Sequence alignment for CL0176

PF06151

GR64A_DROME/1-455MKGPNLNFRKTPSKDNGVKQVESLARPETPPPKFVEDSNLEFNVLASEKLPNYTNLDLFHRAVFPFMFLAQC-VA--IMP
GR05A_DROME/40-438VRGT....RK.........................................NFLHDGSFHEAVAPVLAVAQC-FC--LMP
GR64D_DROME/1-416MLRSHLSVHG.....................................LQMERSVQENTLHYTIGHVLIIARI-FG--VLP
GR64C_DROME/1-407MQQSGQKGTR..............................................NTLQHAIGPVLVIAQF-FG--VLP
GR61A_DROME/1-435MSRTSDDIRK...............HLKVRRQKQ..RAILAMRWRCAQGGLEFEQLDTFYGAIRPYLCVAQF-FG--IMP
GR64F_DROME/63-463LSRS....DK........................................EAFLSDGSFHQAVGRVLLVAEF-FA--MMP
GR64E_DROME/25-448.RVGSEVVEK...................DTKRF..KLSLIKAWLLRIRQEDYKYSGSFQEAIKPVLIIAQI-FA--LMP
GR64B_DROME/1-403MPQG....................................................ETFHRAVSNVLFISQI-YG--LLP

PF08395

Q7PKI1_ANOGA/57-400--------------------------------------------------------------TKAVLVLIKC.FG..QLY
Q7PKI2_ANOGA/11-404--------------------------------------------------------------LRLHFHTAQC.IG..FVP
Q7PKG3_ANOGA/26-401--------------------------------------------------------------VPLHYLVLKM.SG..MGC
GR93B_DROME/24-392--------------------------------------------------------------LRSCFLYGTF.FG..VIT
GR21A_DROME/81-445--------------------------------------------------------------TKSLLVLFQI.MG..VMP
Q7PK37_ANOGA/8-367--------------------------------------------------------------HSRIFQISRL.LY..FTP
Q7PQ43_ANOGA/15-419--------------------------------------------------------------LIAVFSFIQI.IGLQLHD
Q7PK29_ANOGA/12-374--------------------------------------------------------------FKIMSSVYYLPVA.....
Q7PF19_ANOGA/20-402--------------------------------------------------------------LYRLLTVGQV.FG..LVA
Q7PKH1_ANOGA/14-409--------------------------------------------------------------LRILYYIAKT.FG..LIS
Q7PF39_ANOGA/19-415--------------------------------------------------------------ISPTVRLSQC.LS..LAP
GR97A_DROME/41-418--------------------------------------------------------------VFLNILYGVY.LG.....
GR22E_DROME/18-388--------------------------------------------------------------LKGALYGSWI.LG..VFP
GR77A_DROME/37-447--------------------------------------------------------------LGILYSLTRV.FG..LMA
GR36C_DROME/8-389--------------------------------------------------------------LGAVYYYGLF.IGLSNFE
GR98C_DROME/14-394--------------------------------------------------------------ARPYLQVLSL.FG..LTP
Q8MLS6_DROME/6-364--------------------------------------------------------------IKLYFRYSLA.IG..ITS
Q7PKH4_ANOGA/15-393--------------------------------------------------------------LRPLLAFSKY.FG..LTA
Q7PKH2_ANOGA/13-388--------------------------------------------------------------VRPVYRAGKL.IG..IFT
Q7PVJ7_ANOGA/11-395--------------------------------------------------------------LLFSTTIATL.LGYLTIT
Q7PK40_ANOGA/8-372--------------------------------------------------------------HARIFQAAAL.FY..LVP
Q8MMI1_HELVI/3-387--------------------------------------------------------------LDKVFLWSCL.YG.....
GR85A_DROME/27-394--------------------------------------------------------------QRSLGYFCAL.NG..ILD
Q7PVK1_ANOGA/8-381--------------------------------------------------------------SRLLHLKTVL.LG..VVP
Q7PK39_ANOGA/8-367--------------------------------------------------------------HSRIFQISRL.LY..FTP
GR22C_DROME/17-382--------------------------------------------------------------LKATLYSSWF.LG..VFP
G39AA_DROME/8-363--------------------------------------------------------------LLFFLHYQRY.LG..LTN
GR59D_DROME/9-389--------------------------------------------------------------LRIAYAYGRL.TG..VIN
GR92A_DROME/18-383--------------------------------------------------------------LRYIFRYAQF.IGVIFFC
GR08A_DROME/9-380--------------------------------------------------------------LQFHLRLYQV.LGFHGLP
Q7PVJ8_ANOGA/8-380--------------------------------------------------------------GKVLYVKSIL.VG..VIP
Q7PK13_ANOGA/41-414--------------------------------------------------------------LSVAFGIFKC.FG..FIP
GR22B_DROME/17-385--------------------------------------------------------------LKTTLYGSWL.LG..IFP
GR63A_DROME/100-456--------------------------------------------------------------IDPINWFLRI.IG..VLP
GR94A_DROME/17-399--------------------------------------------------------------TIILIGFMTV.FG..LLA
Q7PKI5_ANOGA/30-402--------------------------------------------------------------ERCVWSFLLA.CG..TFP
GR36A_DROME/9-390--------------------------------------------------------------LKVLYYYGQI.IG..LIN
Q7PF38_ANOGA/19-415--------------------------------------------------------------FNLLLNIAQL.AG..FLP
Q7PKH9_ANOGA/7-400--------------------------------------------------------------LRALYYFHSI.LG..LVP
GR93C_DROME/18-394--------------------------------------------------------------LFCSCHYGRI.LG..VIC
Q7PJT3_ANOGA/18-425--------------------------------------------------------------QRPVLRVSFL.VG..MTP
GR68A_DROME/7-379--------------------------------------------------------------IYPISKPSQI.FA..ILP
GR09A_DROME/6-339--------------------------------------------------------------EHFLTGYFQL.CG..LVC
Q7PQT4_ANOGA/106-466--------------------------------------------------------------HKLLLVLFRG.LA..VMP
Q7PK18_ANOGA/61-428--------------------------------------------------------------LSGYVRFHQW.LG..FQP
GR32A_DROME/57-449--------------------------------------------------------------IRTILSVLKA.SG..LMP
GR22A_DROME/19-388--------------------------------------------------------------IRATLYGSWV.LG..LFP
GR22_ANOGA/73-437--------------------------------------------------------------TKSLLVLFQI.MG..VMP
Q7PF20_ANOGA/20-415--------------------------------------------------------------AHRLLRVCQV.FG..TVP
GR58A_DROME/3-389--------------------------------------------------------------LKFMYIYGIG.CG..LMP
GR10A_DROME/19-404--------------------------------------------------------------YRYGHVYALI.YGQVVID
G39AC_DROME/9-372--------------------------------------------------------------LRVQLRTLKW.LG..VLR
O18280_CAEEL/46-428--------------------------------------------------------------LGPLYSYMMV.LG..LNH
Q7PVJ9_ANOGA/29-402--------------------------------------------------------------ARLLHLKMVA.LG..VVP
Q7PK41_ANOGA/8-377--------------------------------------------------------------LRVLFFVSNV.LY..LVP
Q7PK36_ANOGA/8-375--------------------------------------------------------------YRLLLAVASI.GY..LIP
GR58B_DROME/10-387--------------------------------------------------------------MNVVYYHSVV.FA..LMS
GR59C_DROME/9-394--------------------------------------------------------------LLIAYWYGLA.VG..VSN
Q7PTR1_ANOGA/7-389--------------------------------------------------------------IRPILVIFLL.FG..QFP
LITE1_CAEEL/48-425--------------------------------------------------------------LYPIYYLLLI.LG..LNQ
GR10B_DROME/11-372--------------------------------------------------------------LRFWMGLILV.LGFSSHY
Q7PI94_ANOGA/14-414--------------------------------------------------------------VEMNVKFYRL.LG..LAP
G39AD_DROME/8-362--------------------------------------------------------------LRIYLRLLHI.MG..MMC
GR36B_DROME/9-390--------------------------------------------------------------LKAVHIYCYL.IG..LSN
Q7PK17_ANOGA/41-408--------------------------------------------------------------FGSIYPLFQL.LG..FTP
GR48C_DROME/7-410--------------------------------------------------------------LHTYFQVSRL.IG..LCN
G39AB_DROME/8-372--------------------------------------------------------------LCAYYRLCRY.LG..IFC
GR98A_DROME/13-370--------------------------------------------------------------LLYMRRLMKC.LG..MLP
GR98D_DROME/12-392--------------------------------------------------------------ARPYIQIYSI.FG..LTP
GR22F_DROME/19-377--------------------------------------------------------------LQTTLYASWL.LG..LFP
Q9W1V0_DROME/5-363--------------------------------------------------------------GQAYNVYAVF.IG..MTS
GR89A_DROME/10-356--------------------------------------------------------------LCLLLKYWQI.LA..LAP
Q7PF36_ANOGA/19-401--------------------------------------------------------------FRPLLNVAQC.FG..FLP
GR22D_DROME/17-386--------------------------------------------------------------LKSILYSSWL.LG..IFP
GR98B_DROME/12-392--------------------------------------------------------------AFPYLDIFSV.FA..LTP
GR59E_DROME/7-383--------------------------------------------------------------ENLLLTINRF.LG..VYP
GR28B_DROME/45-447--------------------------------------------------------------LRPVFHVTYI.HG..LTS
Q8IN22_DROME/11-375--------------------------------------------------------------LRFMSFYARF.LS..LVC

PF02949

OR22B_DROME/79-381--------------------------------------------------------------SAGEFLSSIQIGV-----
OR24A_DROME/68-388--------------------------------------------------------------NIATALDALCPVA-----
OR23A_DROME/59-365--------------------------------------------------------------DPVENNFSLSLTV-----
OR85D_DROME/84-400--------------------------------------------------------------NFLEATMNLSFIG-----
OR45B_DROME/68-386--------------------------------------------------------------SPVDAMDAFCPLA-----
OR43A_DROME/56-364--------------------------------------------------------------DLPAFILNMFFFS-----
OR98A_DROME/74-379--------------------------------------------------------------TPNELLTVMQLFF-----
OR94A_DROME/69-376--------------------------------------------------------------NLEQAGQVLYMSI-----
OR22C_DROME/69-392--------------------------------------------------------------NLVVALEAFCPGT-----
OR2A_DROME/66-387--------------------------------------------------------------NMAGLCENLTITI-----
OR45A_DROME/64-362--------------------------------------------------------------NFAVFMQGSQST.-----
OR33C_DROME/60-372--------------------------------------------------------------STAEFFKNLTMSL-----
OR46A_DROME/62-365--------------------------------------------------------------YMSEVVKAIFILA-----
OR85C_DROME/62-369--------------------------------------------------------------KFIDAVTVLSYIG-----
OR85B_DROME/63-370--------------------------------------------------------------KFLEAVTALSYIG-----
OR42B_DROME/76-381--------------------------------------------------------------SPGEFLTSLQVCI-----
OR47B_DROME/88-402--------------------------------------------------------------NVIEMGDDLVWIS-----
OR63A_DROME/74-403--------------------------------------------------------------IGETAGTALQFL.-----
OR10A_DROME/70-396--------------------------------------------------------------QITLALETLCPAG-----
OR83B_DROME/70-476--------------------------------------------------------------EVNELSGNTITTL-----
OR59C_DROME/79-385--------------------------------------------------------------TPTEFLTSLQVDI-----
OR9A_DROME/68-381--------------------------------------------------------------QVSLLSDTLGSTF-----
OR30A_DROME/58-366--------------------------------------------------------------SLDFIIRNVYLAV-----
OR47A_DROME/56-375--------------------------------------------------------------NVLLLADAMVALL-----
OR49B_DROME/52-364--------------------------------------------------------------GLTGIIRNSYMLV-----
OR85F_DROME/68-381--------------------------------------------------------------DNVSLIMRYATLV-----
OR94B_DROME/66-372--------------------------------------------------------------DFEEAGQVLYMSI-----
OR59B_DROME/77-382--------------------------------------------------------------TPGEFLTSLQVCI-----
OR56A_DROME/124-407--------------------------------------------------------------EM.ELLVATQAYT-----
OR85A_DROME/77-379--------------------------------------------------------------TTTDLFTYVQVPV-----
OR33B_DROME/61-369--------------------------------------------------------------SLGDVCKGLPITA-----
OR46B_DROME/62-373--------------------------------------------------------------QVREILKVFFMFA-----
OR33A_DROME/60-367--------------------------------------------------------------QI.QVFRSLHFTS-----
OR88A_DROME/73-392--------------------------------------------------------------LGHPANQNPPVLS-----
OR59A_DROME/64-386--------------------------------------------------------------TITEDILNLTTFA-----
OR7A_DROME/80-394--------------------------------------------------------------EITQVLTSAQVAI-----

PF03268

Q9XVJ4_CAEEL/45-398--------------------------------------------------------------LLGPFRFLIKLTL-----
O16246_CAEEL/33-393--------------------------------------------------------------LLGPFRKIIKITG-----
O45459_CAEEL/19-372--------------------------------------------------------------IFGVYPYLLKFSP-----
O16244_CAEEL/60-411--------------------------------------------------------------LLGPFRFLVKASL-----
O16245_CAEEL/33-364--------------------------------------------------------------FLGPYSIILKFSG-----
O18140_CAEEL/17-370--------------------------------------------------------------IFGFFRYLLRVSP-----
O44618_CAEEL/25-384--------------------------------------------------------------LLGFLKYTTKLTG-----

PF06151

GR64A_DROME/1-455L---VGIRES.NPRRVRFAYKSIPMFVTLIFMIATSILFLSMFT-------------HLLK-IGITAKNFVGLVFFGCVL
GR05A_DROME/40-438V---CGISAP.TYRGLSFNRRSWRFWYSSLYLCSTSVDLAFSIR-------------RVAH-SVLDVRSVEPIVFHVSIL
GR64D_DROME/1-416L---AGINPNGKPENVRFRWFSPYILFFVVAFTFVIADFMLSTK-------------IVLN-DGLQLYTMGSLSFSVICI
GR64C_DROME/1-407V---AGVWPSCRPERVRFRWISLSLLAALILFVFSIVDCALSSK-------------VVFD-HGLKIYTIGSLSFSVICI
GR61A_DROME/1-435L---SNIRSR.DPQDVKFKVRSIGLAVTGLFLLLGGMKTLVGAN-------------ILFT-EGLNAKNIVGLVFLIVGM
GR64F_DROME/63-463V---KGVTGK.HPSDLSFSWRNIRTCFSLLFIASSLANFGLSLF-------------KVLN-NPISFNSIKPIIFRGSVL
GR64E_DROME/25-448V---RKVSSK.FAEDLTFTWFSVRSYYALVTILFFGVSSGYMVA-------------FVTS-VSFNFDSVETLVFYLSIF
GR64B_DROME/1-403V---SNVRAL.DVADIRFRWCSPRILYSLLIGILNLSEFGAVIN-------------YVIK-VTINFHTSSTLSLYIVCL

PF08395

Q7PKI1_ANOGA/57-400G........ILPLASNAFTFERSRPVLWYSRTIALLLMVIYPCA...YIVLLTDHEFPILA-LSYYIIMLQFTLNYIIVG
Q7PKI2_ANOGA/11-404L........HFNKQLQTFQI.SRWLTVWSHALALTLLCVYPYVY....VILLTGIRYPKLT-LVNYLVWMQCSLHYVNLA
Q7PKG3_ANOGA/26-401I...........TPRAGVRNGSTMTTLIDIGLFVTNLILAVTMM...IYGMFITQRHMQSP-IMFIGLKMVNFTCYASTI
GR93B_DROME/24-392F........RIERKDSQLVAINRRGYLWICLVIRLLASCFYGYS...YDAWSGQYE...DM-YLRAFFGFRLIGCLICSV
GR21A_DROME/81-445IHR...NPPEKNLPRTGYSW.GSKQVMWAIFIYSCQTTIVVLVL...RERVKKFVTSPDKR-FDEAIYNVIFISLLFTNF
Q7PK37_ANOGA/8-367C........SYNEELGRFEA..TKRNLAFLGAALVLTIPFWVYD...IHLMATNFLHTYTT-VFAAVGGIELLIYVSVVM
Q7PQ43_ANOGA/15-419SY.....ETETNGKTPSLSIVRILYSIILFGAYLVGLYKAVELT......FVVEFAANSPS-IFKFAYMTQIYSGVLATI
Q7PK29_ANOGA/12-374.........YDAVEHRFIEK.RSNLIPFAIGLLLSIGFIYHDFF...IVLPNFNT..DQSA-FTLAVFIVELTVFATVPI
Q7PF19_ANOGA/20-402WDL...QPLEPDRPTTKLHW.FRKLIRATNQGYCFMIIVAIGTA...TVLHHSSNTANAFF-AIRTLYLTENVIVNVIVL
Q7PKH1_ANOGA/14-409F........TTTFDTVGIRR.SFKDVLVFVGFMFFNCYIVFKTG...IPPKSDSPSYFDSS-LIQFILGLFLTLQLIALI
Q7PF39_ANOGA/19-415YPLS.VFQRNCSTRSVRIRIIICFRYAFATCVTVAVVASQFTMF...YYFPHIMYQPKVPI-FIVILYYIVSILQTLTTG
GR97A_DROME/41-418.........RFSFRRKKFVFSKGLTIYSLFVATFFALFYIWNIY.........NEISTGQI-NLRDTIGIYCYMNVCVCL
GR22E_DROME/18-388FA.....YDSWTRTLRRSKW..LIAYGFVLNAAFILLVVTNDTE...SETPLRMEVFHRNA-LAEQINGIHDIQSLSMVS
GR77A_DROME/37-447TANW..SPRGIKRVRQSLYL.RIHGCVMLIFVGCFSPFAFWCIF.......QRMAFLRQNR-ILLMIGFNRYVLLLVCAF
GR36C_DROME/8-389F........DWNTGRVFTKK.WSTLYAIALDSCIFALYIYHWTG...NTNIVNAIFGRANM-LHEYVVAILTGLRIVTGL
GR98C_DROME/14-394PAE...FFTRTLRKRRRFCW.MAGYSLYLIAILLMVFYEFHANI...VSLHLEIYKFHVED-FSKVMGRTQKFLIVAIAT
Q8MLS6_DROME/6-364Q........QFSNRKFFSTL.FSRTYALIANIVTLIMLPIVMWQ....VQLVFQQKKTFPK-LILITNNVREAVSFLVIL
Q7PKH4_ANOGA/15-393F........SIVGEPPYVQV.KVTGVEYVALLMNFVANLYCVYI...NVTNNRLSRWTGSA-VMNLGLGFLFPLGAIVMI
Q7PKH2_ANOGA/13-388H........TIDFERQVLST.NTRDQVLLVVAILMDVYALTVST.......RVSYSFSNSI-LLNVGIYCSVNLGIIISL
Q7PVJ7_ANOGA/11-395Y........DRKRQELRVST.VLVVYSIVLAILCTFTYQSAQFL...SSDMRYRNGIKESA-VNKAIGAIQGQVVLQTFL
Q7PK40_ANOGA/8-372C........SYNTETDQFEQ..RTVNKLAFAVGIGMTVPFWYFD...LKFMIAFYLENISP-IMVAVGSIEIAVYVSIVS
Q8MMI1_HELVI/3-387.........VFGSKRFISLI.WSTLILGSLVIIEVLAIWKVIRA...LAGVARDMSGHRSV-TARLAGTIFYSISILSLV
GR85A_DROME/27-394F........NTDIGTGNLRR.YRVLFMYRLLHNFAVISLTLKFL...FDFTDHFKYIESST-LITVNFFTYFTLVFFALL
Q7PVK1_ANOGA/8-381F........HFHRSTLTLELRRELLLYCCAIVILGPTGRFYIYL...TTFLRMHGKFIVAF-YSALFIELSDVVLLIVPP
Q7PK39_ANOGA/8-367C........SY.NEELGHFV.ATKSNLTVFGVALVLTISFWVYD...IHLMATNVLRTYTT-VFAAVGGIELLIYVSVVI
GR22C_DROME/17-382Y........RFDSRNGQLKR.SRFLLFYGLILNFFLLLKMVCSG...GQKLGIPEAFARNS-VLENTHYTTGMLAVFSCV
G39AA_DROME/8-363L.........DFSKSLHIYWLHGTWSSTAIQIVVVGVFMAALLG...ALAESLYYMETKSQ-TGNTFDNAVILTTSVTQL
GR59D_DROME/9-389F........KIDLKTGQALVTRGATLISVSTHLLIFALLLYQTM...RKSVVNVMWKYANS-LHEYVFLVIAGFRVVCVF
GR92A_DROME/18-383LHTR..KDDKTVFIRNWLKW.LNVTHRIITFTRFFWVYIASISI.............KTNR-VLQVLHGMRLVLSIPNVA
GR08A_DROME/9-380L........PGDGNPARTRR.RLMAWSLFLLISLSALVLACLFS.......GEEFLYRGDM-FGCANDALKYVFAELGVL
Q7PVJ8_ANOGA/8-380L............RLPRSSWELLILCYCYTIAIAGPLVHFLLYL...AWFVIVMVKFRVTF-VVSICMHLGEVPFLIFPP
Q7PK13_ANOGA/41-414F........PFDCCTFALTPCSNVRSLLHLPILQVSFYLTLFCI...IMSNRVNFFFTGLQ-ILSLNDIIKYGTLTLSVF
GR22B_DROME/17-385FT......LDSGKRIRQLRRSRCLTLYGLVLNYFLIFTLIRLAF...EYRKHKLEAFKRNP-VLEMINVVIGIINVLSAL
GR63A_DROME/100-456I.........VRHGPARAKFEMNSASFIYSVVFFVLLACYVGYV...ANNRIHIVRSLSGP-FEEAVIAYLFLVNILPIM
GR94A_DROME/17-399N.......RYRAGRRERFRFSKANLAFASLWAIAFSLVYGRQIY.........KEYQEGQI-NLKDATTLYSYMNITVAV
Q7PKI5_ANOGA/30-402L........RFDAVGPGRFF.TSRKCALYCSGITVVYAVLSPAL...MYLIYEHERVANVY-LVSMLNAAQLSFIYLFMI
GR36A_DROME/9-390F........EIDWQRGRVVAAQRGILFAIAINVLICMVLLLQIS...KKFNLDVYFGRANQ-LHQYVIIVMVSLRMASGI
Q7PF38_ANOGA/19-415FPAY.VLRQDVERLHFRTLVLTCLNLTFAVLIFLTSFVCYLAMY...IYYPDLMYKENLPA-VLQIMYHVENWLRVVMVL
Q7PKH9_ANOGA/7-400YELN..NQNGLRRSKCKRQWTLTIGCTTVVLVGFSFCTVWLQDT...LSFATFVD....AL-LIRSLVLVEFTIRYGTVV
GR93C_DROME/18-394FDIG..QRTSDDSLVVRNRHQFKWFCLSCRLISVTAVCCFCAPY..........VADIEDP-YERLLQCFRLSASLICGI
Q7PJT3_ANOGA/18-425F........TVVKGPTELMMLRCTPFGYINSSVHVILFCSCYVNA.LLQGDTITRFFFRTD-ISTLGDVLQFTIGITALF
GR68A_DROME/7-379FYSG..DVDDGFRFGGLGRW.YGRLVALIILIGSLTLGEDVLF....ASKEYRLVASAQGD-TEEINRTIETLLCIISYT
GR09A_DROME/6-339G..............WSGSR.LGRLLSSTFLVLILIELVGEIET...YFTEENPDNESVPA-YFAKVIMGVNMAYKMIHA
Q7PQT4_ANOGA/106-466I.......TRSVPGRITFSW.RSAASIYAFCFYLVSTVIVLVVG.....YERIKVFQTTTK-FDEYIYGILFVIFLVPHF
Q7PK18_ANOGA/61-428Y...............RLAS.GRVSPFAVLTLAQFLGVLVNLAL...IIYRRRCILYHCEA-IGMVVDFIKLLTIGLSIL
GR32A_DROME/57-449IY.....EQVSDYEVGPPTKTNEFYSFFVRGVVHALTIFNVYSL...FTPISAQLFFSYRE-TDNVNQWIELLLCILTYT
GR22A_DROME/19-388F........TFDSRKRRLNR.SKWLLAYGLVLNLTLLVLSMLPST.DDHNSVKVEVFQRNP-LVKQVEELVEVISLITTL
GR22_ANOGA/73-437IMR...SPKGVDMPRTTFTW.CSKAFLWAYFIYACETVIVLVVA...RERINKFISTSDKR-FDEVIYNIIFMSIMVPHF
Q7PF20_ANOGA/20-415WEV....TLFAHVTQPLSSW.RERLFRTLNALYSLALGLAVLSA...TVLQHAEFDHHMPF-VTHMLYISEYSMENGVVM
GR58A_DROME/3-389A........PLKKGQFLLGYKQRWYLIYTACLHGGLLTVLPFTF...PHYMYDDSYMSSNP-VLKWTFNLTNITRIMAMF
GR10A_DROME/19-404Y........VPQRALKRGVKVLLIAYGHLFSMLLIVVLPGYFCY...HFRTLTDTLDRRLQ-LLFYVSFTNTAIKYATVI
G39AC_DROME/9-372FTID..FNKCLVRENASEER.SAWLYLIGVVGITCSLIVYSTYF...PSHFIMGKH...NT-TGNCYALINIRSCSIVTM
O18280_CAEEL/46-428T........HSSARNTMFKW.PLTIYNYLTLAILTAATIRRISQ...IKQKSATNEEKDAA-FHVLNPTFVLTLCHALLM
Q7PVJ9_ANOGA/29-402Y........EFHPATLSLQFRRSLLLYCFIIAIIGPMGRCWVYL......TTFFTMNFGVS-VAHYTAMFMELLDAILLV
Q7PK41_ANOGA/8-377C........RYCRKENKFKV.NPYLSLLAFGINISLASVHLCFD...WLQIWNGERRDASR-IFNFLQMLHTLTLPVTIV
Q7PK36_ANOGA/8-375C........SYNIRTGLFDCSYRNTLVCVCNVVFFGGFVWYDFG......MILKFYATLPI-VLVGILTVDVTVYNLLIF
GR58B_DROME/10-387TTL....RIRSCRKCLRLEK.VSRTYTIYSFFVGIFLFLNLYFM...VPRIMEDGYMKYNI-VLQWNFFVMLFLRAIAVV
GR59C_DROME/9-394FEVD..WLTGEAIATRRTTI.YAAVHNASLITLLILFNLGNNSL...KSEFISA.....RY-LHEYFFMLMTAVRISAVL
Q7PTR1_ANOGA/7-389L........YGVLTRKPLRWHFRWCSLQTVLSLGLIHVGLFLCF...VEYDRL......KA-IGVNADNLIGPLFYLDVI
LITE1_CAEEL/48-425SI.....RPNNSLLFRIYSW.LVFCLLLFTTLRKFNQVGVRPNG...TRENLQEFFANPRS-MITLCNALIMLSGLLASL
GR10B_DROME/11-372Y........NPTRRRLVYSR.ILQTYDWLLMVINLGAFYLYYRY...AMTYFLEGMFRRQG-FVNQVSTCNVFQQLLMAV
Q7PI94_ANOGA/14-414F........ELNTSRVRLSKPFCCAVGGFVTLYWTAMVSSIATS...........NHANDR-ISRISNYFQLITNAIMLT
G39AD_DROME/8-362WHFD..SDHCQLVATSGSER.YAVVYAGCILVSTTAGFIFALLH...PSRFHIAIY...NQ-TGNFYEAVIFRSTCVVLF
GR36B_DROME/9-390F........EFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFT...AHGDTNLLFQSANK-LHEYVIIIMSGLKIVAGL
Q7PK17_ANOGA/41-408V........PLHGQALTSLR....TLTIVFVSFYTTGEIIVLSY...SLIKPEAVFFLSDA-TGTFADAIQFVIPLAVPL
GR48C_DROME/7-410L........HYDSSNHRFILNHVPTVVYCVILNVVYLLVLPFAL...FVLTGNIYHCPDAG-MFGVVYNVVALTKLLTML
G39AB_DROME/8-372I........DYNPTKKKFRLRRSVLCYIVHFALQAYLVGCISVM...VTYWRRCFKSELTT-TGNHFDRLVMVIALGILV
GR98A_DROME/13-370F..............GQNLFSKGFCYVLLFVSLGFSSYWRFSFD...YEFDYDFLNDRFSS-TIDLSNFVALVLGHAIIV
GR98D_DROME/12-392PIQ....FFTRTLHKRRRGIVILGYACYLISISLMVIYECYANI...VALQKDIHKFHAED-SSKVMGNTQKVLVVAMFV
GR22F_DROME/19-377F........TFDSRRKQLKR.SRWLLLYGFVLHSLAMCLAMSSHL.ASKQRRKYNAFERNP-LLEKIYMQFQVTTFFTIS
Q9W1V0_DROME/5-363Y........ETMGGKFRQSR.ITRIYCLLINAIFLTLLPSAFWK....SAKLLSTADWMPS-YMRVTPYIMCTINYAAIA
GR89A_DROME/10-356FR......TSEPMVARCQRW.MTLIAVFRWLLLTSMAPFVLWK....SAAMYEATNVRHSM-VFKTIALATMTGDVCISL
Q7PF36_ANOGA/19-401YPFDFQRQAEVKNIVLQKML.TILNRTFGLAMIGTVLTCCVSLY...VCYPSYMYEEDYPP-VLNIAYHLENWLKIVTVL
GR22D_DROME/17-386F........KYEPKKRRLRR.SMWLIPFGVVISSSLLILMVKQSAEDREHGIMLDVFQRNA-LLYQISSLMGVVGVVSIC
GR98B_DROME/12-392PP.....QSFGHTPHRRLRWYLMTGYVFYATAILATVFIVSYFN..IIAIDEEVLEYNVSD-FTRVMGNIQKSLYSIMAI
GR59E_DROME/7-383S...........GRVGVLRW.LHTLWSLFLLMYIWTGSIVKCLE..........FTVEIPT-IEKLLYLMEFPGNMATIA
GR28B_DROME/45-447FYIS..CDTKTGKKAIKKTI.FGYINGIMHIAMFVFAYSLTIYN...NCESVASYFFR.SR-ITYFGDLMQIVSGFIGVT
Q8IN22_DROME/11-375FRL...RKQKDNNVWLEEIWSNRSRWKWISVTLRIVPLCIYAFT...YAEWISNRMLITEK-FLHSCSLVVSIPCYLSII

PF02949

OR22B_DROME/79-381---------------------NMYGSSFKSYLTMMGYKKRQEAK......MSLDELDKRCV.CDEERTIVHRHVA...LG
OR24A_DROME/68-388---------------------SSILSLVKMVAIWWYQDELRSLI......ERVRFLTEQQK.SKRKLGYKKRFYTLATQL
OR23A_DROME/59-365---------------------TSLSNLMKFCMYVAQLTKMVEVQ......SLIGQLDARVS.GESQSERHRNMTEHLLRM
OR85D_DROME/84-400---------------------FVIVGDFKIWNISRQRKRLTQVV......SRLEELHPQGL.AQQEPYNIGHHLSGYSRY
OR45B_DROME/68-386---------------------CSFTTLFKLGWMWWRRQEVADLM......DRIRLLIGEQE.KREDSRRKVAQRSYYLMV
OR43A_DROME/56-364---------------------AIFNALMRTWLVIIKRRQFEEFL......GQLATLFHSIL.DSTDEWGRGILRRAEREA
OR98A_DROME/74-379---------------------NSVGMPFKVLFFNLYISGFYKAK......KLLSEMDKRCT.TLKERVEVHQGVV...RC
OR94A_DROME/69-376---------------------TEMALVVKILSIWHYRTEAWRLM......YELQHAPDYQL.HNQEEVDFWRREQ...RF
OR22C_DROME/69-392---------------------TKAVCVLKLWVFFRSNRRWAELV......QRLRAILWESR.RQEAQRMLVGLATTANRL
OR2A_DROME/66-387---------------------TDIVANLKFANVYMVRKQLHEIR......SLLRLMDARAR.LVGDPEEISALRKEVNIA
OR45A_DROME/64-362---------------------......FKFLVMMAKRRRIGSLI......HRLHKLNQAASATPNHLEKIERENQ..LDR
OR33C_DROME/60-372---------------------TCVACSLKHVAHLYHLPQIVEIE......SLIEQLDTFIA.SEQEHRYYRDHVHCHARR
OR46A_DROME/62-365---------------------TSAGHTTKLLSIKANNVQMEELF......RRLDNEEFRPR.GANEELIFAAACE...RS
OR85C_DROME/62-369---------------------FVIVGMSKMFFIWWKKTDLSDLV......KELEHIYPNGK.AEEEMYRLDRYLRSCSRI
OR85B_DROME/63-370---------------------FVTVGMSKMFFIRWKKTAITELI......NELKEIYPNGL.IREERYNLPMYLGTCSRI
OR42B_DROME/76-381---------------------NAYGSSVKVAITYSMLWRLIKAK......NILDQLDLRCT.AMEEREKIHLVVA...RS
OR47B_DROME/88-402---------------------GMALVFTKIFYMHLRCDEIDELI......SDF...EYYNR.ELRPHNIDEEVLG...WQ
OR63A_DROME/74-403---------------------...TSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFER.MSDLPVIKEIRQQVESTM
OR10A_DROME/70-396---------------------TSAVTLLKMFLMLRFRQDLSIMW......NRLRGLLFDPN.WERPEQRDIRLKHSAMAA
OR83B_DROME/70-476---------------------FFTHCITKFIYLAVNQKNFYRTL......NIWNQVNTHPLFAESDARYHSIALA..KMR
OR59C_DROME/79-385---------------------NCIGNVIKSCVTYSQMWRFRRMN......ELISSLDKRCV.TTTQRRIFHKMVA...RV
OR9A_DROME/68-381---------------------ASMLTLVKFLLFCYHRKEFVGLI......YHIRAILAKEI.EVWPDAREIIEVENQSDQ
OR30A_DROME/58-366---------------------LFTNTVVRGVLLCVQRFSYERFI......NILKSFYIELL.QSDDPIINILVKETTRLS
OR47A_DROME/56-375---------------------ITILGLFKFSMILYLRRDFKRLI......DKFRLLMSNEA.EQGEEYAEILNAANKQDQ
OR49B_DROME/52-364---------------------LWINTVLRAYLLLADHDRYLALI......QKLTEAYYDLL.NLNDSYISEILDQVNKVG
OR85F_DROME/68-381---------------------TYIINSDTKFATVLQRSAIQSLN......SKLAELYPKTT.LDRIYHRVNDHYWTKSFV
OR94B_DROME/66-372---------------------TELALVTKLLNIWYRRHEAASLI......HELQHDPAFNL.RNSEEIKFWQQNQ...RN
OR59B_DROME/77-382---------------------NVYGASVKSTITYLFLWRLRKTE......ILLDSLDKRLA.NDSDRERIHNMVA...RC
OR56A_DROME/124-407---------------------RTITLLIWIPSVIAGLMAYSDCI......YRSLFLPKSVF.NVPAVRRGEEHPI.LLFQ
OR85A_DROME/77-379---------------------NTNASIMKGIIVLFMRRRFSRAQ......KMMDAMDIRCT.KMEEKVQVHRAAA...LC
OR33B_DROME/61-369---------------------ACFFASFKFICFRFKLSEIKEIE......ILFKELDQRAL.SREECEFFNQNTR...RE
OR46B_DROME/62-373---------------------TEISCMAKLLHLKLKSRKLAGLV......DAM.LSPEFGV.KSEQEMQMLELDR.VAVV
OR33A_DROME/60-367---------------------ECLFCSYKFFCFRWKLKEIKTIE......GLLQDLDSRVE.SEEERNYFNQNPS...RV
OR88A_DROME/73-392---------------------ITIYFSIRGLMLYLKRKEIVEFV......NDLDRECPRDL.VSQLDMQMDETYRNFWQR
OR59A_DROME/64-386---------------------TCTACSVKCLLYAYNIKDVLEME......RLLRLLDERVV.GPEQRSIYGQVRV...QL
OR7A_DROME/80-394---------------------DAVILPAKIVALAWNLPLLRRAE......HHLAALDARCR.EQEEFQLILDAVR...FC

PF03268

Q9XVJ4_CAEEL/45-398---------LDCSTKS........KCCGLLTTLIAIGIIVALLA---RVGLLMETDGKPLSFAWAECNFFGFPAIFPALS
O16246_CAEEL/33-393---------LDCSLIARAEFNPSLRIKSILTRIVALVVVAIVFF---RMAIYSKAEGACLSLAWAEGNMFQFMALQTIVC
O45459_CAEEL/19-372---------FNCEKSN........PLRFVFMIFSFITFLAMVFR---AGYMLFYLDVKALTLGFAEQNLYGFISMESFCL
O16244_CAEEL/60-411---------LDCSTKS........KCCSVFTCLLGVVMVVVTLI---RISFLMEAVGAPLELGWGEGIFFGYPGLTGFVF
O16245_CAEEL/33-364---------LDCSRVSQSKTDNVSRLKSWITQLVPLLIIALTVL---RCYTLFQLEARSMSFQWAECSMFAYMGVQSVEY
O18140_CAEEL/17-370---------YNCSRSN........PIRFLFVIFSLLSFLALIFR---AYWMFFQISSTILSLGWAERNLYAFISMESFSC
O44618_CAEEL/25-384---------LDCTACAAAKNGNGSKICGFLARLFSIVVILSMLY---RAITFLGEEGKLLTFNWSESNSFGFMGLHAFVC

PF06151

GR64A_DROME/1-455SAYVVFIRLAKKWPAVVRIW----TRT-----EIPFTKPPYE.IPKRNLSRRVQLAALAIIG------LSLGEHALYQVS
GR05A_DROME/40-438IASWQFLNLAQLWPGLMRHW----AAV-----ERRLPGYTCC.LQRARPARRLKLVAFVLLV------VSLMEHLLSIIS
GR64D_DROME/1-416FCFGSFIKLSRRWPHIIRET----ALC-----ERIFLKPCYANQEGLNFTRFLRRWALILLV------AALCEHLTYVGS
GR64C_DROME/1-407FCFGVFLLLSRRWPYIIRRT----AEC-----EQIFLEPEYDCSYGRGYSSRLRLWGVCMLV------AALCEHSTYVGS
GR61A_DROME/1-435VNWLNFVGFARSWSHIMLPW----SSV-----DILMLFPPYK.RGKRSLRSKVNVLALSVVV------LAVGDHMLYYAS
GR64F_DROME/63-463LVLIVALNLARQWPQLMMYW----HTV-----EKDLPQYKTQ.LTKWKMGHTISMVMLLGMM------LSFAEHILSMVS
GR64E_DROME/25-448LISLSFFQLARKWPEIAQSW----QLV-----EAKLPPLKLP.KERRSLAQHINMITIVATT------CSLVEHIMSMLS
GR64B_DROME/1-403LEHLFFWRLAIQWPRIMRTW----HGV-----EQLFLRVPYRFYGEYRIKRRIYIVFTIVMS------SALVEHCLLLGN

PF08395

Q7PKI1_ANOGA/57-400VLYLHVLFDPAPLLHVLNEL....IER-----TRALLRHIDPPAG........ESPVGRRLF------FKTVAIDLLQSF
Q7PKI2_ANOGA/11-404LIYYHLLPARPVIRNIFNGF....VQL-----FRTLNGAGCHRWKGKS...TKKNVLKLALK------MILCDTLLCALF
Q7PKG3_ANOGA/26-401YGLISCFINRHDIWKFYNEA....YAV-----DNMLEELGERTNF........TRSFALFVA------YYGTAIGMCVLV
GR93B_DROME/24-392IILVMQFWFGEELINLVNRF....LQL-----FRRMQSLTNSPKN.........RFGDRAEF------LLMFSKVFSLLF
GR21A_DROME/81-445LLPVASWRHGPQVAIFKNMW....TNY-----QYKFFKTTGSP...........IVFPNLYP------LTWSLCVFSWLL
Q7PK37_ANOGA/8-367CTILNVLVKRQRITRLMNVL....FRP-----DRILDRCSPTNSAD.......ARYNDNRKL------LVFVLFILFGMC
Q7PQ43_ANOGA/15-419ICYASLWRTDRMKCIYIEGIQGSNVKI-----NDRYYQFRNMQIP.........IKYSILVP------FSIGMLIILSVC
Q7PK29_ANOGA/12-374CVVCNSFVHRKEIVQLLNML....FAD-----QNVLDLGGTYGNKSV....QPFSIANRYVK------VLYAIVALICFY
Q7PF19_ANOGA/20-402FAMLECQQSRPFYASILKEL....FEL-----GKNLHDCDASINFPH.....VEAITDRLLV------CAVLYFSTSSLV
Q7PKH1_ANOGA/14-409GIPITNYVQAYKYDRLIYCI....AEV-----DKGLEELGFKHDYSV.....EYFYSTVYLS------VTLGLQLSCLTG
Q7PF39_ANOGA/19-415NMMIGCEQRRAEYEGYFEEV....LHL-----MKETAHQPDCKTT.........IWYRHVTK------VLLALYCIASLT
GR97A_DROME/41-418FNYVTQWEKTLQIIRFQNSV....PLF-----KVLDSLDISAMIV........WRAFIYGLL------KIVFCPLITYIT
GR22E_DROME/18-388IMLLRSFWKSGDIERTLNEL....EDL-----QHRYFRNYSLEEC.........ISFDRFVL------YKGFSVVLELVS
GR77A_DROME/37-447MTLWIHCFKQAEIIGCLNRL....LKC-----RRRLRRLMHTRKL........KDSMDCLAT------KGHLLEVVVLLS
GR36C_DROME/8-389FTLILRWYQRCKMMDLASKV.......-----VRMYVARPQVRRM.........SRWGILTK------FIFGSITDGLQM
GR98C_DROME/14-394CNQLNILLNYGRLGLIYDEI....ANL-----DLGIDKSSKNFCGK.......SHWWSFRLR------LTLSIGLWMVII
Q8MLS6_DROME/6-364YTVLSRGFRDTAFKEMQPLL....LTL-----FREEKRCGFKGIGG......VRRSLRILLF------VKFFTLSWLCVT
Q7PKH4_ANOGA/15-393VLAIDNFMRRDATCQIIGEL....FKV-----DRYLQRIGHQLDH........RRQYVTLVR------ILFVVLMLIATG
Q7PKH2_ANOGA/13-388SISLCNRFVVGRMFRMFKTL....DGV-----DQILKRDGYRLN..........HQLNHLLS------CIYMAVPILVNF
Q7PVJ7_ANOGA/11-395SAVVRRYHKRYEIAQLMRDL....FQL-----KRELFSATELSQ..........RWIKGHIL------RKITISQLIVTS
Q7PK40_ANOGA/8-372CTLLNTFGRRHRYTRLMNVL....FHD-----DWLLDRYESAE...........MEYDNRRP------FAGLLFAMLTMM
Q8MMI1_HELVI/3-387LVSKLYYNWRTNIAGVWGKVE.RSVGV-----KIPVDRTLKCRMT.........FVAGLMTF------FSIFEHAMSILS
GR85A_DROME/27-394SSMGSCYQWQNRILAVLKELK.HQRDL-----SRHMGYRVPRSKQ.........NSIDYLLF------ALTVLLILRLSI
Q7PVK1_ANOGA/8-381CCLLYRHKQVKRLFVLLVKL....YHN-----PAVSAFPFR.............RWFRTCLL------FNLMYESAYGVN
Q7PK39_ANOGA/8-367CTILNVFVKRQRITRLMNVL....FRP-----DRILDRCSPTNSAD.......ARYNDNRKL------LAFALFILFGIF
GR22C_DROME/17-382VIHFLNFWGSTRVQDLANEL....LVL-----EYQQFASLNETKC.........PKFNSFVI------QKWLSVIGLLLS
G39AA_DROME/8-363LANLWLRSQQKSQVNLLQRL....SQV-----VELLQFEPYAVPQ.........FRWLYRIW------LLVCLIYGAMVT
GR59D_DROME/9-389LELVSRWSQRRTFVRLFNSF....RRL-----YQRNPDIIQYCRR.........SIVSKFFC------VTMTETLHIIVT
GR92A_DROME/18-383VILCYHIFRGPEIIDLINQF....LRL-----FRQVSDLFKTKTPG.......FGGRRELIL------ILLNLISFAHEQ
GR08A_DROME/9-380AIYLETLSSQRHLANFWWLH....FKL-----GGQKTGLVSLR...........SEFQQFCR------YLIFLYAMMAAE
Q7PVJ8_ANOGA/8-380CYLLSCRAKMKQLAELCTHV....HSS-----SLLVGPFSLH............AWYRKCFV------FNLGYEAAHTVT
Q7PK13_ANOGA/41-414AIFIDTVLQRNTHRLVWEKI....ALI-----RLSARKVYVERFT.........RHYLWKFY------GYLAVCAFLEAQ
GR22B_DROME/17-385IVHFMNFWGSRKVGEICNEL....LIL-----EYQDFEGLNGRNC.........PNFNCFVI------QKCLTILGQLLS
GR63A_DROME/100-456IIPIL.WYEARKIAKLFNDW....DDF-----EVLYYQISGHSLP........LKLRQKAVY------IAIVLPILSVLS
GR94A_DROME/17-399INYVSQMIISDHVAKVLSKV....PFF-----DTLKEFRLDSRSL.........YISIVLAL------VKTVAFPLTIEV
Q7PKI5_ANOGA/30-402VVNVRMLSKAQRLASTLNAL....LAI-----RNTILQQWNCRVL........SREYGQLLL------YKVLAIDMALLL
GR36A_DROME/9-390SAILNRWRQRAQLMRLVECV....LRL-----FLKKPHVKQM............SRWAILVK------FSVGVVSNFLQM
Q7PF38_ANOGA/19-415IALVGPRLSGRYFRETIDTL....VHI-----MKLFDRATKIESILT.....AISVITNRLL------LLYGLHALIITV
Q7PKH9_ANOGA/7-400LCFYQLLRHEVSLHRYVQRF....VVI-----GKSVIVRCNSRSYAS....VQRMVYALVAK------MLIADVGLCTLF
GR93C_DROME/18-394CIIVVQVCYEKELLRMIISF....LRL-----FRRVRRLSSLKRIGF.....GGKREFFLLL------FKFICLVYELYS
Q7PJT3_ANOGA/18-425MTFFCSIFQRNKLIKCFHAL....ASI-----DRRFKEIGMETNYK......STLHYNLLVM------LTKAIISTLYLV
GR68A_DROME/7-379MVVLSSVQNASRHFRTLHDI....AKI-----DEYLLANGFRETY.........SCRNLTIL------VTSAAGGVLAVA
GR09A_DROME/6-339WIALSALFECRRFRYLLEEL....PPV-----......................KATSFIYR------HLILEIILFACN
Q7PQT4_ANOGA/106-466WIPFVGWGVAKQVAIYKTMW....GAF-----QVRYYRVTGTS...........LQFPHLKL------LIVFLSIGCLVC
Q7PK18_ANOGA/61-428VMYVELFRTSDNICGCWRLL....YKA-----HQTLQRYGMVDH..........RRLTRVMR------LYWWFVLGSLLY
GR32A_DROME/57-449LTVFVCAHNTTSMLRIMNEI....LQL-----DEEVRRQFGANLS.........QNFGFLVK------FLVGITACQAYI
GR22A_DROME/19-388VTHLRTFSRSSELVEILNEL....LVL-----DKNHFSKLMLSEC.........HTFNRYVI------EKGLVIILEIGS
GR22_ANOGA/73-437LLPVASWRNGSEVAKFKNMW....TDF-----QYKYLIVTGKP...........IVFPKLYP------ITWTLCIVSWSL
Q7PF20_ANOGA/20-415MVLIGCHYQRDCYRHYGEQL....LAV-----AVDLSLCGGTVDFPR.....IETIFNRVLA------CIALFFAGVLTV
GR58A_DROME/3-389SGVLLMWFRRKRILNLGENL....ILH-----CLKCKTLDNRSKKYSK...LRKRVRNVLFQ------MLLVANLSILLG
GR10A_DROME/19-404VTYVANTVHFEAINQRCTMQ...RTHL-----EFEFKNAPQEPK..........RPFEFFMY------FKFCLINLMMMI
G39AC_DROME/9-372LIYTQLYIQRFRFVALLQSI....LRF-----NQISGSHREEGRF.........AFYYYTHL------SLLIICMLNYAY
O18280_CAEEL/46-428FSGLAAGFLLLKLQKQREKM....YHV-----LDQGLGRNRNEEHD.......SHHFKLNKL------FISISFSFAAAL
Q7PVJ9_ANOGA/29-402VPPCYLLCRHKKVKELFVLL....VKV-----YYSSLSLSIFPLR.........LWFRACFL------FNLVYDSAYGVN
Q7PK41_ANOGA/8-377YMHLIAFTKRVRITALFNAL.....FT-----DRSWRFFGDRSN..........SWYESSRW------LGRFATAITIGT
Q7PK36_ANOGA/8-375CIIINAVYNRDCFVQLLNSL....FAR-----DDWMLESVAMQGSS......QQRRSTQSTG------GLVCLIVLVLLY
GR58B_DROME/10-387SCYGTLWLKRHKIIQLYKYS....LIY-----WKRFGHITRAIVDKKEL.LDLQESLARIMI------RKIILLYSAFLC
GR59C_DROME/9-394LSLITRWYQRSRFIRIWNQI....LAL-----VRDRPQVVRG............RWYRRSII------LKFVFCVLSDSL
Q7PTR1_ANOGA/7-389IIMLLLLRVAYRWPTVVPKW....EQI-----ESLEVMQYNARQQNARSCRRIRAIALLLIV------LGFAEHMLSIGK
LITE1_CAEEL/48-425QLYTLGAKRLKPLKILCQ......FSL-----NVRTKQAERRQ...........FMINTFLA------VFSGLLALTMAA
GR10B_DROME/11-372TGTWLHFLFERHVCQTYNEL....SRI-----LKHDLKLKEHSRF.........YCLAFLAK------VYNFFHNFNFAL
Q7PI94_ANOGA/14-414AILLMPAFRLRNFAEVTRAL....RKL-----EQDLQQDAIPTNC........RQMARWNIG------IVVGTVTVLLLA
G39AD_DROME/8-362LVYVILYAWRHRYRDLVQHI....LRL-----NRRCASSCTNQQF.........LHNIILYG------MLTILCFGNYLH
GR36B_DROME/9-390ITVLNRWLQRGQMMQLVKDV....IRL-----YMINPQLKSMI...........RWGILLKA------FISFAIELLQVT
Q7PK17_ANOGA/41-408VTLTLSLLKRSTQKRIALLM....DQI-----DGSIEAHGAAPGC........LERFNHQLA------DDIFSTMFVFNV
GR48C_DROME/7-410FLMSSVWIQRRRLYKLGNDL....MKM-----LHKFRFNLGNDCR.........NRCLCKGL------LTSSRFVLLTQQ
G39AB_DROME/8-372VQNAWLIWLQAPHLRIVRQI....EFY-----RRNHLANVRLLLP.........KRLLWLII------ATNVVYMANFIK
GR98A_DROME/13-370LELLWGNCSKDVDRQLQAIH....SQI-----KLQLGTSNSTDRV........RRYCNWIYG------SLIIRWLIFIVV
GR98D_DROME/12-392WNQLNILLNFRRLARIYDDI....ADL-----EIDLNNASSGFVGQ.......RHWWRFRFR------LALSVGLWIVLL
GR22F_DROME/19-377VLLLMNVWKSNTVRKIANEL....LTL-----EGQVKDLLTLKNC.........PNFNCFVI------KKHVAAIGQFVI
Q9W1V0_DROME/5-363YTLISRCYRDAMLMDLQRIV....LEV-----NREMLRTGKKMN..........SLLRRMFF------LKTFTLTYSCLS
GR89A_DROME/10-356ALLGNHLWNRRELANLVNDL....ARL-----HRRRRL................SWWSTLFL------WLKLLLSLYDLL
Q7PF36_ANOGA/19-401VAVLRSQTSTAYFRETVNSL....VQI-----MVQYDQGWRIERKLA.....SVATVSKRLS------VVFLLDDFTIAT
GR22D_DROME/17-386TVHLRTLWRSKHLEEIYNGL....MLL-----EAKYFCSNAVEC..........PAFDGYVI------QKGVVIVVGLLA
GR98B_DROME/12-392ANHLNMLINYRRLGGIYKDI....ADL-----EMDMDEASQCFGGQ.......RQRFSFRFR------MALCVGVWMILM
GR59E_DROME/7-383ILVYYAVLNRPLAHGAELQI....ERI-----ITGLKGKAKRLVYKR.....HGQRTLHLMA------TTLVFHGLCVLV
GR28B_DROME/45-447VIYLTAFVPNHRLERCLQKF....HTM-----DVQLQTVGVK............IMYSKVLR------FSYMVLISMFLV
Q8IN22_DROME/11-375HLKICHGPEVTKLVNQYLHI....FRL-----GTLDIRRRSQFGG.........GRELFLLI------LSVCCQIHEYVF

PF02949

OR22B_DROME/79-381N....FCYIFYHIAYTSFLI----SNF.....LSFIMKRIH..............AWRMYFP......Y.VDPE......
OR24A_DROME/68-388T...FLLLCCGFCTSTSYSV----RHL.....IDNILRRTH............GKDWIYETP......FKMMFPD..LLL
OR23A_DROME/59-365S.......KLFQITYAVVFI----IAA.....VPFVFETEL..............SLPMPMW......FPFDWK....NS
OR85D_DROME/84-400SKFYFGMHMVLIWTYNLYWA----VYY.....LVCDFWLGMRQ.........FERMLPYYCW......VPWDWS....TG
OR45B_DROME/68-386TRCGMLVFTLGSITTGAFVL----RSL.....WEMWVRRHQ..............EFKFDMP......FRMLFHD..FAH
OR43A_DROME/56-364R....NLAILNLSASFLDIV----GAL.....VSPLFREER..............AHPFGLA......LPGVSM....TS
OR98A_DROME/74-379N....KAYLIYQFIYTAYTI----STF.....LSAALSGKL..............PWRIYNP......F.VDFR....ES
OR94A_DROME/69-376.F..KWFFYIYILIS.LGVV----YSG.....CTGVLFLEG.............YELPFAYY......VPFEWQ.....N
OR22C_DROME/69-392S....LLLLSSGTATNAAFT----LQP.....LIMGLYRWIV...........QLPGQTELP......FNIILPS..FAV
OR2A_DROME/66-387Q...G.TFRTFASIFVFGTT----LSC.....VRVVVRPDR..............ELLYPAW......FGVDWM....HS
OR45A_DROME/64-362Y....VARSFRNAAYGVICA----SAI.....APMLLGLWGYVETG...VFTPTTPMEFNFW......L..DER.....K
OR33C_DROME/60-372FT..RCLYISFGMIYALFLF----GVF.....VQVISGNWE...............LLYPAY......FPFDLE....SN
OR46A_DROME/62-365R....KLRDFYGALSFAALS----MIL.....IPQFALDWS............HLPLKTYNP......L..GEN....TG
OR85C_DROME/62-369SITYALLYSVLIWTFNLFSI----MQF.....LVYEKLLKIRV.........VGQTLPYLMY......FPWNWH.....E
OR85B_DROME/63-370SLIYSLLYSVLIWTFNLFCV----MEY.....WVYDKWLNIRV.........VGKQLPYLMY......IPWKWQ.....D
OR42B_DROME/76-381N....HAFLIFTFVYCGYAG----STY.....LSSVLSGRP..............PWQLYNP......F.IDWH....DG
OR47B_DROME/88-402R...LCYVIESGLYINCFCL----VNF.....FSAAIFLQPLL.........GEGKLPFHSV......YPFQWHR.LDLH
OR63A_DROME/74-403NR.YWASTRRQILIYLYSCI----CIT.....TNYFINSFVINLYRYFTKPKGSYDIMLPLP......SLYPAWE.HKGL
OR10A_DROME/70-396RINFWPLSAGFFTCTTYNLK----PIL.....IAMILYLQNR...........YEDFVWFTP......FNMTMPK..VLL
OR83B_DROME/70-476KL..FFLVMLTTVASATAWT----TITFFGDSVKMVVDHET............NSSIPVEIPRLPIKSF.YPWN....AS
OR59C_DROME/79-385N....LIVILFLSTYLGFCF----LTL.....FTSVFAGKA..............PWQLYNP......L.VDWR....KG
OR9A_DROME/68-381ML.SLTYTRCFGLAGIFAAL----KPF.....VGIILSSIR............GDEIHLELP......HNGVYPY..DLQ
OR30A_DROME/58-366V....LISRINLLMGCCTCI----GFV.....TYPIFGSER..............VLPYGMY......LPTIDEY..KYA
OR47A_DROME/56-375RM.CTLFRTCFLLAWALNSV----LPL.....VRMGLSYWLA..........GHAEPELPFP......CLFPWN....IH
OR49B_DROME/52-364K.....LMARGNLFFGMLTS----MGF.....GLYPLSSSER...........VLPFGSKIP......GLNEYE....SP
OR85F_DROME/68-381Y.....LVIIYIGSSIMVVI----GPI.....ITSIIAYFTHN.........VFTYMHCYPY......FLYDPE....KD
OR94B_DROME/66-372.F..KRIFYWYIWGS.LFVA----VMG.....YISVFFQED.............YELPFGYY......VPFEWR.....T
OR59B_DROME/77-382N....YAFLIYSFIYCGYAG----STF.....LSYALSGRP..............PWSVYNP......F.IDWR....DG
OR56A_DROME/124-407......LFPFGELCD.....----.........NFVVGYLG................PWYAL......GLG.........
OR85A_DROME/77-379N....RVVVIYHCIYFGYLS----MAL.....TGALVIGKT..............PFCLYNP......L.VNPD......
OR33B_DROME/61-369A...NFIWKSFIVAYGLSNI----SAI.....ASVLFGGGH..............KLLYPAW......FPYDVQ....AT
OR46B_DROME/62-373R.....MRNSYGIMSLGAAS----LIL.....IVPCFDNFG............ELPLAMLEV......CSIEGW......
OR33A_DROME/60-367A...RMLSKSYLVAAISAII----TAT.....VAGLFSTGR..............NLMYLGW......FPYDFQ....AT
OR88A_DROME/73-392Y...RFIRIYSHLGGPMFCV----VPL.....ALFLLTHEGK...........DTPVAQHEQ......LLGGWLPCGVRK
OR59A_DROME/64-386R....NVLYVFIGIYMPCAL----FAE.....LSFLFKEER..............GLMYPAW......FPFDWL....HS
OR7A_DROME/80-394N....YLVWFYQICYAIYSS----STF.....VCAFLLGQP..............PYALYLP......G.LDWQ....RS

PF03268

Q9XVJ4_CAEEL/45-398AVSILSWTKSLFFPNFVKKL----IRL-----RNLRLEPNQK.LDSYGRIHVVALIFSIPWL------IAMMSWILYNYV
O16246_CAEEL/33-393ALCLFGWTKNSFISKHLGRL----EKV-----RSLRIKENIE.MDNYSNTHRKAFIWSGFYI------AAIMSHAIMSSI
O45459_CAEEL/19-372VIALFKITKVGRLRKVEQKL----AEM-----REMRITSFHESHDKYWKLWIELFIFNSFNL------VLFIGTAIYLLC
O16244_CAEEL/60-411SLCLFGWTKNGLIPKFCKRL----VRV-----RMLRQAANSK.LDKFRILHGLALGFSIPWF------VAMMSWIIYNFV
O16245_CAEEL/33-364AYSLYSWSKKHFISSHLESL----ENI-----RLLRLKDNKN.IDNCLKSHIKIFIWSCLWI------VGVMAHAICSSI
O18140_CAEEL/17-370VIALYRMTTVGSLEKFEQSL----ANL-----KRMRVTGYHESHDEYGKLRLKIFLLKTPIP------VFFIATAIYLVV
O44618_CAEEL/25-384SLCVMGWTANARFPNHIKRL----NEV-----RVLRVEPNEE.IDDYSGFRKKAFFFSLPWL------ATLVSTALFNAL

PF06151

GR64A_DROME/1-455A-ILSYTRRIQMCANITTVPSFNNYMQTNYDYVFQLLPYS---PIIAVLILLINGACTFVW--NYMDLFIMMISKGLSY-
GR05A_DROME/40-438.-VVYYDFCPRRSD......PVESYLLGASAQLFEVFPYS---NWLAWLGKIQNVLLTFGW--SYMDIFLMMLGMGLSE-
GR64D_DROME/1-416A-AWSNYVQIRDCNLKVG..FVENYFLRERQELFSVFEYR---AWMVFFIEWNTMAMTFVW--NFGDIFLFLMCRGLKI-
GR64C_DROME/1-407A-LYNNHLAIVECKLDAN..FWQNYFQRERQQLFLIMHFT---AWWIPFIEWTTLSMTFVW--NFVDIFLILICRGMQM-
GR61A_DROME/1-435G-YCSYSMHILQCHTNHSRITFGLYLEKEFSDIMFIMPFN---IFSMCYGFWLNGAFTFLW--NFMDIFIVMTSIGLAQ-
GR64F_DROME/63-463A-INYASFCNRTAD......PIQNYFLRTNDEIFFVTSYS---TTLALWGKFQNVFSTFIW--NYMDLFVMIVSIGLAS-
GR64E_DROME/25-448M-GYYVNSCPRWPD...R..PIDSFLYLSFSSVFYFVDYT---RFLGIVGKVVNVLSTFAW--NFNDIFVMAVSVALAA-
GR64B_DROME/1-403S-FHLSNMERTQCKINVT..YFESIYKWERPHLYMILPYH---FWMLPILEWVNQTIAYPR--SFTDCFIMCIGIGLAA-

PF08395

Q7PKI1_ANOGA/57-400T-WY...........GTF--LWLQRKFGATYILAFWLNSI...AVMQIVAALNILLATLLWGAFLYRLINERVRTVIGS-
Q7PKI2_ANOGA/11-404V-LY..........FGQF--FIQDGDIQSQILWTLNIFSV....WQSAIFTNLIVVTLIIG.VHFLEILNHRLTLYIRQ-
Q7PKG3_ANOGA/26-401I-AV.............M--YSENLPWMLLLNLGYSYFSL...TTFHILSLTCLDVVRARN.VRLNKVFRKQFSLEGDV-
GR93B_DROME/24-392V-FM..........AFRL--MLSPWFLLTLVCDLYTSVGT...GMITHLCFVGYLSIGVLY.RDLNNYVDCQLRAQLRS-
GR21A_DROME/81-445S-IA.............I--NLSQYFLQPDFRLWYTFAYY.....PIIAMLNCFCSLWYIN.CNAFGTASRALSDALQT-
Q7PK37_ANOGA/8-367M-KLS........YYKKV--EIKILAVMIAGRFLAIWVLI..........FVHRLHVRAIG..QRMEQLRVLY......-
Q7PQ43_ANOGA/15-419E-AY.............A--HHGYYFTIITIVYPLWMFHI.....TILEFTTLVKSTECIL.TKLNWMLDTFLESLQRQ-
Q7PK29_ANOGA/12-374N-YI..............--.NMIHTMHTFLELTLISRFL....LTTQYIYLYYLCVSMVR..LRMQQLRVLFLD....-
Q7PF19_ANOGA/20-402D-WW.............A--DYDPSCTFLCHSVLYILPNV....INVLALYQYAALQLIVA..ACYRSVNSVLARYHDH-
Q7PKH1_ANOGA/14-409T-AF...........TNP--FLVDYDTWCNFTALVGFIMC.....NLVYIMTSCFCCVTLW.AIVYRYHNINATFWYVS-
Q7PF39_ANOGA/19-415V-PI..............--.VMTTILWDIATIPYVMAQTVPFVVSSLILNQYFCVFVHLT..SILRKMNERLARFLNM-
GR97A_DROME/41-418L-IL..........YHRR--SISESQWTSVTTTKTMLPLI....VSNQINNCFFGGLVLAN..LIFAAVNRKLHGIVKE-
GR22E_DROME/18-388M-LVLE......LGMSPN--YSAQFFIGLGSLCLMLLAVL.......LGASHFHLAVVFVY..RYVWIVNRELLKLVNK-
GR77A_DROME/37-447S-YLLSM....AQPIQIL--KDDPEVRRNFMYACSLVFVSVCQAILQLSLGMYTMAILFLG..HLVRHSNLLLAKILAD-
GR36C_DROME/8-389A-MVLS.......AMGSV--DSQFYLGLGLQYWMFVILNM........AMMQQHMIMLFVR..TQFQLINTELRQVIDE-
GR98C_DROME/14-394I-GVIP.......RLTLG--RAGPFFHWVNQVLTQIILIM.....LQLKGPEYCLFVLLVY..ELILRTRHVLEQLKDD-
Q8MLS6_DROME/6-364D-VL.............F--LLYSTDALIWVNVLRFFFKCNTNNILEMVPMGYFLALWHIA..RGFDCVNRRLDQIVKS-
Q7PKH4_ANOGA/15-393T-VF...........ALG--MSTISEFSIRNHLINSFSYALTGIQFMIVNFHFVAAARLVS..FRLDAIKCSLKKHLDT-
Q7PKH2_ANOGA/13-388F-LMIS......TFFIVQ--DQSSQQFTATEMVVFLRSSL....VFTIFGSYITVALTTIY..MRFRALNKMISEKFPT-
Q7PVJ7_ANOGA/11-395S-FVLAV....LAVLDAG--EETAIGSELLSLCIFYYPKL....TIICSVSLYYAVMLFQQ..NLHYALNERLKQLIVE-
Q7PK40_ANOGA/8-372S-IN.............M--FYHRDMNLRILSMSVALKIF....GIGYLCIIHRVCVGAIG..VRMRQLSILGKLS...-
Q8MMI1_HELVI/3-387S-VGLD.......CPPSL--ILKRYVLVSHGFIFMGQDYS...EWFAMPLVIISTIATLLW..NFQDQVIVLISMGLTS-
GR85A_DROME/27-394H-LA.............T--FTLSARMGFNHPCNCFLPEC....MIFSMNYLLFAILAEIT..RCWWSLQSGLKMVLLN-
Q7PVK1_ANOGA/8-381F-LL.............N--IFQPGSTFHLEIVNLLLSTA.....LSQLSKSAVMLIMYGS.GQYLQMALVQLKEHLLL-
Q7PK39_ANOGA/8-367I-KLF........HLKTA--ELKILRMMTAGRFFTIWMLI..........FVHRLHVRAIG..QRMEQLRVMY......-
GR22C_DROME/17-382Y-LS..........IAYG--LPGNNFSVEMVLINSLVQFS.....FNCNIMHYYIGVLLIY..RYLWLINGQLLEMVTN-
G39AA_DROME/8-363H-FG...........INW--LTTMQISRVLTLIGFVYRCV....LANFQFTCYTGMVVILK..KLLQVQVKQLEHLVST-
GR59D_DROME/9-389L-AM..............--MRNRLSIALALRIWAVLSLT...AIINVIITQYYVATACVR..GRYALLNKDLQAIVTE-
GR92A_DROME/18-383T-YLW.........FTIR--KGFSWRFLIDWWCDFYLVSAT..NIFIHINSIGYLSLGVLY.SELNKYVYTNLRIQLQK-
GR08A_DROME/9-380V-AI............HL--GLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELLR..EQLTGLEREMGLLAEY-
Q7PVJ8_ANOGA/8-380L-LAN........LALQS--VFPEGMGKIYPQTLLWIALSNLTKSAVLLTMYGSVQYLMIC.AVKLNELLPRLSSWTDP-
Q7PK13_ANOGA/41-414V-LY.............L--AWDDPSALAYWLVIMILHAF...LRLRHLFHMFFIDILKIH.LQKLHHDLVDAGEYMAD-
GR22B_DROME/17-385F-FT..........LNFA--LPGLEFHICLVLLSCLMEFS.....LNLNIMHYHVGVLLIY..RYVWLINEQLKDLVSQ-
GR63A_DROME/100-456V-VI..............--...THVTMSDLNINQVVPYCILDNLTAMLGAWWFLICEAMS..ITAHLLAERFQKALK.-
GR94A_DROME/17-399A-FI...........LQQ--RRQHPEMSLIWTLYRLFPLI....ISNFLNNCYFGAMVVVK..EILYALNRRLEAQLQE-
Q7PKI5_ANOGA/30-402F-SLIM......YYVTQD--EVPTGAEVVVGVTFSVFRYV.....FTALVNLYLVGLMIVS..FNQGSINSKLTSLVDR-
GR36A_DROME/9-390A-IS..........MESL--DRLGFNEFVGMASDFWMSAI.....INMAISQHYLVILFVR..AYYHLLKTEVRQAIHE-
Q7PF38_ANOGA/19-415T-VW..............--ISTEHPVSTLLNVSYLAPYV....TIAVYILLYRALLASIA..GIVGCLNDNLREITIQ-
Q7PKH9_ANOGA/7-400A-MNSG......IKRHET--SAHVYRTVNIYVVMMSSQFT...NLLLLMLLFGSYVYGQIN..KQLDRTVHRLASFETQ-
GR93C_DROME/18-394E-IC.............Q--LWHLPDSLSLFATLCEIFLEIGSLMIIHIGFVGYLSVAALY.SEVNSFARIELRRQLRS-
Q7PJT3_ANOGA/18-425V-CL...........AVF--ISSDTYPSVTTWMAFLLPYF....MMSMVIVLFLCFVNQTK..HRFHLLNKVLKHLKQA-
GR68A_DROME/7-379F-YY..........IHYR--SGIGAKRQIILLLIYFLQLL....YSTLLALYLRTLMMNLA..QRIGFLNQKLDTFNLQ-
GR09A_DROME/6-339A-FL..............--VLSEYTIRGIYLENLRYAYS.....LQAVRARYLQMMVLV...DRLDGKLEQLHHRVIS-
Q7PQT4_ANOGA/106-466A-IV.............F--LLSLSFLLEGFALWHTSAYY.....HIITMLNMNSALWYIN.SRGIRVASSSLSRCFRQ-
Q7PK18_ANOGA/61-428F-VVNE.......SYLYL--CAEQMQTKRFYVYFFALQYI.....LNIKLQQIIYPAILLD..TYLRMTRAALEHHVGL-
GR32A_DROME/57-449I-VLK.........IYAV--QGEITPTSYILLAFYGIQNG....LTATYIVFASALLRIVY..IRFHFINQLLNGYTYG-
GR22A_DROME/19-388S-LV...........LYF--GIPNSKIVVYEAVCIYIVQL....EVLMVVMHFHLAVIYIY..RYLWIINGQLLDMASR-
GR22_ANOGA/73-437S-LV.............I--ILSQYYLQPDFQFCHTFAYY.....HIIAMLNGFCSLWFVN.CTAFGTASKAFAKELTD-
Q7PF20_ANOGA/20-415D-LLYNDL...VVWRFAR--SSAVYTLSNVINVLALLQYA...YVLYVLYFCYYDTNRLLA..SYNRHLLVRGTDDTRY-
GR58A_DROME/3-389A-LI..........LFRI--HSVQRISKTAMIVAHITQFI...YVVFMMTGICVILLVLHW...QSERLQIALKDLCSF-
GR10A_DROME/19-404Q-VCGIF....AQYGEVG--KGSVSQVRVHFAIYAFVLWN....YTENMADYCYFINGSVL..KYYRQFNLQLGSLRDE-
G39AC_DROME/9-372G-YW.............T--AGVRLTTIPIYLLQYGFSYL....FLGQVVVLFACIQQILL..SILKYYNQVVLKNIKS-
O18280_CAEEL/46-428S-FVQIA.....TKMRYL--DLPDTPDLINRKIYFVILEG....YVIFIASSCISLVAILF.FQLCRILQFSIGQLIEE-
Q7PVJ9_ANOGA/29-402V-ALNL......VLPGTG--IHEKYVKILSWSVLSQLTKS.......IVLLIIYGTAQYLL..RMVDHLNDHLAAGRLS-
Q7PK41_ANOGA/8-377M-LY..........LSLL--ILSQYNSSTKFPLYVTILEAVRVYVTMIAILIYIVCVLVVK..MHFRQLQDRVEQFGAS-
Q7PK36_ANOGA/8-375A-MY............NA--LFVNDHSMVLMDMIILLRFC....FMFLILELYRVCVRIIR..KRMKQLQVLLTQMEEI-
GR58B_DROME/10-387S-TVLQ......YQLLSV--INPQIFLAFCARLTHFLHFL.......CVKMGFFGVLVLLN..HQFLVIHLAINALHGR-
GR59C_DROME/9-394H-TI............SD--VSAQRKRITADLIVKLSLLATLTTIFNMIVCQYYLAMVQVI..GLYKILLQDLRCLVRQ-
Q7PTR1_ANOGA/7-389T-VNARVYEARTCHWNYS--NLPEYYALA..HLRVLFPKS....IIQLSLLYIFRALTMAW..TVQDVLLIMISDSIAG-
LITE1_CAEEL/48-425T-YAMS......KWGYIL--YIVGTPNLDTETIFCVLLDS...YALFVSRAAISALAILFY..QHCSVIRRSIKHLINE-
GR10B_DROME/11-372S-AIM........HWGLR--PFNVWDLLANLYFVYNSLAR......DAILVAYVLLLLNLS..EALRLNGQ........-
Q7PI94_ANOGA/14-414T-AF..........DCYV--TVFRGFIRVDYWIITILPQF....VNVIAVTQVVLLLLYIN..ARFRKLNQLLEEEQHP-
G39AD_DROME/8-362G-YT.............R--AGLATLPLALCMLVYIFAFL....VLCLLLMFFVSLKQVMT..AGLIHYNQQL......-
GR36B_DROME/9-390L-SV...........DAL--DRQGTAEMMGLLVKLCVSFI.....MNLAISQHFLVILLIR..AQYRIMNAKLRMVIEE-
Q7PK17_ANOGA/41-408I-PAVS......EFFIIS--RISGNPVWHRNWLLKVWFFI....LIRLGDSFFLVHVLYLR..NRYRVLNNELQQTAST-
GR48C_DROME/7-410L-LTRD......SVVNCE--SNSSLRQAMVPYQSAAIVYA....LIMILLMSYVDMTVYMV.EVAGNWLLVNMTQGVRE-
G39AB_DROME/8-372T-CI...........FEW--LTDASRLFVITSLGFPLRYL....VTSFTMGTYFCMVHIVR..LVLDWNQSQINAIIDE-
GR98A_DROME/13-370T-IY.............S--NRALTINATYSELVFLARFS........EFTLYCAVILFIY.QELIVGGSNVLDELYRT-
GR98D_DROME/12-392V-GLTP.......RFTLV--ALGPYLHWTNKVLTEIILIM.....LQLKCTEYCVFVLLIY..ELILRGRHILQQISVE-
GR22F_DROME/19-377S-IY............FC--LCQENSYPKILKILCCLPSV....GLQLIIMHFHTEIILVY..RYVWLVNETLED....-
Q9W1V0_DROME/5-363Y-IL............AV--FIYQWKAQNWSNLCNGLLVNISLTILFVNTFFYFTSLWHIA..RGYDFVNQQLNEIVAC-
GR89A_DROME/10-356C-SVPF.......LKGAG--GRLPWSQLVAYGVQLYFQHV.....ASVYGNGIFGGILLML..ECYNQLE.........-
Q7PF36_ANOGA/19-401G-LY..............--FIVEGAPATLINLCYIPPFI....AIVINVLHYYALFGTIS..GIMSCSNDTLYGITVE-
GR22D_DROME/17-386P-WM...........VHF--GMPDSKLPVLNVLVVSMVKL....GTLLLALHYHLGVVIIY..RFVWLINRELLSLVCS-
GR98B_DROME/12-392V-GSM........PRLTM--TAMGPFVSTLLKILTEFVMI....MQQLKSLEYCVFVLIIY..ELVLRLRRTLSQLQEE-
GR59E_DROME/7-383D-VV.............N--YDFEFWTTWSSNSVYNLPGL....MMSLGVLQYAQPVHFLW..LVMDQMRMCLKELKLL-
GR28B_DROME/45-447N-VLF.........TGGT--FSVLYSSEVAPTMALHFTFLIQHTVIAIAIALFSCFTYLVE..MRLVMVNKVLKNLAHQ-
Q8IN22_DROME/11-375I-LV............IA--SRLCGFQHIIWWVSYTYVFI.........ICNSIMCFGFIW.HLSLGVLYAELNDNLRF-

PF02949

OR22B_DROME/79-381.-KQ----------------FYI.SSIAEVILRGWAVFMD------LCTDVCPLISMVIAR--CHITLLKQRLRNLRSE.
OR24A_DROME/68-388R-LP----------------LYPITYILVHWHGYITVVCF------VGADGFFLGFCLYFT--VLLLCLQDDVCDLLEVE
OR23A_DROME/59-365M-VA----------------YIG.ALVFQEIGYVFQIMQC------FAADSFPPLVLYLIS--EQCQLLILRISEIGYG.
OR85D_DROME/84-400Y-SY----------------YFM.YISQNIGGQACLSG.Q------LAADMLMCALVTLVV--MHFIRLSAHIESHVAG.
OR45B_DROME/68-386R-MP----------------WFPVFYLYSTWSGQVTVYAF------AGTDGFFFGFTLYMA--FLLQALRYDIQDALKP.
OR43A_DROME/56-364S-PV----------------YEV.IYLAQLPTPLLLSMMY------MPFVSLFAGLAIFGK--AMLQILVHRLGQIGGE.
OR98A_DROME/74-379R-SS----------------FWK.AALNETALMLFAVTQT------LMSDIYPLLYGLILR--VHLKLLRLRVESLCTD.
OR94A_DROME/69-376E-RR----------------YWF.AYGYDMAGMTLTCISN------ITLDTLGCYFLFHIS--LLYRLLGLRLRETKNM.
OR22C_DROME/69-392Q-PG----------------VFPLTYVLLTASGACTVFAF------SFVDGFFICSCLYIC--GAFRLVQQDIRRIFADL
OR2A_DROME/66-387T-RN----------------YVL.INIYQLFGLIVQAIQN------CASDSYPPAFLCLLT--GHMRALELRVRRIGCRT
OR45A_DROME/64-362P-HF----------------YWP.IYVWGVLGVAAAAWLA------IATDTLFSWLTHNVV--IQFQLLELVLEEKDLN.
OR33C_DROME/60-372R-FL----------------GAV.ALGYQVFSMLVEGFQG------LGNDTYTPLTLCLLA--GHVHLWSIRMGQLGYF.
OR46A_DROME/62-365S-PA----------------YWL.LYCYQCLALSVSCITN------IGFDSLCSSLFIFLK--CQLDILAVRLDKIGRLI
OR85C_DROME/62-369N-WT----------------YYVLLFCQNFAGHTSASG.Q------ISTDLLLCAVATQVV--MHFDYLARVVEKQVLD.
OR85B_DROME/63-370N-WS----------------YYPLLFSQNFAGYTSAAG.Q------ISTDVLLCAVATQLV--MHFDFLSNSMERHELSG
OR42B_DROME/76-381T-LK----------------LWV.ASTLEYMVMSGAVLQD------QLSDSYPLIYTLILR--AHLDMLRERIRRLRSD.
OR47B_DROME/88-402P-YT----------------FWF.LYIWQSLTSQHNLMSI------LMVDMVGISTFLQTA--LNLKLLCIEIRKLGDM.
OR63A_DROME/74-403E-FP----------------YYHIQMYLETCSLYICGMCA------VSFDGVFIVLCLHSV--GLMRSLNQMVEQATSEL
OR10A_DROME/70-396N-YP----------------FFPLTYIFIAYTGYVTIFMF------GGCDGFYFEFCAHLS--ALFEVLQAEIESMFRPY
OR83B_DROME/70-476H-GM----------------FYMISFAFQIYYVLFSMIHS------NLCDVMFCSWLIFAC--EQLQHLKGIMKPLMELS
OR59C_DROME/79-385H-WQ----------------LWI.ASILEYCVVSIGTMQE------LMSDTYAIVFISLFR--CHLAILRDRIANLRQD.
OR9A_DROME/68-381V-VM----------------FYVPTYLWNVMASYSAVTMA------LCVDSLLFFFTYNVC--AIFKIAKHRMIHLPAV.
OR30A_DROME/58-366S-PY----------------YEI.FFVIQAIMAPMGCCMY------IPYTNMVVTFTLFAI--LMCRVLQHKLRSLEKL.
OR47A_DROME/56-375I-IR----------------NYVLSFIWSAFASTGVVLPA------VSLDTIFCSFTSNLC--AFFKIAQYKVVRFKGG.
OR49B_DROME/52-364Y-YE----------------MWY...IFQMLITPMGCCMY------IPYTSLIVGLIMFGI--VRCKALQHRLRQVALK.
OR85F_DROME/68-381P-VW----------------IYISIYALEWLHSTQMVISN------IGADIWLLYFQVQIN--LHFRGIIRSLADHKPS.
OR94B_DROME/66-372R-ER----------------YFY.AWGYNVVAMTLCCLSN------ILLDTLGCYFMFHIA--SLFRLLGMRLEALKNA.
OR59B_DROME/77-382M-GS----------------LWI.QAIFEYITMSFAVLQD------QLSDTYPLMFTIMFR--AHMEVLKDHVRSLRMD.
OR56A_DROME/124-407.-..----------------....ITAIPLWHTFITCL..------..........MKYVN--LKLQILNKRVEEMDITR
OR85A_DROME/77-379.-DH----------------FYL.ATAIESVTMAGIILAN------LILDVYPIIYVVVLR--IHMELLSERIKTLRTD.
OR33B_DROME/61-369E-LI----------------FWL.SVTYQIAGVSLAILQN------LANDSYPPMTFCVVA--GHVRLLAMRLSRIGQG.
OR46B_DROME/62-373.-IC----------------YWS.QYLFHSICLLPTCVLN------ITYDSVAYSLLCFLK--VQLQMLVLRLEKLGPV.
OR33A_DROME/60-367A-AI----------------YWI.SFSYQAIGSSLLILEN------LANDSYPPITFCVVS--GHVRLLIMRLSRIGHD.
OR88A_DROME/73-392D-PN----------------FYLLVWSFDLMCTTCGVSFF------VTFDNLFNVMQGHLV--MHLGHLARQFSAIDPR.
OR59A_DROME/64-386T-RN----------------YYI.ANAYQIVGISFQLLQN------YVSDCFPAVVLCLIS--SHIKMLYNRFEEVGLD.
OR7A_DROME/80-394Q-MQ----------------FCI.QAWIEFLIMNWTCLHQ------ASDDVYAVIYLYVVR--IQVQLLARRVEKLGTDD

PF03268

Q9XVJ4_CAEEL/45-398ENAT----------------IYFGATEESKVIYRVALIISNFYIWFISTVCLAFFVLVFTSINREVSHFNQELEKSKNE-
O16246_CAEEL/33-393A.QK----------------ILIANKTVI.APLYIAMVFINLLSCFIVAICLIYYFLVNLSLSREIRYFNTELEDAKQG-
O45459_CAEEL/19-372N.RV----------------IIVGTKTKS.SWYYYFDAPVMILCAYANFLHLPIHELIHTAFAREFRVFNDELENASKN-
O16244_CAEEL/60-411H.GK----------------VYYGGPEQS.IAKRIFLIISNFYVWFISTVCLAIYIFISAALNREVSYFNEELKKAKEE-
O16245_CAEEL/33-364N.EK----------------IFLSFNDIS................................LKREIEYFNVELEEAQTT-
O18140_CAEEL/17-370K.QK----------------IIVDTTTHN.NWYYFFDAGVMALCAYVNFLFLPIHALIQNAIAREFHVFNEELEGASKN-
O44618_CAEEL/25-384Q.EK----------------ILFSGAVVP.AYKYSLFPALAFIVWMTTSTCLAFYALFQFSMVRETEYFNKELQKASED-

PF06151

GR64A_DROME/1-455-----------------------------------------------------RFEQITTRI-------------RKLEH
GR05A_DROME/40-438-----------------------------------------------------MLARLNRSL-------------EQQVR
GR64D_DROME/1-416-----------------------------------------------------RFQQLHWRI-------------RQNLG
GR64C_DROME/1-407-----------------------------------------------------RFQQMHWRI-------------RQHVR
GR61A_DROME/1-435-----------------------------------------------------RFQQFAARV-------------GALEG
GR64F_DROME/63-463-----------------------------------------------------KFRQLNDDL-------------RNFKG
GR64E_DROME/25-448-----------------------------------------------------RFRQLNDYM-------------MREAR
GR64B_DROME/1-403-----------------------------------------------------RFHQLYRRI-------------AAVHR

PF08395

Q7PKI1_ANOGA/57-400-----------------------------------------------------LLQLDDTDRQVRDSA...TGRERRFIC
Q7PKI2_ANOGA/11-404-----------------------------------------------------MRAPACHLKQ.............LRRQ
Q7PKG3_ANOGA/26-401-----------------------------------------------------ADPPA....................LT
GR93B_DROME/24-392-----------------------------------------------------LNGENNSFRN............NPQPT
GR21A_DROME/81-445-----------------------------------------------------TI.......................RG
Q7PK37_ANOGA/8-367-----------------------------------------------------.........................AS
Q7PQ43_ANOGA/15-419-----------------------------------------------------STPSVTLKGEKNPTNKVYPLNRRPFVQ
Q7PK29_ANOGA/12-374-----------------------------------------------------.........................HQ
Q7PF19_ANOGA/20-402-----------------------------------------------------QARPK....................VR
Q7PKH1_ANOGA/14-409-----------------------------------------------------LHQPVCLTGGRNHVLL.NSFASMYFHT
Q7PF39_ANOGA/19-415-----------------------------------------------------LPGSATEPPV.............QLRG
GR97A_DROME/41-418-----------------------------------------------------ANMLQSPVQMNLH.......KPYYRMR
GR22E_DROME/18-388-----------------------------------------------------MA.......................IG
GR77A_DROME/37-447-----------------------------------------------------AEHIFESSQKA...........GFWPN
GR36C_DROME/8-389-----------------------------------------------------AKDLLLSPRHQ...........GVFMT
GR98C_DROME/14-394-----------------------------------------------------LEDFDCGA.................RI
Q8MLS6_DROME/6-364-----------------------------------------------------.........................KS
Q7PKH4_ANOGA/15-393-----------------------------------------------------GSWYIEQKQ..............RWGR
Q7PKH2_ANOGA/13-388-----------------------------------------------------TRTADPYKHS............NSSVT
Q7PVJ7_ANOGA/11-395-----------------------------------------------------HTGGLVDRARG...........YARLQ
Q7PK40_ANOGA/8-372-----------------------------------------------------.........................CG
Q8MMI1_HELVI/3-387-----------------------------------------------------RYRRLNECL..............AKVC
GR85A_DROME/27-394-----------------------------------------------------RQ.......................LS
Q7PVK1_ANOGA/8-381-----------------------------------------------------GVHRSTGPVQ............QETLR
Q7PK39_ANOGA/8-367-----------------------------------------------------.........................AS
GR22C_DROME/17-382-----------------------------------------------------LKLD.....................CS
G39AA_DROME/8-363-----------------------------------------------------.........................TT
GR59D_DROME/9-389-----------------------------------------------------SQSLVPNGGG.............VFVT
GR92A_DROME/18-383-----------------------------------------------------LNTSGSKQ.................KI
GR08A_DROME/9-380-----------------------------------------------------SRFASETGR..............SFPG
Q7PVJ8_ANOGA/8-380-----------------------------------------------------YRQET....................LR
Q7PK13_ANOGA/41-414-----------------------------------------------------LVEQPQDTAV............FRAMY
GR22B_DROME/17-385-----------------------------------------------------LKL......................NP
GR63A_DROME/100-456-----------------------------------------------------.........................HI
GR94A_DROME/17-399-----------------------------------------------------VNLLQRKDQLKLY.......TKYYRMQ
Q7PKI5_ANOGA/30-402-----------------------------------------------------.........................SG
GR36A_DROME/9-390-----------------------------------------------------SQMLSEIYPRR...........AAFMT
Q7PF38_ANOGA/19-415-----------------------------------------------------DRIDPRRTYGKHTTIS.YIMLQEGKER
Q7PKH9_ANOGA/7-400-----------------------------------------------------QSYWSRRRV..............RVQQ
GR93C_DROME/18-394-----------------------------------------------------LERPVGGPVG............RKQLR
Q7PJT3_ANOGA/18-425-----------------------------------------------------ALEKRISPQRRP........SYWHAIK
GR68A_DROME/7-379-----------------------------------------------------DC.......................GH
GR09A_DROME/6-339-----------------------------------------------------GSSDY......................
Q7PQT4_ANOGA/106-466-----------------------------------------------------DV.......................AI
Q7PK18_ANOGA/61-428-----------------------------------------------------LQCSERLGS................MR
GR32A_DROME/57-449-----------------------------------------------------QQHRRKEGGA.............RARR
GR22A_DROME/19-388-----------------------------------------------------LRR......................GD
GR22_ANOGA/73-437-----------------------------------------------------VLA......................TE
Q7PF20_ANOGA/20-415-----------------------------------------------------ERRRGAHEIV.............LPAG
GR58A_DROME/3-389-----------------------------------------------------LNHEERNSLTL...........SENKA
GR10A_DROME/19-404-----------------------------------------------------MDGLRPGGM...............LLH
G39AC_DROME/9-372-----------------------------------------------------.........................SK
O18280_CAEEL/46-428-----------------------------------------------------MVPKEKEEC...............PLP
Q7PVJ9_ANOGA/29-402-----------------------------------------------------TNTVYQEQ.................IR
Q7PK41_ANOGA/8-377-----------------------------------------------------VYTARQ.....................
Q7PK36_ANOGA/8-375-----------------------------------------------------N........................TT
GR58B_DROME/10-387-----------------------------------------------------.........................KA
GR59C_DROME/9-394-----------------------------------------------------AECICSIRNRR..........GGVYSI
Q7PTR1_ANOGA/7-389-----------------------------------------------------YFKRINSRIQ............FYTTV
LITE1_CAEEL/48-425-----------------------------------------------------MVPAEQDEC...............PLP
GR10B_DROME/11-372-----------------------------------------------------.........................QE
Q7PI94_ANOGA/14-414-----------------------------------------------------VAGRKRFERASRLA....GNMPANEPK
G39AD_DROME/8-362-----------------------------------------------------...........................
GR36B_DROME/9-390-----------------------------------------------------SRRLSFLQLRN...........GAFMT
Q7PK17_ANOGA/41-408-----------------------------------------------------VGRAI....................SP
GR48C_DROME/7-410-----------------------------------------------------MVQDLEVLPER...........NGIPR
G39AB_DROME/8-372-----------------------------------------------------SAD......................LK
GR98A_DROME/13-370-----------------------------------------------------RYEMWS...................IR
GR98D_DROME/12-392-----------------------------------------------------LEGNQSRDS................VQ
GR22F_DROME/19-377-----------------------------------------------------.........................SH
Q9W1V0_DROME/5-363-----------------------------------------------------QSMD.....................LE
GR89A_DROME/10-356-----------------------------------------------------.........................RE
Q7PF36_ANOGA/19-401-----------------------------------------------------GKKDRHRSCSG..........RKSNTK
GR22D_DROME/17-386-----------------------------------------------------LRG......................NH
GR98B_DROME/12-392-----------------------------------------------------FQDCEQQDM................LQ
GR59E_DROME/7-383-----------------------------------------------------QRPPQGST.................KL
GR28B_DROME/45-447-----------------------------------------------------WDTRSLKAVN............QKQRS
Q8IN22_DROME/11-375-----------------------------------------------------ESGFQTAF.................LR

PF02949

OR22B_DROME/79-381..............................................................................PG
OR24A_DROME/68-388N...........................................................................IEKS
OR23A_DROME/59-365..............................................................................YK
OR85D_DROME/84-400..............................................................................IG
OR45B_DROME/68-386.............................................................................IRD
OR43A_DROME/56-364...............................................................................E
OR98A_DROME/74-379..............................................................................SG
OR94A_DROME/69-376..............................................................................KN
OR22C_DROME/69-392HG.........................................................................DSVDV
OR2A_DROME/66-387EK.........................................................................SNKGQ
OR45A_DROME/64-362...............................................................................G
OR33C_DROME/60-372.............................................................................DDE
OR46A_DROME/62-365.............................................................................TTS
OR85C_DROME/62-369..............................................................................RD
OR85B_DROME/63-370............................................................................DWKK
OR42B_DROME/76-381..............................................................................EN
OR47B_DROME/88-402..............................................................................EV
OR63A_DROME/74-403.............................................................................VPP
OR10A_DROME/70-396T...........................................................................DHLE
OR83B_DROME/70-476ASLDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNG
OR59C_DROME/79-385..............................................................................PK
OR9A_DROME/68-381.............................................................................GGK
OR30A_DROME/58-366..............................................................................KN
OR47A_DROME/56-375...............................................................................S
OR49B_DROME/52-364..............................................................................HP
OR85F_DROME/68-381..............................................................................VK
OR94B_DROME/66-372..............................................................................AE
OR59B_DROME/77-382..............................................................................PE
OR56A_DROME/124-407LNSKL...................................................................VIGRLTAS
OR85A_DROME/77-379..............................................................................VE
OR33B_DROME/61-369..............................................................................PE
OR46B_DROME/62-373..............................................................................IE
OR33A_DROME/60-367..............................................................................VK
OR88A_DROME/73-392..............................................................................QS
OR59A_DROME/64-386..............................................................................PA
OR7A_DROME/80-394SGQ.......................................................................VEIYPD

PF03268

Q9XVJ4_CAEEL/45-398------------------------------------------------------------------------------KT
O16246_CAEEL/33-393------------------------------------------------------------------------------RR
O45459_CAEEL/19-372------------------------------------------------------------------------------KE
O16244_CAEEL/60-411------------------------------------------------------------------------------KT
O16245_CAEEL/33-364------------------------------------------------------------------------------KT
O18140_CAEEL/17-370------------------------------------------------------------------------------KE
O44618_CAEEL/25-384------------------------------------------------------------------------------KK

PF06151

GR64A_DROME/1-455EEVCES--------------VF--IQIREHYVKM-C------------------ELLEFVDSAMS----SLIL--LSCVN
GR05A_DROME/40-438QPMPEA--------------YW--TWSRTLYRSI-V------------------ELIREVDDAVS----GIML--ISFGS
GR64D_DROME/1-416KPMAKE--------------FW--QEIRSDFLDL-D------------------SLLKLYDKELS----GLIL--VCCAH
GR64C_DROME/1-407QQMPNE--------------FW--QRIRCDLLDL-S------------------DLLGIYDKELS----GLIV--LSCAH
GR61A_DROME/1-435RHVPEA--------------LW--YDIRRDHIRL-C------------------ELASLVEASMS----NIVF--VSCAN
GR64F_DROME/63-463MNMAPS--------------YW--SERRIQYRNI-C------------------ILCDKMDDAIS----LITM--VSFSN
GR64E_DROME/25-448LPTTVD--------------YW--MQCRINFRNL-C------------------KLCEEVDDAIS----TITL--LCFSN
GR64B_DROME/1-403KVMPAV--------------FW--TEVREHYLAL-K------------------RLVHLLDAAIA----PLVL--LAFGN

PF08395

Q7PKI1_ANOGA/57-400NHIYLQ...............L..TILRTHHSAL.T------------------KCIQNIVEFYN....TPLA..LIMLY
Q7PKI2_ANOGA/11-404ISTYEA...............L..KSVQRNHHLV.S------------------SNVKSFIHLQRSTDTVSNK..LIVIS
Q7PKG3_ANOGA/26-401VYDPKQT............LIL..RQIMQIFDKI.S------------------DLADKGSYYYG....IQIM..VSIAG
GR93B_DROME/24-392RQAISN...............L..DKCLYLYDEI.H------------------QVSRSFQQLFD....LPLF..LSLAQ
GR21A_DROME/81-445EKPAQK...............L..TEYRHLWVDL.S------------------HMMQQLGRAYS....NMYG..MYCLV
Q7PK37_ANOGA/8-367EELEQH...............L..DYFLHRYDRY.S------------------RLIGEVDDCYS....FPVV..LVLLL
Q7PQ43_ANOGA/15-419EHELISG............ERL..TYMFVIHENV.A------------------KLAEFINGAYS....TQII..AIVTV
Q7PK29_ANOGA/12-374HEHDFEQ.............LL..CLFLERFRQY.I------------------AQIERINQCLS....APLL..GMLLQ
Q7PF19_ANOGA/20-402DCAELV..................ETLRRTHLKL.G------------------DLTGRVVGRFG....PLIV..CTVLS
Q7PKH1_ANOGA/14-409ESGSNKQLYPL....SENETI...KTIAMIYMKL.G------------------TAVQVYNRCFF....IHIF..YIIAS
Q7PF39_ANOGA/19-415KPLIYNVLGESLKMESSRLDQL..EQLRLLHVRT.V------------------QTAGSLSEKFG....IVII..LIVIA
GR97A_DROME/41-418RFCELAD............LL...DELARKYGFT.A------------------SRSKNYLRFTD....WSMV..LSMLM
GR22E_DROME/18-388ETVESE..............RM..DLLLYLYHRL.L------------------DLGQRLASIYD....YQMV..MVMVS
GR77A_DROME/37-447RQELYKGQQKWLA.LELWRLLHVHHQLLKLHRSI.C------------------SLCAVQAVCFL....GFVP..LECTI
GR36C_DROME/8-389KCCSLAD.............QI..ENIARIQSQL.Q------------------TIMNQMEEVFG....IQGA..MTYGG
GR98C_DROME/14-394QELCVT...............L..KQNQLLIGRI.W------------------RLVDEIGAYFR....WSMT..LLFLY
Q8MLS6_DROME/6-364TRKHRE...............L..QHLWLLHACL.T------------------KTALNINKIYA....PQML..ASRFD
Q7PKH4_ANOGA/15-393RVDPVD..............VV..SELAEDFAAL.V------------------DVVDRVNRIYS....NQIIALITGVG
Q7PKH2_ANOGA/13-388EVGGIV..................RCIGDIHERL.S------------------ETIVDFNYCFA....LQIL..LMMAS
Q7PVJ7_ANOGA/11-395HAVYVRS.............KL..NYLADARCRI.V------------------ACCTETHNLYQ....QMLL..SCSFL
Q7PK40_ANOGA/8-372RHPAQEK.............VV..YYFVERFELY.A------------------SQLRQIDQCFS....MPLT..MIVLL
Q8MMI1_HELVI/3-387ELEKQHKDSDKKI.EAVKVYTW..RKIREAYVKQ.A------------------MLVRKIDVALG....GIVI..LSCSC
GR85A_DROME/27-394TVAFNL...............WEIERLHTRFQCL.I------------------DLTSEVCSIFR....YVTL..AYMAR
Q7PVK1_ANOGA/8-381QLHVRP..................AGWMQYYGQL.W------------------QVCEILNDLFG....VPLI..TYCLM
Q7PK39_ANOGA/8-367EELEQH...............L..DYFLHRYDRY.S------------------RQIGEVDDCYS....FPVV..LVLLL
GR22C_DROME/17-382VDSSRI..................RKYLSLYRRL.L------------------ELKGYMVATYE....YHMT..LVLTT
G39AA_DROME/8-363ISMAGV..................AGCLRTHDEILL------------------LGQRELIAVYG....GVIL..FLFIY
GR59D_DROME/9-389KCCYLAD.............RL..ERIAKSQSDL.Q------------------ELVENLSTAYE....GEVV..CLVIT
GR92A_DROME/18-383RRVQNR...............L..EKCISLYREI.Y------------------HTSIMFHKLFV....PLLF..LALIY
GR08A_DROME/9-380FESFLRR.............RL..VQKQRIYSHV.Y------------------DMLKCFQGAFN....FSIL..AVLLT
Q7PVJ8_ANOGA/8-380RLHFGR..................DGLMDFYGQL.W------------------QGAELANELFG....APLL..AYLAI
Q7PK13_ANOGA/41-414AQSVDR...............L..LSLKSVYGQL.W------------------ELSDCINRNFG....WSQI..CNFTG
GR22B_DROME/17-385ETDFSR...............I..HQFLSLYKRL.L------------------ELNRKLVIAYE....YQMT..LFIIA
GR63A_DROME/100-456GPAAMV..................ADYRVLWLRL.S------------------KLTRDTGNALC....YTFV..FMSLY
GR94A_DROME/17-399RFCALAD............EL...DQLAYRYRLI.Y------------------VHSGKYLTPMS....LSMI..LSLIC
Q7PKI5_ANOGA/30-402EEKPST...............I..REVYMVHCEN.A------------------QLEKQFMAIMD....LPVL..LLNGW
GR36A_DROME/9-390KCCYLAD............RI...DNIAKLQNQL.Q------------------SIVTQLNQVFG....IQGI..MVYGG
Q7PF38_ANOGA/19-415VTSPLDV............ATI..VRLSTMHMAL.M------------------RLARAANKHFG....VLML..IIVLS
Q7PKH9_ANOGA/7-400ICCDASD.............TI..DRLCTLHQEL.T------------------EIVRAIVSIFQ....LPVL..LMNLN
GR93C_DROME/18-394IVEYRV..................DECISVYDEI.E------------------RVGRTFHRLLE....LPVL..IILLG
Q7PJT3_ANOGA/18-425IQRPLGIASVYSNNDKSMPDVV..STVAEIQDAL.C------------------EACSYAEDYFT....IQML..TIVTI
GR68A_DROME/7-379MENWRE...............L..SNLIEVLCKF.R------------------YITENINCVAG....VSLL..FYFGF
GR09A_DROME/6-339........................KTLRLDYAHL.A------------------KVTRSLSHLFGL..SLLLL.NVLCLG
Q7PQT4_ANOGA/106-466ECTAAM...............I..SRYRFLWLNL.S------------------ELLQALGNAYA....RTYS..TYCLF
Q7PK18_ANOGA/61-428YMEFLAG.............KL..NALKALYSDL.F------------------QASVALNEAYG....RTYL..IIYCK
GR32A_DROME/57-449QRGDVNPNVNPALMEHFPEDSL...FIYRMHNKL.L------------------RIYKGINDCCN....LILV..SFLGY
GR22A_DROME/19-388SVDPDR...............I..QLLLWLYSRL.L------------------DLNHRLTAIYD....IQVT..LFMAT
GR22_ANOGA/73-437RPAAKL..................TEYRHLWVDL.S------------------HMMQQLGKAYS....NMYG..IYCLV
Q7PF20_ANOGA/20-415ALYDYAH............LI...DLLRRTHLRL.A------------------QLLEQANGCFG....VLIV..FTTTA
GR58A_DROME/3-389NRSLGK...............L..AKLFKLFAEN.Q------------------RLVREVFRTFD....LPIA..LLLLK
GR10A_DROME/19-404HCCELSD............RL...EELRRRCREI.H------------------DLQRESFRMHQ....FQLI..GLMLS
G39AC_DROME/9-372ESREFY..................YNFCKYNQVI.W------------------LSYTEINHCFG....LLLL..LVTGL
O18280_CAEEL/46-428EQSLQQ...............I..HDVQIHYQEI.S------------------NAKLYIEQNFS....FSLF..YTYGC
Q7PVJ9_ANOGA/29-402QQHHGP..................AGYLEFYEQL.G------------------KMSETLNDLYG....VPLI..TYFLM
Q7PK41_ANOGA/8-377.....................W..CLIVDRYGAA.V------------------NLVNEINHIFS....ELLL..VMLVQ
Q7PK36_ANOGA/8-375ACVEHV...............V..HVFLDRFQRY.Y------------------LLIDSVNKCFS....VPVT..HTLLL
GR58B_DROME/10-387RKKWKA...............L..RSVAAMHLKT.L------------------RLARRIFDMFD....IANA..TVFIN
GR59C_DROME/9-394QCCSLAD.............QL..DLIAERHYFL.K------------------DRLDEMSDLFQ....IQSL..SMSLV
Q7PTR1_ANOGA/7-389QVVAREK.............FW..SEIHSDYVMV.C------------------ELLEHVMSICS....PLLV..VSCGT
LITE1_CAEEL/48-425ESSLQK...............I..HDCQISYQRI.F------------------NGKAVIEEYYS....FVLF..YSYGV
GR10B_DROME/11-372HDTYSD...............L..MKQLRRRERL.L------------------RIGRRVHRMFA....WLVA..IALIY
Q7PI94_ANOGA/14-414KMSLHVIEVHGCGIDAANLKHLQLPKVLYRYNDL.Y------------------DICKLLDRYFG....LLFL..LTFTS
G39AD_DROME/8-362..CQGD..............LI..SGLRGRQQIL.K------------------LCGGELNECFG....LLML..PIVAL
GR36B_DROME/9-390RCCYLSD............QL...EDIGEVQSQL.Q------------------SMVGQLDEVFG....MQGL..MAYSE
Q7PK17_ANOGA/41-408EAIHRR...............L..VHLKAMQNLL.K------------------DLTGEVSDRFG....WQLF..AVITM
GR48C_DROME/7-410EMGLMQIL...........AAW..RKLWRRCRRL.D------------------ALLKQFVDIFQ....WQVL..FNLLT
G39AB_DROME/8-372MTSPNR...............LRLRVCLEMHDRLML------------------LCNDEISLVYG....FIAW..LSWMF
GR98A_DROME/13-370RLSLQK...............L..AKLQAIHNSL.W------------------QAIRCLECYFQ....LSLI..TLLMK
GR98D_DROME/12-392ELCVAL..................KRNQLLAGRI.W------------------GLVNEVSLYFT....LSLT..LLFLY
GR22F_DROME/19-377HLSSSR...............I..HALASLYDRL.L------------------KLSELVVACND....LQLI..LMLII
Q9W1V0_DROME/5-363RKSKEL..................RGLWALHRNL.S------------------YTARRINKHYG....PQML..AMRFD
GR89A_DROME/10-356EPTNLA..................RLLQKEYSWL..------------------RLIQRFVKLFQ....LGIF..LLVLG
Q7PF36_ANOGA/19-401ENDITT...............I..DKLVRLHTAL.L------------------HLTWKTNAHYG....VLLL..IIMLY
GR22D_DROME/17-386KGSSSR...............V..RFLLKLYNKL.V------------------NLYSKLADCYD....CQTV..LMMAI
GR98B_DROME/12-392ALCVAL..................KRNQLLLGRI.W------------------RLEGDVGSYFT....PTML..LLFLY
GR59E_DROME/7-383DACYESAFAVLVDAGGGSALMI..EEMRYTCNLI.E------------------QVHSQFLLRFG....LYLV..LNLLN
GR28B_DROME/45-447LQCLDSFSMYTIV.TKDPAEII..QESMEIHHLI.C------------------EAAATANKYFT....YQLL..TIISI
Q8IN22_DROME/11-375KQQRIR...............V..QKSMALFKEI.S------------------SVVTSLQDIFN....VHLF..LSALL

PF02949

OR22B_DROME/79-381RTEDEY...LKEL-----------ADCVRDHRLI-L..................DYVDALRSVFS----GTIF--VQFLL
OR24A_DROME/68-388PSEAEEARIVREM-----------EKLVDRHNEV-A..................ELTERLSGVMV----EITL--AHFVT
OR23A_DROME/59-365TLEENE....QDL-----------VNCIRDQNAL-Y..................RLLDVTKSLVS----YPMM--VQFMV
OR85D_DROME/84-400SFQHD....LEFL-----------QATVAYHQSL-I..................HLCQDINEIFG----VSLL--SNFVS
OR45B_DROME/68-386PSLRESKICCQRL-----------ADIVDRHNEI-E..................KIVKEFSGIMA----APTF--VHFVS
OR43A_DROME/56-364QSEEER...FQRL-----------ASCIAYHTQV-M..................RYVWQLNKLVA----NIVA--VEAII
OR98A_DROME/74-379KSDAEN...EQDL-----------IKCIKDHNLI-I..................DYAAAIRPAVT----RTIF--VQFLL
OR94A_DROME/69-376DTIFG.....QQL-----------RAIFIMHQRI-R..................SLTLTCQRIVS----PYIL--SQIIL
OR22C_DROME/69-392FTEEMNAEVRHRL-----------AQVVERHNAI-I..................DFCTDLTRQFT----VIVL--MHFLS
OR2A_DROME/66-387TYEAWREEVYQEL-----------IECIRDLARV-H..................RLREIIQRVLS----VPCM--AQFVC
OR45A_DROME/64-362GDSR........L-----------TGFVSRHRIA-L..................DLAKELSSIFG----EIVF--VKYML
OR33C_DROME/60-372TVVN.....HQRL-----------LDYIEQHKLL-V..................RFHNLVSRTIS----EVQL--VQLGG
OR46A_DROME/62-365GGTVE.....QQL-----------KENIRYHMTI-V..................ELSKTVERLLC----KPIS--VQIFC
OR85C_DROME/62-369WSENS.....RFL-----------AKTVQYHQRI-L..................RLMDVLNDIFG----IPLL--LNFMV
OR85B_DROME/63-370DSRF........L-----------VDIVRYHERI-L..................RLSDAVNDIFG----IPLL--LNFMV
OR42B_DROME/76-381LSEAES...YEEL-----------VKCVMDHKLI-L..................RYCAIIKPVIQ----GTIF--TQFLL
OR47B_DROME/88-402SDKR....FHEEF-----------CRVVRFHQHI-I..................KLVGKANRAFN----GAFN--AQLMA
OR63A_DROME/74-403DRRVEY......L-----------RCCIYQYQRV-A..................NFATEVNNCFR----HITF--TQFLL
OR10A_DROME/70-396LSPVQLYILEQKM-----------RSVIIRHNAI-I..................DLTRFFRDRYT----IITL--AHFVS
OR83B_DROME/70-476LTKKQEMMVRSAI-----------KYWVERHKHV-V..................RLVAAIGDTYG----AALL--LHMLT
OR59C_DROME/79-385LSEMEH...YEQM-----------VACIQDHRTI-I..................QCSQIIRPILS----ITIF--AQFML
OR9A_DROME/68-381EELEG.......L-----------VQVLLLHQKG-L..................QIADHIADKYR----PLIF--LQFFL
OR30A_DROME/58-366EQVRGE......I-----------IWCIKYQLKL-S..................GFVDSMNALNT----HLHL--VEFLC
OR47A_DROME/56-375LKESQ.....ATL-----------NKVFALYQTS-L..................DMCNDLNQCYQ----PIIC--AQFFI
OR49B_DROME/52-364YGDRDPRELREEI-----------IACIRYQQSI-I..................EYMDHINELTT----MMFL--FELMA
OR85F_DROME/68-381HDQEDR....KFI-----------AKIVDKQVHL-V..................SLQNDLNGIFG----KSLL--LSLLT
OR94B_DROME/66-372EKAR......PEL-----------RRIFQLHTKV-R..................RLTRECEVLVS----PYVL--SQVVF
OR59B_DROME/77-382RSEADN...YQDL-----------VNCVLDHKTI-L..................KCCDMIRPMIS----RTIF--VQFAL
OR56A_DROME/124-407ELTFWQ...MQLF-----------KEFVKEQLRI-R..................KFVQELQYLIC----VPVM--ADFII
OR85A_DROME/77-379KGDDQH...YAEL-----------VECVKDHKLI-V..................EYGNTLRPMIS----ATMF--IQLLS
OR33B_DROME/61-369ETIYLT...GKQL-----------IESIEDHRKL-M..................KIVELLRSTMN----ISQL--GQFIS
OR46B_DROME/62-373PQDNEK..IAMEL-----------RECAAYYNRI-V..................RFKDLVELFIK----GPGS--VQLMC
OR33A_DROME/60-367LSSSEN...TRKL-----------IEGIQDHRKL-M..................KIIRLLRSTLH----LSQL--GQFLS
OR88A_DROME/73-392LTDEKR..FFVDL-----------RLLVQRQQLL-N..................GLCRKYNDIFK----VAFL--VSNFV
OR59A_DROME/64-386RDAE......KDL-----------EACITDHKHI-LEWAGGSLVRVLFTFQLFSRLFRRIEAFIS----LPML--IQFTV
OR7A_DROME/80-394ERRQEE..HCAEL-----------QRCIVDHQTM-L..................QLLDCISPVIS----RTIF--VQFLI

PF03268

Q9XVJ4_CAEEL/45-398LKSIGIL-----------------EKFDFRQNEI-L------------------ELILFANQSLS----SFGS--VTPLF
O16246_CAEEL/33-393LQISGVL-----------------SDFCHRQAEL-I------------------RVVRETNESLQ----SYAT--VAPLF
O45459_CAEEL/19-372LLNPQTF-----------------QRFADRQIKM-F------------------ECINPLTERMN----RLMA--FAPLF
O16244_CAEEL/60-411LRNIGVL-----------------EKFDFRQNQI-L------------------EMILFAHESLS----SLGG--FVPLF
O16245_CAEEL/33-364LHKSDAL-----------------QRFCHRQKEL-I------------------GLVRKANKHLG----DYTG--TTPIA
O18140_CAEEL/17-370LLNPAIF-----------------QTFADRQIKM-F------------------EYTNALTTRLM----PFMS--SAPFL
O44618_CAEEL/25-384LKDPTVI-----------------ADFSYRQREL-L------------------KLVNETNEFLQ----SYAK--VAPLF

PF06151

GR64A_DROME/1-455NL-YFVCYQLL--NV--FNKLR-------------.WPINYIY---FW------YSLLYLIGRT-----AFVFLTAADIN
GR05A_DROME/40-438NL-YFICLQLL--KS--INTMP-------------.SSAHAVY---FY------FSLLFLLSRS-----TAVLLFVSAIN
GR64D_DROME/1-416NM-YFICVQVY--HS--FQVKG-------------.AFMDELY---FW------FCLLYVISRL-----MNMMLAASSIP
GR64C_DROME/1-407NM-YFVCVQIY--HS--FQSKG-------------.NYADELY---FW------FCLSYVIIRV-----LNMMFAASSIP
GR61A_DROME/1-435NV-YVICNQAL--AI--FTKLR-------------.HPINYVY---FW------YSLIFLLART-----SLVFMTASKIH
GR64F_DROME/63-463NL-YFICVQLL--RS--LNTMP-------------.SVAHAVY---FY------FSLIFLIGRT-----LAVSLYSSSVH
GR64E_DROME/25-448NL-YFICGKIL--KS--MQAKP-------------.SIWHALY---FW------FSLVYLLGRT-----LILSLYSSSIN
GR64B_DROME/1-403NM-SFICFQLF--NS--FKNIG-------------VDFLVMLA---FW------YSLGFAVVRT-----LLTIFVASSIN

PF08395

Q7PKI1_ANOGA/57-400QF.LIIIS.......--..........................---..................................
Q7PKI2_ANOGA/11-404FR.YNAPTQIF..YA--YTSIVQDIK....NDVDVPLGTYMSS---IL......FAVFEAVQFY......YIVSASSEIT
Q7PKG3_ANOGA/26-401SF.VYLMFYTFAFTL--VIRSVL.........PAEIVFNAGPI---IS......YSMFAYNVFI.......VAFYGNALK
GR93B_DROME/24-392SL.LAMSMVSY..HA--ILRRQ.............YSFNLWGL---VI......KLLIDVVLLT......MSVHSAVNGS
GR21A_DROME/81-445IF.FTTIIATY..GS--ISEII............DHGATYKEV---GL......FVIVFYCMGL.......LYIICNEAH
Q7PK37_ANOGA/8-367VM.LQLIYLAE..HL--YSTIETGTM....MPVADNFFYSLFG---QV......WQTMYGALGY.....YCISACGT.AS
Q7PQ43_ANOGA/15-419TF.VNTLFGFF...I--VTKLLFWN......YQMLDLILRACR---YA......FECIPACLLV.....YYMLIVCASTH
Q7PK29_ANOGA/12-374AL.IELAYFMYEWFR--VISTG...........QVVNGNYVSV---QQ......WITSQFWQLMYGNVLLLLVPSCEQAS
Q7PF19_ANOGA/20-402SF.VVLNLELF..NV--YKATGRGSK...RVWSASEGFRLVHT---LL......WIGLHGAKIL......LILYPGHRAR
Q7PKH1_ANOGA/14-409AFGLNLVSCFTIIHV--YLASSS..........YSIVDPIMIS---QL......FLSLFFILII.....MQVMFAGNLLH
Q7PF39_ANOGA/19-415AF.ASVNIELL..EF--YQSIKL.........GTLTPTTIFMK---FL......YAASKFSFYI......LIAYPNRLIQ
GR97A_DROME/41-418NL.LGITMGCY..NQ--YLAIADHYI....NEEPFDLFLAIVL---VV......FLAVPFLELV......MVARISNQTL
GR22E_DROME/18-388FL.IANVLGIYFFII--YSISLN..........KSLDFKILVF---VQ......ALVINMLDFW......LNVEICELAE
GR77A_DROME/37-447HL.FFTYFMKYSKFI--LRKYGR..........SFPLNYFAIA---FL......VGLFTNLLLV.....ILPTYYSERRF
GR36C_DROME/8-389YY.LSSVGTCY..LA--YSILKHGY.....ENLSMTLSTVILA---YS......WCFFYYLDGM......LNLSVMLHVQ
GR98C_DROME/14-394NG.LTILHVVN..WA--IIRSIDP........NDCCQLNRLGS---IT......FLSFNLLLTC......FFSECCVKTY
Q8MLS6_DROME/6-364NF.VNGVIQAYWGAV--FTFDL.................STPF---FWV....VYGSVQYHVRC......LDYYLIDNMC
Q7PKH4_ANOGA/15-393MFSIFVIYATS..FS--YYVGR............SRETRLTLI---LL......TACVVYIIMI.....GLIFFTGVDVE
Q7PKH2_ANOGA/13-388AFGYTLFSIFGLIHA--FSQVEE..........DESHQVSMNN---MV......YGCIYLSFII......QVVVAGSLVT
Q7PVJ7_ANOGA/11-395CMTFIVTQLLY..LH--YRTRS............ELSFAALGH---ET......FTCLLCYFEV.....YCIAEACELVR
Q7PK40_ANOGA/8-372VL.IEMVYLVF..DI--YAVLALD.......RPVFMENLEIDY---VQ......WALRQLWQTIY...GAVVLLTVTGCQ
Q8MMI1_HELVI/3-387NF.YFICLQMF..LG--ITQGL............SSDLLSLIY---YV......ISLAWLCTRV.....ISVVLAASSVN
GR85A_DROME/27-394NL.WSGIVAGYLLVR--FVIGN............GLQDVELVY---LV......FSFITCIQPL......MLSLLVNSMT
Q7PVK1_ANOGA/8-381SL.MHLTFICY..VM--LTKMMV..........EWHNFSVVQN---VLAGVELMWTVFELLCLM......RIVSTFARTR
Q7PK39_ANOGA/8-367VM.LQLIYLAE..HL--YSTIET..........GRMMPVADNF---FYSLFSQVWQTVYGALGY.....YCISACGT.AS
GR22C_DROME/17-382GL.ASNFLAIYSWIV--LDISM...........NINFIYLLIF---PL......FLLVNVWNLW......LSIAASDLAE
G39AA_DROME/8-363Q..VMQCILIFYISN--LEGFH............SSNDLVLIF---CW........LAPMLFYL......ILPLVVNDIH
GR59D_DROME/9-389YY.LNMLGTSY..LL--FSISKYGN.....FGNNLLVIITLCG---IV......YFVFYVVDCW......INAFNVFYLL
GR92A_DROME/18-383KV.LLIALIGF..NV--AVEFY...............LNSFIF---WI......LLGKHVLDLF......LVTVSVEGAV
GR08A_DROME/9-380IN.IRIAVDCY..FM--YYSIY...............NNVINN---DY......YLIVPALLEI.....PAFIYASQSCM
Q7PVJ8_ANOGA/8-380AF.IHTTTIYYRVWS--QLAGGLEN......QPLVITVHLIVQ---LV......WVTMDLMFLM......AVVGSCGQMR
Q7PK13_ANOGA/41-414NF.VQLSCDLY..WL--YMSMK...........WFEATEYKVV---IV......ITLLPSTSII.....VLLLSSAESCL
GR22B_DROME/17-385QL.SGNIVVIYFLIV--YGLSM...........RTYSIFLVAF---PN......SLLINIWDFW......LCIAACDLTE
GR63A_DROME/100-456LF.FIITLSIY..GL--MSQLSEG........FGIKDIGLTIT---AL......WNIGLLFYIC.....DEAHYASVNVR
GR94A_DROME/17-399HL.LGITVGFY..SL--YYAIADTLI....MGKPYDGLGSLIN---LV......FLSISLAEIT......LLTHLCNHLL
Q7PKI5_ANOGA/30-402YF.YMIVVSVY..YM--YTSTMVEVRRGFGVEDVTKYFNSVTF---FL......YLAVQLYYMM.........SIPSQYT
GR36A_DROME/9-390YY.IFSVATTYITYS--LAINGIE.......ELHLSVRAAALV---FS......WFLFYYTSAI......LNLFVMLKLF
Q7PF38_ANOGA/19-415TF.IQINMLLL..EL--YHNISH.........PVMPEYCLWVL---FL......HAIVHFTFFF......VIATSNHAIQ
Q7PKH9_ANOGA/7-400QF.IVIVSRIYFVYI--LSAQVKHR......SDYMSYHRFFNS---IL......YICFEAVQCF......LLALGSSVIA
GR93C_DROME/18-394KI.FATTILSYEVII--RPELY............ARKIGMWGL---VV......KSFADVILLT......LAVHEAVSSS
Q7PJT3_ANOGA/18-425VF.LIIVFNSY..YV--LDALLGSTS...LDSPFSKGQFAMFF---LC......QAMVYGFGVF......NIVYGSSSLV
GR68A_DROME/7-379SF.YTVTNQSY..LA--FATLTAGSL....SSKTEVADTIGLS---CI......WVLAETITMI......VICSACDGLA
GR09A_DROME/6-339DW.IIVCNVYFMVAY--LQVLP............ATLFLFGQV---MF......VVCPTLIKIW......SICAASHRCV
Q7PQT4_ANOGA/106-466MF.VNITVAIY..GA--LSEII............DHGFGFSFK---EI......GLIVDTVYCS.....TLLFIFCDCSH
Q7PK18_ANOGA/61-428NY.IHILSNSY..WV--VFWLL............NNQRHHAAR---II......SRLICRIILL.....GATFYINSCAM
GR32A_DROME/57-449SF.YTVTTNCY..NL--FVQITGK........GMVSPNILQWC---FA......WLCLHVSLLA......LLSRSCGLTT
GR22A_DROME/19-388LFSVNIIVGHVLVIC--WINITR..........FSLLVIFLLF---PQ......ALIINFWDLW......QGIAFCDLAE
GR22_ANOGA/73-437IF.FTTIIATY..GS--LSEII............EHGATYKEV---GL......FVIVFYCMSL.......LFIICNEAH
Q7PF20_ANOGA/20-415SF.VVLSLQFF..EI--YRATTVRP......WTVTDTYLLVYT---VL......WIVLHAAKVL......MILYPAHLVQ
GR58A_DROME/3-389MF.VTNVNLVYHGVQ--FGNDTI..........ETSSYTRIVG---QW......VVISHYWSAV.....LLMNVVDDVTR
GR10A_DROME/19-404TL.INNLTNFY..TL--FHMLAKQ.......SLEEVSYPVVVG---SV......YATGFYIDTY......IVALINEHIK
G39AC_DROME/9-372IL.LITPSGPF..YL--VSTIFEGRF....RQNWQFSLMSFTA---IL......WSLPWIVLLV......LAMGRND.VQ
O18280_CAEEL/46-428CI.PLTCLLGY..IA--FRNGI...........QADMAETFSV---AI......WLTNTMLALM......LFSIPAFMIA
Q7PVJ9_ANOGA/29-402TL.IHLTFVCY..MT--LTKVLTK.......WSYLSWHALLIA---GI......AVTSNVIDLL.....CLMKIVGTFAR
Q7PK41_ANOGA/8-377VQ.VQLCCQYF..IL--FCSTVDGL......VPIVTGLTVLHT---QL......WESLFLLMLL......VVGYACDSCH
Q7PK36_ANOGA/8-375IV.LERTVAAY..DV--FENLR...........GESKMILWDF---YRLLYRQVWEITYIVLMV......LLAINCNATS
GR58B_DROME/10-387MF.MTAINILYHAVQ--YSNSSIKSN....GWGILFGNGLIVF---NF......WGTMALMEML.....DSVVTSCNNTG
GR59C_DROME/9-394YF.FSTMGSIY..FS--VCSILYSS.....TGFGSTYWGLLLI---VL......STASFYMDNW......LSVNIGFHIR
Q7PTR1_ANOGA/7-389NL.YLICYQLF..HL--VDRTD.............DFIIVTVF---TY......FSLFFIILRT.....FLTMHYCSAVH
LITE1_CAEEL/48-425CI.PIFCFLMF..VG--MSAQS............ICWSEVVSI---VI......WIVNAILVLL......LFSLPAFMIN
GR10B_DROME/11-372LV.FFNTATIYLGYT--MFIQKHDA.....LGLRGRGLKMLLT---VV......SFLVILWDVV......LLQVICEKLL
Q7PI94_ANOGA/14-414IF.IVTTIQLY..YS--YTILYWFT.....GENGFTIWSLMVC---LN......TISINLGVLL......TIVLLCEKIS
G39AD_DROME/8-362VL.LMAPSGPF..FL--ISTVLEGK.....FRPDECLIMLLTS---ST......WDTPWMIMLV......LMLRTNG.IS
GR36B_DROME/9-390YY.LSIVGTSYMSYS--IYKYGPH.......NLKLSAKTSIIV---CI......LITLFYLDAL......VNCNNMLRVL
Q7PK17_ANOGA/41-408LF.ICTTIDGY..WM--YASLH...........YDGNLYKVES---FL......CGISPVLMFF......VLFNTCQKCV
GR48C_DROME/7-410TY.IFSIAVLFRLWI--YLEFD.............KNFHLWKG---IL......YAIIFLTHHV.....EIVMQFSIFEI
G39AB_DROME/8-372AS.LDVTGVIYLTMV--IQTKK............SIVLKLITN---VV......WLSPTFMTCA.......ASFMSNRVT
GR98A_DROME/13-370FF.IDTSALPY..WL--YLSRVE..........HTRVAVQHYV---AT......VECIKLLEIV......VPCYLCTRCD
GR98D_DROME/12-392NE.LTILQIVN..WA--LIKSVNP........NECCQYRRVGT---CL......LLSINIFLSC......LYSEFCIQTY
GR22F_DROME/19-377YL.IGNTVQIFFLIV--LGVSM............NKRYIYLVA---SP......QLIINFWDFW......LNIVVCDLAG
Q9W1V0_DROME/5-363YF.IFSIINACIGTI--YSTTDQ.........EPSLEKIFGSL---IY......WVRSFDFFLN........DYICDLVS
GR89A_DROME/10-356SF.VNIMVNIYAFMS--YYVSL...........HGVPLTISNN---CL......VLAIQLYAVI......LAAHLCQVRS
Q7PF36_ANOGA/19-401SF.IQISVILA..EL--YFDNY...........DLPLVFVGIC---LT......HAAVYFMFFL......IIAHANHAII
GR22D_DROME/17-386FL.AANIIVCFYMIV--YRISLS.........KMSFFVMLIMF---PL......AIANNFMDFW......LSMKVCDLLQ
GR98B_DROME/12-392NG.LTILHMVN..WA--YINKFLY........DSCCQYERFLV---CS......TLLVNLLLPC......LLSQRCINAY
GR59E_DROME/7-383SL.VSICVELYLIFN--FFETPL..........WEESVLLVYR---LL......WLAMHGGRIW......FILSVNEQIL
GR28B_DROME/45-447AF.LIIVFDAY..YV--LETLLGKSK....RESKFKTVEFVTF---FS......CQMILYLIAI.....ISIVEGSNRAI
Q8IN22_DROME/11-375TL.LQVLVVWY..KM--IIDLG............FSDFRIWSF---SL......KNLIQTLLPV.....LAIQEAANQFK

PF02949

OR22B_DROME/79-381IG-IVLGLSMINIMF--FST..-------------.LSTGVAV...VL------FMSCVSMQTF------PFCYLCNMIM
OR24A_DROME/68-388SS-LIIGTSVVDILL--FSG..-------------..LGIIVY...VV------YTCAVGVEIF------LYCLGGSHIM
OR23A_DROME/59-365IG-INIAITLFVLIF--YVE..-------------TLYDRIYY...LC------FLLGITVQTY------PLCYYGTMVQ
OR85D_DROME/84-400SS-FIICFVGFQMT.--IGS..-------------KIDNLVML...VL------FLFCAMVQVF------MIATHAQRLV
OR45B_DROME/68-386AS-LVIATSVIDILL--YSG..-------------..YNIIRY...VV------YTFTVSSAIF------LYCYGGTEMS
OR43A_DROME/56-364FG-SIICSLLFCLNI--ITS..-------------.PTQVISI...VM------YILTMLYVLF------TYYNRANEIC
OR98A_DROME/74-379IG-ICLGLSMINLLF--FAD..-------------.IWTGLAT...VA------YINGLMVQTF------PFCFVCDLLK
OR94A_DROME/69-376SA-LIICFSGYRLQH--VGIRD-------------NPGQFISM...LQ------FVSVMILQIY------LPCYYGNEIT
OR22C_DROME/69-392AA-FVLCSTILDIML--NTS..-------------.SLSGLTY...IC------YIIAALTQLF------LYCFGGNHVS
OR2A_DROME/66-387SA-AVQCTVAMHFLY--VADDH-------------DHTAMIIS...IV------FFSAVTLEVF------VICYFGDRMR
OR45A_DROME/64-362SY-LQLCMLAFRFSR--SGW..-------------.SAQVPFR...AT------FLVAIIIQLS------SYCYGGEYIK
OR33C_DROME/60-372CG-ATLCIIVSYMLF--FVG..-------------DTISLVYY...LV------FFGVVCVQLF------PSCYFASEVA
OR46A_DROME/62-365SV-LVLTANFYAIAV--LSD..-------------ERLELFKY...VT------YQACMLIQIF------ILCYYAGEVT
OR85C_DROME/62-369ST-FVICFVGFQMTV--GVP..-------------.PDIMIKL...FL------FLFSSLSQVY------LICHYGQLIA
OR85B_DROME/63-370SS-FVICFVGFQMTV--GVP..-------------.PDIVVKL...FL------FLVSSMSQVY------LICHYGQLVA
OR42B_DROME/76-381IG-LVLGFTLINVFF--FSD..-------------.IWTGIAS...FM------FVITILLQTF------PFCYTCNLIM
OR47B_DROME/88-402SF-SLISISTFETMA--AAAV.-------------DPKMAAKF...VL------LMLVAFIQLS------LWCVSGTLVY
OR63A_DROME/74-403SL-FNWGLALFQMSV--GLGNN-------------SSITMIRM...TM------YLVAAGYQIV------VYCYNGQRFA
OR10A_DROME/70-396AA-MVIGFSMVNLLT--LGN..-------------NGLGAMLY...VA------YTVAALSQLL------VYCYGGTLVA
OR83B_DROME/70-476ST-IKLTLLAYQATK--ING..-------------VNVYAFTV...VG------YLGYALAQVF------HFCIFGNRLI
OR59C_DROME/79-385VG-IDLGLAAISILF--FPN..-------------TIWTIMAN...VS------FIVAICTESF------PCCMLCEHLI
OR9A_DROME/68-381SA-LQICFIGFQVAD--LFP..-------------.NPQSLYF...IA------FVGSLLIALF------IYSKCGENIK
OR30A_DROME/58-366FG-AMLCVLLFSLII--AQT..-------------.IAQTVIV...IA------YMVMIFANSV------VLYYVANELY
OR47A_DROME/56-375SS-LQLCMLGYLFSI--TFA..-------------.QTEGVYY...AS------FIATIIIQAY------IYCYCGENLK
OR49B_DROME/52-364FS-ALLCALLFMLII--VSG..-------------.TSQLIIV...CM------YINMILAQIL------ALYWYANELR
OR85F_DROME/68-381TA-AVICTVAVYTLI--QGP..-------------.TLEGFTY...VI------FIGTSVMQVY------LVCYYGQQVL
OR94B_DROME/66-372SA-FIICFSAYRLVH--MGFKQ-------------RPGLFVTT...VQ------FVAVMIVQIF------LPCYYGNELT
OR59B_DROME/77-382IG-SVLGLTLVNVFF--FSN..-------------.FWKGVAS...LL------FVITILLQTF------PFCYTCNMLI
OR56A_DROME/124-407FS-VLICFLFFALTV--GVP..-------------SKMDYFFM...FI------YLFVMAGILW------IYHWHATLIV
OR85A_DROME/77-379VG-LLLGLAAVSMQF--YNT..-------------.VMERVVS...GV------YTIAILSQTF------PFCYVCEQLS
OR33B_DROME/61-369SG-VNISITLVNILF--FAD..-------------NNFAITYY...GV------YFLSMVLELF------PCCYYGTLIS
OR46B_DROME/62-373SV-LVLVSNLYDMST--MSI..-------------ANGDAIFMLKTCI------YQLVMLWQIF------IICYASNEVT
OR33A_DROME/60-367SG-INISITLINILF--FAE..-------------NNFAMLYY...AV------FFAAMLIELF------PSCYYGILMT
OR88A_DROME/73-392GA-GSLCFYLFMLSE--TSD..-------------.VLIIAQY...IL------PTLVLVGFTF------EICLRGTQLE
OR59A_DROME/64-386TA-LNVCIGLAALVF--FVS..-------------EPMARMYF...IF------YSLAMPLQIF------PSCFFGTDNE
OR7A_DROME/80-394TA-AIMGTTMINIFI--FAN..-------------.TNTKIAS...II------YLLAVTLQTA------PCCYQATSLM

PF03268

Q9XVJ4_CAEEL/45-398LF-YGLINGVYLTS...FFDDL-------------PTLYKVIL---GL------NLAAIIIYNF------IILSTACALQ
O16246_CAEEL/33-393AF-NSLINAVFIASG..FSSSL-------------PPVVFGVL---LF------DLFAVIGLTF------FTLRPASNVQ
O45459_CAEEL/19-372IL-TALTNVLYLVTN..LRSAT-------------HTLYFICM---VG------MLISCIIISK------ILLYPPALVQ
O16244_CAEEL/60-411MY-WGLANGVYLTS...FVYDV-------------PLLYAIIV---GF------NLASIIFYNV------FVMFPAIILQ
O16245_CAEEL/33-364CF-NACVNGTYMWFGFHDFPMD-------------SSISSIIL---KY------NIFAVLFITF------FSLRPASNVQ
O18140_CAEEL/17-370IL-TALANVTFIFTN..LGSLI-------------DTYYYICM---IG------LMICCIIISS------NLMYPPALVQ
O44618_CAEEL/25-384CF-FSIINAIFNLS...FFSFV-------------PVPYAIML---VF------LLACIIGMII------LSLLPAAKVQ

PF06151

GR64A_DROME/1-455E----ESKRGLGVL-----------------RRV------SSRSWCVE--VERLIFQMT-TQTV----ALSGKK-FYFLT
GR05A_DROME/40-438D----QAREPLRLL-----------------RLV------PLKGYHPE--VFRFAAELA-SDQV----ALTGLK-FFNVT
GR64D_DROME/1-416Q----EIKDISNTL-----------------YEV------RSSPWCDE--LGRLSEMLR-NETF----ALSGMG-YFYVT
GR64C_DROME/1-407Q----EAKEISYTL-----------------YEI------PTEFWCVE--LRRLNEIFL-SDHF----ALSGKG-YFLLT
GR61A_DROME/1-435D----ASLLPLRSL-----------------YLV------PSDGWTQE--VQRFADQLT-SEFV----GLSGYR-LFCLT
GR64F_DROME/63-463D----ESRLTLRYL-----------------RCV------PKESWCPE--VKRFTEEVI-SDEV----ALTGMK-FFHLT
GR64E_DROME/25-448D----ESKRPLVIF-----------------RLV------PREYWCDE--LKRFSEEVQ-MDNV----ALTGMK-FFRLT
GR64B_DROME/1-403D----YERKIVTAL-----------------RDV------PSRAWSIE--VQRFSEQLG-NDTT----ALSGSG-FFYLT

PF08395

Q7PKI1_ANOGA/57-400.....EAEKTGVLL..N-EF.........L-PTD------PNPRVERC..IESFAIELL.HEDF....KINNCG-MYDVD
Q7PKI2_ANOGA/11-404EEVRKHAEKTGVLL..N-EF.........L-PTD------PNPRVERC..IESFAIELL.HEDF....KINNCG-MYDVD
Q7PKG3_ANOGA/26-401Q....QCAQLCFAS.TF-DFVL....VFGL-IST------LCESVKLT.LLRMFLMQLG.HRSP.....MITCG-LFPFD
GR93B_DROME/24-392R....LIRRLSFEN...-...........F-YVT------DSQSYHQK..LELFLGRLQ.HQEL....RVFPLG-LFEVS
GR21A_DROME/81-445Y....ASRKVGLDFQTK-LLN.......IN-LTA------VDAATQKE..VEMLLVAIN.KNPP....IMNLDG-YANIN
Q7PK37_ANOGA/8-367E....EVEETALCT..R-HF........DD-YRL------QNTRAAKQ..IQNFLLKNL.HQKK....KFSACG-FFDID
Q7PQ43_ANOGA/15-419S....ELFKSASLL..H-KLLQ....YKSN-YFI------DDQALFER..SKAIALQLL.HRKRF..SLFDGSG-LFRLD
Q7PK29_ANOGA/12-374N....EVEETALCT..R-HF........DD-YRL------QNTRAAKQ..IQNFLLKNL.HQKK....KFSACG-FFDID
Q7PF19_ANOGA/20-402V....ECERTGPTL..Y-EIA.......SR-YEA------AG.RSNSA..LMKFAGQLL.LLHGK.RHHCKACG-LITLD
Q7PKH1_ANOGA/14-409K....KAKQTAILL...-............-..H------KAAIYNDC..GSQIIEQLSHGIPK......ASCY-FYDID
Q7PF39_ANOGA/19-415Q....ENQKALFML..Y-RI.........K-RIS------CSVELNEA..IEHFISQIS.NLHD....VHQACG-MLNLD
GR97A_DROME/41-418T......RRTGELL..Q-RF.........D-LQH------ADARFKQV..VNAFWLQVV.TINY....KLMPLG-LLELN
GR22E_DROME/18-388R....TGRQTSTIL..K-LF........ND-IEN------IDEKLERS..ITDFALFCS.HRRL....RFHHCG-LFYVN
GR77A_DROME/37-447NCTREIIKGGGLAF...-...........P-SRI------TVKQLRHT..MHFYGLYLKNVEHV...FAVSACG-LFKLN
GR36C_DROME/8-389D....DYWEMLQILGKR-TI.........F-VGL------DV.RLEEA..FENLNLQLI.RNPL....KITVVK-LYDVT
GR98C_DROME/14-394N....SISYILHQI..G-CL.........P-TAE------EFQMLKMG..LKEYILQMQ.HLKL....LFTCGG-LFDIN
Q8MLS6_DROME/6-364D....VAVEYHDSA...-...........K-HSW------SEVRWTKE..ISSYVIYAN.STKL....QLWSCG-LFQAN
Q7PKH4_ANOGA/15-393N....TSNDIVGLL..H-EA.........I-QRV------VDSSTKRK..LIWFSQQILFRRPK......LRCI-FYAYD
Q7PKH2_ANOGA/13-388K....ECKRTVIFV..H-KA........VC-YGY------YDMPILLQ..IKFLSQQLRSVAPR......VSCL-LFDFE
Q7PVJ7_ANOGA/11-395E....QSLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-MFTLD
Q7PK40_ANOGA/8-372RT.CGELQQTAQLV..R-RL........DD-DRN------RNSRVATQ..IHRFLLQNL.NRKI....NFSVCG-MFDID
Q8MMI1_HELVI/3-387T....HSKLALNHL..Y-NY..........-...------ETHCYNVE..VERLQDQLT.KDYI....ALSGMG-FFYLN
GR85A_DROME/27-394S....TTGSLVEVT..R-DIL.......KI-SHK------KSVNLERS..IEWLSLQLT.WQHT....HVTIFG-VFRIN
Q7PVK1_ANOGA/8-381E....ESLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-MFTLD
Q7PK39_ANOGA/8-367E....EVEETALCT..R-HF........DD-YRL------QNTRAAKQ..IQKFLLKNL.HQKK....KFSACG-FFDID
GR22C_DROME/17-382N....AGKSTQTVL..K-LF........AD-LEV------KDIELERS..VNEFALLCG.HCQF....NFHVCG-LFTIN
G39AA_DROME/8-363N....QANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-FFALD
GR59D_DROME/9-389D....AHDKMVKLLNKR-TL.........F-QPG------LDHRLEMV..FENFALNLV.RNPL....KLHMYG-LFEFG
GR92A_DROME/18-383N....QFLNIGMQF...-...........G-NVG------DLSKFQTT..LDTLFLHLR.LGHF....RVSILG-LFDVT
GR08A_DROME/9-380V....VVPRIAHQL..H-NIV......TDS-GCC------SCPDLSLQ..IQNFSLQLL.HQPI....RIDCLG-LTILD
Q7PVJ8_ANOGA/8-380Q....ESLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-MFTLD
Q7PK13_ANOGA/41-414G....VAASLQSAL..L-DI..........-PMG------NDSTFRKI..IYRFGLQIA.QQRI....RLTAHG-LFEIN
GR22B_DROME/17-385K....AGDETAIIL..K-IF........SD-LEH------RDDKLEMS..VNEFAWLCS.HRKF....RFQLCG-LFSMN
GR63A_DROME/100-456T....NFQKKLLMV...-...........E-LNW------MNSDAQTE..INMFLRATE.MNPS....TINCGG-FFDVN
GR94A_DROME/17-399V....ATRRSAVIL..Q-EM.........N-LQH------ADSRYRQA..VHGFTLLVT.VTKY....QIKPLG-LYELD
Q7PKI5_ANOGA/30-402E....RSKKMLSIL..G-AI.........N-HRS------RGRRMERM..LDFITLDYM.QRDY....DVRNYG-LYDIN
GR36A_DROME/9-390D....DHKEMERILEER-TL.........F-TSA------LDVRLEQS..FESIQLQLI.RNPL....KIEVLD-IFTIT
Q7PF38_ANOGA/19-415Q....ENERTMLLL..H-EF..........-KCS------WSSEQNMT..IEHFISQIS.NLHD....VHQACG-MLNLD
Q7PKH9_ANOGA/7-400Q....EARRPGTTM..N-VF.........V-NAW------LDTRTERS..IELFTLAVL.TTDA....RIKIGG-MYVLN
GR93C_DROME/18-394R....MMRRLSLEN...-...........F-PIT------DHKAWHMK..WEMFLSRLN.FFEF....RVRPLG-LFEVS
Q7PJT3_ANOGA/18-425Q....ENDNIGSNV..H-KLL.......NA-AAG------ADSELAGK..LMHLSLQML.HRKV....RFSACG-LFSLD
GR68A_DROME/7-379S....EVNGTAQIL..A-RI..........-.YG------KSKQFQNL..IDKFLTKSI.KQDL....QFTAYG-FFSID
GR09A_DROME/6-339S....KSKHLQQQL..K-DL..........-.PG------QTPVERSQ..IEGFALQIM.QDPI....QIDVCG-IYHLN
Q7PQT4_ANOGA/106-466NATLQVAQGVQDTL..L-SI.........N-LLK------VDQPTQKE..IDLFIQAIE.MNPA....IVSLKG-YAEVN
Q7PK18_ANOGA/61-428K....SAQNLRHRLHTM-DL.........G-IQI------KCQALFTR..IESFLQQTQ.FESI....QLTAGD-FFDLN
GR32A_DROME/57-449T....EANATSQIL..A-RV..........-.YA------KSKEYQNI..IDKFLTKSI.KQEV....QFTAYG-FFAID
GR22A_DROME/19-388S....TGKKTSMIL..K-LF........ND-MEN------MDQETERR..VTEFTLFCS.HRRL....KVCHLG-LLDIN
GR22_ANOGA/73-437H....ASKRVGLNFQER-LLN.......VN-LTA------VDKATQKE..VEMFLVAID.KNPP....TMNLDG-YANIN
Q7PF20_ANOGA/20-415R....ERDRTGPIL..C-HF.........N-PAA------LDSALNSA..LAKFSSQLL.HVQG....PQTACG-VINLE
GR58A_DROME/3-389R....SDLKMGDLL..R-EF........SH-LEL------VKRDFHLQ..LELFSDHLR.CHPS....TYKVCG-LFIFN
GR10A_DROME/19-404L....ELEAVALTM..R-RF........AE-PRE------MDERLTRE..IEHLSLELLNYQPP......MLCG-LLHLD
G39AC_DROME/9-372K....EANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-FFALD
O18280_CAEEL/46-428E....EGDKLLTAS..F-KMY.......HE-TLC------EERDLLVLSQMSFLSFQMH.ATKL....TLTAGN-FFMMN
Q7PVJ9_ANOGA/29-402TR..EESLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-MFTLD
Q7PK41_ANOGA/8-377N....QIQDVNVAV..R-NN.........V-GSL------NTQRVEARKWVDRFLLQKLSQTNQ...QRFMAGG-LFVLD
Q7PK36_ANOGA/8-375L....QVEETALCT..R-HF........DD-YRL------QNTRAAKQ..IQNFLLKNL.HQKK....KFSACG-FFDID
GR58B_DROME/10-387Q....QLRQLSDLP...-............-..K------VGPKMQRE..LDVFTMQLR.QNRL....VYKICG-IVELD
GR59C_DROME/9-394D....QQDELFRVLADR-TL.........F-YRE------LDNRLEAA..FENFQLQLASNRHE.....FYVMG-LFKME
Q7PTR1_ANOGA/7-389E....VARKPLKLF..R-RV..........-...------PTSNWCSE..LERFYSFIR.KSSI....AINAMG-LFRLT
LITE1_CAEEL/48-425E....DGDRLVASS..F-RMY.......HE-TFH------EERDLTVLSQMTFFTFQIH.STKL....TLSACN-YFYMD
GR10B_DROME/11-372A....EENKICDCP...-...........E-DVA------SSRTTYRQWEMSALRRAIT.RSSP....ENNVLG-MFRMD
Q7PI94_ANOGA/14-414N....KTKHANDLL..A-DL..........-.QL------RGSRYMSSEEVIKLTVPFQAPNKV...FKFSAMG-FFQID
G39AD_DROME/8-362E....EANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-FFALD
GR36B_DROME/9-390D....HHKDFLGLLEER-TV.........F-ASS------LDIRLEES..FESLQLQLA.RNPL....KINVMG-MFPIT
Q7PK17_ANOGA/41-408D....EGEITFYYL..H-SV........LN-RVL------PQTTITL...IENFSKQLD.NEQI....NFSAAN-FFDIR
GR48C_DROME/7-410N....RCKWLGLLEDVG-NLWDINYSGRQC-IKS------SGTILSRKLEFSLLYMNRKLQLNPKRVRRLHIVG-LFDLS
G39AB_DROME/8-372I....QANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-FFALD
GR98A_DROME/13-370A....MQRKFLSMF..Y-TV.........T-TDR------RSSQLNAA..LRSLNLQLS.QEKY....KFSAGG-MVDIN
GR98D_DROME/12-392N....SISRVLHQM..Y-CL..........-.SA------AEDYLILKMGLREYSLQME.HLKL....IFTCGG-LFDIN
GR22F_DROME/19-377K....CGDQTSKVL..K-LF........TD-LEH------DDEELERS..LNEFAWLCT.HRKF....RFQLCG-LFSIN
Q9W1V0_DROME/5-363E....YQMQPKFFA...-............-...------PESSMSNE..LSSYLIYES.STRL....DLLVCG-LYRVN
GR89A_DROME/10-356A....KLRKKCLQL...-...........E-YVP------EGLTQEQAMASTPFPVLTP.TGNV....KFRILG-VFILD
Q7PF36_ANOGA/19-401M....ENERTLLLL..L-DI..........-NCI------WNSELNGM..VDYYFMQVS.NLQD....THQACG-MIKLD
GR22D_DROME/17-386K....TGRQTSMIL..K-LF........ND-IEN------MDKDLEIS..ISDFALYCS.HRRF....KFLHCG-LFHVN
GR98B_DROME/12-392N....CFPRILHKI..R-CT.........S-ADP------NFAMLTRG..LREYSLQME.HLKL....RFTCGG-LFDIN
GR59E_DROME/7-383E....QKCNLCQLL..N-EL..........-.EV------CSSRLQRT..INRFLLQLQRSIDQ....PLEACG-IVTLD
GR28B_DROME/45-447K....KSEKTGGIV..H-SL.........L-NKT------KSAEVKEK..LQQFSMQLM.HLKI....NFTAAG-LFNID
Q8IN22_DROME/11-375Q....TRERALDIF...-............-LVG------KSKHWMKS..VEIFVTHLN.LSEF....RVNLLG-LFNVS

PF02949

OR22B_DROME/79-381D----DCQEMADSL--F.QS---------D.WTS......ADRRYKST--LVYFLHNLQ..QPI----ILTAGG.VFPIS
OR24A_DROME/68-388E----ACSNLARST--F.SS---------H.WYG......HSVRVQKM--TLLMVARAQ..RVL----TIKIPF..FSPS
OR23A_DROME/59-365E----SFAELHYAV--F.CS---------N.WVD......QSASYRGH--MLILAERTK..RMQ----LLLAGN.LVPIH
OR85D_DROME/84-400D----ASEQIGQAV--Y.NH---------D.WFR......ADLRYRKM--LILIIKRAQ..QPS----RLKATM.FLNIS
OR45B_DROME/68-386T----ESLSLGEAA--Y.SS---------A.WYT......WDRETRRR--VFLIILRAQ..RPI----TVRVPF..FAPS
OR43A_DROME/56-364L----ENNRVAEAV--Y.NV---------P.WYE......AGTRFRKT--LLIFLMQTQ..HPM----EIRVGN.VYPMT
OR98A_DROME/74-379K----DCELLVSAI--F.HS---------N.WIN......SSRSYKSS--LRYFLKNAQ..KSI----AFTAGS.IFPIS
OR94A_DROME/69-376V----YANQLTNEV--Y.HT---------N.WLE......CRPPIRKL--LNAYMEHLK..KPV----TIRAGN.FFAVG
OR22C_DROME/69-392E----SSAAVADVL--Y.DM---------E.WYK......CDARTRKV--ILMILRRSQ..RAK----TIAVPF..FTPS
OR2A_DROME/66-387T----QSEALCDAF--Y.DC---------N.WIE......QLPKFKRE--LLFTLARTQ..RPS----LIYAGN.YIALS
OR45A_DROME/64-362Q----QSLAIAQAV--YGQI---------N.WPE......MTPKKRRL--WQMVIMRAQ..RPA----KIFGFM..FVVD
OR33C_DROME/60-372E----ELERLPYAI--F.SS---------R.WYD......QSRDHRFD--LLIFTQLTLGNRGW----IIKAGG.LIELN
OR46A_DROME/62-365Q----RSLDLPHEL--Y.KT---------S.WVD......WDYRSRRI--ALLFMQRLH..STL----RIRTLNPSLGFD
OR85C_DROME/62-369D----ASSSLSISA--Y.KQ---------N.WQN......ADIRYRRA--LVFFIARPQ..RTT----YLKATI......
OR85B_DROME/63-370D----ASYGFSVAT--Y.NQ---------K.WYK......ADVRYKRA--LVIIIARSQ..KVT----FLKATI......
OR42B_DROME/76-381E----DCESLTHAI--F.QS---------N.WVD......ASRRYKTT--LLYFLQNVQ..QPI----VFIAGG.IFQIS
OR47B_DROME/88-402T----QSVEVAQAA--F.DI---------NDWHT......KSPGIQRD--ISFVILRAQ..KPL----MYVAEP.FLPFT
OR63A_DROME/74-403T----ASEEIANAF--Y.QV---------R.WYG......ESREFRHL--IRMMLMRTN..RGF----RLDVSW.FMQMS
OR10A_DROME/70-396E----SSTGLCRAM--F.SC---------P.WQL......FKPKQRRL--VQLLILRSQ..RPV----SMAVPF..FSPS
OR83B_DROME/70-476E----ESSSVMEAA--Y.SC---------H.WYD......GSEEAKTF--VQIVCQQCQ..KAM----SISGAK.FFTVS
OR59C_DROME/79-385E----DSVHVSNAL--F.HS---------N.WIT......ADRSYKSA--VLYFLHRAQ..QPI----QFTAGS.IFPIS
OR9A_DROME/68-381S----ASLDFGNGL--Y.ET---------N.WTD......FSPPTKRA--LLIAAMRAQ..RPC----QMKGYF..FEAS
OR30A_DROME/58-366F----QSFDIAIAA--Y.ES---------N.WMD......FDVDTQKT--LKFLIMRSQ..KPL----AILVGG.TYPMN
OR47A_DROME/56-375T----ESASFEWAI--Y.DS---------P.WHESLGAGGASTSICRS--LLISMMRAH..RGF----RITGYF..FEAN
OR49B_DROME/52-364E----QNLAVATAA--Y.ET---------E.WFT......FDVPLRKN--ILFMMMRAQ..RPA----AILLGN.IRPIT
OR85F_DROME/68-381D----LSGEVAHAV--Y.NH---------D.FHD......ASIAYKRY--LLIIIIRAQ..QPV----ELNAMG.YLSIS
OR94B_DROME/66-372F----HANALTNSV--F.GT---------N.WLE......YSVGTRKL--LNCYMEFLK..RPV----KVRAGV.FFEIG
OR59B_DROME/77-382D----DAQDLSNEI--F.QS---------N.WVD......AEPRYKAT--LVLFMHHVQ..QPI----IFIAGG.IFPIS
OR56A_DROME/124-407E----CHDELSLAY--F.SC---------G.WYN......FEMPLQKM--LVFMMMHAQ..RPM----KMRALL..VDLN
OR85A_DROME/77-379S----DCESLTNTL--F.HS---------K.WIG......AERRYRTT--MLYFIHNVQ..QSI----LFTAGG.IFPIC
OR33B_DROME/61-369V----EMNQLTYAI--Y.SS---------N.WMS......MNRSYSRI--LLIFMQLTL..AEV----QIKAGG.MIGIG
OR46B_DROME/62-373V----QSSRLCHSI--Y.SS---------Q.WTG......WNRANRRI--VLLMMQRFN..SPM----LLSTFNPTFAFS
OR33A_DROME/60-367M----EFDKLPYAI--F.SS---------N.WLK......MDKRYNRS--LIILMQLTL..VPV----NIKAGG.IVGID
OR88A_DROME/73-392K----ASEGLESSL--R.SQ---------E.WYL......GSRRYRKF--YLLWTQYCQ..RTQ----QLGAFG.LIQVN
OR59A_DROME/64-386Y----WFGRLHYAA--F.SC---------N.WHT......QNRSFKRK--MMLFVEQSL..KKS----TAVAGG.MMRIH
OR7A_DROME/80-394L----DNERLALAI--F.QC---------Q.WLG......QSARFRKM--LLYYLHRAQ..QPI----TLTAMK.LFPIN

PF03268

Q9XVJ4_CAEEL/45-398E----HLATSTRILINHYEF-----------ECS------KDSTVYQT--YRLMVDRFQ-KVDT----RMYVVS-AIPIT
O16246_CAEEL/33-393Y----DLAQTARILMDSEEF-----------EGS------QDVEVFKA--YQVMINRSL-KHTA----HIRVVG-AIPIY
O45459_CAEEL/19-372E----AMLHTSTVLMNDQFI-----------HHS------KDPQIYSI--YRTMVDRSM-HNRS----VNVVIR-IFDVN
O16244_CAEEL/60-411E----HLKTTTRILINNDEF-----------ECS------KDPIVYQT--YRIMIDRFQ-KVNT----NISIIA-SLPIT
O16245_CAEEL/33-364F----QLADTARILMENEEF-----------GKT------KDSEVVNT--YHTMIDRSL-RHTA----RLRVHG-GIPIY
O18140_CAEEL/17-370E----AMLHTSTVLMDDQYV-----------HHS------KDPQIYTT--YRSMVDRSI-NNRT----VNLVVQ-IFSVN
O44618_CAEEL/25-384D----QIVATSKILMESEDF-----------ENA------ENQKVYQT--YRLMVDRSL-KSET----RIFVVN-AFGIN

PF06151

GR64A_DROME/1-455RRLLFGMAGTIVTYELVLLQFDEPNRRKGLQPLC
GR05A_DROME/40-438RKLFLAMAGTVATYELVLIQFHEDKKTWD....C
GR64D_DROME/1-416RRLIFAMAGALMGYELVLFRQMQGAVVQKSI..C
GR64C_DROME/1-407RRLIFAMAATLMVYELVLINQMAGSEVQKSF..C
GR61A_DROME/1-435RKSLFGMLATLVTYELMLLQIDAKSHKGLR...C
GR64F_DROME/63-463RKLVLSVAGTIVTYELVLIQFHEDNDLWD....C
GR64E_DROME/25-448RGVVISVAGTIVTYELILLQFNGEEKVPG....C
GR64B_DROME/1-403RSLVLAMGTTIITYELMISDVINQGSIRQKTQYC

PF08395

Q7PKI1_ANOGA/57-400YTLMFSMIATITSYLIMLVQFQLAE---------
Q7PKI2_ANOGA/11-404YTLMFSMIATITSYLIMLVQFQLAE---------
Q7PKG3_ANOGA/26-401WTLIFSILSTAATYIIILLQFESAG---------
GR93B_DROME/24-392NELTLFFLSAMVTYLVFLVQYGMQS---------
GR21A_DROME/81-445RELITTNISFMATYLVVLLQFKITE---------
Q7PK37_ANOGA/8-367NTVIYMVFSSIVTYLVILIQFKQLE---------
Q7PQ43_ANOGA/15-419FTFIFSVFSAATSYLIVLLQFDLSK---------
Q7PK29_ANOGA/12-374NTVIYMVFSSIVTYLVILIQFKQLE---------
Q7PF19_ANOGA/20-402LTLISKIVAGLTTYLMILIQFDSAF---------
Q7PKH1_ANOGA/14-409WTFLLSMISSFATYLNILVQFDIMQ---------
Q7PF39_ANOGA/19-415MKLISNAVAAITSIMVVLIQFSDTG---------
GR97A_DROME/41-418TSLVNKVFSSAIGSLLILIQSDLTL---------
GR22E_DROME/18-388YEMGFRMAITSFLYLLFLIQFDYWN---------
GR77A_DROME/37-447NAILFCIVGAILEYLMILIQFDKVL---------
GR36C_DROME/8-389RSNTMAMFGNLITHSIFLIQYDIEH---------
GR98C_DROME/14-394IKLFGGMLVTLCGYVIIIVQFKIQD---------
Q8MLS6_DROME/6-364RSMWFAMISSVLYYILVLLQFHLVM---------
Q7PKH4_ANOGA/15-393WKTIYNMFGFVVTYLIILLQFDKFS---------
Q7PKH2_ANOGA/13-388WPFLVSVAATLVMHVVILVQFDLSI---------
Q7PVJ7_ANOGA/11-395YTVLFSIAAAVTNYLIILIQFEMAI---------
Q7PK40_ANOGA/8-372YAMIHMVLSSIFTYLVILVQFDQLQ---------
Q8MMI1_HELVI/3-387KTILLQMAGAIVTYELVLIQFDDQG---------
GR85A_DROME/27-394RSLAFRSASLILVHVLYMVQSDYIS---------
Q7PVK1_ANOGA/8-381YTVLFSIAAAVTNYLIILIQFEMAI---------
Q7PK39_ANOGA/8-367NTVIYMVFSSIVTYLVILIQFKQLE---------
GR22C_DROME/17-382YKMGFQMIITSFLYLIYMIQFDFMN---------
G39AA_DROME/8-363KSTLFKLFTAIFTYMVILVQFKEME---------
GR59D_DROME/9-389RGTSFAVFNSLLTHSLLLIQYDVQN---------
GR92A_DROME/18-383QMQYLQFLSALLSGLAFIAQYRMQV---------
GR08A_DROME/9-380CSLLTRMACSVGTYMIYSIQFIPKF---------
Q7PVJ8_ANOGA/8-380YTVLFSIAAAVTNYLIILIQFEMAI---------
Q7PK13_ANOGA/41-414YSLLKMFGTGITTYMIIFITFSKDI---------
GR22B_DROME/17-385CRMGFKMIITTFLYLVYLVQFDYMN---------
GR63A_DROME/100-456RTLFKGLLTTMVTYLVVLLQFQISI---------
GR94A_DROME/17-399MRLISNVFSAVASFLLILVQADLSQ---------
Q7PKI5_ANOGA/30-402RALLFGTIATVTSYVIILVQFHMQQ---------
GR36A_DROME/9-390RSSSAAMIGSIITNSIFLIQYDMEY---------
Q7PF38_ANOGA/19-415MKLISNAVAAITSIMVVLIQFSDTG---------
Q7PKH9_ANOGA/7-400MAFVFSLATTVNMYLIVLVQFQLNI---------
GR93C_DROME/18-394NEVILLFLSSMITYFTYVVQYGIQT---------
Q7PJT3_ANOGA/18-425FSLIFTLVGAATTYLVILIQYELSM---------
GR68A_DROME/7-379NSTLFKIFSAVTTYLVILIQFKQLE---------
GR09A_DROME/6-339LQTLAGMFFFILEALVIFLQFVSLV---------
Q7PQT4_ANOGA/106-466RELLTSSIATIAIYLIVLLQFKLSL---------
Q7PK18_ANOGA/61-428FSPILTIIFSVGAYISIFIQQAINQ---------
GR32A_DROME/57-449NSTLFKIFSAVTTYLVILIQFKQLE---------
GR22A_DROME/19-388YEMGFRMIITNILYVVFLVQFDYMN---------
GR22_ANOGA/73-437RGLITSNISFMATYLVVLMQFKLTL---------
Q7PF20_ANOGA/20-415MTLISTMVGALTTYLVILIQFDTAI---------
GR58A_DROME/3-389KQTSLAYFFYVLVQVLVLVQFDLKN---------
GR10A_DROME/19-404RRLVYLIAVTAFSYFITLVQFDLYL---------
G39AC_DROME/9-372KSTLFKLFTAIFTYMVILVQFKEME---------
O18280_CAEEL/46-428RKIMISLFSAIFTYFLILVQFDAEK---------
Q7PVJ9_ANOGA/29-402YTVLFSIAAAVTNYLIILIQFEMAI---------
Q7PK41_ANOGA/8-377NKLVCTALTSMITYLVILIQFRKYD---------
Q7PK36_ANOGA/8-375NTVIYMVFSSIVTYLVILIQFKQLE---------
GR58B_DROME/10-387KPACLSYIGSILSNVIILMQFDLRR---------
GR59C_DROME/9-394RGRLIAMLSSVITHTMVLVQWEIQN---------
Q7PTR1_ANOGA/7-389KKTMLTMLGAVITYELVMLHFAQTT---------
LITE1_CAEEL/48-425RSILLSLFSAILTYFLILWEFDIKN---------
GR10B_DROME/11-372MRCAFALISCSLSYGIIIIQIGYIP---------
Q7PI94_ANOGA/14-414CNMLCGMIGAITTYLVIYIQFYILY---------
G39AD_DROME/8-362KSTLFKLFTAIFTYMVILVQFKEME---------
GR36B_DROME/9-390RGSTAAMCASVIVNSIFLIQFDMEF---------
Q7PK17_ANOGA/41-408LSSLTTIFGSITSYLVIYINFIPKT---------
GR48C_DROME/7-410NLTVHNMTRSIITNVLVLCQIAYKK---------
G39AB_DROME/8-372KSTLFKLFTAIFTYMVILVQFKEME---------
GR98A_DROME/13-370TEMLGKFFFGMISYIVICIQFSINF---------
GR98D_DROME/12-392LKFFGGMVVTLFGYIIILVQFKIQF---------
GR22F_DROME/19-377HNMGFQMIITSFLYLVYLLQFDFMN---------
Q9W1V0_DROME/5-363KRKWLQMVGSIVVHSSMLFQFHLVM---------
GR89A_DROME/10-356NSFWLFLVSYAMNFIVVILQTSFEH---------
Q7PF36_ANOGA/19-401MQLVPNVIAVITSILFILMQFSDAD---------
GR22D_DROME/17-386REMGFKMFVASVLYLLYLVQFDYMN---------
GR98B_DROME/12-392LKYFGGLLVTIFGYIIILIQFKVQA---------
GR59E_DROME/7-383TRSLGGFIGVLMAIVIFLIQIGLGN---------
GR28B_DROME/45-447RTLYFTISGALTTYLIILLQFTSNS---------
Q8IN22_DROME/11-375NELFLIIVSAMFCYLVFVTQCVIVY---------

PF02949

OR22B_DROME/79-381MQTNLNMVKLAF----------------------
OR24A_DROME/68-388LETLTSILRFTG----------------------
OR23A_DROME/59-365LSTYVACWKGAY----------------------
OR85D_DROME/84-400LVTVSDLLQLSY----------------------
OR45B_DROME/68-386LPVFTSVIKFTG----------------------
OR43A_DROME/56-364LAMFQSLLNASY----------------------
OR98A_DROME/74-379TGSNIKVAKLAF----------------------
OR94A_DROME/69-376LPIFVKTINNAY----------------------
OR22C_DROME/69-392LPALRSILSTAG----------------------
OR2A_DROME/66-387LETFEQVMRFTY----------------------
OR45A_DROME/64-362LPLL.....LWV----------------------
OR33C_DROME/60-372LNAFFATLKMAY----------------------
OR46A_DROME/62-365LMLF.....SSI----------------------
OR85C_DROME/62-369...FMNITRATM----------------------
OR85B_DROME/63-370...FLDITRSTM----------------------
OR42B_DROME/76-381MSSNISVAKFAF----------------------
OR47B_DROME/88-402LGTYMLVLKNCY----------------------
OR63A_DROME/74-403LPTL.....MAM----------------------
OR10A_DROME/70-396LATFAAILQTSG----------------------
OR83B_DROME/70-476LDLFASVLGAVV----------------------
OR59C_DROME/79-385VQSNIAVAKFAF----------------------
OR9A_DROME/68-381MATFSTIVRSAV----------------------
OR30A_DROME/58-366LKMLQSLLNAIY----------------------
OR47A_DROME/56-375MEAFSSIVRTAM----------------------
OR49B_DROME/52-364LELFQNLLNTTY----------------------
OR85F_DROME/68-381LDTFKQLMSVSY----------------------
OR94B_DROME/66-372LPIFVKTINNAY----------------------
OR59B_DROME/77-382MNSNITVAKFAF----------------------
OR56A_DROME/124-407LRTFIDIGRGAY----------------------
OR85A_DROME/77-379LNTNIKMAKFAF----------------------
OR33B_DROME/61-369MNAFFATVRLAY----------------------
OR46B_DROME/62-373LEAFGSIVNCSY----------------------
OR33A_DROME/60-367MSAFFATVRMAY----------------------
OR88A_DROME/73-392MVHFTEIMQLAY----------------------
OR59A_DROME/64-386LDTFFSTLKGAY----------------------
OR7A_DROME/80-394LATYFSIAKFSF----------------------

PF03268

Q9XVJ4_CAEEL/45-398RSTFAAASFIVPNMG-------------------
O16246_CAEEL/33-393PTSAHFAFLLIPNLG-------------------
O45459_CAEEL/19-372RKNIERAYFIISNIV-------------------
O16244_CAEEL/60-411VQTFAACSFVAPNLG-------------------
O16245_CAEEL/33-364PKTVNIAMFFIPMIV-------------------
O18140_CAEEL/17-370RKNIERAYFVITNIV-------------------
O44618_CAEEL/25-384SNNLNIAMFVIPNLG-------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window