E..ARAVIVIWSDL-------------------------
C3ZXI7_BRAFL/383-491THD.....K.LG.Q...S..KEEF..LQ-INAPR.I...A.G..CKNILVLLTEA-------------------------
A7S5P1_NEMVE/555-656I.D.....V.EQ.M...E..GSTL...E-AMASA.V...E.N..AAAVLMCVSRA-------------------------
A7S5P1_NEMVE/1014-1115M.D.....V.EQ.M...G..GSTL...E-AMARA.V...E.N..ASVILIAMSQR-------------------------
A8L2Q4_FRASN/29-136I.Q....AW.DF.V...P..GTNW..FQ-GMEQG.V...A.E..ADRMIALISEA-------------------------
E3JD12_FRASU/19-126I.Q....VW.DF.V...A..GSNW..QI-RMIEG.M...E.Q..AQRTVAVLSPA-------------------------
E3IW96_FRASU/15-122I.Q....AW.DF.V...A..GSDW..AA-RMDQG.I...R.L..ARRTIAVLSDA-------------------------
Q0REH0_FRAAA/6-113IRA.....W.DF.V...P..GSNW..SL-HIQQG.V...V.G..AERTIVVLSAA-------------------------
A1BEX3_CHLPD/90-190W.D.....P.EI.P...P..GETW..RG-YIKKK.L...D.E..SRCVLVAWSRL-------------------------
E3J785_FRASU/17-124V.Q....AW.DF.V...P..GSNW..SV-RMQEG.V...T.K..AERTIVLLSAA-------------------------
Q2JBL6_FRASC/19-126V.Q....AW.DF.V...P..GSNW..QI-RMQQG.V...Q.H..ARHTLAVLSGA-------------------------
Q0RGM6_FRAAA/6-113V.Q....AW.DF.V...P..GSHW..MS-RMDEG.I...R.A..GARTLAVLSRA-------------------------
C6XNE0_HIRBI/4-104W.D.....H.GI.A...P..GSQW..DQ-TIQKE.L...T.E..AKMVIAVWSEL-------------------------
Q0RIN9_FRAAA/22-129I.Q....AW.DF.D...R..GSHF..VR-EMRQA.A...A.T..ADRTIAVVSAV-------------------------
E3J7J7_FRASU/27-134I.Q....VW.DF.V...P..GSHW..QT-QMEEG.I...L.G..AERTVAILSDA-------------------------
Q0RPX4_FRAAA/13-120I.Q....AW.DF.V...P..GSNW..RF-KMQQG.V...M.H..STRMVAVLSTA-------------------------
A8L235_FRASN/21-128I.Q....AW.DF.T...P..GSNW..VT-GMDEG.V...A.A..AARTIAVLSHA-------------------------
Q82CN6_STRAW/36-142F.D.....QWSI.E...P..GQVV..IH-ELEAA.L...L.A..STNGIAVISPA-------------------------
Q0RPX3_FRAAA/13-120I.Q....AW.DF.V...P..GSDW..RF-KMEQG.V...T.Q..AARTIAVLSKT-------------------------
Q21Z38_RHOFT/11-111W.D.....R.DL.A...A..GSEF..TA-VIEAQ.L...L.G..AAVVMVLWSAD-------------------------
Q0RFT3_FRAAA/25-132V.Q....AW.DM.V...A..GSNW..SA-AMQDG.I...R.Y..STRTLAVLSGA-------------------------
E3IX94_FRASU/15-122L.Q....AW.DS.V...A..GSNW..SV-RMDEG.I...R.T..AHRTIAILSEA-------------------------
B3S2N0_TRIAD/460-568A.H.....D.KLGR...S..KEEF..IR-FNGHR.L...A.V..SKHVVIVLTAT-------------------------
A8LGL3_FRASN/20-127I.Q....VW.DF.A...V..GSHF..VH-EMHRA.A...G.G..AARTVAVLSAE-------------------------
E3IX60_FRASU/26-133V.Q....AW.DF.L...A..GTHF..VH-EMHRA.A...M.S..AARTLAVVSAA-------------------------
B4SC53_PELPB/96-199W.D.....R.NL.R...A..GHNW..PI-EISRA.L...D.E..SRCVLVFWSFA-------------------------
Q0RTF6_FRAAA/29-136I.Q....AW.DF.G...A..GAHF..VT-EMHQA.A...Q.T..AARTVAVLSAA-------------------------
Q0RIT4_FRAAA/69-176LQD.....W.DF.A...P..GTRW..TT-FLQRA.R...A.R..SERTIALVSEN-------------------------
A8KXQ9_FRASN/9-116C.E....AW.DA.V...A..GSSR..DR-LIDDA.V...G.R..SVRTLAVLSAA-------------------------
E3J7Y1_FRASU/19-126L.Q....AW.DM.T...P..GTSW..PS-LLDQA.V...R.R..ARRTIAMVSAA-------------------------
D2SAJ1_GEOOG/13-119L.D....VW.DW.A...P..GEDF..VA-LMAAA.L...E.S..ADRLLAVCTEA-------------------------
A8L102_FRASN/20-127L.Q....VW.DF.G...P..GSRF..VD-QMHQA.A...Q.Q..AQRTVAVLSDA-------------------------
Q028E9_SOLUE/5-105W.D.....P.KL.Q...G..GDAF..DK-AIGTA.L...A.A..ARCVIVMWSRH-------------------------
A7ST59_NEMVE/24-124L..........I.S...E..GSPL..AL-ALREQTV...S.W..CDLFVMVVSFN-------------------------
A7ST59_NEMVE/413-519M.D....IWGGM.Q.......GNI..NE-AMATA.V...E.N..STMLVAFLTEK-------------------------
Q2JEN2_FRASC/35-142I.Q....TW.DF.N...A..GSHF..VT-EMHQA.A...Q.V..AARTIAVLSTA-------------------------
A7HHI0_ANADF/4-104W.D.....D.RI.D...Q..GD.F..PA-EIERT.L...S.S..AKAVVPVWSKH-------------------------
D2B0U4_STRRD/14-121I.Q....AW.DF.R...P..GDNF..MA-AMDHA.L...T.M..CRHTLGVLSPD-------------------------
E3JD26_FRASU/17-124L.Q....AW.DA.V...P..GTHL..TT-KMREG.V...E.F..SLRTLALVSAE-------------------------
A8DUR5_NEMVE/387-495M.H.....K.RLGQ...S..KEDF..LK-LNGPD.L...G.A..SSSVVVLMSEA-------------------------
C3Z670_BRAFL/206-314M.D....IK.EM.G...G..GDQL..YA-AIDRG.M...R.Q..AKVVISCVTPK-------------------------
A8L472_FRASN/36-137V.Q....AW.DS.P...A..GENF..VT-WISVQ.M...G.A..AARTVAVCSQA-------------------------
O86768_STRCO/8-114L.D....VW.DW.R...T..GDNL..VQ-RMDEA.L...E.R..ADAVIALFSTS-------------------------
C3YB32_BRAFL/1078-1172M.D.....G.................NN-SVTDT.V...N.M..AAVVLMCITND-------------------------
Q2W1R2_MAGSA/34-139I.Q.....EYDF.R.......GNF..IT-EMDKA.V...D.E..CDYTLALLSPK-------------------------
E3IUH8_FRASU/87-194L.Q....AW.DG.V...P..GSHW..MN-QMNTA.I...H.Q..SDHTIAVVSRA-------------------------
E3JB70_FRASU/15-122F.Y.....RRSF.P...L..GANF..VD-QIDAA.L...T.R..ADRMIAVVSPA-------------------------
D9SFF3_GALCS/4-108L.A.....SVSM.Q...P..GERW..MP-HIMES.L...R.S..STWVLCLASRT-------------------------
C6XQ37_HIRBI/5-107W.D.....Q.KI.E...G..GVDW..RD-AIVEN.L...I.S..SDMLVILFSEE-------------------------
Q3SW17_NITWN/99-207W.D.....KWCI.T...T..GDSL..RQ-KIDEG.L...G.D..CTHFLVLLTPQ-------------------------
C4ZIJ8_THASP/6-119H.D.....R.GI.V...P..GQEW..DK-AIDEQ.L...A.M..ADLILLLVSMD-------------------------
C7RV87_ACCPU/4-106R.D.....HGQL.R...A..GSDW..RD-GIERG.I...S.D..SVAVLVALSEN-------------------------
B6JHA2_OLICO/99-207W.A....GW.CI.G...A..GDSL..RQ-KIDEG.L...A.D..CTHFLVLLTPA-------------------------
D2B0U5_STRRD/10-115V.K....AW.DF.L...P..GENL..LD-RLDRA.L...A.T..CRHTIGVLSPD-------------------------
C7RQ25_ACCPU/133-235L.D.....TSDI.P...G..GEVW..LA-AIADG.I...E.R..AYAVVSLVSTA-------------------------
Q2J5A8_FRASC/18-127L.E....AW.DF.V...P..GSNW..PA-LVQAG.L...T.T..AGRLLAVLTPA-------------------------
Q2NDU5_ERYLH/20-120W.D.....G.LL.E...G..GARY..NE-ITEDR.L...E.N..AYAVIVLWSHA-------------------------
A8L863_FRASN/19-126LRA.....W.DF.T...S..GSNI..VT-ETQRV.L...A.T..SAKMIAVMSSA-------------------------
Q2JGC9_FRASC/4-109L.AQ..NIRVGV.Q...P..GDMW..KD-RLHRE.L...R.A..ADAVVCVITNA-------------------------
Q9L0M8_STRCO/8-114L.D.....RWHW.R...T..GDDF..VQ-KMNLA.L...G.K..ADAVVALFSRH-------------------------
Q0RFV3_FRAAA/13-120IRA.....W.DA.V...P..GSHP..VA-DLQRT.L...A.S..GARSVVVLSEA-------------------------
B3QZ81_CHLT3/7-115F.Q....PW.DFNT...A..GRSI..IG-NINTA.T...I.Q..SERTIAVISPD-------------------------
Q0RPP6_FRAAA/10-118LPE.....W.DD.V...P..GSRR..IA-TLETG.L...R.T..ASRFLAVVSAQ-------------------------
Q8CJY8_STRCO/19-125L.D....VW.DW.R...I..GDNF..IE-RMNDA.M...R.R..ATTVVALFSNN-------------------------
C3ZQ01_BRAFL/737-845M.D....IK.QM.G...G..GDSL..YE-MMDKG.I...R.G..AKVVVSCVTPP-------------------------
Q0RIR9_FRAAA/18-121V.Q....AW.HS.V...P..GTNV..VA-WLDRC.L...A.R..ADHVLLVLSAA-------------------------
B0CFH1_ACAM1/694-807H.D.....R.KI.L...P..GTDW..KN-ELDRN.L...E.Q..ADIILPLVSPD-------------------------
E3J0G5_FRASU/353-460L.D....SW.DL.H...G..GDKT..VE-ALDVA.V...R.S..FDRTIAVLSPG-------------------------
D3B3K4_POLPA/805-907L.D.....EYRL.Q...A..GCDW..RA-EITKG.V...A.N..AQVIIYTISET-------------------------
Q0RRH7_FRAAA/33-134VLA.....W.DL.P...P..GVNY..VL-WTDAQ.M...A.A..ARLTMVISSAA-------------------------
E3J6F2_FRASU/4-111L.D....LW.EI.E...I..GDSI..VE-KMNEG.L...A.G..AQYVVLCLSAA-------------------------
A9FJE9_SORC5/5-116H.R.....G.RL.G...A..GAVL..DA-SIAAE.L...S.A..AEVVLLLVSEA-------------------------
A8LGX9_FRASN/19-119Y.D.....D.GL.G...W..GARF..TQ-EIRLR.I...R.N..ALAVIVVMSPA-------------------------
B3S8Y4_TRIAD/187-291L.D.....VHEI.K...C..GVDW..QD-SLNDA.V...S.S..CEVFVPLVTPR-------------------------
B3E9D8_GEOLS/5-116V.D.....SKHL.L...P..GQNW..EA-EIERA.F...S.D..ANVVVLLLSKR-------------------------
C3YRI2_BRAFL/372-473M.D.....I.DR.M...G..GSTL...Q-AMAKA.V...E.G..AAVVLICMTRK-------------------------
D2QTN1_SPILD/23-136H.D.....R.KI.L...S..GQNF..EN-AIDKN.L...T.N..ADIVIFFVSAD-------------------------
A9VAD9_MONBE/378-481I.D.....VHKM.E.......GNI..MS-EMASA.V...E.N..AAVVLMLYSKA-------------------------
C3YBW8_BRAFL/463-564M.D.....L.EQ.M...G..GSTL...Q-AMAEA.V...E.N..SVVVLICMSQK-------------------------
B2IVL0_NOSP7/8-109Q.A.....Q.NI.S...I..GSKI..IN-QTTEM.L...D.K..AKFVIVLWSNN-------------------------
Q0RIX3_FRAAA/21-122V.Q....PS.ES.P...G..GEYA..VS-DIGAE.V...A.R..AERVLAVCSPA-------------------------
E3I8Q6_RHOVT/4-115L.DLD.PER.GI.A...A..GERW..ER-ALNEA.A...R.R..CEAVLFLISQA-------------------------
Q01GF4_OSTTA/482-587M.D.....V.DR.M...M..GSTL...E-AMAAA.I...E.S..SDAIIMCISGR-------------------------
Q8YVL7_NOSS1/8-109E.A.....Q.NI.S...I..GSQI..IS-ETTKA.L...E.K..NKFVIVLWSNT-------------------------
A8WVG1_CAEBR/367-484I.D.....VDKL.Y...A..GK.F..DS-SLLKN.I...Q.A..AKHFILVLTPN-------------------------
A9GSK2_SORC5/1147-1260H.D.....R.RI.A...A..GDAR..AG-QIDKN.L...D.E..AEVILLLVSAD-------------------------
D1A5Y5_THECD/4-128R.A....GK.SI.P...P..GEDY..TR-WLRQA.V...R.R..CSVLIAVIGPE-------------------------
A9GWR7_SORC5/353-464H.D.....G.EI.G...A..GEER..DT-ALAEH.L...E.T..AKVILLLISAD-------------------------
E3I131_RHOVT/20-126L.Q.....QWDF.G......NRNF..MQ-AMHEA.L...A.S..DARVIALLSRD-------------------------
Q488J9_COLP3/4-122F.D.....QDAI.L...P..GGYY..AK-DIATA.L...K.D..IDVFVLMTSAN-------------------------
C4ZM27_THASP/14-137R.D.....VDDI.A...A..GADF..GV-VIEQA.L...Q.Q..VQAVLVVIGTR-------------------------
D2SB43_GEOOG/12-118L.D....PW.DI.T...P..GVDL..ID-SFRGV.T...E.A..ADVVLVVLSDV-------------------------
Q0RSZ9_FRAAA/6-111L.AR..DIRTGI.R...P..GEVW..KE-RLHQE.L...R.A..ADAVICVVTEA-------------------------
D2SB14_GEOOG/4-110V.DFD.PED.GI.P...A..GRNW..ER-ELYAQ.L...R.R..TEAVVFLASHA-------------------------
B0C5U4_ACAM1/223-330I.D.....Q.SM.A...V..GTKW..AE-KIERE.L...R.Q..SDFLITLLSAS-------------------------
B4HIY9_DROSE/842-958I.D.....VERL.E...A..GK.F..DN-GLLNS.I...R.Q..AKNFVLVLTPD-------------------------
A7SAI7_NEMVE/4-114M.D....IHGGI.R.......GDI..NG-SMAKG.V...D.G..AAILCCFMSTK-------------------------
B1ZSG7_OPITP/145-246V.A.....HADI.R...P..TKAW..QD-EIENA.L...A.T..MDAFVALMTED-------------------------
C1EBU5_MICSR/479-580M.D.....V.DR.M...M..GSTL...E-AMAAA.I...E.S..SDAIIMCVTNR-------------------------
C3ZH48_BRAFL/391-492M.D.....V.DQ.M......GGDI..LE-AMAEA.V...E.G..AAVVLVTMTEK-------------------------
Q099H8_STIAD/11-117F.D.....KWDL.I...P..GEEW..LP-AVTRA.L...Q.E..QPCMAVCIGPS-------------------------
C1N563_MICPC/155-256M.D.....V.DR.M...M..GSTL...E-AMAAA.V...E.Q..SDAVIMCVTHR-------------------------
A8KZ03_FRASN/14-119V.Q....VW.NV.A...P..GAHS..VD-AIREG.A...I.R..ARSVIVVISST-------------------------
C3YRI0_BRAFL/374-476M.D.....I.DQ.M...G..GSTL...E-AMAGA.V...E.G..AAVVLVCMSRK-------------------------
Q08W08_STIAD/272-383Y.D.....R.KI.A...I..GAQW..EP-DVHLH.L...E.S..ADLILVLVSQG-------------------------
B5GMC1_STRC2/51-156L.A.....R.WI.G...P..GLVE..SL-EKEEA.L...L.A..SANGLLVFSGA-------------------------
A9GWR0_SORC5/11-122Q.G.....F.AL.G...G..GRER..RE-ASAAR.L...R.E..ARVVLLLVSAD-------------------------
C3ZI71_BRAFL/547-647L.D.....K.DE.M...G..GT.M..LE-SMARG.V...R.S..SAIVIIAFSED-------------------------
B2IT96_NOSP7/9-118L.D.....KWEL.R...P..GLAW..QS-LLEEQ.I...E.N..IKSAAVFVGSS-------------------------
B9M1H6_GEODF/3-109T.S.....D.SM.E...Q..GDDI..TS-AIGKL.I...E.R..AEAFVIIVSPK-------------------------
A1W966_ACISJ/133-236L.D.....THGI.P...P..AEDF..QT-MLWHR.L...C.D..SDVLVMLDTPG-------------------------
A8ZZH8_DESOH/82-183V.A.....HEDI.H...P..TTEW..QN-EIENA.L...H.T..MDSFVALLTDG-------------------------
D5SSN8_PLAL2/117-218I.A.....HEDI.E...A..SREW..RD-EVEAG.L...E.T..MDVLAAVVEPG-------------------------
A8L7D9_FRASN/338-442L.E.....Q.IS.Q...S..GAGW..KD-DTEP......E.P..IRRMVAIVSAA-------------------------
B9M1I3_GEODF/4-102I.D.....K.KI.V...G....SF..RQ-AIEKE.L...P.G..SGCVVAVNSMA-------------------------
B7KBK1_CYAP7/4-116I.P....GH.QL.I...F..GKSI..DE-QLKTY.L...N.E..TIGLIALITQD-------------------------
C3XYH4_BRAFL/100-210F.D.....DVSI.K...P..GEVI..RD-RIIST.LS.SQ.S..LELVVVVVSTA-------------------------
Q10WW3_TRIEI/118-233M.A....GD.HI.R...L..GENW..FR-RINIE.L...K.R..CDYLLLFLPPQ-------------------------
A8IF66_CHLRE/788-889M.D.....I.EK.M...S..GSTL...E-AMALA.V...E.G..AAAVLLCISKR-------------------------
Q0C4A7_HYPNA/4-101Y................P..GEDT.SRE-EADAA.I...D.K..AFAVIVLVSAA-------------------------
Q7NE51_GLOVI/173-287R.A....CE.ES.H...G..RAKR..RI-GIDQP.L...R.R..GERLLVVLSED-------------------------
B1W250_STRGG/340-445V.P.....R.DV.S...A..ERSP..DE-PADTT.A...E.N..AARTVVLLSSA-------------------------
Q0RNC1_FRAAA/414-526Q.V.....RWAQ.N...R..GERL..AE-TVDRI.A...R.W.DPEITVVLLSRH-------------------------
Q8TM16_METAC/5-107Y.R.....KARI.L........SL..AE-RIRFG.I...R.Q..SDCIIPIITQE-------------------------
B1ZQ16_OPITP/12-113W.G.....Q.DK.V...P..GQDA..WG-TIYSW.I...D.S..ADLVVVVLTGK-------------------------
E3J6T1_FRASU/274-377L.G.......DL.S...Y..AD....TA-EMTGI.M...R.L..SRRWLVILSPD-------------------------
Q0RUF2_FRAAA/4-111L.D.....RWEV.R...I..GDTV..PM-FMNDT.L...A.T..ADFLVLGHSTL-------------------------
B2J3V1_NOSP7/6-112I.D.....DEQI.R...P..GRPF..QD-EIQQA.IPLVK.S..AAIFFGVLGLG-------------------------
Q47DY5_DECAR/7-118Y.DK..FEEVDL.....W..GKDL..YT-HLSDV.Y...QNR..AVFTVMFVSDA-------------------------
C3YU72_BRAFL/10-119F.D.....ERSL.D...T..GDEL...D-SIVKV.I...E.SPSLKLFVFVVSKY-------------------------
C9YT07_STRSW/352-458L.A.....QEGT.V...E..SAQR..RD-EIERG.V...E.S..ASHTLVIFSEA-------------------------
Q7MX37_PORGI/356-463Y.DR..LYE.DN.Y...L..GMSL..SD-EFERI.F..TS.E..SKFVVCLLDKN-------------------------
Q1QLK5_NITHX/3-113F.D.....KEHV.L...V..GEDW..RA-AREQA.Q...D.E..ADLVIHLISPE-------------------------
A4G5B3_HERAR/134-239I.D....VR.SV.P...P..AVDF..QA-ELWHR.M...S.D..VDVIVLIDTPG-------------------------
A9GS07_SORC5/7-118H.E.....G.KV.D...P..GGQP..AA-QVHAQ.L...E.A..AELVVLLVTPA-------------------------
Q2JGW8_FRASC/4-114L.D.....RWEI.R...I..GDTV..SM-FMNET.L...A.V..ADFLVLGYSTL-------------------------
A0B6K5_METTP/5-107T.S.....QFRY.T...C..GISR..TA-WASFG.I...R.S..SECIVPIVTSN-------------------------
A8WVG6_CAEBR/253-355M.D.....I.DN.T...E..ANDL..EE-SLLRD.V...S.S..CKHLVLILTTN-------------------------
A8L8G2_FRASN/4-112Y.NYRVPGH.RT.A...P..GAAW..AP-DIRRN.L...L.V..SEAFIAITTPK-------------------------
B4SA08_PELPB/9-120L.D.....E.EF.QHEIW..GRNL..VE-YLDQT.Y...R.E.RGQFVLVLLSKS-------------------------
C7PX42_CATAD/13-123R.L.....S.WT.A...D..GEDL..GR-TIGDV.L...G.G.GVSCCVVVLSEA-------------------------
Q479U9_DECAR/327-433Y.DKN.EQH.RI.L......AQDV..EE-YLAPI.Y..AS.D..AQFVVCILGPD-------------------------
Q0C0W9_HYPNA/5-105F.N.....Q..S.Q...V..DETF..DP-KDARD.A...T.N..SQSVLVLWSEN-------------------------
B7KMX7_CYAP7/356-465Y.DKN.EQH.RI.L......AENV..EE-YLAPI.Y...RTE..AQFVIVLLGQE-------------------------
C6XN50_HIRBI/11-116T.SF..NPA.SL.P...A....PP..KL-EIEDR.I...A.T..SDTVLFILTPD-------------------------
Q82BJ3_STRAW/346-445LYD.....V.SA.G...P..........-..VER.P...D.A..ATRALVLLSNA-------------------------
C7RUX1_ACCPU/310-422Y.D.....Y.NF.K...S..QTAVPDSD-LLLQH.IY.HD.Q..SDLVVVFLGGN-------------------------
D5SMM7_PLAL2/3-112L.S....TR.DI.D...R..GALW..FS-EIHDQ.L...Q.D..TSVGIVCLTQE-------------------------
YDDK_BACSU/116-233Y.TSS.PYH.GI.P...G..DEDI..FE-YLKKH.L...F.K..GAYVFYMLSDN-------------------------
C7PT18_CHIPD/9-118Y.Y.....A.EN.EIGSW..GSHI.IDL-TIDAY.G...R.Q..ARFVLMITSAT-------------------------
C6XK34_HIRBI/4-106P.P.....A.DS.L...F..IEAD..IE-VFERK.L...Q.E..ANCVIACWTTK-------------------------
Q7UFB2_RHOBA/254-366Y.D.....F.DY.Q...AQLARPN..LD-TLLQR.IY.RD.Q..SDLIVVFLCDE-------------------------
B7KLQ5_CYAP7/3-111V.S.....SEDI.D...K..GKRW..NE-RLSEE.L...K.D..TNFGLICVTKD-------------------------
F1QWA8_DANRE/556-669I.D.....VEKL.E...A..GR.F..EE-KLITS.V...Q.R..ARNFILVLSAN-------------------------
K1QKT6_CRAGI/9-119T.D.....N.NE.P...F..EA....VA-TAENI.E...K.R..CKKVLVVISAA-------------------------
Q2YN91_BRUA2/146-256Y.DN..NYV.SQ.L...A..RPSL..DT-LLQDI.Y..RN.R..CKLIVVFVGDD-------------------------
Q6N9F4_RHOPA/4-114H.D.....R.RI.G...A..GREF..AR-EIDQH.V...E.S..DEIILLLVSAD-------------------------

PF08937

Q12I74_SHEDO/3-119E-A.....KRRS-G---.....GI--EQ-WI.EDQL---K-G--TSVTVVLFGAE-------------------------
A7HHH7_ANADF/34-147P-F.....DSSR-A---D....YI--RQ-KI.GERI---A-Q--SSVTVVFVSSA-------------------------
Q6LJM5_PHOPR/2-127H-IN....RRPP-T---DSASKPV--KQ-EI.SRLL---N-E--SDKLLVLIGPD-------------------------
A4G5B5_HERAR/3-116E-I.....KKKG-D---K....AI--ED-WI.ADNM---K-G--KECLVVLVGEK-------------------------
A0LCB5_MAGMM/7-121P-IH....NAEN-D---K....KL--YE-AI.KDKM---Y-P--VNCVVMLAGVY-------------------------
A4G5B4_HERAR/2-119A-S.....QKES-D---D....VL--KA-FL.RKGL---E-N--TSVTCVLAGAS-------------------------
A3N1I6_ACTP2/3-115E-V.....K.KS-E---N....SI--KK-WI.DDNL---K-N--KSCLVVLIGKQ-------------------------
A1SXM2_PSYIN/2-127H-IN....RRSP-N---DNASNPV--KK-EI.SSLL---A-Q--SDRLLVLVGPD-------------------------
Q122C0_POLSJ/18-136.-......ERRV-D---SDDINYV--MR-RIRENHI---A-G--SSCTIVLVGKD-------------------------
A6LX77_CLOB8/3-127.-......SPDL-T---DTTTENI--KR-HL.KDMM---W-G--TSVTIVIISPN-------------------------
Q9A8E1_CAUCR/8-195P-IF....RDRD-E---LSAAADL--SE-AI.RDAL---D-R--SDTLIILCSSH-------------------------
Q6MN07_BDEBA/5-124T-LR....DGSS-E---E....TI--KR-KL.RERM---N-N--AGLLVVLVGEK-------------------------
Q2NGB5_METST/3-120.-......LTNN-D---YSSDEYI--SN-IINENNI---T-N--TTTTIVLVGPK-------------------------
A1W964_ACISJ/3-116E-V.....KRGG-E---A....AI--KR-WI.DDQL---Q-G--RTCTIVLVGAE-------------------------
Q21ZJ7_RHOFT/6-120.-......SNPN-N---AKSPDYI--KS-EILAPQI---N-W--AGTLLVYVSPK-------------------------
A3N1I7_ACTP2/3-151N-D.....NESL-A---DFKTEYI--RS-KL.ADKI---F-D--SSVTIVLISPN-------------------------
Q82T32_NITEU/4-119S-I.....ASGA-N---Q..DEKI--KR-WI.AEQM---Q-G--RTCTIVLVGTS-------------------------
Q6F1E6_MESFL/3-131.-......GDIN-E---NLPTERI--YQ-IIRDDYL---K-D--SQVTIVLLGLH-------------------------
Q0RX23_RHOJR/5-119.-......ATPN-D---AHAEGYI--RT-IL.ADCI---R-W--AGKIIVIVSPE-------------------------
A3DI79_CLOTH/7-123P-V.....IDPD-D---PVDQKTL--IE-EL.KGQI---R-P--VNCVLILSGMY-------------------------
A6LX79_CLOB8/4-117E-V.....KEKT-D---T....KI--KE-WI.DDQM---A-K--RSCLVVLIGST-------------------------
Q1IIP2_KORVE/3-120K-A.....KKEG-D---Q....AV--KK-II.DNGL---V-G--STALCVLIGKE-------------------------
A6QC47_SULNB/3-134.-......GDID-P---FLRTETI--RQ-KIRDEYL---R-D--STVTVVLIGSE-------------------------
Q122B7_POLSJ/5-119.-......SNPN-N---ASSPDYI--KS-SILAPRI---Q-W--ASVLVVLISQN-------------------------
Q03QQ3_LACBA/2-119Q-VPPVKFQGRG-A---A....AI--RR-QL.RREI---R-Q--THQLLVVVSRE-------------------------
Q8FTW2_COREF/4-118T-V.....RNQS-Q---P....AI--VR-WI.DSQM---S-H--KRAVVVLIGQE-------------------------
Q3Y0J6_ENTFC/3-117K-V.....KRNG-D---I....AI--KN-WI.DNQL---I-G--TSVTVVLIGKE-------------------------
Q3A0F5_PELCD/2-120A-S.....KKES-D---D....SL--KT-FL.REGL---K-N--TSVTCVLAGTD-------------------------
Q31IQ3_THICR/3-119K-V.....KRKG-D---S....AI--KK-WI.DNQL---N-G--TSVTVVLVGAK-------------------------
O86760_STRCO/8-131.-......GDVL-N---SNNRDYI--MR-RVRALYL---G-N--STVTIVMVGKC-------------------------
Q2LRS2_SYNAS/24-142.-......ERQI-G---SDSVTYQ--QQ-VIREQHI---T-G--SSITIVLCGAE-------------------------

PF10137

C6W705_DYAFD/4-121--NE.....DFF-E---N--NKSS--FE-SLSQS-...ST-L--FDFAILLASAD....DVVLKRDN.............
Q21MV2_SACD2/143-262--HE.....QPD-K---G--.QTI--IE-KFESN-...AS-N--VGFAIVLLTPD....DIASS................
D2QVU6_SPILD/4-126--HE.....QPS-K---G--.LTI--IE-KFSDY-...SN-.--VSYAIVLLSAD....DLAHS................
F8B4J3_FRADG/196-328--NE..AVRATG-H---P--TPYI--GE-ILTTA-...FA-S--AQAIVVLLTPD....DDARLAPAFWRPDDPPHERA.
A3CWB8_METMJ/141-285--HK.....QAN-L---G--.KTI--IE-KVEHY-...SN-S--VRFAIILLTGD....DIGAKKNTPHNPPSFQTKKGT
B1M988_METRJ/155-274--AN.....GVF-K---V--TNYT--LE-TLEEE-...LM-Q--SDFAVAVAHPD....DKTEIRDE.............
Q8TKX7_METAC/9-127--YQ.....GIF-G---L--NEGT--LE-SLEKS-...LE-K--FEFAILVLTPD....DVVISRDK.............
Q24ZU3_DESHY/13-134--NK....EGLF-P---L--GEYP--AE-SLRNI-...CQ-Q--VDAAILIFHED....DMTWYRNN.............
E3J264_FRASU/144-263--AD.....QPN-S---G--.QTI--IE-KLEGH-...FE-N--SAFAVILMTAD....DEGRL................
I3UFW1_ADVKW/147-263--HE.....QAN-S---G--.RTI--IE-KIE.W-...HS-G--VGMAVVLLTPD....DVGGK................
A1SX31_PSYIN/148-267--HE.....QPN-A---S--.KTI--IE-KIEAF-...SN-.--VGFGVVIYSPC....DIGGK................
B0UTQ9_HISS2/135-254--HE.....QSS-L---G--.MTI--IE-KIEKY-...TN-.--VGFGIVLYTPC....DKGYE................
M4NKT6_9GAMM/158-276--DQ.....GVF-R---A--SNYT--LE-ELERQ-...LE-Q--ADFAIAVAHAD....DMVISRSD.............
C5BHR5_TERTT/6-125--KN.....GTF-K---L--SSST--ID-DLVEK-...SS-F--VDFALFIFAPD....DISEIRSR.............
Q8XW61_RALSO/85-207--DQ.....LPS-E---G--.QTI--IE-KLEKY-...TA-E--VKFAVVLATPD....DEGY.................
L0HBG8_METFS/245-360--VE.....RES-T---S--.KPV--PD-KVLDD-...MR-S--CFAGVIIINNEGELIDQTGK................
F0ZMV3_DICPU/57-185--FE.....RAN-N---G--.DTI--IE-KLERE-...VD-Q--CSFGIVIVSPD....NIVYSKSK............D
B0UF11_METS4/156-275--KE.....QPD-Q---G--.RTI--IE-KFEQS-...AT-D--VGYAVVLLTPD....DMGGA................
Q12JL6_SHEDO/5-125--RN.....GTF-N---L--SSNA--LD-DLISK-...AK-S--VDFSIFIFSPD....DLTIMKSR.............
Q81W84_BACAN/128-251--HR.....EAN-E---G--.LTV--LE-KFEKH-...SD-.--VQYAFVLLTPD....DIGCSVKE............R
C7PYD3_CATAD/410-541--DE..AVGLLQ-Q---P--MPFL--GR-VLREA-...IP-R--AKAVVVIMTPD....DIVRLHPELAGPSEPGFETG.
C5CLS7_VARPS/123-235--AQ.....EAS-Q---G--.RTI--VE-KLEAE-...AS-S--CDSAVIVMSGD....DTDSA................
R5R263_9FIRM/4-124--CD.....NFF-D---L--GQCT--YH-ELLKK-...SL-S--FDYAIFIGGKD....DYVRRESD.............
R7K6B0_9FIRM/70-191--DQ.....QAS-S---G--.QTI--IE-KLEEY-...GA-D--VGYAIVLATPD....DEG..................
C4ZIE6_THASP/167-285--QS.....DFI-P---G--.RTI--ID-QIEEA-...AS-R--SIAGIFLFTKD....DDLANPS..............
B4S624_PROA2/362-481--AK.....QPH-E---G--.QTI--ID-KFTSN-...AD-.--VAFAIVLLTSD....DNCTE................
K0AW63_CLOA9/134-254--NQ....PGTF-I---A--GNYL--YD-SLIDI-...SK-S--VDAAIFIFNED....DEVWYRGD.............
C7RC53_KANKD/229-343--VE.....KET-A---S--.IPV--PE-KVFED-...MR-E--CSAAVIHLEAEQELLDPEGN................
C7R666_KANKD/7-127--DN......AF-D---L--SSVT--IT-SLIKR-...AK-E--TEFGIFVFHPD....DKTIIREN.............
I4BA92_TURPD/15-129--KD.....QVN-R---G--.RTV--IE-KLEEE-...TD-E--CHYAIIVMTAE....DEQAD................
D5V4Y7_ARCNC/166-284--HL.....QAS-S---G--.MTI--IE-KIEKY-...TN-.--VGYALVLYTPC....DIGTK................
Q6D353_PECAS/127-247--HE.....QAN-V---G--.MTI--IE-KIERY-...TN-D--ADFALVLYTAC....DLGRG................
Q2K8S5_RHIEC/205-324--KE.....QPN-Q---G--.RTI--IE-KYEGC-...AD-E--VGFAVVLLTPD....DVGSA................
R5V068_9FIRM/111-228--HE.....QVN-A---G--.MTI--ME-KIESY-...GN-T--VNAAIILFTPD....DDGKA................
V6KJV2_STRRC/56-188--ED..LVRATG-K---T--APFL--GE-VIAQA-...PA-Q--AQAALVLLTPD....DIVQLHPELRGPNEPPFESE.
D0LNL0_HALO1/453-571--NE.....RPD-Q---G--.ATI--IE-KFERE-...SK-G--VCFAIVLLTPD....DVGGR................
E1W054_ARTAR/175-307--TD..ARQLTN-K---P--SPST--LE-IVKAG-...LM-N--AQAVVVLFTPD....DQARLDKQFVKPSDRSPEKE.
C1DBI6_LARHH/98-222--AN.....TGG-H---G--.LTI--IE-ALEAK-IGKNA-A--SSFGIVLMTPD....DMGYA................
Q9X882_STRCO/76-207--ED..LVRATG-Q---A--SPFL--GD-VVAGA-...PA-Q--AQAALVLLTPD....DVVTLHPELRGHNEPDHETR.
B9TGA1_RICCO/4-125--SN.....GVF-Q---I--SGTT--IY-SLINA-...LR-N--SDFGVFVFSPD....DLTIMRGQ.............
R6JZ57_9CLOT/29-145--AE.....LPD-C---G--.RTI--IE-KFEEQ-...AD-Q--ADIVFVLLTPD....DFNHE................
R5IEF5_9BACT/151-269--HE.....QPN-R---G--.KTI--IE-KIEAF-...SK-.--VCFAIILYTPC....DKGAS................
D5C5H2_NITHN/120-239--LE.....QPD-A---G--CKTV--IE-KFEHY-...AQ-T--CSYAIAVFTPD....DEVTSGND.............
Q47ER9_DECAR/134-252--HE.....QAS-S---G--.KTI--IE-KIEAH-...TN-.--VGFAIVLYTPC....DIGGL................
Q027G3_SOLUE/4-122--TE......IF-H---P--GLLT--FE-ALENV-...LL-R--CCAAVFVASAD....DVTTFRGQ.............
Q9A4X3_CAUCR/154-272--TD.....GVF-K---V--ANYT--LQ-SLEDE-...ID-N--SDFAIAIAHPD....DKVESRQA.............
C1F5N0_ACIC5/154-273--TD.....GVF-R---A--SHYA--IE-SLERA-...LD-Q--SDVAIAVAQPD....DITESRGQ.............
Q8EDI5_SHEON/128-249--HL.....NAS-K---G--.DTI--IK-KLERL-...AE-G--VGYGIVLYTPD....DMGET..K............V
A5I3L4_CLOBH/140-260--TQ.....GIF-K---L--SSNT--LD-DLYNN-...IK-G--MDAGIFIFTPD....DISDIREN.............
B1ZZI8_OPITP/123-242--QE.....QVN-R---G--.MTV--IE-KFEEF-...AS-R--AGFAVVLMTPD....DIGYA................
B2FIX1_STRMK/122-235--ES.....GAR-A---G--.HSI--RD-ILESM-...AA-K--SSFALLVMTGE....DMDAS................
Q6AL85_DESPS/128-241--ET.....GAR-A---G--.HTI--RD-ILEDM-...VN-N--STFALLVMTAE....DEQDT................
D4LTG4_9FIRM/2-122--NE....PEVF-P---L--GAYT--WD-ALIDL-...SE-N--VDAAIFIFGED....DQIWFRGE.............
C5CLS5_VARPS/5-125--DQ.....GVF-D---L--SSTT--IE-SLTKM-...LH-D--SDFAIFVFSAD....DMLKIRKT.............
TIRC_DICDI/55-184--FE.....KPN-N---G--.QTI--IE-KLEKE-...IS-N--CKFGIVIMSPD....NKAFTKKD............S
Q98RD6_MYCPU/91-212--QN.....KTT-R---G--.LSI--LD-GVLED-...IS-S--VSFAFDLLTPD....DKGYS................
J9R4G8_RIEAN/5-130--NEDVWEKAVF-R---L--NNSY--LN-DLIRA-...TL-Q--FDFGILIGTKD....DKVVYRGN.............
R6SAH6_9BACE/4-122--ND.....GIF-Q---F--NEGF--LE-TLLKS-...AS-L--FDFGFMIFAAD....DISRIRNQ.............
Q7MKB6_VIBVY/8-129--SQ.....GVF-N---L--TQST--LS-DLLSA-...LD-T--FDAAIFVMSPD....DVVKMRGQ.............

PF08357

CIKS_HUMAN/410-552I-------FED.-----RIRGIDI--IK-WMERY....LR-D--KTVMIIVAI.SPKYKQDVEG----------------
I17RC_HUMAN/584-737L-------WSRR-----ELSAQGP--VA-WFHAQRRQTLQ-E--GGVVVLLFSPGAVALCSEWL----------------
I17RD_DANRE/355-520L-------WEHL-----EICKEGQ--MS-WLSRR....ID-E--AHFIITVCSKGLKHFVEKRH----------------
I17RA_MOUSE/380-539L-------LEEQ-----VISEVGV--MT-WVSRQKQEMVE-S--NSKIIILCSRGTQAKWKAIL----------------
Q8VUX6_STAHO/2-124K-------WDIN-----K..GQEV--PL-FMERG....IQ-Q--SDFVLIICS....ERYKVNA----------------
Q7UT52_RHOBA/13-152Q-------YDL.-----...KEGQ--DA-NTFMEKVVTDK-T--IDRVLIVSD....ENYAAKA----------------
Q8BPI5_MOUSE/107-257L-------WSRR-----ELSAHGA--LA-WFHHQRRRILQ-E--GGVVILLFSPAAVAQCQQWL----------------
I17RB_HUMAN/332-479K-------WQKK-----KIAEMGP--VQ-WLATQ....KK-A--ADKVVFLLSNDVNSVCDGTC----------------
Q69HQ3_CIOIN/391-538L-------FEQN-----EIFA.DR--CD-WMEKR....MS-Q--AEKVVIVWSAGAIDIWKKCQ----------------
YSO2_CAEEL/415-566L-------EKLI-----TAEQIVP--SR-WLVDQ....IS-S--LKKFIIVVSDCAEKILDTEA----------------
I17RD_HUMAN/356-511L-------WEDF-----SLCREGQ--RE-WVIQK....IH-E--SQFIIVVCSKGMKYFVDKKN----------------
Q543U7_MOUSE/329-476K-------WQKK-----KIAEMGP--VQ-WLTTQ....KQ-A--ADKVVFLLPSDVPTLCDSAC----------------
I17RE_RAT/448-585L-------WEGT-----HVARIGP--LP-WLWAARERVAR-E--QGTVLLLWS......CAGPS----------------
I17RD_CHICK/358-512L-------WEDL-----KICKESQ--KE-WLIKK....IN-E--SQFIIIVCSKGMKYFVEKKN----------------
Q73LP6_TREDE/1-127K-------WDL.-----...SAGQ--DK-YAFMEQMIQDS-S--IDHVLIMLN....REYKQKS----------------

PF01582

B9N1N5_POPTR/14-194--------------YA----S-------S------------K..WCL--E-E----LA----------------------
B9S6Z7_RICCO/19-198--------------YA----D-------S------------P..WCL--D-E----LV----------------------
B9S9D9_RICCO/12-191--------------YA----C-------S------------A..WCL--D-E----LV----------------------
B9SBW2_RICCO/15-195--------------YA----F-------S------------P..WCL--D-E----LV----------------------
D7KR54_ARALL/8-188--------------YA----A-------S------------P..WCL--D-E----LV----------------------
D7MRD9_ARALL/8-185--------------YA----T-------S------------K..WCL--D-E----LV----------------------
D7UDZ7_VITVI/24-202--------------YA----S-------S------------R..WCL--E-E----LV----------------------
F4IFF6_ARATH/55-233--------------YA----S-------S------------S..WCL--N-E----LV----------------------
F6I7C7_VITVI/9-189--------------YA----S-------S------------R..WCL--E-E----LV----------------------
I1KE95_SOYBN/20-200--------------YA----S-------S------------T..WCL--R-E----LA----------------------
I1MD01_SOYBN/13-191--------------YA----S-------S------------K..WCL--E-E----VV----------------------
TLR4_HUMAN/676-839--------------FI----Q-------S------------R..WCI--F-E----YE----------------------
TLR5_HUMAN/695-858--------------FL----R-------D------------G..WCL--E-A----FS----------------------
I18RA_HUMAN/410-598--------------YV----N-------G------------P...SI--F-E----LQ----------------------
ILRL1_MOUSE/384-567--------------MM----H-------S------------K..EFA--Y-E----QE----------------------
IL18R_HUMAN/377-541--------------YM----S-------N------------E...VR--Y-E----LE----------------------
ILRL2_HUMAN/385-575--------------SL----G-------F------------GLLKNL--S-E----EQ----------------------
IL1AP_HUMAN/407-570--------------YV----L-------Q------------G.TQAL--L-E----LK----------------------
I18RA_MOUSE/409-597--------------YL----N-------G------------P...RV--F-E----LQ----------------------
Q9ZVX6_ARATH/11-188--------------YA----S-------S------------T..WCL--N-E----LL----------------------
F4J361_ARATH/93-270--------------YA----S-------S------------S..WCL--D-E----LA----------------------
M4E4G7_BRARP/12-187--------------YA----S-------S------------S..WCL--D-E----LV----------------------
Q9SSN5_ARATH/8-185--------------YA----A-------S------------S..WCL--D-E----LV----------------------
RPS4C_ARATH/16-186--------------YT----E-------S------------V..WCV--R-E----LE----------------------

PF13676

Q47BW0_DECAR/4-104--------------SI....E.------S............E..WVY..E.E....AT----------------------
C3Y619_BRAFL/689-797--------------YA....E.------S............T..NCN..H.E....IN----------------------
C3Y619_BRAFL/881-989--------------YT....L.------S............A..NCR..R.E....IS----------------------
E3I8M0_RHOVT/4-107--------------SV....K.------S............D..WVL..A.E....AG----------------------
C3ZXI7_BRAFL/383-491--------------AA....T.------S............P..FVF..N.E....VA----------------------
A7S5P1_NEMVE/555-656--------------YK....E.------S............P..NCR..S.E....AE----------------------
A7S5P1_NEMVE/1014-1115--------------YQ....D.------S............P..NCR..S.E....AE----------------------
A8L2Q4_FRASN/29-136--------------YL....D.------S............V..FGR..L.E....LQ----------------------
E3JD12_FRASU/19-126--------------YL....S.------S............V..YGQ..S.E....WQ----------------------
E3IW96_FRASU/15-122--------------YL....G.------S............V..YGA..Q.E....WR----------------------
Q0REH0_FRAAA/6-113--------------YL....R.------SLD.......DTPE..WQA..A.F....AA----------------------
A1BEX3_CHLPD/90-190--------------SV....T.------S............E..WVI..A.E....AD----------------------
E3J785_FRASU/17-124--------------YL....D.------S............V..YGQ..A.E....WL----------------------
Q2JBL6_FRASC/19-126--------------YL....T.------S............I..YGH..A.E....WQ----------------------
Q0RGM6_FRAAA/6-113--------------YL....R.------S............V..YGQ..A.E....WE----------------------
C6XNE0_HIRBI/4-104--------------SI....S.------A............P..WVK..E.E....AG----------------------
Q0RIN9_FRAAA/22-129--------------YL....K.------S............A..YGE..A.E....WQ----------------------
E3J7J7_FRASU/27-134--------------YL....T.------S............V..YGR..A.E....WQ----------------------
Q0RPX4_FRAAA/13-120--------------YL....T.------S............V..YGQ..E.E....WG----------------------
A8L235_FRASN/21-128--------------YT....H.------S............V..YGA..A.E....WR----------------------
Q82CN6_STRAW/36-142--------------SV....R.------S............A..PAM..N.EY.AVLA----------------------
Q0RPX3_FRAAA/13-120--------------YL....S.------S............V..YGG..E.E....WR----------------------
Q21Z38_RHOFT/11-111--------------SV....R.------S............T..FVR..D.E....SS----------------------
Q0RFT3_FRAAA/25-132--------------YL....D.------S............V..YGE..Q.E....WQ----------------------
E3IX94_FRASU/15-122--------------YL....G.------S............V..FGV..G.E....WH----------------------
B3S2N0_TRIAD/460-568--------------SA....A.------S............P..FVY..Q.E....VL----------------------
A8LGL3_FRASN/20-127--------------YL....A.------S............A..YAE..A.E....WA----------------------
E3IX60_FRASU/26-133--------------YL....T.------S............A..FSE..A.Q....WQ----------------------
B4SC53_PELPB/96-199--------------SV....D.------LN.........KHH..WVR..E.E....AE----------------------
Q0RTF6_FRAAA/29-136--------------YV....S.------S............A..FAE..A.E....WQ----------------------
Q0RIT4_FRAAA/69-176--------------YI....K.------F............A..YGQ..P.E....WE----------------------
A8KXQ9_FRASN/9-116--------------YL....R.------A............P..SVQ..S.E....WR----------------------
E3J7Y1_FRASU/19-126--------------YC....T.------S............M..IVA..V.E....WQ----------------------
D2SAJ1_GEOOG/13-119--------------YF....A.------S............V..FGG..A.E....LR----------------------
A8L102_FRASN/20-127--------------YL....G.------S............R..FGA..A.E....WQ----------------------
Q028E9_SOLUE/5-105--------------SI....E.------S............D..FVF..D.E....AR----------------------
A7ST59_NEMVE/24-124--------------YQ....R.------A............P..YCT..E.L....AN----------------------
A7ST59_NEMVE/413-519--------------YQ....Q.------S............V..NCN..L.E....LK----------------------
Q2JEN2_FRASC/35-142--------------YL....S.------S............A..FAE..A.E....WQ----------------------
A7HHI0_ANADF/4-104--------------SR....D.------K............V..WVL..D.E....AR----------------------
D2B0U4_STRRD/14-121--------------YL....T.------S............L..FTR..A.E....WT----------------------
E3JD26_FRASU/17-124--------------YL....A.------D............S..YGK..T.E....WQ----------------------
A8DUR5_NEMVE/387-495--------------SA....T.------S............V..FVY..S.E....LL----------------------
C3Z670_BRAFL/206-314--------------YT....E.------S............D..NCR..N.E....VA----------------------
A8L472_FRASN/36-137--------------YF....A.------S............H..WCT..Q.E....WT----------------------
O86768_STRCO/8-114--------------YF....E.------D............E.RWTT..E.E....WT----------------------
C3YB32_BRAFL/1078-1172--------------YK....D.------T............G..RCK..R.V....AQ----------------------
Q2W1R2_MAGSA/34-139--------------YR....A.------S............V..NCQ..R.E....WS----------------------
E3IUH8_FRASU/87-194--------------YI....E.------S............V..FEQ..E.A....WQ----------------------
E3JB70_FRASU/15-122--------------YL....DR------S............S..WVR..E.E....WQ----------------------
D9SFF3_GALCS/4-108--------------AC....A.------S............P..WVM..Q.E....MG----------------------
C6XQ37_HIRBI/5-107--------------CN....N.------S............K..QLK..K.E....LA----------------------
Q3SW17_NITWN/99-207--------------SV....G.------K............P..WVN..Q.E....MD----------------------
C4ZIJ8_THASP/6-119--------------FL....N.------S............D..YIW.GK.E....LA----------------------
C7RV87_ACCPU/4-106--------------SA....S.------S............S..YVT..F.E....WA----------------------
B6JHA2_OLICO/99-207--------------SI....T.------K............P..WVN..Q.E....MD----------------------
D2B0U5_STRRD/10-115--------------YV....A.------S............E..MAA..R.T....AA----------------------
C7RQ25_ACCPU/133-235--------------AN....T.------N............D..WVR..L.E....YL----------------------
Q2J5A8_FRASC/18-127--------------YL....A.------S............V..GAA..A.Q....WQ----------------------
Q2NDU5_ERYLH/20-120--------------ST....K.------S............H..WVH..D.E....AM----------------------
A8L863_FRASN/19-126--------------YL....V.------S............A..MES..A.Q....WQ----------------------
Q2JGC9_FRASC/4-109--------------YN....A.------S............P..WCA..Y.E....LG----------------------
Q9L0M8_STRCO/8-114--------------YF....E.------P............K.RWTR..E.E....WS----------------------
Q0RFV3_FRAAA/13-120--------------YL....A.------S............ATRGAE..W.E....VG----------------------
B3QZ81_CHLT3/7-115--------------YF....N.------S............R..YTV..S.E....WE----------------------
Q0RPP6_FRAAA/10-118--------------YL....D.------S............P..VAQ..T.V....WR----------------------
Q8CJY8_STRCO/19-125--------------YF....D.------P...........AR..WTR..E.E....WT----------------------
C3ZQ01_BRAFL/737-845--------------YA....E.------S............K..NCR..D.E....VA----------------------
Q0RIR9_FRAAA/18-121--------------FL....R.------S............A..GAG..A.E....WQ----------------------
B0CFH1_ACAM1/694-807--------------FI....A.------S............D..YCY..EVE....MS----------------------
E3J0G5_FRASU/353-460--------------YL....A.------S............S..EVR..A.A....WQ----------------------
D3B3K4_POLPA/805-907--------------SS....I.------S............L..WCR..K.E....LK----------------------
Q0RRH7_FRAAA/33-134--------------YF....D.------T............P..WSS..Q.V....WT----------------------
E3J6F2_FRASU/4-111--------------GV....T.------A............P..WIT..R.E....WA----------------------
A9FJE9_SORC5/5-116--------------FL....A.------S............D..SCY..ERE....LG----------------------
A8LGX9_FRASN/19-119--------------AE....K.------S............E..WVE..R.E....IL----------------------
B3S8Y4_TRIAD/187-291--------------YG....K.------T............Q..WTN..R.E....IK----------------------
B3E9D8_GEOLS/5-116--------------SV....T.------K............R.GFVQ..R.E....AN----------------------
C3YRI2_BRAFL/372-473--------------YK....E.------S............A..NCR..G.E....CE----------------------
D2QTN1_SPILD/23-136--------------FI....A.------S............D..YCY..KNE....VI----------------------
A9VAD9_MONBE/378-481--------------YA....Q.------S............R..HCM..L.E....AQ----------------------
C3YBW8_BRAFL/463-564--------------YK....E.------S............P..NCR..T.E....AE----------------------
B2IVL0_NOSP7/8-109--------------SV....K.------S............A..LLK..S.L....AL----------------------
Q0RIX3_FRAAA/21-122--------------LF....D.------A............P..WCT..L.E....WA----------------------
E3I8Q6_RHOVT/4-115--------------WL....S.------S............R..WCL..N.E....MN----------------------
Q01GF4_OSTTA/482-587--------------YK....E.------S............Q..ACR..T.E....AE----------------------
Q8YVL7_NOSS1/8-109--------------SV....K.------S............A..LLT..N.L....AA----------------------
A8WVG1_CAEBR/367-484--------------SL....D.------RLLND....DNCED..WVH..K.E....LK----------------------
A9GSK2_SORC5/1147-1260--------------FV....A.------S............D..YCF..DGE....MR----------------------
D1A5Y5_THECD/4-128--------------WA....R.------DPRL.....RKADD..WVR..R.E....LL----------------------
A9GWR7_SORC5/353-464--------------FL....A.------S............D..FCY..DVE....MQ----------------------
E3I131_RHOVT/20-126--------------YL....E.------S............D..HCL..G.E...ALN----------------------
Q488J9_COLP3/4-122--------------SI....G.------DKVNN....IAGSS..EVA..K.E....VV----------------------
C4ZM27_THASP/14-137--------------WL....D.------ARDGRGRRLDDPGD..YVR..R.E....VE----------------------
D2SB43_GEOOG/12-118--------------DP....E.------L............A.VFSR..A.E....LS----------------------
Q0RSZ9_FRAAA/6-111--------------YN....T.------S............P..WCA..Y.E....IG----------------------
D2SB14_GEOOG/4-110--------------AT....A.------S............R..WCF..A.E....LS----------------------
B0C5U4_ACAM1/223-330--------------AV....G.------S............E..MVQ..G.E....VE----------------------
B4HIY9_DROSE/842-958--------------AL....H.------RCIND....EDCKD..WVH..R.E....IV----------------------
A7SAI7_NEMVE/4-114--------------YS....E.------S............K..NCK..K.E....LS----------------------
B1ZSG7_OPITP/145-246--------------FH....Q.------S............D..WTD..Q.E....VG----------------------
C1EBU5_MICSR/479-580--------------YR....E.------S............Q..ACR..T.E....AE----------------------
C3ZH48_BRAFL/391-492--------------YK....D.------S............P..NCR..T.E....AE----------------------
Q099H8_STIAD/11-117--------------GWGPVQD.------S............E..MQN..A.Q....YR----------------------
C1N563_MICPC/155-256--------------YK....E.------S............Q..ACR..T.E....AE----------------------
A8KZ03_FRASN/14-119--------------YL....D.------A............I..HGE..S.E....SQ----------------------
C3YRI0_BRAFL/374-476--------------YK....E.------S............A..NCR..R.E....CE----------------------
Q08W08_STIAD/272-383--------------FL....A.------S............N..YCW..DIE....LK----------------------
B5GMC1_STRC2/51-156--------------TM....A.------D............A..AIR..D.EYAALLQ----------------------
A9GWR0_SORC5/11-122--------------FL....S.------T............D.AWLS..P.E....MR----------------------
C3ZI71_BRAFL/547-647--------------YV....I.------S............D..NCK..R.E....AN----------------------
B2IT96_NOSP7/9-118--------------GLG.PWQ.------S............Q..EMR..A.F....LN----------------------
B9M1H6_GEODF/3-109--------------GL....G.------N............E..RLM..W.E....WR----------------------
A1W966_ACISJ/133-236--------------YF....E.------S............R..WTS..A.E....FG----------------------
A8ZZH8_DESOH/82-183--------------FH....D.------S............L..WTD..Q.E....VG----------------------
D5SSN8_PLAL2/117-218--------------FK....E.------S............D..WCV..Q.E....VG----------------------
A8L7D9_FRASN/338-442--------------YL....R.------S............A..EAM..E.R....WR----------------------
B9M1I3_GEODF/4-102--------------AR....V.------K............A..TYA..A.E....LQ----------------------
B7KBK1_CYAP7/4-116--------------SL....R.------S............N..WVI..F.E....LG----------------------
C3XYH4_BRAFL/100-210--------------FL....N.------K............P.YWPR..L.E....FE----------------------
Q10WW3_TRIEI/118-233--------------SA....Q.------S............E..LLT..Y.Q....VQ----------------------
A8IF66_CHLRE/788-889--------------YK....E.------S............Q..ACR..A.E....AE----------------------
Q0C4A7_HYPNA/4-101--------------AV....R.------S............K..WVR..Q.D....VE----------------------
Q7NE51_GLOVI/173-287--------------SL....Q.------S............G..WIE..Q.E....VE----------------------
B1W250_STRGG/340-445--------------YL....K.------S............Q..RAVELW.ER..TAT----------------------
Q0RNC1_FRAAA/414-526--------------YR....A.------PV.........PED..PGT..T.E....TE----------------------
Q8TM16_METAC/5-107--------------GV....L.------S............P..EVN..Q.E....IG----------------------
B1ZQ16_OPITP/12-113--------------TL....S.------R............A.LSVG..N.E....VG----------------------
E3J6T1_FRASU/274-377--------------YL....K.------SNP........FGE..VWK..R.E....WE----------------------
Q0RUF2_FRAAA/4-111--------------GI....H.------A............P..WVA..Q.E....FL----------------------
B2J3V1_NOSP7/6-112--------------RW....Q.------S............W..ELR..S.L....IN----------------------
Q47DY5_DECAR/7-118--------------YC....K.------K............L..WTN..H.E....RK----------------------
C3YU72_BRAFL/10-119--------------CF....D.------V............DRTWIR..T.E....WE----------------------
C9YT07_STRSW/352-458--------------YL....R.------S............SRFRTT..W.E....AV----------------------
Q7MX37_PORGI/356-463--------------HK....K.------K............I..WPT..F.E....RD----------------------
Q1QLK5_NITHX/3-113--------------MQ....S.------R............A.GEVQ..R.E....IK----------------------
A4G5B3_HERAR/134-239--------------FR....E.------G............R..WTS..A.E....LA----------------------
A9GS07_SORC5/7-118--------------FI....A.------S............D.RHMH..E.E....AA----------------------
Q2JGW8_FRASC/4-114--------------GI....H.------T............P..WIV..Q.E....WL----------------------
A0B6K5_METTP/5-107--------------SI....F.------S............R..TVN..M.E....IG----------------------
A8WVG6_CAEBR/253-355--------------SL....E.------P............D..QMP..K.E....LD----------------------
A8L8G2_FRASN/4-112--------------AL....D.------.............E..WCS..T.E....VA----------------------
B4SA08_PELPB/9-120--------------YR....D.------K............G..FTK..V.E....LF----------------------
C7PX42_CATAD/13-123--------------FL....A.------A...........AD..YSP..Q.Q....WR----------------------
Q479U9_DECAR/327-433--------------YP....K.------K............I..WTK..F.E....SS----------------------
Q0C0W9_HYPNA/5-105--------------AV....K.------S............D..WVR..A.A....AS----------------------
B7KMX7_CYAP7/356-465--------------YP....K.------R............I..WTK..F.E....SE----------------------
C6XN50_HIRBI/11-116--------------AL....N.------D............S..KAT..S.E....LE----------------------
Q82BJ3_STRAW/346-445--------------FQ....K.------S............R..YGE..D.V....WR----------------------
C7RUX1_ACCPU/310-422--------------YQ....G.------K............E..WCG..L.E....WR----------------------
D5SMM7_PLAL2/3-112--------------NR....Q.------R............P..WIL..F.ES.GALA----------------------
YDDK_BACSU/116-233--------------YY....D.------S............V..YCL..N.E....MG----------------------
C7PT18_CHIPD/9-118--------------FV....N.------K............Y..WSG..L.EK..LIA----------------------
C6XK34_HIRBI/4-106--------------SL....S.------S............S..FLK..T.S....AK----------------------
Q7UFB2_RHOBA/254-366--------------YA....K.------K............Q..WCG..L.E....WR----------------------
B7KLQ5_CYAP7/3-111--------------NQ....T.------S............P..WLN..F.E....AG----------------------
F1QWA8_DANRE/556-669--------------AL....D.------KCMGD....VAMKD..WVH..K.E....IV----------------------
K1QKT6_CRAGI/9-119--------------SL....E.------S............D..LFH..F.Q....LK----------------------
Q2YN91_BRUA2/146-256--------------YQ....R.------K............D..WCG..V.E....FR----------------------
Q6N9F4_RHOPA/4-114--------------FL....A.------S............D..YCY..EKE....ML----------------------

PF08937

Q12I74_SHEDO/3-119--------------T.----YD......R------------T--WVR--H-E----IK......................
A7HHH7_ANADF/34-147--------------T.----HR......S------------R--WVD--W-E----IR......................
Q6LJM5_PHOPR/2-127--------------T.----HS......S------------L--WVQ--W-E----INAF....................
A4G5B5_HERAR/3-116--------------T.----AS......R------------R--WVK--H-E----IK......................
A0LCB5_MAGMM/7-121--------------S.----TH......S------------K--WIN--N-E----IK......................
A4G5B4_HERAR/2-119--------------T.----WS......R------------R--WVR--Y-E----IA......................
A3N1I6_ACTP2/3-115--------------T.----SE......R------------E--WVK--Y-E----IK......................
A1SXM2_PSYIN/2-127--------------T.----HS......S------------L--WVQ--W-E----INAF....................
Q122C0_POLSJ/18-136--------------T.----WG......R------------K--YVD--W-E----IM......................
A6LX77_CLOB8/3-127--------------I.----KK......S------------K--WID--W-E----IE......................
Q9A8E1_CAUCR/8-195--------------A.----AT......S------------R--WVD--K-E----VAHFLTLRGADHMISVIAPGAPEG
Q6MN07_BDEBA/5-124--------------TR----NL......Y------------K--YVR--W-E----IE......................
Q2NGB5_METST/3-120--------------T.----YK......R------------K--HID--W-D----IY......................
A1W964_ACISJ/3-116--------------T.----AN......R------------P--WIR--Y-E----IE......................
Q21ZJ7_RHOFT/6-120--------------T.----KD......S------------D--WVN--W-E----IE......................
A3N1I7_ACTP2/3-151--------------M.----KDVWKSEND------------Q--WIP--W-E----IA......................
Q82T32_NITEU/4-119--------------T.----AN......R------------K--WIN--H-E----IV......................
Q6F1E6_MESFL/3-131--------------T.----NH......R------------K--HID--R-E----IA......................
Q0RX23_RHOJR/5-119--------------T.----RN......H------------E--WVD--W-E----IE......................
A3DI79_CLOTH/7-123--------------A.----AY......S------------F--WIQ--K-E----ID......................
A6LX79_CLOB8/4-117--------------T.----SG......R------------K--WIN--Y-E----IE......................
Q1IIP2_KORVE/3-120--------------T.----YT......R------------R--WVD--Y-E----IL......................
A6QC47_SULNB/3-134--------------T.----WK......R------------K--HVD--W-E----IA......................
Q122B7_POLSJ/5-119--------------T.----QH......S------------E--YVN--W-E----IE......................
Q03QQ3_LACBA/2-119--------------T.----WQ......S------------E--WTD--W-E----IA......................
Q8FTW2_COREF/4-118--------------T.----AS......R------------D--WVK--Y-E----IK......................
Q3Y0J6_ENTFC/3-117--------------T.----LD......R------------E--YVK--Y-E----IQ......................
Q3A0F5_PELCD/2-120--------------T.----WS......R------------R--WVR--Y-E----IA......................
Q31IQ3_THICR/3-119--------------T.----CS......S------------R--WVK--Y-E----IE......................
O86760_STRCO/8-131--------------T.----WA......R------------R--YVD--W-E----IA......................
Q2LRS2_SYNAS/24-142--------------T.----WK......R------------R--WID--W-E----IH......................

PF10137

C6W705_DYAFD/4-121..............LE----I-------S------------ARDNVL--F-E----FG----------------------
Q21MV2_SACD2/143-262KATPE.......D.TM----P-------R------------ARQNVV--L-E----LG----------------------
D2QVU6_SPILD/4-126KHEND.......EKSR----Y-------R------------ARQNVI--L-E----LG----------------------
F8B4J3_FRADG/196-328..............YT----G-------Q------------PRANVL--F-E----AG----------------------
A3CWB8_METMJ/141-285LIANDQWKNAILDNLK----K-------R------------ARQNVI--F-E----FG----------------------
B1M988_METRJ/155-274..............EW----P-------T------------PRDNVV--F-E----LG----------------------
Q8TKX7_METAC/9-127..............VV----Q-------L------------PRDNVL--F-E----LG----------------------
Q24ZU3_DESHY/13-134..............YV----L-------K------------PRDNVV--Y-E----YG----------------------
E3J264_FRASU/144-263KGSAD.........LQ----S-------R------------ARQNVI--L-E----LG----------------------
I3UFW1_ADVKW/147-263..TGE.......D.LK----P-------R------------VRQNVL--L-E----LG----------------------
A1SX31_PSYIN/148-267NKDNP.......E.LA----G-------R------------ARQNVV--F-E----HG----------------------
B0UTQ9_HISS2/135-254KDSPK.......E.IK----S-------R------------ARQNVV--F-E----HG----------------------
M4NKT6_9GAMM/158-276..............EW----P-------A------------MRDNVV--F-E----LG----------------------
C5BHR5_TERTT/6-125..............KE----H-------V------------VRDNVI--F-E----MG----------------------
Q8XW61_RALSO/85-207RAGHE.......DEKA----F-------R------------ARQNVV--M-E----LG----------------------
L0HBG8_METFS/245-360..............TH----K-------K------------INDNVL--I-E----IG----------------------
F0ZMV3_DICPU/57-185SQTYN.........EM----A-------Y------------PRLNVI--F-E----FG----------------------
B0UF11_METS4/156-275KTTEE.........QD----T-------R------------ARQNVI--F-E----LG----------------------
Q12JL6_SHEDO/5-125..............EK----Y-------A------------VRDNVV--F-E----LG----------------------
Q81W84_BACAN/128-251AKSVE.......E.YS----F-------R------------ARQNVI--F-E----LG----------------------
C7PYD3_CATAD/410-541..............HS----M-------Q------------ARPNVL--I-E----LG----------------------
C5CLS7_VARPS/123-235..............GN----P-------R------------VRENVM--H-E----IG----------------------
R5R263_9FIRM/4-124............RTHK----Y-------A------------ARDNVY--L-E----FG----------------------
R7K6B0_9FIRM/70-191KAVNE.......ESYK----F-------R------------VRQNVV--L-E----LG----------------------
C4ZIE6_THASP/167-285............EAHQ----S-------V------------PRDNVV--F-E----AG----------------------
B4S624_PROA2/362-481NHNG........SSPR----L-------R------------ARQNVI--F-E----LG----------------------
K0AW63_CLOA9/134-254..............ML----N-------Q------------ARDNVL--I-E----YG----------------------
C7RC53_KANKD/229-343..............KH----S-------K------------INENVL--I-E----IG----------------------
C7R666_KANKD/7-127..............EY----S-------T------------VRDNVL--F-E----LG----------------------
I4BA92_TURPD/15-129..............GT----I-------R------------ARQNVV--H-E----IG----------------------
D5V4Y7_ARCNC/166-284RDSLI.........YK----R-------R------------ARQNVV--F-E----HG----------------------
Q6D353_PECAS/127-247GDEPN.......P.PK----F-------R------------ARQNVV--F-E----HG----------------------
Q2K8S5_RHIEC/205-324AAATG.........QA----Q-------R------------ARQNVI--F-E----LG----------------------
R5V068_9FIRM/111-228..KKE.......EVLK----N-------R------------ARQNVV--F-E----AG----------------------
V6KJV2_STRRC/56-188..............PT----G-------Q------------PRPNVL--I-E----LG----------------------
D0LNL0_HALO1/453-571..IGD.......D.SQ----L-------R------------ARQNVI--F-E----LG----------------------
E1W054_ARTAR/175-307..............LT----G-------Q------------ARQNVI--L-E----AG----------------------
C1DBI6_LARHH/98-222LSKGQ.......DSAQ----P-------R------------ARQNVV--L-E----MG----------------------
Q9X882_STRCO/76-207..............PV----C-------Q------------PRPNVL--I-E----LG----------------------
B9TGA1_RICCO/4-125..............QN----P-------V------------VRDNVI--F-E----LG----------------------
R6JZ57_9CLOT/29-145..............NQ----A-------R------------ARQNVI--F-E----LG----------------------
R5IEF5_9BACT/151-269KDSHD.........LL----P-------R------------ARQNVV--F-E----HG----------------------
D5C5H2_NITHN/120-239..............KY----L-------Q------------ARPNVI--Y-E----LG----------------------
Q47ER9_DECAR/134-252ASEKA.........QK----S-------R------------ARQNVV--F-E----HG----------------------
Q027G3_SOLUE/4-122..............CI----H-------T------------PRANVM--L-E----FG----------------------
Q9A4X3_CAUCR/154-272..............QW----P-------Q------------PRDNVI--F-E----LG----------------------
C1F5N0_ACIC5/154-273..............QR----A-------T------------PRDNVI--F-E----LG----------------------
Q8EDI5_SHEON/128-249KAVQH.......E.LQ----P-------R------------ARQNVV--F-E----HG----------------------
A5I3L4_CLOBH/140-260..............SV----S-------V------------VRDNVI--F-E----LG----------------------
B1ZZI8_OPITP/123-242ANHEG.......D.KK----P-------R------------PRQNVI--L-E----LG----------------------
B2FIX1_STRMK/122-235..............GE----M-------R------------ARQNVI--H-E----AG----------------------
Q6AL85_DESPS/128-241..............GQ----L-------R------------ARQNVI--H-E----IG----------------------
D4LTG4_9FIRM/2-122..............ST----M-------T------------VRDNVL--L-E----YG----------------------
C5CLS5_VARPS/5-125..............ES----L-------S------------VRDNVM--F-E----FG----------------------
TIRC_DICDI/55-184NSDYV.........EI----A-------Y------------PRLNVV--F-E----FG----------------------
Q98RD6_MYCPU/91-212NLDGE.......SKTL----P-------R------------ARQNVI--F-E----MG----------------------
J9R4G8_RIEAN/5-130..............EE----L-------Q------------PRDNIL--F-E----LG----------------------
R6SAH6_9BACE/4-122..............EY----N-------T------------ARDNVL--F-E----YG----------------------
Q7MKB6_VIBVY/8-129..............EQ----T-------V------------TRDNVL--F-E----LG----------------------

PF08357

CIKS_HUMAN/410-552--------------AE----SQLDEDEHGL...........HTKYIH--R------MM----------------------
I17RC_HUMAN/584-737--------------QD----GVSGPGAHGP...........HDAFRA--S------LS----------------------
I17RD_DANRE/355-520--------------RK----GKATSKEKNREPSASDSSSSSRDLFIV--A------SA----------------------
I17RA_MOUSE/380-539--------------GW----AEPAVQLRCDHW......KPAGDLFTA--A------MN----------------------
Q8VUX6_STAHO/2-124--------------DK----RRGGSGYEAR..............LMS--D------EV----------------------
Q7UT52_RHOBA/13-152--------------DG----RKGGVGTESQIITQKLYKDIEETRFIP--I------LK----------------------
Q8BPI5_MOUSE/107-257--------------QL----QTVEPGP..............HDALAA--W------LS----------------------
I17RB_HUMAN/332-479--------------GK----SEGSPSENSQ............DLFPL--A------FN----------------------
Q69HQ3_CIOIN/391-538--------------NQ----QDAFEVTN.............SDFFTP--V------VK----------------------
YSO2_CAEEL/415-566--------------SE----THQLVQARPF...........ADLFGP--A------ME----------------------
I17RD_HUMAN/356-511--------------YK----HKGGGRGSGK...........GELFLV--A------VS----------------------
Q543U7_MOUSE/329-476--------------GH----NEGSARENSQ............DLFPL--A------FN----------------------
I17RE_RAT/448-585--------------TA----CSGDPQTASL................R--T------LS----------------------
I17RD_CHICK/358-512--------------WK----HRGVTKDTGK...........GELFLF--A------VF----------------------
Q73LP6_TREDE/1-127--------------DE----RKGGVGTEAQIISSDLYNKVDQTKFIP--I------VI----------------------

PF01582

B9N1N5_POPTR/14-194-----------------------------------KILECKK.VK------GQ---------MVIPVF-------YR---
B9S6Z7_RICCO/19-198-----------------------------------HIMECKR.AH------GQ---------IVLPVF-------YR---
B9S9D9_RICCO/12-191-----------------------------------TILQCNK.EM------GQ---------VVLPVF-------YE---
B9SBW2_RICCO/15-195-----------------------------------KILECKK.TV------GQ---------IVLPVF-------YH---
D7KR54_ARALL/8-188-----------------------------------KIMDFEN.KG------SI---------TVMPIF-------YG---
D7MRD9_ARALL/8-185-----------------------------------EILKCKE.EL------GQ---------IVIPIF-------YD---
D7UDZ7_VITVI/24-202-----------------------------------KILECKE.NK------GQ---------TVLPIF-------YH---
F4IFF6_ARATH/55-233-----------------------------------EIMKCRK.ML------DQ---------TVMTIF-------YE---
F6I7C7_VITVI/9-189-----------------------------------KILECKK.TK------GQ---------VVLPIF-------YQ---
I1KE95_SOYBN/20-200-----------------------------------HIWNCFQ.PS------TR---------HLLPIF-------YD---
I1MD01_SOYBN/13-191-----------------------------------KIIECMH.SN------KQ---------IVIPVF-------YN---
TLR4_HUMAN/676-839-----------------------------------IAQTWQFLSS------RA---------GIIFIV-------LQ---
TLR5_HUMAN/695-858-----------------------------------YAQGRCLSDL------NS---------ALIMVV-------VG---
I18RA_HUMAN/410-598-----------------------------------AAVNLALDDQ------TL---------KLILIK-------FC---
ILRL1_MOUSE/384-567-----------------------------------IALHSALIQN------NS---------KVILIE-------ME---
IL18R_HUMAN/377-541-----------------------------------SGLHEALVER------KI---------KIILIE-------FT---
ILRL2_HUMAN/385-575-----------------------------------IAVYSALIQD------GM---------KVILIE-------LE---
IL1AP_HUMAN/407-570-----------------------------------AGLENMASRG------NI---------NVILVQ-------YK---
I18RA_MOUSE/409-597-----------------------------------AAVNLALVDQ------TL---------KLILIK-------FC---
Q9ZVX6_ARATH/11-188-----------------------------------EILKCRE.DI------GQ---------IVMTVF-------YG---
F4J361_ARATH/93-270-----------------------------------EIMKCRE.LL------GQ---------IVMTIF-------YE---
M4E4G7_BRARP/12-187-----------------------------------EIMKCRK.ED------QQ---------KVMTIF-------YE---
Q9SSN5_ARATH/8-185-----------------------------------TIMDFEK.KG------SI---------TVMPIF-------YG---
RPS4C_ARATH/16-186-----------------------------------KIKDCTD.EG------TL---------VAIPIF-------YK---

PF13676

Q47BW0_DECAR/4-104-----------------------------------EG......RR......LG......K...LVPVL.......IE...
C3Y619_BRAFL/689-797-----------------------------------LA......NL......LN......K..PIIPLL.......VE...
C3Y619_BRAFL/881-989-----------------------------------LA......DA......LR......K..PIVPLL.......LQ...
E3I8M0_RHOVT/4-107-----------------------------------YA......AR......LK......K...LIPII.......VG...
C3ZXI7_BRAFL/383-491-----------------------------------FA......EW......LN......R..TIVTAL.......FK...
A7S5P1_NEMVE/555-656-----------------------------------YS......FQ......LR......K..DIIPLM.......ME...
A7S5P1_NEMVE/1014-1115-----------------------------------YA......FQ......RR......K..KIVPLM.......ME...
A8L2Q4_FRASN/29-136-----------------------------------SA......INQDPLGFAR......K...LVPIR.......VA...
E3JD12_FRASU/19-126-----------------------------------AA......HRADPSGFAR......K...LLPVR.......IE...
E3IW96_FRASU/15-122-----------------------------------SA......QVADPGGFAR......K...LLPIR.......IE...
Q0REH0_FRAAA/6-113-----------------------------------DP......SG......AG......R..RLLPVR.......VE...
A1BEX3_CHLPD/90-190-----------------------------------EA......KK......RG......I...LVPVL.......LD...
E3J785_FRASU/17-124-----------------------------------AV......QAADPLGFTR......R...LLPIR.......VE...
Q2JBL6_FRASC/19-126-----------------------------------AA......HAADPHGFKR......K...LLPVR.......VE...
Q0RGM6_FRAAA/6-113-----------------------------------GA......YQADPTGFAR......R...LVPVR.......VE...
C6XNE0_HIRBI/4-104-----------------------------------VG......KA......RG......K...LLPVR.......ID...
Q0RIN9_FRAAA/22-129-----------------------------------AAWA.ADPSG......AG......R..NLIPIR.......IE...
E3J7J7_FRASU/27-134-----------------------------------AV......YRADPQGFAR......R...LIPIR.......VE...
Q0RPX4_FRAAA/13-120-----------------------------------AVQA.SDPHG......LE......R..KLLPVR.......IE...
A8L235_FRASN/21-128-----------------------------------AA......WAADPTGGQR......K...LLPVR.......IG...
Q82CN6_STRAW/36-142-----------------------------------GA.....SAT......HG......L..RFIPVL.......LG...
Q0RPX3_FRAAA/13-120-----------------------------------AA......RAADPEGLAR......K...LLPVR.......VE...
Q21Z38_RHOFT/11-111-----------------------------------RA......AK......TG......K...LLPVR.......IE...
Q0RFT3_FRAAA/25-132-----------------------------------AAFVADPDGA......AR......R...LLPVR.......IE...
E3IX94_FRASU/15-122-----------------------------------AA......RAADPTGFDR......R...LVPVR.......VE...
B3S2N0_TRIAD/460-568-----------------------------------LA......DW......LG......K..TPISMV.......FH...
A8LGL3_FRASN/20-127-----------------------------------AA......WARDPIGIHR......R...LLVLR.......VG...
E3IX60_FRASU/26-133-----------------------------------AAWM.FDPSG......RE......R..RLVPVR.......VE...
B4SC53_PELPB/96-199-----------------------------------TG......RK......RG......V...LVPLC.......ID...
Q0RTF6_FRAAA/29-136-----------------------------------AAWA.TDPSG......RD......R..KLLVFR.......VE...
Q0RIT4_FRAAA/69-176-----------------------------------LA......YQTD.PLGLR......R..RLLPIR.......VA...
A8KXQ9_FRASN/9-116-----------------------------------AA......WRRDPDGLT.......R..RLIPVR.......ID...
E3J7Y1_FRASU/19-126-----------------------------------AAFV.EVPGG......RG......R..KLLPVR.......LE...
D2SAJ1_GEOOG/13-119-----------------------------------AAFA.NQAKA......AG......R...IVPVL.......VE...
A8L102_FRASN/20-127-----------------------------------AAWADDPDGR......IG......K...LLVFR.......VE...
Q028E9_SOLUE/5-105-----------------------------------RA......YK......RG......A...ALPVL.......LD...
A7ST59_NEMVE/24-124-----------------------------------YA......KD......KK......K..PVVSVI.......IQ...
A7ST59_NEMVE/413-519-----------------------------------YA......TM......KE......K..PIIFIK.......AE...
Q2JEN2_FRASC/35-142-----------------------------------AAWAADPSGR......AR......K...LLVFR.......VE...
A7HHI0_ANADF/4-104-----------------------------------YA......SE......AN......V..PLFPVR.......VD...
D2B0U4_STRRD/14-121-----------------------------------AA......YRQ...TLLG......KTRGFVPVR.......VA...
E3JD26_FRASU/17-124-----------------------------------IT......YNSDPQGLLR......K...LVPIR.......VS...
A8DUR5_NEMVE/387-495-----------------------------------FA......DW......LN......K..PFIVAM.......AK...
C3Z670_BRAFL/206-314-----------------------------------LA......HS......LR......K..TIVPVL.......LE...
A8L472_FRASN/36-137-----------------------------------GA......LA......GR......K...LTPLR.......VA...
O86768_STRCO/8-114-----------------------------------AA......VA.....HRD......R...LIPLA.......LE...
C3YB32_BRAFL/1078-1172-----------------------------------LA......AE......LG......V..PLIPIK.......LQ..T
Q2W1R2_MAGSA/34-139-----------------------------------AALA.ADPDK.....PQG......K...LLPLR.......VV...
E3IUH8_FRASU/87-194-----------------------------------AV.....FRRDP.EGLA.......R..RLIPVC.......VE...
E3JB70_FRASU/15-122-----------------------------------AGMR.LAHTR......DG......F...LLPVL.......VE...
D9SFF3_GALCS/4-108-----------------------------------AA.....IVG......NK......K...LIPII.......WD...
C6XQ37_HIRBI/5-107-----------------------------------LA......DD......MD......K..DVIPVL.......IE...
Q3SW17_NITWN/99-207-----------------------------------AGL....VRK......LG.....NK.CRFLPVRH.....KLP...
C4ZIJ8_THASP/6-119-----------------------------------TAIE..RARR......GD......A..SVIPVL.......LR...
C7RV87_ACCPU/4-106-----------------------------------YG......LG......KG......K..TILPVR.......LE...
B6JHA2_OLICO/99-207-----------------------------------AGL....VRKL...NENT......R...FIAVRS.....GLA...
D2B0U5_STRRD/10-115-----------------------------------HYQ...GLEG......KE......R..ALIPVK.......VA...
C7RQ25_ACCPU/133-235-----------------------------------QA......RK......RG......K..PVFPLL.......TG...
Q2J5A8_FRASC/18-127-----------------------------------AI......WAAD.MGGRG......R..RLIPVQ.......VE...
Q2NDU5_ERYLH/20-120-----------------------------------RG......RD......RH......C...LVPAS.......ID...
A8L863_FRASN/19-126-----------------------------------AVWV.DDPTG.....AKR......R...LVVVQ.......VQ...
Q2JGC9_FRASC/4-109-----------------------------------IA......YE......VG......S..LLLPLR.......VE...
Q9L0M8_STRCO/8-114-----------------------------------AA......VA.....LRG......R...LVPVA.......IELLN
Q0RFV3_FRAAA/13-120-----------------------------------WA......TDP...AGLN......R..RVLVVR.......VE...
B3QZ81_CHLT3/7-115-----------------------------------TA......VKK...DPEG......EVGLLIPII.......VR...
Q0RPP6_FRAAA/10-118-----------------------------------KA......WELD.PHGDR......R..QLIPVR.......IE...
Q8CJY8_STRCO/19-125-----------------------------------SV......VA......RR......E..RIVPVT.......IE...
C3ZQ01_BRAFL/737-845-----------------------------------LA......HT......LK......T..PIIPVM.......LE...
Q0RIR9_FRAAA/18-121-----------------------------------AR......FD......PG......E.RTLIPIR.......VE...
B0CFH1_ACAM1/694-807-----------------------------------RA......RDRH..DAKE......A..ILLPIL.......IR...
E3J0G5_FRASU/353-460-----------------------------------HAWM.EDPNG......LE......R..TLIPVR.......VA...
D3B3K4_POLPA/805-907-----------------------------------MA......RR......LG......K..TIIALY.......YH...
Q0RRH7_FRAAA/33-134-----------------------------------GA......LV......SR......S...VIPLR.......VE...
E3J6F2_FRASU/4-111-----------------------------------PAVA.RQLEN......SG......T..RLLPAV.......LT...
A9FJE9_SORC5/5-116-----------------------------------RAL...ERHR......SG......A.ARVVPIL.......VR...
A8LGX9_FRASN/19-119-----------------------------------EG......QR......HD......R..EFFPIL.......IE...
B3S8Y4_TRIAD/187-291-----------------------------------LA......DV......LG......K..YVVPVN.......FL...
B3E9D8_GEOLS/5-116-----------------------------------DAIERLRYKQ.....LTD......I..YVIPLL.......LE...
C3YRI2_BRAFL/372-473-----------------------------------YT......RE......RG......T..DIIPLK.......ME...
D2QTN1_SPILD/23-136-----------------------------------KSV...ERHN......QG......H.CTVVPVI.......LR...
A9VAD9_MONBE/378-481-----------------------------------YV......FQ......QQ......K..SYIPVF.......VE...
C3YBW8_BRAFL/463-564-----------------------------------YT......FQ......LR......K..QIVPLM.......ME...
B2IVL0_NOSP7/8-109-----------------------------------EA......KK......NN......K..ILIPVL.......IE...
Q0RIX3_FRAAA/21-122-----------------------------------AM......LA......TR......P...LLLVR.......VA...
E3I8Q6_RHOVT/4-115-----------------------------------LA......RR......LN......K..RLFGLV.......IE...
Q01GF4_OSTTA/482-587-----------------------------------YA......YT......RK......K..TLIPVK.......VE...
Q8YVL7_NOSS1/8-109-----------------------------------EA......KK......NG......K..VLISVL.......IE...
A8WVG1_CAEBR/367-484-----------------------------------CA......FE......HQ......K..NIIPIFDTAFEFPTK...
A9GSK2_SORC5/1147-1260-----------------------------------RAL...ERHD......AGD....AR...VIPVI.......LR...
D1A5Y5_THECD/4-128-----------------------------------EA......RE......CG......I..PVLPVLKGRGAARLD...
A9GWR7_SORC5/353-464-----------------------------------KAI...ERHE......RG......E.ARVIPVI.......LD...
E3I131_RHOVT/20-126-----------------------------------KIAH.DPLNK......KS......R...LIVMR.......VA...
Q488J9_COLP3/4-122-----------------------------------LA......QS......SS......A..VIIPVK.......LD...
C4ZM27_THASP/14-137-----------------------------------LA......LA......SG......K..PLIPVL.......VG...
D2SB43_GEOOG/12-118-----------------------------------AR.....ALRV...GGLG......A...ILPVR.......VS...
Q0RSZ9_FRAAA/6-111-----------------------------------IA......HE......VG......S..LLLPLR.......AQ...
D2SB14_GEOOG/4-110-----------------------------------LA......RS......LG......H..PVFPLG.......LE...
B0C5U4_ACAM1/223-330-----------------------------------TANR..LGSE......LG......K.PAILPVR.......VN...
B4HIY9_DROSE/842-958-----------------------------------AA......LN......SN......C..NIIPII.......DQ...
A7SAI7_NEMVE/4-114-----------------------------------YA......DGKT..GCEE......V..IIVPVM.......CE...
B1ZSG7_OPITP/145-246-----------------------------------FA......FA......RG......I..PLIAVN.......LG...
C1EBU5_MICSR/479-580-----------------------------------YA......YT......RK......K..LMIPAM.......LQ...
C3ZH48_BRAFL/391-492-----------------------------------YT......HK......LR......K..DIVPLR.......LQ...
Q099H8_STIAD/11-117-----------------------------------AM......KD......PK......R..RVIPVL.......LP...
C1N563_MICPC/155-256-----------------------------------YA......YQ......RK......K..TLIPVM.......FE...
A8KZ03_FRASN/14-119-----------------------------------PAL...TIDQ.....IRH......K...ILPIY.......VE...
C3YRI0_BRAFL/374-476-----------------------------------YT......VT......RG......T..DIIPLK.......MD...
Q08W08_STIAD/272-383-----------------------------------RAL...ERHE......LG......Q.ARVLPIF.......IE...
B5GMC1_STRC2/51-156-----------------------------------RV......HS......GG......R..RFVPVL.......VE...
A9GWR0_SORC5/11-122-----------------------------------EAI...ARHE......AG......E.CRVIPVI.......LR...
C3ZI71_BRAFL/547-647-----------------------------------FA......SD......QK......R..EIVPLK.......MT...
B2IT96_NOSP7/9-118-----------------------------------EF......VE......RN......C..PVIPVL.......LG...
B9M1H6_GEODF/3-109-----------------------------------TVLE.NSWKE......QG......R..PIFGVL.......VG...
A1W966_ACISJ/133-236-----------------------------------RA......LA......KG......I..SVLRVG.......WP...
A8ZZH8_DESOH/82-183-----------------------------------FA......FG......RG......I..PIISVK.......LG...
D5SSN8_PLAL2/117-218-----------------------------------YA......LG......RK......I..DVIPLR.......A....
A8L7D9_FRASN/338-442-----------------------------------RSLT.FDPDG......AQ......R..LLVPVR.......VE...
B9M1I3_GEODF/4-102-----------------------------------IA......EN......YK......V..PMIPVR.......LD...
B7KBK1_CYAP7/4-116-----------------------------------SS......WA......MS......K..LVIPIMG....PGIN...
C3XYH4_BRAFL/100-210-----------------------------------TC......LK......NN......K..RIFPIW.......VD...
Q10WW3_TRIEI/118-233-----------------------------------LA......RELQFSRPER......K.PVILPIR.......VG...
A8IF66_CHLRE/788-889-----------------------------------YA......YQ......QR......K..RIIPIM.......ME...
Q0C4A7_HYPNA/4-101-----------------------------------AA......KA......LG......L..KRIPYQ.......VD...
Q7NE51_GLOVI/173-287-----------------------------------AVFL.RENEE......KH......E..IIHALR.......VD...
B1W250_STRGG/340-445-----------------------------------EA......VG......SG......R.RRLVPLR.......IG...
Q0RNC1_FRAAA/414-526-----------------------------------AW......ER......LGLEGPLAR..RVVRVT.......ID...
Q8TM16_METAC/5-107-----------------------------------LA......VG......AD......Q..LIIPLV.......EA...
B1ZQ16_OPITP/12-113-----------------------------------YA......RK......AG......K..RIIPLV........G...
E3J6T1_FRASU/274-377-----------------------------------HD.....PDR.....FWS......T...IATVR.......IR...
Q0RUF2_FRAAA/4-111-----------------------------------PALA.ADLSS......RG......I..VMLPVI.......LS...
B2J3V1_NOSP7/6-112-----------------------------------QC......VN......RG......I..PVIPVL.......LP...
Q47DY5_DECAR/7-118-----------------------------------SAQA.RAFTE......NR......E..YILPAF.......FD...
C3YU72_BRAFL/10-119-----------------------------------AA......LE......NN......K..QIFPIW.......LD...
C9YT07_STRSW/352-458-----------------------------------YAE...GDRR......SH......Q...LVSMQ.......VD...
Q7MX37_PORGI/356-463-----------------------------------CF......LEK...VQTN......E...VIPIF.......LD...
Q1QLK5_NITHX/3-113-----------------------------------RSLD..KAKDI....PPG......N.LFLIPIL.......VG...
A4G5B3_HERAR/134-239-----------------------------------QA......NL......LG......I.QTLHLLW.......PG...
A9GS07_SORC5/7-118-----------------------------------RAL...ARRT......AG......E.VDVVPVL.......VR...
Q2JGW8_FRASC/4-114-----------------------------------PALA.DDLAA......RG......I..TLLPAL.......LS...
A0B6K5_METTP/5-107-----------------------------------FA......KA......ID......H..LIIPIA.......ED...
A8WVG6_CAEBR/253-355-----------------------------------FA......FQ......FD......K..NIITVN.......HK...
A8L8G2_FRASN/4-112-----------------------------------IF......RE......RK.....PR.APFLEIV.......VG...
B4SA08_PELPB/9-120-----------------------------------AAFD.RMINE......RA......E..YLLPVK.......VD...
C7PX42_CATAD/13-123-----------------------------------TA......LRDS.ADLLD......R...LFPVV.......VD...
Q479U9_DECAR/327-433-----------------------------------QF......KQR...FKSG......D...VIPIV.......LS...
Q0C0W9_HYPNA/5-105-----------------------------------VG.....NSR......PG......T...LIQAA.......ID...
B7KMX7_CYAP7/356-465-----------------------------------QF......KS.....RFG......Q.SSIIPIW.......FS...
C6XN50_HIRBI/11-116-----------------------------------DA......YN......MG......KRLYLIPIK......PIS...
Q82BJ3_STRAW/346-445-----------------------------------AFTG.GDPDG......AH......P..ALVPLR.......VD...
C7RUX1_ACCPU/310-422-----------------------------------AVRD.LIKKR......DG......K..RIMFFR.......FD...
D5SMM7_PLAL2/3-112-----------------------------------KG......LS......SN......R.VCTFLVD.......LK...
YDDK_BACSU/116-233-----------------------------------ATW....VNS......NN......CSTFILPGF.......KG...
C7PT18_CHIPD/9-118-----------------------------------LA.....KTR......MG......E.PHILQLR.......LD...
C6XK34_HIRBI/4-106-----------------------------------EA......EI......AG......K...LIEID.......LD...
Q7UFB2_RHOBA/254-366-----------------------------------AIRDIIKSKE......DE......R...VMFVR.......FD...
B7KLQ5_CYAP7/3-111-----------------------------------AL......SKL...PAS.......N...VCTLLF.....GLS...
F1QWA8_DANRE/556-669-----------------------------------TA......LN......GK......K..NIVPVTDN..FVWPD...
K1QKT6_CRAGI/9-119-----------------------------------VA......HSMS.PGARS......R..KIIPIR.......LD...
Q2YN91_BRUA2/146-256-----------------------------------AI......REII.MARAE......Q..RIMFVR.......VD...
Q6N9F4_RHOPA/4-114-----------------------------------RAL...TRHD......AG......E.AVVIPVI.......LR...

PF08937

Q12I74_SHEDO/3-119...................................RSYE......---...LK------K--GILAID-------IHSVK
A7HHH7_ANADF/34-147...................................ESLE......---...RG------K--KVVAVH-------VGKRA
Q6LJM5_PHOPR/2-127...................................TSKH......---...SS------S--NILMMR-------IPDNQ
A4G5B5_HERAR/3-116...................................KAWA......---...DG------L--AVLAIH-------IHNLK
A0LCB5_MAGMM/7-121...................................IAKQF.....---...YG------K--PIIAVE-------PWASE
A4G5B4_HERAR/2-119...................................RSVV......---...KG------N--GLLTVN-------IDGVK
A3N1I6_ACTP2/3-115...................................RAWE......---...LG------K--AVCGIY-------IHKLK
A1SXM2_PSYIN/2-127...................................ISKH......---...GS------N--HVLLMR-------IPNDS
Q122C0_POLSJ/18-136...................................ATLE......---...KE------H--ALIGVQ-------LPTAA
A6LX77_CLOB8/3-127...................................YSLKEIMRSD---KTSRS------N--GIVGVI-------MKYNG
Q9A8E1_CAUCR/8-195LPLMELLPPALRAALPEGVEPLAVDLRQDADGRRLAKLK......---...IA------A--RLLGVS-------LDRLV
Q6MN07_BDEBA/5-124...................................IALK......---...DG------I--PIVVAN-------LNGKR
Q2NGB5_METST/3-120...................................AALK......---...QK------S--SLIGIC-------LPNRN
A1W964_ACISJ/3-116...................................QSWN......---...SG------K--GLLGIR-------VHKLL
Q21ZJ7_RHOFT/6-120...................................YAVK......---...QG------K--RIVGVW-------EHGTK
A3N1I7_ACTP2/3-151...................................YSLKNKTRSD---NRSKR------N--AILAVI-------LPDRY
Q82T32_NITEU/4-119...................................KSWN......---...DG------L--GVVGIR-------IHGLK
Q6F1E6_MESFL/3-131...................................SSIRETFLN.---...PR------N--GLVILV-------MPEMV
Q0RX23_RHOJR/5-119...................................YANRF.....---...PD------K--RIIGVW-------APGAD
A3DI79_CLOTH/7-123...................................ISVD......---...YG------K--PIIGIK-------PWGQE
A6LX79_CLOB8/4-117...................................KAYE......---...LN------K--GIVGIY-------IHNLK
Q1IIP2_KORVE/3-120...................................KAVE......---...YG------M--GIFGIR-------IHQLK
A6QC47_SULNB/3-134...................................SSIRQTTYS.---...SR------S--GVIGIL-------LPSYH
Q122B7_POLSJ/5-119...................................YAEK......---...QG------K--RIVGVW-------DHGAG
Q03QQ3_LACBA/2-119...................................TARQ......---...ED------K--RLLAAR-------MDSTN
Q8FTW2_COREF/4-118...................................KAWD......---...MN------K--PMVGVY-------IHGLA
Q3Y0J6_ENTFC/3-117...................................ESYK......---...RG------N--AILAVN-------IGKIK
Q3A0F5_PELCD/2-120...................................RSVI......---...KG------N--GLLTVY-------IDGVK
Q31IQ3_THICR/3-119...................................QSIA......---...RG------N--GILGID-------ISKIK
O86760_STRCO/8-131...................................STLRDDVRN.---...KR------G--GLLGIV-------LPSAV
Q2LRS2_SYNAS/24-142...................................MTLN......---...KE------H--ALLGIA-------LPTAT

PF10137

C6W705_DYAFD/4-121-----------------------------------LYVGRLG---------RN---------RAF.FV..KEKG...---
Q21MV2_SACD2/143-262-----------------------------------YFCGSLG---------RD---------KVC.VL..Y....KD---
D2QVU6_SPILD/4-126-----------------------------------YFLGKLG---------RN---------KVL.TLFEA....SK---
F8B4J3_FRADG/196-328-----------------------------------MAMAVDA---------RR---------TVL.VE.......VG---
A3CWB8_METMJ/141-285-----------------------------------YFVGLLG---------RE---------NVI.IL..Y....ED---
B1M988_METRJ/155-274-----------------------------------FFMGSLG---------RQ---------RAV.LM..EPKG..A---
Q8TKX7_METAC/9-127-----------------------------------LFMGRLG---------RK---------RVF.IV..YCDE..E---
Q24ZU3_DESHY/13-134-----------------------------------LFEGHLG---------PK---------RTI.IC......RRG---
E3J264_FRASU/144-263-----------------------------------YAAAKLG---------RR---------NVA.IL..F....ED---
I3UFW1_ADVKW/147-263-----------------------------------YFIGVLG---------RD---------KVC.AL..K....SG---
A1SX31_PSYIN/148-267-----------------------------------FLIGKLG---------RS---------KVC.PL..V....TG---
B0UTQ9_HISS2/135-254-----------------------------------FLISKLG---------RN---------NVC.AL..V....KD---
M4NKT6_9GAMM/158-276-----------------------------------MFIGFLG---------RK---------RAF.LM..EPRE..D---
C5BHR5_TERTT/6-125-----------------------------------LFVGAIG---------KS---------RSF.IL..KPRG..I---
Q8XW61_RALSO/85-207-----------------------------------MMLTLLG---------RK---------NVA.ILMKQ....QD---
L0HBG8_METFS/245-360-----------------------------------AALALYG---------RN---------NIL.LV.......QN---
F0ZMV3_DICPU/57-185-----------------------------------LLIGKLG---------RK---------NVI.FLNVPYTG.SN---
B0UF11_METS4/156-275-----------------------------------YFAGRLG---------RG---------RVC.LL..K....KG---
Q12JL6_SHEDO/5-125-----------------------------------LFIGAIG---------KN---------RCF.IV..KPRD..V---
Q81W84_BACAN/128-251-----------------------------------FFIGKLG---------RA---------KVC.TL..Y....KD---
C7PYD3_CATAD/410-541-----------------------------------MALAYHP---------RA---------TLI.LQ.......VG---
C5CLS7_VARPS/123-235-----------------------------------YFQGRYG---------RR---------CVI.LL..H....EE---
R5R263_9FIRM/4-124-----------------------------------LYAGILT---------YA---------RCF.FL..IQEG...---
R7K6B0_9FIRM/70-191-----------------------------------MFLAKLG---------RN---------KVA.ILLKE....NK---
C4ZIE6_THASP/167-285-----------------------------------YFSGLKG---------KR---------NVL.IV......REA---
B4S624_PROA2/362-481-----------------------------------FFLGRLD---------KK---------NVA.ML..I....KG---
K0AW63_CLOA9/134-254-----------------------------------LFTGALD---------RS---------KVI.FC......TKG---
C7RC53_KANKD/229-343-----------------------------------AAIALYN---------KN---------FVL.LV.......KK---
C7R666_KANKD/7-127-----------------------------------LFIGSLG---------IE---------RCF.VL..IPKSKET---
I4BA92_TURPD/15-129-----------------------------------FFQGKFG---------RE---------NVL.VL..R....QD---
D5V4Y7_ARCNC/166-284-----------------------------------YLLAKLK---------RE---------RVA.AI..V....KD---
Q6D353_PECAS/127-247-----------------------------------YLMAKLG---------RE---------NVC.AL..V....KD---
Q2K8S5_RHIEC/205-324-----------------------------------YFSGKLG---------RG---------KVC.LL..R....KG---
R5V068_9FIRM/111-228-----------------------------------YFAGLLG---------RN---------RTIFIV..S....DD---
V6KJV2_STRRC/56-188-----------------------------------MLLMAYP---------ER---------TLL.VE.......IG---
D0LNL0_HALO1/453-571-----------------------------------FFVGKLG---------RG---------RVA.LL..R....KG---
E1W054_ARTAR/175-307-----------------------------------MALAMDD---------QR---------TIL.VR.......KG---
C1DBI6_LARHH/98-222-----------------------------------MLISSIG---------RR---------NIA.ILVK......G---
Q9X882_STRCO/76-207-----------------------------------MVLMAYP---------ER---------TLI.VE.......VG---
B9TGA1_RICCO/4-125-----------------------------------LFIGRLG---------VE---------RCF.FI..TPDH.VA---
R6JZ57_9CLOT/29-145-----------------------------------YFIGKMG---------RK---------SGR.VILLS....KG---
R5IEF5_9BACT/151-269-----------------------------------YLVGKLG---------RE---------RVC.AL..V....KE---
D5C5H2_NITHN/120-239-----------------------------------WFCGRLG---------RS---------GAMLLL.......KE---
Q47ER9_DECAR/134-252-----------------------------------YLIGKLG---------RH---------NVC.AL..V....KG---
Q027G3_SOLUE/4-122-----------------------------------LVAGRIG---------RH---------SIALCL.......AG---
Q9A4X3_CAUCR/154-272-----------------------------------LFMGRLG---------RA---------RAI.LM..EPRD..E---
C1F5N0_ACIC5/154-273-----------------------------------FFMGRLG---------RH---------RAL.LV..EPRG..E---
Q8EDI5_SHEON/128-249-----------------------------------YLMGLIG---------RP---------NVA.AI..V....EG---
A5I3L4_CLOBH/140-260-----------------------------------LAIGILG---------KQ---------NVF.YI..IPRG..C---
B1ZZI8_OPITP/123-242-----------------------------------YFAAKLG---------RR---------RTL.VI..T....KG---
B2FIX1_STRMK/122-235-----------------------------------IFQGRLG---------FS---------RAI.ML..L....EE---
Q6AL85_DESPS/128-241-----------------------------------LFQGRLG---------FN---------RAI.VL..M....EN---
D4LTG4_9FIRM/2-122-----------------------------------LFSGKLS---------KA---------NTI.FL......CDG---
C5CLS5_VARPS/5-125-----------------------------------LFVGRLG---------RE---------RVF.FL..LPQN..E---
TIRC_DICDI/55-184-----------------------------------YLIGKFG---------RS---------NVI.YLSVPYNGKSQ---
Q98RD6_MYCPU/91-212-----------------------------------MLYGKLP---------KN---------KIM.IL..N....KN---
J9R4G8_RIEAN/5-130-----------------------------------LFIGRLG---------LN---------NCA.FL..IDKD...---
R6SAH6_9BACE/4-122-----------------------------------LFLGRVG---------ID---------RAY.II......KED---
Q7MKB6_VIBVY/8-129-----------------------------------MFIGRLG---------PE---------KTF.MV..KPRN.SQ---

PF08357

CIKS_HUMAN/410-552-----------------------------------QI.....EFIKQGSMNF.---------RFIPVLF.PNAKKEH---
I17RC_HUMAN/584-737-----------------------------------CV...LPDFLQ..GRAPG---------SYVGACFDRLLHPDA---
I17RD_DANRE/355-520-----------------------------------IISEKLKEVHQ.KSSDLS---------RFMSVYF.DYSHETD---
I17RA_MOUSE/380-539-----------------------------------MI...LPDFKR..PACFG---------TYVVCYFSGICSERD---
Q8VUX6_STAHO/2-124-----------------------------------LR...........NEDKD---------RFIPIIL.NEKDKKN---
Q7UT52_RHOBA/13-152-----------------------------------ER.......DDQGNACLP---------VFLGGRI........---
Q8BPI5_MOUSE/107-257-----------------------------------CV...LPDFLQ..GRATG---------RYVGVYFDGLLHPDS---
I17RB_HUMAN/332-479-----------------------------------LFCSDLRS.....QIHLH---------KYVVVYF.REIDTKD---
Q69HQ3_CIOIN/391-538-----------------------------------KIKNDLIK.....ESNLR---------KYCFVYF.GYVKMKE---
YSO2_CAEEL/415-566-----------------------------------MI...IRDATHNFPEARK---------KYAVVRF...NYSPH---
I17RD_HUMAN/356-511-----------------------------------AIAEKLRQAKQSSSAALS---------KFIAVYF.DYSCEGD---
Q543U7_MOUSE/329-476-----------------------------------LFCSDFSS.....QTHLH---------KYLVVYL.GGADLKG---
I17RE_RAT/448-585-----------------------------------CA.............APR---------QLLLAYFSRLCAKGD---
I17RD_CHICK/358-512-----------------------------------TVAEKLRQAKQ.NSNDLC---------KFIAVYF.DYSCEGD---
Q73LP6_TREDE/1-127-----------------------------------EK...........DDSGR---------PYLPIYL........---

PF01582

B9N1N5_POPTR/14-194VDPSHVRNQTGSF--AD----AFA----RHDQ-----LLKEKMEKVLNWRAAMREAANLSGWDSHNIKSESEFVDDIVRD
B9S6Z7_RICCO/19-198VDPSEVEEQIGEF--GK----GFD----RAKK-----QANGDMRLVKKWKAALKDAANLSGWDSSVVRPDSKLITEIVNH
B9S9D9_RICCO/12-191IDPTEVQELTGSY--GN----ALM----NHRK-----EFENC..LVESWSHALMEIAAMAGFVSWNTKPESKLIDEIANR
B9SBW2_RICCO/15-195VDPSDVAEQKGGF--GA----AFI----EHEK-----CFKERIDKLQKWRAALTEAANISGWSSSVIRSESKLIQEIAED
D7KR54_ARALL/8-188VDPCHLRRQSGDV--AE----QFK----KHEA-----REEDL.DKVASWRRALTSLASISGDCSLKCEDESKLVDEIADK
D7MRD9_ARALL/8-185LDPFHVRKQLGKF--GE----AFK----NTCL-----NKTKN..EIQLWRQALNDVANLLGYHSHTCNNEPKMIEDIVSD
D7UDZ7_VITVI/24-202VDPADVRKQRGKF--GE----ALA----KHKK-----NM.ENMERVKIWKDALTKVAYLSGWDSQN.KNELLLIKEVAEN
F4IFF6_ARATH/55-233VDPTDVKKQTGDF--GK----VFK----KTCM-----GKTNA..VSRKWIEALSEVATIAGEHSINWDTEAAMIEKISTD
F6I7C7_VITVI/9-189VDPSDVRKQKGSY--GK----AFA----KHEE-----NMKENMEKVHIWREALSEVGNISGRDSRN.KDESVLIKEIVSM
I1KE95_SOYBN/20-200VDPSQVRKLSGDY--EK----AFA----QHQQ-----SSRFQEKEITTWREVLERVASL.SGWDIRNKEQPTVIDEIVQK
I1MD01_SOYBN/13-191VDPSDVRHQKGTY--GD----AFA----KHEK-----NKRNL.AKVPNWRCALNIAANLSGFHSSKFVDEVELIEEIAKC
TLR4_HUMAN/676-839KVEK.......TL--LR----QQV----ELYR-----LLSRN..TYLEWE..............DSVLGRHIFWRRLRKA
TLR5_HUMAN/695-858SLSQYQLM.....--..----KHQ----SIRG-----FVQKQ..QYLRWP..............EDFQDVGWFLHKLSQQ
I18RA_HUMAN/410-598YFQEPE.....SL--PH----LVK----KALR-----VL.....PTVTWRGL............KSVPPNSRFWAKMRYH
ILRL1_MOUSE/384-567PLGEASRLQVGDL--QD----SLQ----HLVK-----IQ.....GTIKWREDHVA.........DKQSLSSKFWKHVRYQ
IL18R_HUMAN/377-541PVTDFT.....FL--PQ----SLK----LLKS-----H......RVLKWKAD............KSLSYNSRFWKNLLYL
ILRL2_HUMAN/385-575KIEDYT.....VM--PE----SIQ----YIKQ-----KH.....GAIRWHGDFTE.........QSQCMKTKFWKTVRYH
IL1AP_HUMAN/407-570AVKE.......TK--VK----ELK----RAKT-----VL.....TVIKWKGE............KSKYPQGRFWKQLQVA
I18RA_MOUSE/409-597SFQEPE.....SL--PY----LVK----KALR-----VL.....PTVTWKGL............KSVHASSRFWTQIRYH
Q9ZVX6_ARATH/11-188VDPSDVRKQTGEF--GT----VFN----KTCA-----RRTEK..ERRNWSQALNVVGNIAGEHFLNWDNEAEMIEKIARD
F4J361_ARATH/93-270VDPTDIKKQTGEF--GK----AFT----KTCK-----GKTKE..YVERWRKALEDVATIAGEHSRNWRNEADMIEKIATD
M4E4G7_BRARP/12-187VDPSHVRKQTGDF--GK----AFE----KTCM-----GKTEE..VKQEWRQALEDVAGIAGYHSSNSDNEAEMIDKVASD
Q9SSN5_ARATH/8-185VEPNHVRWQTGVL--AE----QFK----KHGS-----REDHE..KVLKWRQALTNFAQ..LSGDCSGDDDSKLVDKIANE
RPS4C_ARATH/16-186LEPSTVRDLKGKF--GD----RFR----SMAK-----GD..E..RKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKA

PF13676

Q47BW0_DECAR/4-104A.V........RP..PA....GFR....EIQA.....AD-----------------------------------------
C3Y619_BRAFL/689-797N.T........PWPPPGSMSMIFS....QLLY.....IM-----------------------------------------
C3Y619_BRAFL/881-989D.TSWP..PEGPM..SM....AFT....ELLY.....ID-----------------------------------------
E3I8M0_RHOVT/4-107S.LN.....PKDL..PI....PFN....VYQT.....HI-----------------------------------------
C3ZXI7_BRAFL/383-491N.MWFK..LRPAM..KA....ILG....ENPA.....ID-----------------------------------------
A7S5P1_NEMVE/555-656P.Q.......YKP..DG....WLG....IIVG.....AK-----------------------------------------
A7S5P1_NEMVE/1014-1115Q.D.......YRP..DG....WLG....MILG.....AK-----------------------------------------
A8L2Q4_FRASN/29-136D.C........RR..PG....LLG....TIVS.....FD-----------------------------------------
E3JD12_FRASU/19-126P.C........PQ..PG....PLG....AIVS.....ID-----------------------------------------
E3IW96_FRASU/15-122D.C........PR..PG....LLR....TIVS.....ID-----------------------------------------
Q0REH0_FRAAA/6-113D.C........EL..PG....LLK....QLAP.....ID-----------------------------------------
A1BEX3_CHLPD/90-190A.V........EP..PF....GFS....HIHA.....AN-----------------------------------------
E3J785_FRASU/17-124E.C........PR..PV....LLG....QIVS.....FD-----------------------------------------
Q2JBL6_FRASC/19-126D.C........PR..PG....LLG....AVVS.....ID-----------------------------------------
Q0RGM6_FRAAA/6-113D.C........PR..PG....LLG....GVVS.....FD-----------------------------------------
C6XNE0_HIRBI/4-104E.V........DP..PL....GFG....LIQM.....AN-----------------------------------------
Q0RIN9_FRAAA/22-129D.C........PR..PG....SLS....QLVG.....DD-----------------------------------------
E3J7J7_FRASU/27-134D.C........AR..PG....LLG....EVVS.....LD-----------------------------------------
Q0RPX4_FRAAA/13-120D.C........AR..PG....LLG....AVVS.....ID-----------------------------------------
A8L235_FRASN/21-128D.C........PR..PG....LLG....QIGS.....VD-----------------------------------------
Q82CN6_STRAW/36-142Q.V........AA..PP....FAA....QRVW.....RD-----------------------------------------
Q0RPX3_FRAAA/13-120N.C........DR..PG....VLR....TVVS.....VD-----------------------------------------
Q21Z38_RHOFT/11-111D.V........EL..PL....GFG....QLHT.....LD-----------------------------------------
Q0RFT3_FRAAA/25-132N.C........AR..PG....VLG....SRVS.....VD-----------------------------------------
E3IX94_FRASU/15-122N.C........PR..PG....LLR....TIVS.....ID-----------------------------------------
B3S2N0_TRIAD/460-568N.CYNN..MKLSL..RS....ILN....DRSA.....VD-----------------------------------------
A8LGL3_FRASN/20-127E.C........EQ..PG....LLR....QVVG.....TD-----------------------------------------
E3IX60_FRASU/26-133D.C........PL..PG....LLG....QLVS.....VD-----------------------------------------
B4SC53_PELPB/96-199D.V........EP..PL....GFR....TIQA.....ET-----------------------------------------
Q0RTF6_FRAAA/29-136D.C........DR..PG....LLA....QTVS.....VD-----------------------------------------
Q0RIT4_FRAAA/69-176D.D........PL..PG....LLG....GIRA.....FD-----------------------------------------
A8KXQ9_FRASN/9-116A.C........EP..EG....LLG....GVVP.....ID-----------------------------------------
E3J7Y1_FRASU/19-126D.C........PR..EG....LLA....QVAG.....VD-----------------------------------------
D2SAJ1_GEOOG/13-119P.V........TL..PP....LYA....SLIH.....LD-----------------------------------------
A8L102_FRASN/20-127D.C........PQ..PG....LLG....QLVS.....VD-----------------------------------------
Q028E9_SOLUE/5-105K.V........EI..PL....GFG....RIQA.....VS-----------------------------------------
A7ST59_NEMVE/24-124H.N.......YSP..SG....CTG....AIAK.....AW-----------------------------------------
A7ST59_NEMVE/413-519K.DLV....LKDW.IQQ....LVD....KSVV.....FE-----------------------------------------
Q2JEN2_FRASC/35-142E.C........DR..PG....LLG....QLVS.....VD-----------------------------------------
A7HHI0_ANADF/4-104G.C........TL..PI....GFG....RLHT.....QD-----------------------------------------
D2B0U4_STRRD/14-121E.C........DV..AP....LLG....PLVY.....ID-----------------------------------------
E3JD26_FRASU/17-124D.C........VI..PD....ILG....QIAS.....FD-----------------------------------------
A8DUR5_NEMVE/387-495N.SWGA..MRPSV..QA....ILG....DCPA.....ID-----------------------------------------
C3Z670_BRAFL/206-314N.TAWP..PEGPM..AM....PFA....QLLY.....ID-----------------------------------------
A8L472_FRASN/36-137D.C........PV..PP....VLS....TISY.....RD-----------------------------------------
O86768_STRCO/8-114P.LT.....TSDL..PR....VLA....AKLR.....KN-----------------------------------------
C3YB32_BRAFL/1078-1172D.V........VL..DD....WLQ....LVSN.....KV-----------------------------------------
Q2W1R2_MAGSA/34-139E.M........EV..TG....LLG....PIIW.....HD-----------------------------------------
E3IUH8_FRASU/87-194D.C........SR..PG....LLG....SIIP.....VD-----------------------------------------
E3JB70_FRASU/15-122Q.C........DL..PP....LLG....TINM.....IV-----------------------------------------
D9SFF3_GALCS/4-108Q.PA......EAL..PG....WMK....QFQA.....VN-----------------------------------------
C6XQ37_HIRBI/5-107D.T........KP..KG....HFL...YEMAA.....RN-----------------------------------------
Q3SW17_NITWN/99-207P.K........DL..PP....LLS....GMHA.....PE-----------------------------------------
C4ZIJ8_THASP/6-119A.V........DL.EDA....PFA....HLQGL...PTD-----------------------------------------
C7RV87_ACCPU/4-106P.C........KV..HP....RLE....PIQH.....LD-----------------------------------------
B6JHA2_OLICO/99-207A.S........AL..PP....LLA....GMLS.....PS-----------------------------------------
D2B0U5_STRRD/10-115D.H........QV..PP....SMG....PIIS.....ID-----------------------------------------
C7RQ25_ACCPU/133-235D.G........EP..PW....YLA....DRQA.....IA-----------------------------------------
Q2J5A8_FRASC/18-127P.C........EPDTLG....LLG....SLTW.....ID-----------------------------------------
Q2NDU5_ERYLH/20-120G.S........EP..PL....GFR....QFQC.....VT-----------------------------------------
A8L863_FRASN/19-126D.C........PQ..PG....LLR....PLVG.....VP-----------------------------------------
Q2JGC9_FRASC/4-109P.T........VT..SP....LLE....DRQH.....VH-----------------------------------------
Q9L0M8_STRCO/8-114D.D........DI..PA....LLA....GTLR.....TD-----------------------------------------
Q0RFV3_FRAAA/13-120D.C........LP..PA....LLG....QIQA.....VD-----------------------------------------
B3QZ81_CHLT3/7-115E.H........EI..DG....ILS....RLNY.....IS-----------------------------------------
Q0RPP6_FRAAA/10-118P.C........SL..PG....LMN....DVVP.....CD-----------------------------------------
Q8CJY8_STRCO/19-125P.LT.....ASDI..PD....ILT....AVIR.....KD-----------------------------------------
C3ZQ01_BRAFL/737-845K.TTWP..PPGPM..SI....PFA....QLIY.....IN-----------------------------------------
Q0RIR9_FRAAA/18-121L.C........AP..PG....LLS....PLVR.....ID-----------------------------------------
B0CFH1_ACAM1/694-807P.V........DW.NST....SFC....DIQAL...PSD-----------------------------------------
E3J0G5_FRASU/353-460W.C........EP..AG....LLR....GIRY.....ID-----------------------------------------
D3B3K4_POLPA/805-907N.V........EI..DP....ILR....GLFD.....YE-----------------------------------------
Q0RRH7_FRAAA/33-134A.C........PL..PG....MLA....TIAH.....VD-----------------------------------------
E3J6F2_FRASU/4-111G.Q........EA..PA....LLA....DIKA.....AD-----------------------------------------
A9FJE9_SORC5/5-116A.C........DL.EGT....ALS....ELQA.....LP-----------------------------------------
A8LGX9_FRASN/19-119G.S........RL...F....LLA....TRHY.....FD-----------------------------------------
B3S8Y4_TRIAD/187-291..S........DW..PP....ACL....AIQFA...TTQ-----------------------------------------
B3E9D8_GEOLS/5-116P.C........EV..PT....HIA...ARLQY.....VD-----------------------------------------
C3YRI2_BRAFL/372-473D.S.......YRP..DG....WLG....FLVG.....AR-----------------------------------------
D2QTN1_SPILD/23-136E.C........DW.EGA....PFE....SIHGL...PTD-----------------------------------------
A9VAD9_MONBE/378-481PGC........ER.ITG....VLG....IMRG....TLL-----------------------------------------
C3YBW8_BRAFL/463-564G.K.......YKP..DG....WLG....AILG.....AK-----------------------------------------
B2IVL0_NOSP7/8-109N.I........KV..PG....EFL....DIQP.....AY-----------------------------------------
Q0RIX3_FRAAA/21-122D.G........PV..PE....VLA....TVER.....VD-----------------------------------------
E3I8Q6_RHOVT/4-115E.GLS....IADL.PPD....VTS....TWQL.....VN-----------------------------------------
Q01GF4_OSTTA/482-587K.G.......YSP..DG....WLGILVGSKLY.....YN-----------------------------------------
Q8YVL7_NOSS1/8-109P.V........KI..PG....EFL....DIQS.....AN-----------------------------------------
A8WVG1_CAEBR/367-484P.D........QI..PE....DIR....MITK.....YN-----------------------------------------
A9GSK2_SORC5/1147-1260P.T........DW.HSA....PFA....RLQAL...PKD-----------------------------------------
D1A5Y5_THECD/4-128R.A........EL..PR....ELR....WLADMQSLRLD-----------------------------------------
A9GWR7_SORC5/353-464A.C........DW.EGA....PFG....RLAS.....LP-----------------------------------------
E3I131_RHOVT/20-126N.C........TP..TG....LFA....ALAY.....WD-----------------------------------------
Q488J9_COLP3/4-122D.CWMETTTHDEF..TY....LLA....RTQW.....LD-----------------------------------------
C4ZM27_THASP/14-137G.ATMP..AAEAL..PA....TLR....GLAN.....RN-----------------------------------------
D2SB43_GEOOG/12-118G.D........NP..SG....IFA....GLRY.....LD-----------------------------------------
Q0RSZ9_FRAAA/6-111A.G........VA..SP....LLD....DRQH.....VA-----------------------------------------
D2SB14_GEOOG/4-110P.G........VR..LP....LLA....DVQW.....ID-----------------------------------------
B0C5U4_ACAM1/223-330Y..........RE..PF....TYP....LSAY.....LN-----------------------------------------
B4HIY9_DROSE/842-958Q.FDWP..EVERL..PE....DMR....SVAH.....FN-----------------------------------------
A7SAI7_NEMVE/4-114K.G.......FKA..KG....WLGIITAGLLW.....ID-----------------------------------------
B1ZSG7_OPITP/145-246R..........NP..YG....FIG....KFQA.....LP-----------------------------------------
C1EBU5_MICSR/479-580K.N.......YKP..DG....WLG....ILMG.....SK-----------------------------------------
C3ZH48_BRAFL/391-492P.Q.......YDP..DG....WLG....ALVG.....TK-----------------------------------------
Q099H8_STIAD/11-117G.S........EP..HS....LTN....LLEN.....RT-----------------------------------------
C1N563_MICPC/155-256K.G.......YKA..DG....WLG....IIMG.....TK-----------------------------------------
A8KZ03_FRASN/14-119G.F........LR..PT....IVD....REVG.....ID-----------------------------------------
C3YRI0_BRAFL/374-476G.K.......YKP..DG....WLG...ITIGS.....SL-----------------------------------------
Q08W08_STIAD/272-383P.C........HW.QDA....SFA....HLQG.....LP-----------------------------------------
B5GMC1_STRC2/51-156D.V........EL..PP....FAR....IRRP.....VD-----------------------------------------
A9GWR0_SORC5/11-122P.C........AW.EKT....LLG....ELQP.....LP-----------------------------------------
C3ZI71_BRAFL/547-647T.Y........YP..DN....WLG....MLIS.....GK-----------------------------------------
B2IT96_NOSP7/9-118N.TPQ....QPKL..PV....FLR....GNTW.....VD-----------------------------------------
B9M1H6_GEODF/3-109N.V........VP..PP....FLM....GRQL.....VT-----------------------------------------
A1W966_ACISJ/133-236D.C........TP..SA....RTA....TASR.....AE-----------------------------------------
A8ZZH8_DESOH/82-183K..........DP..YG....FIG....KFQA.....LT-----------------------------------------
D5SSN8_PLAL2/117-218G.L........DP..FG....FFG....KFQG.....IQ-----------------------------------------
A8L7D9_FRASN/338-442E.V........RL..PP....EGA....ARDH.....AD-----------------------------------------
B9M1I3_GEODF/4-102D.S........DL..PY....PFG....ENSH.....VD-----------------------------------------
B7KBK1_CYAP7/4-116Y.D........DL..PG....PLK....NYPG.....VR-----------------------------------------
C3XYH4_BRAFL/100-210A.N.......EDS..FK....AFS....ELVG.....KY-----------------------------------------
Q10WW3_TRIEI/118-233F.SL.....TQPL..NH....DLR....GYLY....RIQ-----------------------------------------
A8IF66_CHLRE/788-889R.G.......YRP..TG....WLG....ILIG.....TK-----------------------------------------
Q0C4A7_HYPNA/4-101K.A........RL..NG....FFK....QEVQ.....PD-----------------------------------------
Q7NE51_GLOVI/173-287G.GMGQ..TAMGW..PA....MLY...SSRSI.....VD-----------------------------------------
B1W250_STRGG/340-445D.V........RL..SA....PYI....DRNP.....VD-----------------------------------------
Q0RNC1_FRAAA/414-526P.Q........PL..PE....PLR....TLRT.....LD-----------------------------------------
Q8TM16_METAC/5-107G.V........EL..PI....LIR....HLPP.....IN-----------------------------------------
B1ZQ16_OPITP/12-113P.E........VP..KG....ELG....CLEG.....IT-----------------------------------------
E3J6T1_FRASU/274-377D.C........EP..AE....ILT....EIPG.....LD-----------------------------------------
Q0RUF2_FRAAA/4-111G.T........EA..PS....RLG....GRPC.....LD-----------------------------------------
B2J3V1_NOSP7/6-112G.V.......NQL..PD....NLI....FLNE.....FR-----------------------------------------
Q47DY5_DECAR/7-118E.T.......VEV..PG....LLK....TTGH.....IA-----------------------------------------
C3YU72_BRAFL/10-119D.N.......NDD..FK....AFG....NLVR.....KF-----------------------------------------
C9YT07_STRSW/352-458R.K.......LSL..DA....PFT....EQL......AD-----------------------------------------
Q7MX37_PORGI/356-463D.T........KF..PG....IPN....DIAC.....IR-----------------------------------------
Q1QLK5_NITHX/3-113G.A........AV..PR....EIA....SYQY.....VE-----------------------------------------
A4G5B3_HERAR/134-239Q.T.......EDS..NY....SFS....RFLK.....LG-----------------------------------------
A9GS07_SORC5/7-118D.C........AW.DWT....EFG....KLAP.....LP-----------------------------------------
Q2JGW8_FRASC/4-114G.SS.....GGDA..PY....RLA....GRRC.....TD-----------------------------------------
A0B6K5_METTP/5-107G.V........EM..PF....FIE....DVVP.....IT-----------------------------------------
A8WVG6_CAEBR/253-355D.F........EQ..TA....EWQ....ETLR.....TA-----------------------------------------
A8L8G2_FRASN/4-112E.A........SR..RA....LTG....ALQG.....IR-----------------------------------------
B4SA08_PELPB/9-120D.D........SW.IDG....LPR....STAY.....LD-----------------------------------------
C7PX42_CATAD/13-123R.A........QL..PA....ELPL.EVRQQI.....ID-----------------------------------------
Q479U9_DECAR/327-433S.A.........P..LG....VFD....TATS.....VG-----------------------------------------
Q0C0W9_HYPNA/5-105K.T........IP..YE....PFR....QEKR.....YS-----------------------------------------
B7KMX7_CYAP7/356-465D.A........PPNWFD....ETS....RVGG.....LE-----------------------------------------
C6XN50_HIRBI/11-116S.G........DA..PE....AML....QLPY.....VS-----------------------------------------
Q82BJ3_STRAW/346-445E.V........RL..PD....SYL....AHEP.....VD-----------------------------------------
C7RUX1_ACCPU/310-422N.V........PV..DG....VFS....LDLA.....ID-----------------------------------------
D5SMM7_PLAL2/3-112P.S........DL..ED....PLA....QFNH.....TM-----------------------------------------
YDDK_BACSU/116-233E.IKG...VIDKN..KK....AFS....LEEP.....ID-----------------------------------------
C7PT18_CHIPD/9-118N.T........PI..DG....ISK....HVVY.....QD-----------------------------------------
C6XK34_HIRBI/4-106D.I........PNRSIT....GIP....EMAY.....MA-----------------------------------------
Q7UFB2_RHOBA/254-366D.A........EV..DG....MLS....IDGY.....VD-----------------------------------------
B7KLQ5_CYAP7/3-111A.N........EL..TG....PLE....QFQS.....TK-----------------------------------------
F1QWA8_DANRE/556-669P.T........SL..PE....DMS....TILK.......-----------------------------------------
K1QKT6_CRAGI/9-119S.T........EV..PA....VIR....FTTS.....CD-----------------------------------------
Q2YN91_BRUA2/146-256D.G........AV..DG....VFR....TDGY.....VD-----------------------------------------
Q6N9F4_RHOPA/4-114A.C........DW.HGA....PFG....KLNA.....V.-----------------------------------------

PF08937

Q12I74_SHEDO/3-119..D.PQKG.......AD----TKG----KNPL-----DY-----------------------------------------
A7HHH7_ANADF/34-147PRQL...........PA----AVT----ENRI-----AV-----------------------------------------
Q6LJM5_PHOPR/2-127TA.............GA----PAN----ARHL-----SI-----------------------------------------
A4G5B5_HERAR/3-116..D.SDGN.......QS----TKG----ANPF-----TG-----------------------------------------
A0LCB5_MAGMM/7-121KT.............SQ----PVK----NNAN-----AI-----------------------------------------
A4G5B4_HERAR/2-119..N.DKGM.......SS----IKG----ANPL-----AQ-----------------------------------------
A3N1I6_ACTP2/3-115..D.SDEK.......QS----SKG----KNPF-----SQ-----------------------------------------
A1SXM2_PSYIN/2-127TS.............GT----PAN----AKHF-----PI-----------------------------------------
Q122C0_POLSJ/18-136RSDENQIIV......PG----RLY----DNIQ-----SG-----------------------------------------
A6LX77_CLOB8/3-127GYSWLR.........TK----TIK----KDGH-----FL-----------------------------------------
Q9A8E1_CAUCR/8-195QRDARRRLRL.....MT----AVS----GVAL-----AI-----------------------------------------
Q6MN07_BDEBA/5-124SFDDHRC........PA----ILD----NELA-----LH-----------------------------------------
Q2NGB5_METST/3-120DYRLNNLILETY...PP----RLH----DNVT-----SG-----------------------------------------
A1W964_ACISJ/3-116..D.HNQQ.......PS----VAG----ANPF-----DS-----------------------------------------
Q21ZJ7_RHOFT/6-120DCEV...........PS----ALA----EYAD-----AM-----------------------------------------
A3N1I7_ACTP2/3-151GR.............YD----YVN----SYGF-----YF-----------------------------------------
Q82T32_NITEU/4-119..D.RNGN.......TS----AMG----KNPF-----DH-----------------------------------------
Q6F1E6_MESFL/3-131PYVSAGTWNSERIC.GP----RIS----KNIK-----NN-----------------------------------------
Q0RX23_RHOJR/5-119QCDL...........PE----PLA----DYAD-----AM-----------------------------------------
A3DI79_CLOTH/7-123RI.............PK----AVS----DVAI-----EI-----------------------------------------
A6LX79_CLOB8/4-117..D.SDGN.......QT----NKG----SNPF-----YQ-----------------------------------------
Q1IIP2_KORVE/3-120..D.PKHG.......AD----TEG----SSPF-----QF-----------------------------------------
A6QC47_SULNB/3-134DYYDIEHGKYRKTTIPP----RLS----ENID-----CG-----------------------------------------
Q122B7_POLSJ/5-119QCDI...........PE----ALD----KYAD-----AI-----------------------------------------
Q03QQ3_LACBA/2-119ISP............LG----LVD----AQAV-----WI-----------------------------------------
Q8FTW2_COREF/4-118..SLPIGS.......TD----SKG----ADPF-----LK-----------------------------------------
Q3Y0J6_ENTFC/3-117..D.FNQM.......TT----TSQ----.SVI-----KI-----------------------------------------
Q3A0F5_PELCD/2-120..N.KDGA.......TV----TKG----ADPL-----AQ-----------------------------------------
Q31IQ3_THICR/3-119GLDGVT.........TE----RCG----QIPK-----GY-----------------------------------------
O86760_STRCO/8-131NSPKA..........PP----RLK----DNLE-----SG-----------------------------------------
Q2LRS2_SYNAS/24-142RNSAGQIIV......PD----RLH----ANII-----SG-----------------------------------------

PF10137

C6W705_DYAFD/4-121-----------.LNLPS----DLY----GITL-----SEFD.--------------------------------------
Q21MV2_SACD2/143-262-----------EVEIPS----DYL----GVIY-----MPFGS--------------------------------------
D2QVU6_SPILD/4-126-----------NIEIPS----DFS----GVLY-----VPYDG--------------------------------------
F8B4J3_FRADG/196-328-----------RVRPFS----DIA----GRLV-----LHLNN--------------------------------------
A3CWB8_METMJ/141-285-----------GVELPS----DTQ----GLLY-----ISLNS--------------------------------------
B1M988_METRJ/155-274-----------KLKLPS----DLA----GITT-----IKYN.--------------------------------------
Q8TKX7_METAC/9-127-----------NVKLPS----DLA----GVTV-----CRISK--------------------------------------
Q24ZU3_DESHY/13-134-----------TPKLAS----DLE----GITY-----CDLDK--------------------------------------
E3J264_FRASU/144-263-----------GVEMPS----DFH----GVGR-----TLFDS--------------------------------------
I3UFW1_ADVKW/147-263-----------NVDIPT----DFA----GVVW-----TEMS.--------------------------------------
A1SX31_PSYIN/148-267-----------NVETPN----DIS----GIVY-----TSMDT--------------------------------------
B0UTQ9_HISS2/135-254-----------DIEKPN----DIS----GVVY-----ITFDS--------------------------------------
M4NKT6_9GAMM/158-276-----------KLKLPS----DLA----GLTT-----VPY..--------------------------------------
C5BHR5_TERTT/6-125-----------EMHLPT----DLL----GVTP-----ADYDA--------------------------------------
Q8XW61_RALSO/85-207-----------NMERPS----DIQ----GLLY-----IPFKD--------------------------------------
L0HBG8_METFS/245-360-----------GITLPS----NLQ----GLYR-----CEY..--------------------------------------
F0ZMV3_DICPU/57-185-----------FYDLPS----DLL----GYVW-----INYDE--------------------------------------
B0UF11_METS4/156-275-----------RIEIPS----DLF----GVIY-----TEMDP--------------------------------------
Q12JL6_SHEDO/5-125-----------DLHFPS----DLL----GITP-----TDFDA--------------------------------------
Q81W84_BACAN/128-251-----------GVELPN----DIS----GLVY-----QKVND--------------------------------------
C7PYD3_CATAD/410-541-----------DHRPIA----DLG----GFNY-----VRVAE--------------------------------------
C5CLS7_VARPS/123-235-----------GVSVPT----NLA----GIVY-----VPYP.--------------------------------------
R5R263_9FIRM/4-124-----------.CQIAS----DLL----GVNV-----VFFDK--------------------------------------
R7K6B0_9FIRM/70-191-----------NFEKPS----DIQ----GLIY-----IPFQN--------------------------------------
C4ZIE6_THASP/167-285-----------GSKMPA----DLG----GDIY-----AALMD--------------------------------------
B4S624_PROA2/362-481-----------DIEKPS----DIE----GIGF-----TVMED--------------------------------------
K0AW63_CLOA9/134-254-----------NPKIAS----DLK----GITY-----INMEM--------------------------------------
C7RC53_KANKD/229-343-----------GVKLPS----NLQ----GLYR-----SE...--------------------------------------
C7R666_KANKD/7-127-----------EFRLPA----DLA----GVTT-----TSYDD--------------------------------------
I4BA92_TURPD/15-129-----------SVEEFS----NIA----GIVY-----EPFSG--------------------------------------
D5V4Y7_ARCNC/166-284-----------ELELPN----DMS----GLVY-----ISYDE--------------------------------------
Q6D353_PECAS/127-247-----------NIETPN----DIS----GVVY-----VPLDN--------------------------------------
Q2K8S5_RHIEC/205-324-----------NVEMPS----DLF----GVVY-----TDMDS--------------------------------------
R5V068_9FIRM/111-228-----------SMELPG----DLN----GIIY-----NK...--------------------------------------
V6KJV2_STRRC/56-188-----------TLRQIS----DIG----GMNV-----IRFDG--------------------------------------
D0LNL0_HALO1/453-571-----------DVEMLS----DYH----GVVY-----REHDD--------------------------------------
E1W054_ARTAR/175-307-----------FTRPIS----DIE----GVHW-----IDLKD--------------------------------------
C1DBI6_LARHH/98-222-----------HLEKPS----DAD----GILY-----IPFNN--------------------------------------
Q9X882_STRCO/76-207-----------GVRPIA----DIA----GRNV-----IRFDG--------------------------------------
B9TGA1_RICCO/4-125-----------DLRLPT----DLM----GIMP-----GQYEA--------------------------------------
R6JZ57_9CLOT/29-145-----------NLDIPS----DLS----GILR-----IDIG.--------------------------------------
R5IEF5_9BACT/151-269-----------EVEKPG----DVD----GVVY-----IMYDD--------------------------------------
D5C5H2_NITHN/120-239-----------GTSLFS----DFG----GIIQ-----KRFAK--------------------------------------
Q47ER9_DECAR/134-252-----------DVEIPN----DIS----GVVY-----VPLDS--------------------------------------
Q027G3_SOLUE/4-122-----------GAQLPS----DLQ----GLTV-----IDMS.--------------------------------------
Q9A4X3_CAUCR/154-272-----------KVKLPS----DLA----GVTT-----IG...--------------------------------------
C1F5N0_ACIC5/154-273-----------EISLPS----DLA----GINT-----ITY..--------------------------------------
Q8EDI5_SHEON/128-249-----------YVEKPS----DID----GVVY-----IPSS.--------------------------------------
A5I3L4_CLOBH/140-260-----------DFHIPS----DLA----GITP-----GDYDA--------------------------------------
B1ZZI8_OPITP/123-242-----------ELEMPS----DVF----GLLY-----EPMDS--------------------------------------
B2FIX1_STRMK/122-235-----------DVVEFS----NVD----GVQY-----IPFSK--------------------------------------
Q6AL85_DESPS/128-241-----------STEEFS----NIA----GVQQ-----IRYSN--------------------------------------
D4LTG4_9FIRM/2-122-----------RPKLAS----DLE----GITW-----GDIRK--------------------------------------
C5CLS5_VARPS/5-125-----------VFHLPT----DLL----GITG-----GKYET--------------------------------------
TIRC_DICDI/55-184-----------NYDLPS----DLL----GYVW-----INYTE--------------------------------------
Q98RD6_MYCPU/91-212-----------DVELPS----DIN----GMIY-----KSFKN--------------------------------------
J9R4G8_RIEAN/5-130-----------.IKLLS----DIK----GISL-----ARFNR--------------------------------------
R6SAH6_9BACE/4-122-----------TVKIPS----DIL----GVTL-----LSYTT--------------------------------------
Q7MKB6_VIBVY/8-129-----------DFHVPT----DLL----GLTP-----GVYDN--------------------------------------

PF08357

CIKS_HUMAN/410-552VPTWLQN..THVYSWPK----NKK----NILL-----RL-----------------------------------------
I17RC_HUMAN/584-737VPALFRT..VPVFTLPS----QLP----DFLG-----AL-----------------------------------------
I17RD_DANRE/355-520VPTSLSL..APKFKLMD----QLP----QLFA-----RL-----------------------------------------
I17RA_MOUSE/380-539VPDLFNI..TSRYPLMD----RFE----EVYF-----RI-----------------------------------------
Q8VUX6_STAHO/2-124IPNFLKS..........----...----KLWT-----EL-----------------------------------------
Q7UT52_RHOBA/13-152.........YIDFSNPD----AYA----TRLE-----EL-----------------------------------------
Q8BPI5_MOUSE/107-257VPSPFRV..APLFSLPS----QLP----AFLD-----AL-----------------------------------------
I17RB_HUMAN/332-479DYNALSV..CPKYHLMK----DAT----AFCA-----EL-----------------------------------------
Q69HQ3_CIOIN/391-538IPTIFRELSGCHFQLMK----QFQ----EFYF-----QL-----------------------------------------
YSO2_CAEEL/415-566VPPNLAILNLPTFILPE----QFA----QLTA-----FL-----------------------------------------
I17RD_HUMAN/356-511VPGILDL..STKYRLMD----NLP----QLCS-----HL-----------------------------------------
Q543U7_MOUSE/329-476DYNALSV..CPQYHLMK----DAT----AFHT-----EL-----------------------------------------
I17RE_RAT/448-585IPGPLRA..LPRYRLLR----DLP----RLLR-----AL-----------------------------------------
I17RD_CHICK/358-512IPGILDL..STKYKLMD----NLP----QLYS-----HL-----------------------------------------
Q73LP6_TREDE/1-127.................----.NN----RIYI-----DL-----------------------------------------

PF01582

B9N1N5_POPTR/14-194I...................LNKLHQTSMS.THHTSLIGI
B9S6Z7_RICCO/19-198I...................LKKLNHTPSS..DTEGLIGI
B9S9D9_RICCO/12-191T...................WEKLNQAFPYDYCDDGLVGI
B9SBW2_RICCO/15-195I...................LKKLNHMSSS.TDSKGLVGI
D7KR54_ARALL/8-188I...................SKKLMVVTTI.SNGSNLVGI
D7MRD9_ARALL/8-185I...................FHKL.NETPS.KDFDNFVGI
D7UDZ7_VITVI/24-202I...................WNKLLSTLTS..DTEDLVGI
F4IFF6_ARATH/55-233I...................SNKLNNSTPL.RDFDGLVGM
F6I7C7_VITVI/9-189L...................LNELLSTPSS.DAEDQLVGI
I1KE95_SOYBN/20-200I...................KKIVGCKFSI.LRNDNLVGM
I1MD01_SOYBN/13-191L...................SSKLNLMYQS..ELTELVGI
TLR4_HUMAN/676-839LLD...............GKSWNPEGTVGTGCNWQEATSI
TLR5_HUMAN/695-858IL.................KKEKEKKKDNNIPLQTVATIS
I18RA_HUMAN/410-598MPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKE
ILRL1_MOUSE/384-567MPVP............ERASKTASVAAPLSGKACLDLKHF
IL18R_HUMAN/377-541M..................PAKTVKPGRDEPEVLPVLSES
ILRL2_HUMAN/385-575MPPRRCRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG
IL1AP_HUMAN/407-570MPV...............KKSPRRSSSDEQGLSYSSLKNV
I18RA_MOUSE/409-597MPVKNSNRFMFNGLRIFLKGFSPEKDLVTQKPLEGMPKSG
Q9ZVX6_ARATH/11-188V...................SEKL.NMTPS.SDFDGMVGI
F4J361_ARATH/93-270V...................SNMLNSFTPS.RDFDGLVG.
M4E4G7_BRARP/12-187V...................T.AVLGFTPS.KDFDDFV..
Q9SSN5_ARATH/8-185I...................SNKKTIYATI.NNGKNLVGI
RPS4C_ARATH/16-186V...................KTALTGIPPE.GSHNA....

PF13676

Q47BW0_DECAR/4-104----------------------------------------
C3Y619_BRAFL/689-797----------------------------------------
C3Y619_BRAFL/881-989----------------------------------------
E3I8M0_RHOVT/4-107----------------------------------------
C3ZXI7_BRAFL/383-491----------------------------------------
A7S5P1_NEMVE/555-656----------------------------------------
A7S5P1_NEMVE/1014-1115----------------------------------------
A8L2Q4_FRASN/29-136----------------------------------------
E3JD12_FRASU/19-126----------------------------------------
E3IW96_FRASU/15-122----------------------------------------
Q0REH0_FRAAA/6-113----------------------------------------
A1BEX3_CHLPD/90-190----------------------------------------
E3J785_FRASU/17-124----------------------------------------
Q2JBL6_FRASC/19-126----------------------------------------
Q0RGM6_FRAAA/6-113----------------------------------------
C6XNE0_HIRBI/4-104----------------------------------------
Q0RIN9_FRAAA/22-129----------------------------------------
E3J7J7_FRASU/27-134----------------------------------------
Q0RPX4_FRAAA/13-120----------------------------------------
A8L235_FRASN/21-128----------------------------------------
Q82CN6_STRAW/36-142----------------------------------------
Q0RPX3_FRAAA/13-120----------------------------------------
Q21Z38_RHOFT/11-111----------------------------------------
Q0RFT3_FRAAA/25-132----------------------------------------
E3IX94_FRASU/15-122----------------------------------------
B3S2N0_TRIAD/460-568----------------------------------------
A8LGL3_FRASN/20-127----------------------------------------
E3IX60_FRASU/26-133----------------------------------------
B4SC53_PELPB/96-199----------------------------------------
Q0RTF6_FRAAA/29-136----------------------------------------
Q0RIT4_FRAAA/69-176----------------------------------------
A8KXQ9_FRASN/9-116----------------------------------------
E3J7Y1_FRASU/19-126----------------------------------------
D2SAJ1_GEOOG/13-119----------------------------------------
A8L102_FRASN/20-127----------------------------------------
Q028E9_SOLUE/5-105----------------------------------------
A7ST59_NEMVE/24-124----------------------------------------
A7ST59_NEMVE/413-519----------------------------------------
Q2JEN2_FRASC/35-142----------------------------------------
A7HHI0_ANADF/4-104----------------------------------------
D2B0U4_STRRD/14-121----------------------------------------
E3JD26_FRASU/17-124----------------------------------------
A8DUR5_NEMVE/387-495----------------------------------------
C3Z670_BRAFL/206-314----------------------------------------
A8L472_FRASN/36-137----------------------------------------
O86768_STRCO/8-114----------------------------------------
C3YB32_BRAFL/1078-1172----------------------------------------
Q2W1R2_MAGSA/34-139----------------------------------------
E3IUH8_FRASU/87-194----------------------------------------
E3JB70_FRASU/15-122----------------------------------------
D9SFF3_GALCS/4-108----------------------------------------
C6XQ37_HIRBI/5-107----------------------------------------
Q3SW17_NITWN/99-207----------------------------------------
C4ZIJ8_THASP/6-119----------------------------------------
C7RV87_ACCPU/4-106----------------------------------------
B6JHA2_OLICO/99-207----------------------------------------
D2B0U5_STRRD/10-115----------------------------------------
C7RQ25_ACCPU/133-235----------------------------------------
Q2J5A8_FRASC/18-127----------------------------------------
Q2NDU5_ERYLH/20-120----------------------------------------
A8L863_FRASN/19-126----------------------------------------
Q2JGC9_FRASC/4-109----------------------------------------
Q9L0M8_STRCO/8-114----------------------------------------
Q0RFV3_FRAAA/13-120----------------------------------------
B3QZ81_CHLT3/7-115----------------------------------------
Q0RPP6_FRAAA/10-118----------------------------------------
Q8CJY8_STRCO/19-125----------------------------------------
C3ZQ01_BRAFL/737-845----------------------------------------
Q0RIR9_FRAAA/18-121----------------------------------------
B0CFH1_ACAM1/694-807----------------------------------------
E3J0G5_FRASU/353-460----------------------------------------
D3B3K4_POLPA/805-907----------------------------------------
Q0RRH7_FRAAA/33-134----------------------------------------
E3J6F2_FRASU/4-111----------------------------------------
A9FJE9_SORC5/5-116----------------------------------------
A8LGX9_FRASN/19-119----------------------------------------
B3S8Y4_TRIAD/187-291----------------------------------------
B3E9D8_GEOLS/5-116----------------------------------------
C3YRI2_BRAFL/372-473----------------------------------------
D2QTN1_SPILD/23-136----------------------------------------
A9VAD9_MONBE/378-481----------------------------------------
C3YBW8_BRAFL/463-564----------------------------------------
B2IVL0_NOSP7/8-109----------------------------------------
Q0RIX3_FRAAA/21-122----------------------------------------
E3I8Q6_RHOVT/4-115----------------------------------------
Q01GF4_OSTTA/482-587----------------------------------------
Q8YVL7_NOSS1/8-109----------------------------------------
A8WVG1_CAEBR/367-484----------------------------------------
A9GSK2_SORC5/1147-1260----------------------------------------
D1A5Y5_THECD/4-128----------------------------------------
A9GWR7_SORC5/353-464----------------------------------------
E3I131_RHOVT/20-126----------------------------------------
Q488J9_COLP3/4-122----------------------------------------
C4ZM27_THASP/14-137----------------------------------------
D2SB43_GEOOG/12-118----------------------------------------
Q0RSZ9_FRAAA/6-111----------------------------------------
D2SB14_GEOOG/4-110----------------------------------------
B0C5U4_ACAM1/223-330----------------------------------------
B4HIY9_DROSE/842-958----------------------------------------
A7SAI7_NEMVE/4-114----------------------------------------
B1ZSG7_OPITP/145-246----------------------------------------
C1EBU5_MICSR/479-580----------------------------------------
C3ZH48_BRAFL/391-492----------------------------------------
Q099H8_STIAD/11-117----------------------------------------
C1N563_MICPC/155-256----------------------------------------
A8KZ03_FRASN/14-119----------------------------------------
C3YRI0_BRAFL/374-476----------------------------------------
Q08W08_STIAD/272-383----------------------------------------
B5GMC1_STRC2/51-156----------------------------------------
A9GWR0_SORC5/11-122----------------------------------------
C3ZI71_BRAFL/547-647----------------------------------------
B2IT96_NOSP7/9-118----------------------------------------
B9M1H6_GEODF/3-109----------------------------------------
A1W966_ACISJ/133-236----------------------------------------
A8ZZH8_DESOH/82-183----------------------------------------
D5SSN8_PLAL2/117-218----------------------------------------
A8L7D9_FRASN/338-442----------------------------------------
B9M1I3_GEODF/4-102----------------------------------------
B7KBK1_CYAP7/4-116----------------------------------------
C3XYH4_BRAFL/100-210----------------------------------------
Q10WW3_TRIEI/118-233----------------------------------------
A8IF66_CHLRE/788-889----------------------------------------
Q0C4A7_HYPNA/4-101----------------------------------------
Q7NE51_GLOVI/173-287----------------------------------------
B1W250_STRGG/340-445----------------------------------------
Q0RNC1_FRAAA/414-526----------------------------------------
Q8TM16_METAC/5-107----------------------------------------
B1ZQ16_OPITP/12-113----------------------------------------
E3J6T1_FRASU/274-377----------------------------------------
Q0RUF2_FRAAA/4-111----------------------------------------
B2J3V1_NOSP7/6-112----------------------------------------
Q47DY5_DECAR/7-118----------------------------------------
C3YU72_BRAFL/10-119----------------------------------------
C9YT07_STRSW/352-458----------------------------------------
Q7MX37_PORGI/356-463----------------------------------------
Q1QLK5_NITHX/3-113----------------------------------------
A4G5B3_HERAR/134-239----------------------------------------
A9GS07_SORC5/7-118----------------------------------------
Q2JGW8_FRASC/4-114----------------------------------------
A0B6K5_METTP/5-107----------------------------------------
A8WVG6_CAEBR/253-355----------------------------------------
A8L8G2_FRASN/4-112----------------------------------------
B4SA08_PELPB/9-120----------------------------------------
C7PX42_CATAD/13-123----------------------------------------
Q479U9_DECAR/327-433----------------------------------------
Q0C0W9_HYPNA/5-105----------------------------------------
B7KMX7_CYAP7/356-465----------------------------------------
C6XN50_HIRBI/11-116----------------------------------------
Q82BJ3_STRAW/346-445----------------------------------------
C7RUX1_ACCPU/310-422----------------------------------------
D5SMM7_PLAL2/3-112----------------------------------------
YDDK_BACSU/116-233----------------------------------------
C7PT18_CHIPD/9-118----------------------------------------
C6XK34_HIRBI/4-106----------------------------------------
Q7UFB2_RHOBA/254-366----------------------------------------
B7KLQ5_CYAP7/3-111----------------------------------------
F1QWA8_DANRE/556-669----------------------------------------
K1QKT6_CRAGI/9-119----------------------------------------
Q2YN91_BRUA2/146-256----------------------------------------
Q6N9F4_RHOPA/4-114----------------------------------------

PF08937

Q12I74_SHEDO/3-119----------------------------------------
A7HHH7_ANADF/34-147----------------------------------------
Q6LJM5_PHOPR/2-127----------------------------------------
A4G5B5_HERAR/3-116----------------------------------------
A0LCB5_MAGMM/7-121----------------------------------------
A4G5B4_HERAR/2-119----------------------------------------
A3N1I6_ACTP2/3-115----------------------------------------
A1SXM2_PSYIN/2-127----------------------------------------
Q122C0_POLSJ/18-136----------------------------------------
A6LX77_CLOB8/3-127----------------------------------------
Q9A8E1_CAUCR/8-195----------------------------------------
Q6MN07_BDEBA/5-124----------------------------------------
Q2NGB5_METST/3-120----------------------------------------
A1W964_ACISJ/3-116----------------------------------------
Q21ZJ7_RHOFT/6-120----------------------------------------
A3N1I7_ACTP2/3-151----------------------------------------
Q82T32_NITEU/4-119----------------------------------------
Q6F1E6_MESFL/3-131----------------------------------------
Q0RX23_RHOJR/5-119----------------------------------------
A3DI79_CLOTH/7-123----------------------------------------
A6LX79_CLOB8/4-117----------------------------------------
Q1IIP2_KORVE/3-120----------------------------------------
A6QC47_SULNB/3-134----------------------------------------
Q122B7_POLSJ/5-119----------------------------------------
Q03QQ3_LACBA/2-119----------------------------------------
Q8FTW2_COREF/4-118----------------------------------------
Q3Y0J6_ENTFC/3-117----------------------------------------
Q3A0F5_PELCD/2-120----------------------------------------
Q31IQ3_THICR/3-119----------------------------------------
O86760_STRCO/8-131----------------------------------------
Q2LRS2_SYNAS/24-142----------------------------------------

PF10137

C6W705_DYAFD/4-121----------------------------------------
Q21MV2_SACD2/143-262----------------------------------------
D2QVU6_SPILD/4-126----------------------------------------
F8B4J3_FRADG/196-328----------------------------------------
A3CWB8_METMJ/141-285----------------------------------------
B1M988_METRJ/155-274----------------------------------------
Q8TKX7_METAC/9-127----------------------------------------
Q24ZU3_DESHY/13-134----------------------------------------
E3J264_FRASU/144-263----------------------------------------
I3UFW1_ADVKW/147-263----------------------------------------
A1SX31_PSYIN/148-267----------------------------------------
B0UTQ9_HISS2/135-254----------------------------------------
M4NKT6_9GAMM/158-276----------------------------------------
C5BHR5_TERTT/6-125----------------------------------------
Q8XW61_RALSO/85-207----------------------------------------
L0HBG8_METFS/245-360----------------------------------------
F0ZMV3_DICPU/57-185----------------------------------------
B0UF11_METS4/156-275----------------------------------------
Q12JL6_SHEDO/5-125----------------------------------------
Q81W84_BACAN/128-251----------------------------------------
C7PYD3_CATAD/410-541----------------------------------------
C5CLS7_VARPS/123-235----------------------------------------
R5R263_9FIRM/4-124----------------------------------------
R7K6B0_9FIRM/70-191----------------------------------------
C4ZIE6_THASP/167-285----------------------------------------
B4S624_PROA2/362-481----------------------------------------
K0AW63_CLOA9/134-254----------------------------------------
C7RC53_KANKD/229-343----------------------------------------
C7R666_KANKD/7-127----------------------------------------
I4BA92_TURPD/15-129----------------------------------------
D5V4Y7_ARCNC/166-284----------------------------------------
Q6D353_PECAS/127-247----------------------------------------
Q2K8S5_RHIEC/205-324----------------------------------------
R5V068_9FIRM/111-228----------------------------------------
V6KJV2_STRRC/56-188----------------------------------------
D0LNL0_HALO1/453-571----------------------------------------
E1W054_ARTAR/175-307----------------------------------------
C1DBI6_LARHH/98-222----------------------------------------
Q9X882_STRCO/76-207----------------------------------------
B9TGA1_RICCO/4-125----------------------------------------
R6JZ57_9CLOT/29-145----------------------------------------
R5IEF5_9BACT/151-269----------------------------------------
D5C5H2_NITHN/120-239----------------------------------------
Q47ER9_DECAR/134-252----------------------------------------
Q027G3_SOLUE/4-122----------------------------------------
Q9A4X3_CAUCR/154-272----------------------------------------
C1F5N0_ACIC5/154-273----------------------------------------
Q8EDI5_SHEON/128-249----------------------------------------
A5I3L4_CLOBH/140-260----------------------------------------
B1ZZI8_OPITP/123-242----------------------------------------
B2FIX1_STRMK/122-235----------------------------------------
Q6AL85_DESPS/128-241----------------------------------------
D4LTG4_9FIRM/2-122----------------------------------------
C5CLS5_VARPS/5-125----------------------------------------
TIRC_DICDI/55-184----------------------------------------
Q98RD6_MYCPU/91-212----------------------------------------
J9R4G8_RIEAN/5-130----------------------------------------
R6SAH6_9BACE/4-122----------------------------------------
Q7MKB6_VIBVY/8-129----------------------------------------

PF08357

CIKS_HUMAN/410-552----------------------------------------
I17RC_HUMAN/584-737----------------------------------------
I17RD_DANRE/355-520----------------------------------------
I17RA_MOUSE/380-539----------------------------------------
Q8VUX6_STAHO/2-124----------------------------------------
Q7UT52_RHOBA/13-152----------------------------------------
Q8BPI5_MOUSE/107-257----------------------------------------
I17RB_HUMAN/332-479----------------------------------------
Q69HQ3_CIOIN/391-538----------------------------------------
YSO2_CAEEL/415-566----------------------------------------
I17RD_HUMAN/356-511----------------------------------------
Q543U7_MOUSE/329-476----------------------------------------
I17RE_RAT/448-585----------------------------------------
I17RD_CHICK/358-512----------------------------------------
Q73LP6_TREDE/1-127----------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window