Sequence alignment for CL0176

PF06151

GR64A_DROME/1-455MKGPNLNFRKTPSKDNGVKQVESLARPETPPPKFVEDSNLEFNVLASEKLPNYTNLDLFHRAVFPFMFLAQC-VA--IMP
GR05A_DROME/40-438VRGT....RK.........................................NFLHDGSFHEAVAPVLAVAQC-FC--LMP
GR64D_DROME/1-416MLRSHLSVHG.....................................LQMERSVQENTLHYTIGHVLIIARI-FG--VLP
GR64C_DROME/1-407MQQSGQKGTR..............................................NTLQHAIGPVLVIAQF-FG--VLP
GR61A_DROME/1-435MSRTSDDIRK...............HLKVRRQKQ..RAILAMRWRCAQGGLEFEQLDTFYGAIRPYLCVAQF-FG--IMP
GR64F_DROME/63-463LSRS....DK........................................EAFLSDGSFHQAVGRVLLVAEF-FA--MMP
GR64E_DROME/25-448.RVGSEVVEK...................DTKRF..KLSLIKAWLLRIRQEDYKYSGSFQEAIKPVLIIAQI-FA--LMP
GR64B_DROME/1-403MPQG....................................................ETFHRAVSNVLFISQI-YG--LLP

PF08395

Q7PKI1_ANOGA/57-400--------------------------------------------------------------TKAVLVLIKC.FG..QLY
Q7PKI2_ANOGA/11-404--------------------------------------------------------------LRLHFHTAQC.IG..FVP
Q7PKG3_ANOGA/26-401--------------------------------------------------------------VPLHYLVLKM.SG..MGC
GR93B_DROME/24-392--------------------------------------------------------------LRSCFLYGTF.FG..VIT
GR21A_DROME/81-445--------------------------------------------------------------TKSLLVLFQI.MG..VMP
Q7PK37_ANOGA/8-367--------------------------------------------------------------HSRIFQISRL.LY..FTP
Q7PQ43_ANOGA/15-419--------------------------------------------------------------LIAVFSFIQI.IGLQLHD
Q7PK29_ANOGA/12-374--------------------------------------------------------------FKIMSSVYYLPVA.....
Q7PF19_ANOGA/20-402--------------------------------------------------------------LYRLLTVGQV.FG..LVA
Q7PKH1_ANOGA/14-409--------------------------------------------------------------LRILYYIAKT.FG..LIS
Q7PF39_ANOGA/19-415--------------------------------------------------------------ISPTVRLSQC.LS..LAP
GR97A_DROME/41-418--------------------------------------------------------------VFLNILYGVY.LG.....
GR22E_DROME/18-388--------------------------------------------------------------LKGALYGSWI.LG..VFP
GR77A_DROME/37-447--------------------------------------------------------------LGILYSLTRV.FG..LMA
GR36C_DROME/8-389--------------------------------------------------------------LGAVYYYGLF.IGLSNFE
GR98C_DROME/14-394--------------------------------------------------------------ARPYLQVLSL.FG..LTP
Q8MLS6_DROME/6-364--------------------------------------------------------------IKLYFRYSLA.IG..ITS
Q7PKH4_ANOGA/15-393--------------------------------------------------------------LRPLLAFSKY.FG..LTA
Q7PKH2_ANOGA/13-388--------------------------------------------------------------VRPVYRAGKL.IG..IFT
Q7PVJ7_ANOGA/11-395--------------------------------------------------------------LLFSTTIATL.LGYLTIT
Q7PK40_ANOGA/8-372--------------------------------------------------------------HARIFQAAAL.FY..LVP
GR85A_DROME/27-394--------------------------------------------------------------QRSLGYFCAL.NG..ILD
Q7PVK1_ANOGA/8-381--------------------------------------------------------------SRLLHLKTVL.LG..VVP
GR22C_DROME/17-382--------------------------------------------------------------LKATLYSSWF.LG..VFP
G39AA_DROME/8-363--------------------------------------------------------------LLFFLHYQRY.LG..LTN
GR59D_DROME/9-389--------------------------------------------------------------LRIAYAYGRL.TG..VIN
GR92A_DROME/18-383--------------------------------------------------------------LRYIFRYAQF.IGVIFFC
GR08A_DROME/9-380--------------------------------------------------------------LQFHLRLYQV.LGFHGLP
Q7PVJ8_ANOGA/8-380--------------------------------------------------------------GKVLYVKSIL.VG..VIP
Q7PK13_ANOGA/41-414--------------------------------------------------------------LSVAFGIFKC.FG..FIP
GR22B_DROME/17-385--------------------------------------------------------------LKTTLYGSWL.LG..IFP
GR63A_DROME/100-456--------------------------------------------------------------IDPINWFLRI.IG..VLP
GR94A_DROME/17-399--------------------------------------------------------------TIILIGFMTV.FG..LLA
Q7PKI5_ANOGA/30-402--------------------------------------------------------------ERCVWSFLLA.CG..TFP
GR36A_DROME/9-390--------------------------------------------------------------LKVLYYYGQI.IG..LIN
Q7PF38_ANOGA/19-415--------------------------------------------------------------FNLLLNIAQL.AG..FLP
Q7PKH9_ANOGA/7-400--------------------------------------------------------------LRALYYFHSI.LG..LVP
GR93C_DROME/18-394--------------------------------------------------------------LFCSCHYGRI.LG..VIC
Q7PJT3_ANOGA/18-425--------------------------------------------------------------QRPVLRVSFL.VG..MTP
GR68A_DROME/7-379--------------------------------------------------------------IYPISKPSQI.FA..ILP
GR09A_DROME/6-339--------------------------------------------------------------EHFLTGYFQL.CG..LVC
Q7PQT4_ANOGA/106-466--------------------------------------------------------------HKLLLVLFRG.LA..VMP
Q7PK18_ANOGA/61-428--------------------------------------------------------------LSGYVRFHQW.LG..FQP
GR32A_DROME/57-449--------------------------------------------------------------IRTILSVLKA.SG..LMP
GR22A_DROME/19-388--------------------------------------------------------------IRATLYGSWV.LG..LFP
GR22_ANOGA/73-437--------------------------------------------------------------TKSLLVLFQI.MG..VMP
Q7PF20_ANOGA/20-415--------------------------------------------------------------AHRLLRVCQV.FG..TVP
GR58A_DROME/3-389--------------------------------------------------------------LKFMYIYGIG.CG..LMP
GR10A_DROME/19-404--------------------------------------------------------------YRYGHVYALI.YGQVVID
G39AC_DROME/9-372--------------------------------------------------------------LRVQLRTLKW.LG..VLR
O18280_CAEEL/46-428--------------------------------------------------------------LGPLYSYMMV.LG..LNH
Q7PVJ9_ANOGA/29-402--------------------------------------------------------------ARLLHLKMVA.LG..VVP
Q7PK41_ANOGA/8-377--------------------------------------------------------------LRVLFFVSNV.LY..LVP
Q7PK36_ANOGA/8-375--------------------------------------------------------------YRLLLAVASI.GY..LIP
GR58B_DROME/10-387--------------------------------------------------------------MNVVYYHSVV.FA..LMS
GR59C_DROME/9-394--------------------------------------------------------------LLIAYWYGLA.VG..VSN
Q7PTR1_ANOGA/7-389--------------------------------------------------------------IRPILVIFLL.FG..QFP
LITE1_CAEEL/48-425--------------------------------------------------------------LYPIYYLLLI.LG..LNQ
GR10B_DROME/11-372--------------------------------------------------------------LRFWMGLILV.LGFSSHY
Q7PI94_ANOGA/14-414--------------------------------------------------------------VEMNVKFYRL.LG..LAP
G39AD_DROME/8-362--------------------------------------------------------------LRIYLRLLHI.MG..MMC
GR36B_DROME/9-390--------------------------------------------------------------LKAVHIYCYL.IG..LSN
Q7PK17_ANOGA/41-408--------------------------------------------------------------FGSIYPLFQL.LG..FTP
GR58C_DROME/7-410--------------------------------------------------------------LHTYFQVSRL.IG..LCN
G39AB_DROME/8-372--------------------------------------------------------------LCAYYRLCRY.LG..IFC
GR98A_DROME/13-370--------------------------------------------------------------LLYMRRLMKC.LG..MLP
GR98D_DROME/12-392--------------------------------------------------------------ARPYIQIYSI.FG..LTP
GR22F_DROME/19-377--------------------------------------------------------------LQTTLYASWL.LG..LFP
Q9W1V0_DROME/5-363--------------------------------------------------------------GQAYNVYAVF.IG..MTS
GR89A_DROME/10-356--------------------------------------------------------------LCLLLKYWQI.LA..LAP
Q7PF36_ANOGA/19-401--------------------------------------------------------------FRPLLNVAQC.FG..FLP
GR22D_DROME/17-386--------------------------------------------------------------LKSILYSSWL.LG..IFP
GR98B_DROME/12-392--------------------------------------------------------------AFPYLDIFSV.FA..LTP
GR59E_DROME/7-383--------------------------------------------------------------ENLLLTINRF.LG..VYP
GR28B_DROME/45-447--------------------------------------------------------------LRPVFHVTYI.HG..LTS
Q8IN22_DROME/11-375--------------------------------------------------------------LRFMSFYARF.LS..LVC

PF02949

OR22B_DROME/79-381--------------------------------------------------------------SAGEFLSSIQIGV-----
OR24A_DROME/68-388--------------------------------------------------------------NIATALDALCPVA-----
OR23A_DROME/59-365--------------------------------------------------------------DPVENNFSLSLTV-----
OR85D_DROME/84-400--------------------------------------------------------------NFLEATMNLSFIG-----
OR45B_DROME/68-386--------------------------------------------------------------SPVDAMDAFCPLA-----
OR43A_DROME/56-364--------------------------------------------------------------DLPAFILNMFFFS-----
OR98A_DROME/74-379--------------------------------------------------------------TPNELLTVMQLFF-----
OR94A_DROME/69-376--------------------------------------------------------------NLEQAGQVLYMSI-----
OR22C_DROME/69-392--------------------------------------------------------------NLVVALEAFCPGT-----
OR2A_DROME/66-387--------------------------------------------------------------NMAGLCENLTITI-----
OR45A_DROME/64-362--------------------------------------------------------------NFAVFMQGSQST.-----
OR33C_DROME/60-372--------------------------------------------------------------STAEFFKNLTMSL-----
OR46A_DROME/62-365--------------------------------------------------------------YMSEVVKAIFILA-----
OR85C_DROME/62-369--------------------------------------------------------------KFIDAVTVLSYIG-----
OR85B_DROME/63-370--------------------------------------------------------------KFLEAVTALSYIG-----
OR42B_DROME/76-381--------------------------------------------------------------SPGEFLTSLQVCI-----
OR47B_DROME/88-402--------------------------------------------------------------NVIEMGDDLVWIS-----
OR63A_DROME/74-403--------------------------------------------------------------IGETAGTALQFL.-----
OR10A_DROME/70-396--------------------------------------------------------------QITLALETLCPAG-----
OR83B_DROME/70-476--------------------------------------------------------------EVNELSGNTITTL-----
OR59C_DROME/79-385--------------------------------------------------------------TPTEFLTSLQVDI-----
OR9A_DROME/68-381--------------------------------------------------------------QVSLLSDTLGSTF-----
OR30A_DROME/58-366--------------------------------------------------------------SLDFIIRNVYLAV-----
OR47A_DROME/56-375--------------------------------------------------------------NVLLLADAMVALL-----
OR49B_DROME/52-364--------------------------------------------------------------GLTGIIRNSYMLV-----
OR85F_DROME/68-381--------------------------------------------------------------DNVSLIMRYATLV-----
OR94B_DROME/66-372--------------------------------------------------------------DFEEAGQVLYMSI-----
OR59B_DROME/77-382--------------------------------------------------------------TPGEFLTSLQVCI-----
OR56A_DROME/124-407--------------------------------------------------------------EM.ELLVATQAYT-----
OR85A_DROME/77-379--------------------------------------------------------------TTTDLFTYVQVPV-----
OR33B_DROME/61-369--------------------------------------------------------------SLGDVCKGLPITA-----
OR46B_DROME/62-373--------------------------------------------------------------QVREILKVFFMFA-----
OR33A_DROME/60-367--------------------------------------------------------------QI.QVFRSLHFTS-----
OR88A_DROME/73-392--------------------------------------------------------------LGHPANQNPPVLS-----
OR59A_DROME/64-386--------------------------------------------------------------TITEDILNLTTFA-----
OR7A_DROME/80-394--------------------------------------------------------------EITQVLTSAQVAI-----

PF03268

G5EG25_CAEEL/32-391--------------------------------------------------------------LLGPFEPLVRFSGLDCHK
A8X6W9_CAEBR/10-368--------------------------------------------------------------LLGCYKYTVKLTGLDCTP
G0N357_CAEBE/15-367--------------------------------------------------------------IFGFYRYVWKLSPYNCGK
H2W3U0_CAEJA/53-412--------------------------------------------------------------LFGPFRTILRITGLDCTA
O16244_CAEEL/60-411--------------------------------------------------------------LLGPFRFLVKASLLDCST
G0N363_CAEBE/25-374--------------------------------------------------------------IFGFFHVFHKFSHFSLHS
O18140_CAEEL/17-370--------------------------------------------------------------IFGFFRYLLRVSPYNCSR
E3LNY7_CAERE/33-393--------------------------------------------------------------LLGPFRKIIKVTGLDCSL
G0MS85_CAEBE/20-379--------------------------------------------------------------LLGYHKCTIKLTGLDCSP
G0MS87_CAEBE/33-393--------------------------------------------------------------FLGPYRLIIKLSGLDCSV
H2WA63_CAEJA/32-391--------------------------------------------------------------LLGPFEPVLKFSGFDCHK
E3LNY5_CAERE/55-405--------------------------------------------------------------LLGPFHFLMKFTLLDCSM
A8X6X0_CAEBR/35-395--------------------------------------------------------------LVGPFRKTIKITGLDCRV
G0MS88_CAEBE/61-413--------------------------------------------------------------LLGPFNYFVKLTLLDCSA
H2W0A5_CAEJA/25-383--------------------------------------------------------------LLGIFRHTAKLTGLDCTA
O45459_CAEEL/19-372--------------------------------------------------------------IFGVYPYLLKFSPFNCEK
O16246_CAEEL/33-393--------------------------------------------------------------LLGPFRKIIKITGLDCSL
G0N991_CAEBE/33-392--------------------------------------------------------------LLGPFESLIRFSGLDCHK
A8X6X1_CAEBR/32-394--------------------------------------------------------------FLGPLGFLVPFTGLDCSV
E3LNY3_CAERE/17-368--------------------------------------------------------------LLGPFRFLVKFTLLDCSA
E3LNY6_CAERE/32-392--------------------------------------------------------------FLGPLSFFIRFTGLDCSI
O44618_CAEEL/25-384--------------------------------------------------------------LLGFLKYTTKLTGLDCTA
Q8IFZ2_CAEEL/17-368--------------------------------------------------------------LLGPFRYLVKLSLLDCSA
E3MHA0_CAERE/16-369--------------------------------------------------------------IFGAFRYLWKFSPYNCQK
G0MS86_CAEBE/36-396--------------------------------------------------------------LLGPFRKIIRVTGLDCTV
G0PNV7_CAEBE/53-404--------------------------------------------------------------LMGPFRFLVKFTLLDCSS
Q9XVJ4_CAEEL/45-398--------------------------------------------------------------LLGPFRFLIKLTLLDCST
H2WBG2_CAEJA/242-592--------------------------------------------------------------VFGTFQKLQKFSPFNCGA

PF06151

GR64A_DROME/1-455L---VGIRES.NPRRVRFAYKSIPMFVTLIFMIATSILFLSMFT-------------HLLK-IGITAKNFVGLVFFGCVL
GR05A_DROME/40-438V---CGISAP.TYRGLSFNRRSWRFWYSSLYLCSTSVDLAFSIR-------------RVAH-SVLDVRSVEPIVFHVSIL
GR64D_DROME/1-416L---AGINPNGKPENVRFRWFSPYILFFVVAFTFVIADFMLSTK-------------IVLN-DGLQLYTMGSLSFSVICI
GR64C_DROME/1-407V---AGVWPSCRPERVRFRWISLSLLAALILFVFSIVDCALSSK-------------VVFD-HGLKIYTIGSLSFSVICI
GR61A_DROME/1-435L---SNIRSR.DPQDVKFKVRSIGLAVTGLFLLLGGMKTLVGAN-------------ILFT-EGLNAKNIVGLVFLIVGM
GR64F_DROME/63-463V---KGVTGK.HPSDLSFSWRNIRTCFSLLFIASSLANFGLSLF-------------KVLN-NPISFNSIKPIIFRGSVL
GR64E_DROME/25-448V---RKVSSK.FAEDLTFTWFSVRSYYALVTILFFGVSSGYMVA-------------FVTS-VSFNFDSVETLVFYLSIF
GR64B_DROME/1-403V---SNVRAL.DVADIRFRWCSPRILYSLLIGILNLSEFGAVIN-------------YVIK-VTINFHTSSTLSLYIVCL

PF08395

Q7PKI1_ANOGA/57-400G........ILPLASNAFTFERSRPVLWYSRTIALLLMVIYPCA...YIVLLTDHEFPILA-LSYYIIMLQFTLNYIIVG
Q7PKI2_ANOGA/11-404L........HFNKQLQTFQI.SRWLTVWSHALALTLLCVYPYVY....VILLTGIRYPKLT-LVNYLVWMQCSLHYVNLA
Q7PKG3_ANOGA/26-401I...........TPRAGVRNGSTMTTLIDIGLFVTNLILAVTMM...IYGMFITQRHMQSP-IMFIGLKMVNFTCYASTI
GR93B_DROME/24-392F........RIERKDSQLVAINRRGYLWICLVIRLLASCFYGYS...YDAWSGQYE...DM-YLRAFFGFRLIGCLICSV
GR21A_DROME/81-445IHR...NPPEKNLPRTGYSW.GSKQVMWAIFIYSCQTTIVVLVL...RERVKKFVTSPDKR-FDEAIYNVIFISLLFTNF
Q7PK37_ANOGA/8-367C........SYNEELGRFEA..TKRNLAFLGAALVLTIPFWVYD...IHLMATNFLHTYTT-VFAAVGGIELLIYVSVVM
Q7PQ43_ANOGA/15-419SY.....ETETNGKTPSLSIVRILYSIILFGAYLVGLYKAVELT......FVVEFAANSPS-IFKFAYMTQIYSGVLATI
Q7PK29_ANOGA/12-374.........YDAVEHRFIEK.RSNLIPFAIGLLLSIGFIYHDFF...IVLPNFNT..DQSA-FTLAVFIVELTVFATVPI
Q7PF19_ANOGA/20-402WDL...QPLEPDRPTTKLHW.FRKLIRATNQGYCFMIIVAIGTA...TVLHHSSNTANAFF-AIRTLYLTENVIVNVIVL
Q7PKH1_ANOGA/14-409F........TTTFDTVGIRR.SFKDVLVFVGFMFFNCYIVFKTG...IPPKSDSPSYFDSS-LIQFILGLFLTLQLIALI
Q7PF39_ANOGA/19-415YPLS.VFQRNCSTRSVRIRIIICFRYAFATCVTVAVVASQFTMF...YYFPHIMYQPKVPI-FIVILYYIVSILQTLTTG
GR97A_DROME/41-418.........RFSFRRKKFVFSKGLTIYSLFVATFFALFYIWNIY.........NEISTGQI-NLRDTIGIYCYMNVCVCL
GR22E_DROME/18-388FA.....YDSWTRTLRRSKW..LIAYGFVLNAAFILLVVTNDTE...SETPLRMEVFHRNA-LAEQINGIHDIQSLSMVS
GR77A_DROME/37-447TANW..SPRGIKRVRQSLYL.RIHGCVMLIFVGCFSPFAFWCIF.......QRMAFLRQNR-ILLMIGFNRYVLLLVCAF
GR36C_DROME/8-389F........DWNTGRVFTKK.WSTLYAIALDSCIFALYIYHWTG...NTNIVNAIFGRANM-LHEYVVAILTGLRIVTGL
GR98C_DROME/14-394PAE...FFTRTLRKRRRFCW.MAGYSLYLIAILLMVFYEFHANI...VSLHLEIYKFHVED-FSKVMGRTQKFLIVAIAT
Q8MLS6_DROME/6-364Q........QFSNRKFFSTL.FSRTYALIANIVTLIMLPIVMWQ....VQLVFQQKKTFPK-LILITNNVREAVSFLVIL
Q7PKH4_ANOGA/15-393F........SIVGEPPYVQV.KVTGVEYVALLMNFVANLYCVYI...NVTNNRLSRWTGSA-VMNLGLGFLFPLGAIVMI
Q7PKH2_ANOGA/13-388H........TIDFERQVLST.NTRDQVLLVVAILMDVYALTVST.......RVSYSFSNSI-LLNVGIYCSVNLGIIISL
Q7PVJ7_ANOGA/11-395Y........DRKRQELRVST.VLVVYSIVLAILCTFTYQSAQFL...SSDMRYRNGIKESA-VNKAIGAIQGQVVLQTFL
Q7PK40_ANOGA/8-372C........SYNTETDQFEQ..RTVNKLAFAVGIGMTVPFWYFD...LKFMIAFYLENISP-IMVAVGSIEIAVYVSIVS
GR85A_DROME/27-394F........NTDIGTGNLRR.YRVLFMYRLLHNFAVISLTLKFL...FDFTDHFKYIESST-LITVNFFTYFTLVFFALL
Q7PVK1_ANOGA/8-381F........HFHRSTLTLELRRELLLYCCAIVILGPTGRFYIYL...TTFLRMHGKFIVAF-YSALFIELSDVVLLIVPP
GR22C_DROME/17-382Y........RFDSRNGQLKR.SRFLLFYGLILNFFLLLKMVCSG...GQKLGIPEAFARNS-VLENTHYTTGMLAVFSCV
G39AA_DROME/8-363L.........DFSKSLHIYWLHGTWSSTAIQIVVVGVFMAALLG...ALAESLYYMETKSQ-TGNTFDNAVILTTSVTQL
GR59D_DROME/9-389F........KIDLKTGQALVTRGATLISVSTHLLIFALLLYQTM...RKSVVNVMWKYANS-LHEYVFLVIAGFRVVCVF
GR92A_DROME/18-383LHTR..KDDKTVFIRNWLKW.LNVTHRIITFTRFFWVYIASISI.............KTNR-VLQVLHGMRLVLSIPNVA
GR08A_DROME/9-380L........PGDGNPARTRR.RLMAWSLFLLISLSALVLACLFS.......GEEFLYRGDM-FGCANDALKYVFAELGVL
Q7PVJ8_ANOGA/8-380L............RLPRSSWELLILCYCYTIAIAGPLVHFLLYL...AWFVIVMVKFRVTF-VVSICMHLGEVPFLIFPP
Q7PK13_ANOGA/41-414F........PFDCCTFALTPCSNVRSLLHLPILQVSFYLTLFCI...IMSNRVNFFFTGLQ-ILSLNDIIKYGTLTLSVF
GR22B_DROME/17-385FT......LDSGKRIRQLRRSRCLTLYGLVLNYFLIFTLIRLAF...EYRKHKLEAFKRNP-VLEMINVVIGIINVLSAL
GR63A_DROME/100-456I.........VRHGPARAKFEMNSASFIYSVVFFVLLACYVGYV...ANNRIHIVRSLSGP-FEEAVIAYLFLVNILPIM
GR94A_DROME/17-399N.......RYRAGRRERFRFSKANLAFASLWAIAFSLVYGRQIY.........KEYQEGQI-NLKDATTLYSYMNITVAV
Q7PKI5_ANOGA/30-402L........RFDAVGPGRFF.TSRKCALYCSGITVVYAVLSPAL...MYLIYEHERVANVY-LVSMLNAAQLSFIYLFMI
GR36A_DROME/9-390F........EIDWQRGRVVAAQRGILFAIAINVLICMVLLLQIS...KKFNLDVYFGRANQ-LHQYVIIVMVSLRMASGI
Q7PF38_ANOGA/19-415FPAY.VLRQDVERLHFRTLVLTCLNLTFAVLIFLTSFVCYLAMY...IYYPDLMYKENLPA-VLQIMYHVENWLRVVMVL
Q7PKH9_ANOGA/7-400YELN..NQNGLRRSKCKRQWTLTIGCTTVVLVGFSFCTVWLQDT...LSFATFVD....AL-LIRSLVLVEFTIRYGTVV
GR93C_DROME/18-394FDIG..QRTSDDSLVVRNRHQFKWFCLSCRLISVTAVCCFCAPY..........VADIEDP-YERLLQCFRLSASLICGI
Q7PJT3_ANOGA/18-425F........TVVKGPTELMMLRCTPFGYINSSVHVILFCSCYVNA.LLQGDTITRFFFRTD-ISTLGDVLQFTIGITALF
GR68A_DROME/7-379FYSG..DVDDGFRFGGLGRW.YGRLVALIILIGSLTLGEDVLF....ASKEYRLVASAQGD-TEEINRTIETLLCIISYT
GR09A_DROME/6-339G..............WSGSR.LGRLLSSTFLVLILIELVGEIET...YFTEENPDNESVPA-YFAKVIMGVNMAYKMIHA
Q7PQT4_ANOGA/106-466I.......TRSVPGRITFSW.RSAASIYAFCFYLVSTVIVLVVG.....YERIKVFQTTTK-FDEYIYGILFVIFLVPHF
Q7PK18_ANOGA/61-428Y...............RLAS.GRVSPFAVLTLAQFLGVLVNLAL...IIYRRRCILYHCEA-IGMVVDFIKLLTIGLSIL
GR32A_DROME/57-449IY.....EQVSDYEVGPPTKTNEFYSFFVRGVVHALTIFNVYSL...FTPISAQLFFSYRE-TDNVNQWIELLLCILTYT
GR22A_DROME/19-388F........TFDSRKRRLNR.SKWLLAYGLVLNLTLLVLSMLPST.DDHNSVKVEVFQRNP-LVKQVEELVEVISLITTL
GR22_ANOGA/73-437IMR...SPKGVDMPRTTFTW.CSKAFLWAYFIYACETVIVLVVA...RERINKFISTSDKR-FDEVIYNIIFMSIMVPHF
Q7PF20_ANOGA/20-415WEV....TLFAHVTQPLSSW.RERLFRTLNALYSLALGLAVLSA...TVLQHAEFDHHMPF-VTHMLYISEYSMENGVVM
GR58A_DROME/3-389A........PLKKGQFLLGYKQRWYLIYTACLHGGLLTVLPFTF...PHYMYDDSYMSSNP-VLKWTFNLTNITRIMAMF
GR10A_DROME/19-404Y........VPQRALKRGVKVLLIAYGHLFSMLLIVVLPGYFCY...HFRTLTDTLDRRLQ-LLFYVSFTNTAIKYATVI
G39AC_DROME/9-372FTID..FNKCLVRENASEER.SAWLYLIGVVGITCSLIVYSTYF...PSHFIMGKH...NT-TGNCYALINIRSCSIVTM
O18280_CAEEL/46-428T........HSSARNTMFKW.PLTIYNYLTLAILTAATIRRISQ...IKQKSATNEEKDAA-FHVLNPTFVLTLCHALLM
Q7PVJ9_ANOGA/29-402Y........EFHPATLSLQFRRSLLLYCFIIAIIGPMGRCWVYL......TTFFTMNFGVS-VAHYTAMFMELLDAILLV
Q7PK41_ANOGA/8-377C........RYCRKENKFKV.NPYLSLLAFGINISLASVHLCFD...WLQIWNGERRDASR-IFNFLQMLHTLTLPVTIV
Q7PK36_ANOGA/8-375C........SYNIRTGLFDCSYRNTLVCVCNVVFFGGFVWYDFG......MILKFYATLPI-VLVGILTVDVTVYNLLIF
GR58B_DROME/10-387TTL....RIRSCRKCLRLEK.VSRTYTIYSFFVGIFLFLNLYFM...VPRIMEDGYMKYNI-VLQWNFFVMLFLRAIAVV
GR59C_DROME/9-394FEVD..WLTGEAIATRRTTI.YAAVHNASLITLLILFNLGNNSL...KSEFISA.....RY-LHEYFFMLMTAVRISAVL
Q7PTR1_ANOGA/7-389L........YGVLTRKPLRWHFRWCSLQTVLSLGLIHVGLFLCF...VEYDRL......KA-IGVNADNLIGPLFYLDVI
LITE1_CAEEL/48-425SI.....RPNNSLLFRIYSW.LVFCLLLFTTLRKFNQVGVRPNG...TRENLQEFFANPRS-MITLCNALIMLSGLLASL
GR10B_DROME/11-372Y........NPTRRRLVYSR.ILQTYDWLLMVINLGAFYLYYRY...AMTYFLEGMFRRQG-FVNQVSTCNVFQQLLMAV
Q7PI94_ANOGA/14-414F........ELNTSRVRLSKPFCCAVGGFVTLYWTAMVSSIATS...........NHANDR-ISRISNYFQLITNAIMLT
G39AD_DROME/8-362WHFD..SDHCQLVATSGSER.YAVVYAGCILVSTTAGFIFALLH...PSRFHIAIY...NQ-TGNFYEAVIFRSTCVVLF
GR36B_DROME/9-390F........EFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFT...AHGDTNLLFQSANK-LHEYVIIIMSGLKIVAGL
Q7PK17_ANOGA/41-408V........PLHGQALTSLR....TLTIVFVSFYTTGEIIVLSY...SLIKPEAVFFLSDA-TGTFADAIQFVIPLAVPL
GR58C_DROME/7-410L........HYDSSNHRFILNHVPTVVYCVILNVVYLLVLPFAL...FVLTGNIYHCPDAG-MFGVVYNVVALTKLLTML
G39AB_DROME/8-372I........DYNPTKKKFRLRRSVLCYIVHFALQAYLVGCISVM...VTYWRRCFKSELTT-TGNHFDRLVMVIALGILV
GR98A_DROME/13-370F..............GQNLFSKGFCYVLLFVSLGFSSYWRFSFD...YEFDYDFLNDRFSS-TIDLSNFVALVLGHAIIV
GR98D_DROME/12-392PIQ....FFTRTLHKRRRGIVILGYACYLISISLMVIYECYANI...VALQKDIHKFHAED-SSKVMGNTQKVLVVAMFV
GR22F_DROME/19-377F........TFDSRRKQLKR.SRWLLLYGFVLHSLAMCLAMSSHL.ASKQRRKYNAFERNP-LLEKIYMQFQVTTFFTIS
Q9W1V0_DROME/5-363Y........ETMGGKFRQSR.ITRIYCLLINAIFLTLLPSAFWK....SAKLLSTADWMPS-YMRVTPYIMCTINYAAIA
GR89A_DROME/10-356FR......TSEPMVARCQRW.MTLIAVFRWLLLTSMAPFVLWK....SAAMYEATNVRHSM-VFKTIALATMTGDVCISL
Q7PF36_ANOGA/19-401YPFDFQRQAEVKNIVLQKML.TILNRTFGLAMIGTVLTCCVSLY...VCYPSYMYEEDYPP-VLNIAYHLENWLKIVTVL
GR22D_DROME/17-386F........KYEPKKRRLRR.SMWLIPFGVVISSSLLILMVKQSAEDREHGIMLDVFQRNA-LLYQISSLMGVVGVVSIC
GR98B_DROME/12-392PP.....QSFGHTPHRRLRWYLMTGYVFYATAILATVFIVSYFN..IIAIDEEVLEYNVSD-FTRVMGNIQKSLYSIMAI
GR59E_DROME/7-383S...........GRVGVLRW.LHTLWSLFLLMYIWTGSIVKCLE..........FTVEIPT-IEKLLYLMEFPGNMATIA
GR28B_DROME/45-447FYIS..CDTKTGKKAIKKTI.FGYINGIMHIAMFVFAYSLTIYN...NCESVASYFFR.SR-ITYFGDLMQIVSGFIGVT
Q8IN22_DROME/11-375FRL...RKQKDNNVWLEEIWSNRSRWKWISVTLRIVPLCIYAFT...YAEWISNRMLITEK-FLHSCSLVVSIPCYLSII

PF02949

OR22B_DROME/79-381---------------------NMYGSSFKSYLTMMGYKKRQEAK......MSLDELDKRCV.CDEERTIVHRHVA...LG
OR24A_DROME/68-388---------------------SSILSLVKMVAIWWYQDELRSLI......ERVRFLTEQQK.SKRKLGYKKRFYTLATQL
OR23A_DROME/59-365---------------------TSLSNLMKFCMYVAQLTKMVEVQ......SLIGQLDARVS.GESQSERHRNMTEHLLRM
OR85D_DROME/84-400---------------------FVIVGDFKIWNISRQRKRLTQVV......SRLEELHPQGL.AQQEPYNIGHHLSGYSRY
OR45B_DROME/68-386---------------------CSFTTLFKLGWMWWRRQEVADLM......DRIRLLIGEQE.KREDSRRKVAQRSYYLMV
OR43A_DROME/56-364---------------------AIFNALMRTWLVIIKRRQFEEFL......GQLATLFHSIL.DSTDEWGRGILRRAEREA
OR98A_DROME/74-379---------------------NSVGMPFKVLFFNLYISGFYKAK......KLLSEMDKRCT.TLKERVEVHQGVV...RC
OR94A_DROME/69-376---------------------TEMALVVKILSIWHYRTEAWRLM......YELQHAPDYQL.HNQEEVDFWRREQ...RF
OR22C_DROME/69-392---------------------TKAVCVLKLWVFFRSNRRWAELV......QRLRAILWESR.RQEAQRMLVGLATTANRL
OR2A_DROME/66-387---------------------TDIVANLKFANVYMVRKQLHEIR......SLLRLMDARAR.LVGDPEEISALRKEVNIA
OR45A_DROME/64-362---------------------......FKFLVMMAKRRRIGSLI......HRLHKLNQAASATPNHLEKIERENQ..LDR
OR33C_DROME/60-372---------------------TCVACSLKHVAHLYHLPQIVEIE......SLIEQLDTFIA.SEQEHRYYRDHVHCHARR
OR46A_DROME/62-365---------------------TSAGHTTKLLSIKANNVQMEELF......RRLDNEEFRPR.GANEELIFAAACE...RS
OR85C_DROME/62-369---------------------FVIVGMSKMFFIWWKKTDLSDLV......KELEHIYPNGK.AEEEMYRLDRYLRSCSRI
OR85B_DROME/63-370---------------------FVTVGMSKMFFIRWKKTAITELI......NELKEIYPNGL.IREERYNLPMYLGTCSRI
OR42B_DROME/76-381---------------------NAYGSSVKVAITYSMLWRLIKAK......NILDQLDLRCT.AMEEREKIHLVVA...RS
OR47B_DROME/88-402---------------------GMALVFTKIFYMHLRCDEIDELI......SDF...EYYNR.ELRPHNIDEEVLG...WQ
OR63A_DROME/74-403---------------------...TSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFER.MSDLPVIKEIRQQVESTM
OR10A_DROME/70-396---------------------TSAVTLLKMFLMLRFRQDLSIMW......NRLRGLLFDPN.WERPEQRDIRLKHSAMAA
OR83B_DROME/70-476---------------------FFTHCITKFIYLAVNQKNFYRTL......NIWNQVNTHPLFAESDARYHSIALA..KMR
OR59C_DROME/79-385---------------------NCIGNVIKSCVTYSQMWRFRRMN......ELISSLDKRCV.TTTQRRIFHKMVA...RV
OR9A_DROME/68-381---------------------ASMLTLVKFLLFCYHRKEFVGLI......YHIRAILAKEI.EVWPDAREIIEVENQSDQ
OR30A_DROME/58-366---------------------LFTNTVVRGVLLCVQRFSYERFI......NILKSFYIELL.QSDDPIINILVKETTRLS
OR47A_DROME/56-375---------------------ITILGLFKFSMILYLRRDFKRLI......DKFRLLMSNEA.EQGEEYAEILNAANKQDQ
OR49B_DROME/52-364---------------------LWINTVLRAYLLLADHDRYLALI......QKLTEAYYDLL.NLNDSYISEILDQVNKVG
OR85F_DROME/68-381---------------------TYIINSDTKFATVLQRSAIQSLN......SKLAELYPKTT.LDRIYHRVNDHYWTKSFV
OR94B_DROME/66-372---------------------TELALVTKLLNIWYRRHEAASLI......HELQHDPAFNL.RNSEEIKFWQQNQ...RN
OR59B_DROME/77-382---------------------NVYGASVKSTITYLFLWRLRKTE......ILLDSLDKRLA.NDSDRERIHNMVA...RC
OR56A_DROME/124-407---------------------RTITLLIWIPSVIAGLMAYSDCI......YRSLFLPKSVF.NVPAVRRGEEHPI.LLFQ
OR85A_DROME/77-379---------------------NTNASIMKGIIVLFMRRRFSRAQ......KMMDAMDIRCT.KMEEKVQVHRAAA...LC
OR33B_DROME/61-369---------------------ACFFASFKFICFRFKLSEIKEIE......ILFKELDQRAL.SREECEFFNQNTR...RE
OR46B_DROME/62-373---------------------TEISCMAKLLHLKLKSRKLAGLV......DAM.LSPEFGV.KSEQEMQMLELDR.VAVV
OR33A_DROME/60-367---------------------ECLFCSYKFFCFRWKLKEIKTIE......GLLQDLDSRVE.SEEERNYFNQNPS...RV
OR88A_DROME/73-392---------------------ITIYFSIRGLMLYLKRKEIVEFV......NDLDRECPRDL.VSQLDMQMDETYRNFWQR
OR59A_DROME/64-386---------------------TCTACSVKCLLYAYNIKDVLEME......RLLRLLDERVV.GPEQRSIYGQVRV...QL
OR7A_DROME/80-394---------------------DAVILPAKIVALAWNLPLLRRAE......HHLAALDARCR.EQEEFQLILDAVR...FC

PF03268

G5EG25_CAEEL/32-391L--------RKESIR...SVKGILTGGVAVIILIISIIKIIVLM------.QIE..DKSFSIGWAESTVYAFMAVQAFFS
A8X6W9_CAEBR/10-368C--------AAAKNG.GSKIVGFLARLFAILVIISMFYRTFTFL------.GEE..GKLLTLNWSESNVFGFMGFHAVVC
G0N357_CAEBE/15-367.--------.GP.FR.......FIFVLFSLASFLSMVFRAWWMF------YEID..VKLLSFGWAERNMYAFISMESFSC
H2W3U0_CAEJA/53-412V--------SRVQLDPSYGKQALFSRILAVIVLLLILFRCVMFF------.MAG..GKVLSFQWTESNMYAFMAIHSIVC
O16244_CAEEL/60-411.--------.......KSKCCSVFTCLLGVVMVVVTLIRISFLM------.EAV..GAPLELGWGEGIFFGYPGLTGFVF
G0N363_CAEBE/25-374H--------SNPIIR.......FGSLLITVVIILLQLFRFYWML------WQVP..GEFLTFSWAEAKMFGFLSMESAIL
O18140_CAEEL/17-370.--------SNP.IR.......FLFVIFSLLSFLALIFRAYWMF------FQIS..STILSLGWAERNLYAFISMESFSC
E3LNY7_CAERE/33-393I--------ALSQHNPHLRIKAIITRVVAIAVIVVIFFRCGMLF------.KAE..GPTLSLTWAESNMFAFMGIQSIVC
G0MS85_CAEBE/20-379C--------AAANHGHGSKICGYLARTISIIVIIIMFYRAFTFL------.GAE..GKIMSFNWSEANVFGFMSLHTVIC
G0MS87_CAEBE/33-393V--------ALSRVNYSLRIRSWITQIFALLIISLIVLRCYTLF------.QLK..GQSMSFQWAESGMFAFMGVQSIEC
H2WA63_CAEJA/32-391L--------RKESIR...SVRGIATAVIAVLILAILVLEAFTLM------.GIQ..GKPFTIGWAESTLYAFMAMQALIS
E3LNY5_CAERE/55-405.--------.......KTKRC..LPRLIAVLIIILLSARVGILM------ILSK..GNALSFAWAESNFFGFPAIFTQFC
A8X6X0_CAEBR/35-395I--------ALAQNNPNLRIRSIITRIVALAVIALIFFRCGMIF------.KAE..GPAMSLTWAESNMFAFMGIHAIVC
G0MS88_CAEBE/61-413.--------.......KSRRVGFLSRLVAVLVITLLSTRVAFLM------MKSR..GNVLSFAWAESNFFGFPAIFTQFC
H2W0A5_CAEJA/25-383C--------AAAKTGNGSKVLGAISQILSIAVIILMFVRAFTFL------.GEE..GKILSFNWAESNVFGFMGLHCVVC
O45459_CAEEL/19-372.--------SNP.LR.......FVFMIFSFITFLAMVFRAGYML------FYLD..VKALTLGFAEQNLYGFISMESFCL
O16246_CAEEL/33-393I--------ARAEFNPSLRIKSILTRIVALVVVAIVFFRMAIYS------.KAE..GACLSLAWAEGNMFQFMALQTIVC
G0N991_CAEBE/33-392L--------RKESIG...SVKGIISAVIALIVVLIMALKVFTYM------.EVQ..DRPFSIGWAESTVYAFMSMQALFS
A8X6X1_CAEBR/32-394V--------ALSKVDPRYKLRAWISQLFALILIAVIVFRCYTFF------.QLKLSVNSMSLEWAESGMIAFMGVQSVEC
E3LNY3_CAERE/17-368.--------.......KSKCLGVITRLLAAVIIVLLFARVGLLM------.ETK..GNSLSFPWAESNFFGFPAIFAAVC
E3LNY6_CAERE/32-392V--------ALSKVDSRFKLRAWITQIFAIIIMAIIVLRCFTFF------.QLH..GHSMSFQWAESGMFAFLGVQSVEC
O44618_CAEEL/25-384C--------AAAKNGNGSKICGFLARLFSIVVILSMLYRAITFL------.GEE..GKLLTFNWSESNSFGFMGLHAFVC
Q8IFZ2_CAEEL/17-368.--------.......KSKRMTIFTCILGLFMIVVTLIRIPILM------.ETV..GTPLSFGWGEGNFFGYSALFGFVC
E3MHA0_CAERE/16-369.--------GNP.IR.......IFFLLFSLASFLGMIFRAWWMF------YMVD..VDLLSFGWAERNLYAFISMESFSC
G0MS86_CAEBE/36-396I--------AQYENNPMLRTKAIITRIGALAVIALMFFRCGMLF------.KAE..GPTMSVTWAESNMFAFLGIHSIAC
G0PNV7_CAEBE/53-404.--------.......KSKCPKFFAYLLSIFMIVFLGARVGLLM------.NTK..GNPLSFYWGESNFFGFPALFAVVC
Q9XVJ4_CAEEL/45-398.--------.......KSKCCGLLTTLIAIGIIVALLARVGLLM------.ETD..GKPLSFAWAECNFFGFPAIFPALS
H2WBG2_CAEJA/242-592.--------PQP.FR.......FIFTIFTAISALSMLFRTYWMF------WQIG..SESLEFGWAESQLYGFISFESFCI

PF06151

GR64A_DROME/1-455SAYVVFIRLAKKWPAVVRIW----TRT-----EIPFTKP--PYE.IPKRNLSRRVQLAALAIIG------LSLGEHALYQ
GR05A_DROME/40-438IASWQFLNLAQLWPGLMRHW----AAV-----ERRLPGY--TCC.LQRARPARRLKLVAFVLLV------VSLMEHLLSI
GR64D_DROME/1-416FCFGSFIKLSRRWPHIIRET----ALC-----ERIFLKP--CYANQEGLNFTRFLRRWALILLV------AALCEHLTYV
GR64C_DROME/1-407FCFGVFLLLSRRWPYIIRRT----AEC-----EQIFLEP--EYDCSYGRGYSSRLRLWGVCMLV------AALCEHSTYV
GR61A_DROME/1-435VNWLNFVGFARSWSHIMLPW----SSV-----DILMLFP--PYK.RGKRSLRSKVNVLALSVVV------LAVGDHMLYY
GR64F_DROME/63-463LVLIVALNLARQWPQLMMYW----HTV-----EKDLPQY--KTQ.LTKWKMGHTISMVMLLGMM------LSFAEHILSM
GR64E_DROME/25-448LISLSFFQLARKWPEIAQSW----QLV-----EAKLPPL--KLP.KERRSLAQHINMITIVATT------CSLVEHIMSM
GR64B_DROME/1-403LEHLFFWRLAIQWPRIMRTW----HGV-----EQLFLRV--PYRFYGEYRIKRRIYIVFTIVMS------SALVEHCLLL

PF08395

Q7PKI1_ANOGA/57-400VLYLHVLFDPAPLLHVLNEL....IER-----TRALLRH--IDPPAG........ESPVGRRLF------FKTVAIDLLQ
Q7PKI2_ANOGA/11-404LIYYHLLPARPVIRNIFNGF....VQL-----FRTLNGA--GCHRWKGKS...TKKNVLKLALK------MILCDTLLCA
Q7PKG3_ANOGA/26-401YGLISCFINRHDIWKFYNEA....YAV-----DNMLEEL--GERTNF........TRSFALFVA------YYGTAIGMCV
GR93B_DROME/24-392IILVMQFWFGEELINLVNRF....LQL-----FRRMQSL--TNSPKN.........RFGDRAEF------LLMFSKVFSL
GR21A_DROME/81-445LLPVASWRHGPQVAIFKNMW....TNY-----QYKFFKT--TGSP...........IVFPNLYP------LTWSLCVFSW
Q7PK37_ANOGA/8-367CTILNVLVKRQRITRLMNVL....FRP-----DRILDRC--SPTNSAD.......ARYNDNRKL------LVFVLFILFG
Q7PQ43_ANOGA/15-419ICYASLWRTDRMKCIYIEGIQGSNVKI-----NDRYYQF--RNMQIP.........IKYSILVP------FSIGMLIILS
Q7PK29_ANOGA/12-374CVVCNSFVHRKEIVQLLNML....FAD-----QNVLDLG--GTYGNKSV....QPFSIANRYVK------VLYAIVALIC
Q7PF19_ANOGA/20-402FAMLECQQSRPFYASILKEL....FEL-----GKNLHDC--DASINFPH.....VEAITDRLLV------CAVLYFSTSS
Q7PKH1_ANOGA/14-409GIPITNYVQAYKYDRLIYCI....AEV-----DKGLEEL--GFKHDYSV.....EYFYSTVYLS------VTLGLQLSCL
Q7PF39_ANOGA/19-415NMMIGCEQRRAEYEGYFEEV....LHL-----MKETAHQ--PDCKTT.........IWYRHVTK------VLLALYCIAS
GR97A_DROME/41-418FNYVTQWEKTLQIIRFQNSV....PLF-----KVLDSLD--ISAMIV........WRAFIYGLL------KIVFCPLITY
GR22E_DROME/18-388IMLLRSFWKSGDIERTLNEL....EDL-----QHRYFRN--YSLEEC.........ISFDRFVL------YKGFSVVLEL
GR77A_DROME/37-447MTLWIHCFKQAEIIGCLNRL....LKC-----RRRLRRL--MHTRKL........KDSMDCLAT------KGHLLEVVVL
GR36C_DROME/8-389FTLILRWYQRCKMMDLASKV.......-----VRMYVAR--PQVRRM.........SRWGILTK------FIFGSITDGL
GR98C_DROME/14-394CNQLNILLNYGRLGLIYDEI....ANL-----DLGIDKS--SKNFCGK.......SHWWSFRLR------LTLSIGLWMV
Q8MLS6_DROME/6-364YTVLSRGFRDTAFKEMQPLL....LTL-----FREEKRC--GFKGIGG......VRRSLRILLF------VKFFTLSWLC
Q7PKH4_ANOGA/15-393VLAIDNFMRRDATCQIIGEL....FKV-----DRYLQRI--GHQLDH........RRQYVTLVR------ILFVVLMLIA
Q7PKH2_ANOGA/13-388SISLCNRFVVGRMFRMFKTL....DGV-----DQILKRD--GYRLN..........HQLNHLLS------CIYMAVPILV
Q7PVJ7_ANOGA/11-395SAVVRRYHKRYEIAQLMRDL....FQL-----KRELFSA--TELSQ..........RWIKGHIL------RKITISQLIV
Q7PK40_ANOGA/8-372CTLLNTFGRRHRYTRLMNVL....FHD-----DWLLDRY--ESAE...........MEYDNRRP------FAGLLFAMLT
GR85A_DROME/27-394SSMGSCYQWQNRILAVLKELK.HQRDL-----SRHMGYR--VPRSKQ.........NSIDYLLF------ALTVLLILRL
Q7PVK1_ANOGA/8-381CCLLYRHKQVKRLFVLLVKL....YHN-----PAVSAFP--FR.............RWFRTCLL------FNLMYESAYG
GR22C_DROME/17-382VIHFLNFWGSTRVQDLANEL....LVL-----EYQQFAS--LNETKC.........PKFNSFVI------QKWLSVIGLL
G39AA_DROME/8-363LANLWLRSQQKSQVNLLQRL....SQV-----VELLQFE--PYAVPQ.........FRWLYRIW------LLVCLIYGAM
GR59D_DROME/9-389LELVSRWSQRRTFVRLFNSF....RRL-----YQRNPDI--IQYCRR.........SIVSKFFC------VTMTETLHII
GR92A_DROME/18-383VILCYHIFRGPEIIDLINQF....LRL-----FRQVSDL--FKTKTPG.......FGGRRELIL------ILLNLISFAH
GR08A_DROME/9-380AIYLETLSSQRHLANFWWLH....FKL-----GGQKTGL--VSLR...........SEFQQFCR------YLIFLYAMMA
Q7PVJ8_ANOGA/8-380CYLLSCRAKMKQLAELCTHV....HSS-----SLLVGPF--SLH............AWYRKCFV------FNLGYEAAHT
Q7PK13_ANOGA/41-414AIFIDTVLQRNTHRLVWEKI....ALI-----RLSARKV--YVERFT.........RHYLWKFY------GYLAVCAFLE
GR22B_DROME/17-385IVHFMNFWGSRKVGEICNEL....LIL-----EYQDFEG--LNGRNC.........PNFNCFVI------QKCLTILGQL
GR63A_DROME/100-456IIPIL.WYEARKIAKLFNDW....DDF-----EVLYYQI--SGHSLP........LKLRQKAVY------IAIVLPILSV
GR94A_DROME/17-399INYVSQMIISDHVAKVLSKV....PFF-----DTLKEFR--LDSRSL.........YISIVLAL------VKTVAFPLTI
Q7PKI5_ANOGA/30-402VVNVRMLSKAQRLASTLNAL....LAI-----RNTILQQ--WNCRVL........SREYGQLLL------YKVLAIDMAL
GR36A_DROME/9-390SAILNRWRQRAQLMRLVECV....LRL-----FLKKPHV--KQM............SRWAILVK------FSVGVVSNFL
Q7PF38_ANOGA/19-415IALVGPRLSGRYFRETIDTL....VHI-----MKLFDRA--TKIESILT.....AISVITNRLL------LLYGLHALII
Q7PKH9_ANOGA/7-400LCFYQLLRHEVSLHRYVQRF....VVI-----GKSVIVR--CNSRSYAS....VQRMVYALVAK------MLIADVGLCT
GR93C_DROME/18-394CIIVVQVCYEKELLRMIISF....LRL-----FRRVRRL--SSLKRIGF.....GGKREFFLLL------FKFICLVYEL
Q7PJT3_ANOGA/18-425MTFFCSIFQRNKLIKCFHAL....ASI-----DRRFKEI--GMETNYK......STLHYNLLVM------LTKAIISTLY
GR68A_DROME/7-379MVVLSSVQNASRHFRTLHDI....AKI-----DEYLLAN--GFRETY.........SCRNLTIL------VTSAAGGVLA
GR09A_DROME/6-339WIALSALFECRRFRYLLEEL....PPV-----.......--...............KATSFIYR------HLILEIILFA
Q7PQT4_ANOGA/106-466WIPFVGWGVAKQVAIYKTMW....GAF-----QVRYYRV--TGTS...........LQFPHLKL------LIVFLSIGCL
Q7PK18_ANOGA/61-428VMYVELFRTSDNICGCWRLL....YKA-----HQTLQRY--GMVDH..........RRLTRVMR------LYWWFVLGSL
GR32A_DROME/57-449LTVFVCAHNTTSMLRIMNEI....LQL-----DEEVRRQ--FGANLS.........QNFGFLVK------FLVGITACQA
GR22A_DROME/19-388VTHLRTFSRSSELVEILNEL....LVL-----DKNHFSK--LMLSEC.........HTFNRYVI------EKGLVIILEI
GR22_ANOGA/73-437LLPVASWRNGSEVAKFKNMW....TDF-----QYKYLIV--TGKP...........IVFPKLYP------ITWTLCIVSW
Q7PF20_ANOGA/20-415MVLIGCHYQRDCYRHYGEQL....LAV-----AVDLSLC--GGTVDFPR.....IETIFNRVLA------CIALFFAGVL
GR58A_DROME/3-389SGVLLMWFRRKRILNLGENL....ILH-----CLKCKTL--DNRSKKYSK...LRKRVRNVLFQ------MLLVANLSIL
GR10A_DROME/19-404VTYVANTVHFEAINQRCTMQ...RTHL-----EFEFKNA--PQEPK..........RPFEFFMY------FKFCLINLMM
G39AC_DROME/9-372LIYTQLYIQRFRFVALLQSI....LRF-----NQISGSH--REEGRF.........AFYYYTHL------SLLIICMLNY
O18280_CAEEL/46-428FSGLAAGFLLLKLQKQREKM....YHV-----LDQGLGR--NRNEEHD.......SHHFKLNKL------FISISFSFAA
Q7PVJ9_ANOGA/29-402VPPCYLLCRHKKVKELFVLL....VKV-----YYSSLSL--SIFPLR.........LWFRACFL------FNLVYDSAYG
Q7PK41_ANOGA/8-377YMHLIAFTKRVRITALFNAL.....FT-----DRSWRFF--GDRSN..........SWYESSRW------LGRFATAITI
Q7PK36_ANOGA/8-375CIIINAVYNRDCFVQLLNSL....FAR-----DDWMLES--VAMQGSS......QQRRSTQSTG------GLVCLIVLVL
GR58B_DROME/10-387SCYGTLWLKRHKIIQLYKYS....LIY-----WKRFGHI--TRAIVDKKEL.LDLQESLARIMI------RKIILLYSAF
GR59C_DROME/9-394LSLITRWYQRSRFIRIWNQI....LAL-----VRDRPQV--VRG............RWYRRSII------LKFVFCVLSD
Q7PTR1_ANOGA/7-389IIMLLLLRVAYRWPTVVPKW....EQI-----ESLEVMQ--YNARQQNARSCRRIRAIALLLIV------LGFAEHMLSI
LITE1_CAEEL/48-425QLYTLGAKRLKPLKILCQ......FSL-----NVRTKQA--ERRQ...........FMINTFLA------VFSGLLALTM
GR10B_DROME/11-372TGTWLHFLFERHVCQTYNEL....SRI-----LKHDLKL--KEHSRF.........YCLAFLAK------VYNFFHNFNF
Q7PI94_ANOGA/14-414AILLMPAFRLRNFAEVTRAL....RKL-----EQDLQQD--AIPTNC........RQMARWNIG------IVVGTVTVLL
G39AD_DROME/8-362LVYVILYAWRHRYRDLVQHI....LRL-----NRRCASS--CTNQQF.........LHNIILYG------MLTILCFGNY
GR36B_DROME/9-390ITVLNRWLQRGQMMQLVKDV....IRL-----YMINPQL--KSMI...........RWGILLKA------FISFAIELLQ
Q7PK17_ANOGA/41-408VTLTLSLLKRSTQKRIALLM....DQI-----DGSIEAH--GAAPGC........LERFNHQLA------DDIFSTMFVF
GR58C_DROME/7-410FLMSSVWIQRRRLYKLGNDL....MKM-----LHKFRFN--LGNDCR.........NRCLCKGL------LTSSRFVLLT
G39AB_DROME/8-372VQNAWLIWLQAPHLRIVRQI....EFY-----RRNHLAN--VRLLLP.........KRLLWLII------ATNVVYMANF
GR98A_DROME/13-370LELLWGNCSKDVDRQLQAIH....SQI-----KLQLGTS--NSTDRV........RRYCNWIYG------SLIIRWLIFI
GR98D_DROME/12-392WNQLNILLNFRRLARIYDDI....ADL-----EIDLNNA--SSGFVGQ.......RHWWRFRFR------LALSVGLWIV
GR22F_DROME/19-377VLLLMNVWKSNTVRKIANEL....LTL-----EGQVKDL--LTLKNC.........PNFNCFVI------KKHVAAIGQF
Q9W1V0_DROME/5-363YTLISRCYRDAMLMDLQRIV....LEV-----NREMLRT--GKKMN..........SLLRRMFF------LKTFTLTYSC
GR89A_DROME/10-356ALLGNHLWNRRELANLVNDL....ARL-----HRRRRL.--...............SWWSTLFL------WLKLLLSLYD
Q7PF36_ANOGA/19-401VAVLRSQTSTAYFRETVNSL....VQI-----MVQYDQG--WRIERKLA.....SVATVSKRLS------VVFLLDDFTI
GR22D_DROME/17-386TVHLRTLWRSKHLEEIYNGL....MLL-----EAKYFCS--NAVEC..........PAFDGYVI------QKGVVIVVGL
GR98B_DROME/12-392ANHLNMLINYRRLGGIYKDI....ADL-----EMDMDEA--SQCFGGQ.......RQRFSFRFR------MALCVGVWMI
GR59E_DROME/7-383ILVYYAVLNRPLAHGAELQI....ERI-----ITGLKGK--AKRLVYKR.....HGQRTLHLMA------TTLVFHGLCV
GR28B_DROME/45-447VIYLTAFVPNHRLERCLQKF....HTM-----DVQLQTV--GVK............IMYSKVLR------FSYMVLISMF
Q8IN22_DROME/11-375HLKICHGPEVTKLVNQYLHI....FRL-----GTLDIRR--RSQFGG.........GRELFLLI------LSVCCQIHEY

PF02949

OR22B_DROME/79-381N....FCYIFYHIAYTSFLI----SNF.....LSFIMKR--IH..............AWRMYFP......Y.VDPE....
OR24A_DROME/68-388T...FLLLCCGFCTSTSYSV----RHL.....IDNILRR--TH............GKDWIYETP......FKMMFPD..L
OR23A_DROME/59-365S.......KLFQITYAVVFI----IAA.....VPFVFET--EL..............SLPMPMW......FPFDWK....
OR85D_DROME/84-400SKFYFGMHMVLIWTYNLYWA----VYY.....LVCDFWL--GMRQ.........FERMLPYYCW......VPWDWS....
OR45B_DROME/68-386TRCGMLVFTLGSITTGAFVL----RSL.....WEMWVRR--HQ..............EFKFDMP......FRMLFHD..F
OR43A_DROME/56-364R....NLAILNLSASFLDIV----GAL.....VSPLFRE--ER..............AHPFGLA......LPGVSM....
OR98A_DROME/74-379N....KAYLIYQFIYTAYTI----STF.....LSAALSG--KL..............PWRIYNP......F.VDFR....
OR94A_DROME/69-376.F..KWFFYIYILIS.LGVV----YSG.....CTGVLFL--EG.............YELPFAYY......VPFEWQ....
OR22C_DROME/69-392S....LLLLSSGTATNAAFT----LQP.....LIMGLYR--WIV...........QLPGQTELP......FNIILPS..F
OR2A_DROME/66-387Q...G.TFRTFASIFVFGTT----LSC.....VRVVVRP--DR..............ELLYPAW......FGVDWM....
OR45A_DROME/64-362Y....VARSFRNAAYGVICA----SAI.....APMLLGL--WGYVETG...VFTPTTPMEFNFW......L..DER....
OR33C_DROME/60-372FT..RCLYISFGMIYALFLF----GVF.....VQVISGN--WE...............LLYPAY......FPFDLE....
OR46A_DROME/62-365R....KLRDFYGALSFAALS----MIL.....IPQFALD--WS............HLPLKTYNP......L..GEN....
OR85C_DROME/62-369SITYALLYSVLIWTFNLFSI----MQF.....LVYEKLL--KIRV.........VGQTLPYLMY......FPWNWH....
OR85B_DROME/63-370SLIYSLLYSVLIWTFNLFCV----MEY.....WVYDKWL--NIRV.........VGKQLPYLMY......IPWKWQ....
OR42B_DROME/76-381N....HAFLIFTFVYCGYAG----STY.....LSSVLSG--RP..............PWQLYNP......F.IDWH....
OR47B_DROME/88-402R...LCYVIESGLYINCFCL----VNF.....FSAAIFL--QPLL.........GEGKLPFHSV......YPFQWHR.LD
OR63A_DROME/74-403NR.YWASTRRQILIYLYSCI----CIT.....TNYFINS--FVINLYRYFTKPKGSYDIMLPLP......SLYPAWE.HK
OR10A_DROME/70-396RINFWPLSAGFFTCTTYNLK----PIL.....IAMILYL--QNR...........YEDFVWFTP......FNMTMPK..V
OR83B_DROME/70-476KL..FFLVMLTTVASATAWT----TITFFGDSVKMVVDH--ET............NSSIPVEIPRLPIKSF.YPWN....
OR59C_DROME/79-385N....LIVILFLSTYLGFCF----LTL.....FTSVFAG--KA..............PWQLYNP......L.VDWR....
OR9A_DROME/68-381ML.SLTYTRCFGLAGIFAAL----KPF.....VGIILSS--IR............GDEIHLELP......HNGVYPY..D
OR30A_DROME/58-366V....LISRINLLMGCCTCI----GFV.....TYPIFGS--ER..............VLPYGMY......LPTIDEY..K
OR47A_DROME/56-375RM.CTLFRTCFLLAWALNSV----LPL.....VRMGLSY--WLA..........GHAEPELPFP......CLFPWN....
OR49B_DROME/52-364K.....LMARGNLFFGMLTS----MGF.....GLYPLSS--SER...........VLPFGSKIP......GLNEYE....
OR85F_DROME/68-381Y.....LVIIYIGSSIMVVI----GPI.....ITSIIAY--FTHN.........VFTYMHCYPY......FLYDPE....
OR94B_DROME/66-372.F..KRIFYWYIWGS.LFVA----VMG.....YISVFFQ--ED.............YELPFGYY......VPFEWR....
OR59B_DROME/77-382N....YAFLIYSFIYCGYAG----STF.....LSYALSG--RP..............PWSVYNP......F.IDWR....
OR56A_DROME/124-407......LFPFGELCD.....----.........NFVVGY--LG................PWYAL......GLG.......
OR85A_DROME/77-379N....RVVVIYHCIYFGYLS----MAL.....TGALVIG--KT..............PFCLYNP......L.VNPD....
OR33B_DROME/61-369A...NFIWKSFIVAYGLSNI----SAI.....ASVLFGG--GH..............KLLYPAW......FPYDVQ....
OR46B_DROME/62-373R.....MRNSYGIMSLGAAS----LIL.....IVPCFDN--FG............ELPLAMLEV......CSIEGW....
OR33A_DROME/60-367A...RMLSKSYLVAAISAII----TAT.....VAGLFST--GR..............NLMYLGW......FPYDFQ....
OR88A_DROME/73-392Y...RFIRIYSHLGGPMFCV----VPL.....ALFLLTH--EGK...........DTPVAQHEQ......LLGGWLPCGV
OR59A_DROME/64-386R....NVLYVFIGIYMPCAL----FAE.....LSFLFKE--ER..............GLMYPAW......FPFDWL....
OR7A_DROME/80-394N....YLVWFYQICYAIYSS----STF.....VCAFLLG--QP..............PYALYLP......G.LDWQ....

PF03268

G5EG25_CAEEL/32-391AISVMCWTREGFVSQFEDTL----ARL-----RTMRLST..SQSIDDYTTYHRKAAIMIIPIFV------VSLSTSFYSS
A8X6W9_CAEBR/10-368SFCVMGWTANAFIPNYLKQL----NQV-----RVLRVEP..NDEIDEYSGLRKKAFFFSLPWLG------TLAFTAIFNA
G0N357_CAEBE/15-367VISLYFMTSKGTMKIFEEGM----GRL-----KALRVTH.YHAKYDEYSRLRLKTFLLKVPILV------FFIGSAGFLL
H2W3U0_CAEJA/53-412GGCLFGWTKNGFFFTYLEML----NKV-----RKLRVNG..KKEKDDYTKLHRRAFFWAALWFL------AVMSHSVASM
O16244_CAEEL/60-411SLCLFGWTKNGLIPKFCKRL----VRV-----RMLRQAA..NSKLDKFRILHGLALGFSIPWFV------AMMSWIIYNF
G0N363_CAEBE/25-374TMALGKMGWTQSLGRSEKSL----DSL-----KVLRIEK.CQKKKDDYRILWGRSLISNCFAFL------TFILTTVYLA
O18140_CAEEL/17-370VIALYRMTTVGSLEKFEQSL----ANL-----KRMRVTG.YHESHDEYGKLRLKIFLLKTPIPV------FFIATAIYLV
E3LNY7_CAERE/33-393TFCLFGWTKNEFVPLHLTRL----NKV-----RSLRIKE..NTVVDDYSNIHRKAFIWSGFWFA------AILSHAIASA
G0MS85_CAEBE/20-379SFCLMGWTSNSRIPEYLTKL----AHL-----RKQRIET..NDELDDYQGLRKKAFFFSIPWLV------TLGFTAIFNA
G0MS87_CAEBE/33-393AVCIYSWTKKDFISNHLEKL----EHI-----RSLRLKN..NENLDNYTYLHLKIFGWTFLWSV------ITMAHAIASA
H2WA63_CAEJA/32-391AISVMCWSRENFISQFEDTL----ARL-----RTMRLST..SQSIDDYTSFHRKAAFMIVPIFV------VTLSTSFYSS
E3LNY5_CAERE/55-405GICLFNWTRTRFIEHFSEKL----AQI-----RILRSEP..NQNMDNYQRVHALALILSIPWFG------ASTSWILFNF
A8X6X0_CAEBR/35-395AFCIFGWSKNEFVPLHISRL----NKV-----RALRVKE..SREIDDYSSVHRKAFIWSAFWFL------ALLSHAIASA
G0MS88_CAEBE/61-413GICIFSWTRKEFVETFCEKL----GKL-----KLLRLEQ..NAALDHYTKIHIFAIGCSIPWLV------ATMSWSVYNM
H2W0A5_CAEJA/25-383CFCVMGWTAHSFVPNYLKQL----GQV-----RILRVEP..NEEIDDYRGLRKKAFILSLPWLG------VMMFTALFNS
O45459_CAEEL/19-372VIALFKITKVGRLRKVEQKL----AEM-----REMRITS.FHESHDKYWKLWIELFIFNSFNLV------LFIGTAIYLL
O16246_CAEEL/33-393ALCLFGWTKNSFISKHLGRL----EKV-----RSLRIKE..NIEMDNYSNTHRKAFIWSGFYIA------AIMSHAIMSS
G0N991_CAEBE/33-392AFSIIYWTRENFVSQFEDTL----ARL-----RTMRLST..SLTIDDYTTFHRKAAVMVVPIFA------VTLTSSFYSS
A8X6X1_CAEBR/32-394AYCIFSWTRRDFISSHLEKL----EEV-----RQLRIKD..NEKLDNYSTAHFKILGWTTIWTV------IVMAHAVACA
E3LNY3_CAERE/17-368ALCIFGWTKNGFVRKFSKKL----VRV-----RTLRVES..NSKMDSYRLVQVLAMIFSIPWLV------AMMSWIIFNF
E3LNY6_CAERE/32-392AYCIFSWTRNDFIMNHLEKL----EVL-----RLLRVKD..NEKIDSYCSIHLKILVWTGLWTL------ITMAHAVNCA
O44618_CAEEL/25-384SLCVMGWTANARFPNHIKRL----NEV-----RVLRVEP..NEEIDDYSGFRKKAFFFSLPWLA------TLVSTALFNA
Q8IFZ2_CAEEL/17-368SLCVFGWTKNGLVQKFCGRL----VRV-----RMLRQVA..NPKLDNFRILHILALCFSIPWFV------AMMSWIIYNF
E3MHA0_CAERE/16-369VIALYKMTTNDTLRKFEQGL----GML-----KKMRITN.YHQKYDEYSALRTKTFLLKVPILV------FFIGCSGYLV
G0MS86_CAEBE/36-396SFCIFGWTKNGLVPSHLLRL----DKV-----RALRIKE..NSMLDDYSGLHRKAFIWSAFWFL------FVMAHAIASA
G0PNV7_CAEBE/53-404ALCVFGWTKNGFIRKFTKKL----VKV-----RMLRVEP..NSSVDSYRMVQVLAMIFSIPWLV------AMMSWIIFNF
Q9XVJ4_CAEEL/45-398AVSILSWTKSLFFPNFVKKL----IRL-----RNLRLEP..NQKLDSYGRIHVVALIFSIPWLI------AMMSWILYNY
H2WBG2_CAEJA/242-592TIGLYRITSKRSLCRFTENM----QRL-----KSLRVSKNFHEKFDNYRTLYIRLFIAVTFNFA------AFTLSAIYLV

PF06151

GR64A_DROME/1-455VSA-ILSYTRRIQMCANITTVPSFNNYMQ---TNYDYVFQLLPY-S---PIIAVLILLINGACTFVW--NYMDLFIMMIS
GR05A_DROME/40-438IS.-VVYYDFCPRRSD......PVESYLL---GASAQLFEVFPY-S---NWLAWLGKIQNVLLTFGW--SYMDIFLMMLG
GR64D_DROME/1-416GSA-AWSNYVQIRDCNLKVG..FVENYFL---RERQELFSVFEY-R---AWMVFFIEWNTMAMTFVW--NFGDIFLFLMC
GR64C_DROME/1-407GSA-LYNNHLAIVECKLDAN..FWQNYFQ---RERQQLFLIMHF-T---AWWIPFIEWTTLSMTFVW--NFVDIFLILIC
GR61A_DROME/1-435ASG-YCSYSMHILQCHTNHSRITFGLYLE---KEFSDIMFIMPF-N---IFSMCYGFWLNGAFTFLW--NFMDIFIVMTS
GR64F_DROME/63-463VSA-INYASFCNRTAD......PIQNYFL---RTNDEIFFVTSY-S---TTLALWGKFQNVFSTFIW--NYMDLFVMIVS
GR64E_DROME/25-448LSM-GYYVNSCPRWPD...R..PIDSFLY---LSFSSVFYFVDY-T---RFLGIVGKVVNVLSTFAW--NFNDIFVMAVS
GR64B_DROME/1-403GNS-FHLSNMERTQCKINVT..YFESIYK---WERPHLYMILPY-H---FWMLPILEWVNQTIAYPR--SFTDCFIMCIG

PF08395

Q7PKI1_ANOGA/57-400SFT-WY...........GTF--LWLQRKF---GATYILAFWLNS-I...AVMQIVAALNILLATLLWGAFLYRLINERVR
Q7PKI2_ANOGA/11-404LFV-LY..........FGQF--FIQDGDI---QSQILWTLNIFS-V....WQSAIFTNLIVVTLIIG.VHFLEILNHRLT
Q7PKG3_ANOGA/26-401LVI-AV.............M--YSENLPW---MLLLNLGYSYFS-L...TTFHILSLTCLDVVRARN.VRLNKVFRKQFS
GR93B_DROME/24-392LFV-FM..........AFRL--MLSPWFL---LTLVCDLYTSVG-T...GMITHLCFVGYLSIGVLY.RDLNNYVDCQLR
GR21A_DROME/81-445LLS-IA.............I--NLSQYFL---QPDFRLWYTFAY-Y.....PIIAMLNCFCSLWYIN.CNAFGTASRALS
Q7PK37_ANOGA/8-367MCM-KLS........YYKKV--EIKILAV---MIAGRFLAIWVL-I..........FVHRLHVRAIG..QRMEQLRVLY.
Q7PQ43_ANOGA/15-419VCE-AY.............A--HHGYYFT---IITIVYPLWMFH-I.....TILEFTTLVKSTECIL.TKLNWMLDTFLE
Q7PK29_ANOGA/12-374FYN-YI..............--.NMIHTM---HTFLELTLISRF-L....LTTQYIYLYYLCVSMVR..LRMQQLRVLFL
Q7PF19_ANOGA/20-402LVD-WW.............A--DYDPSCT---FLCHSVLYILPN-V....INVLALYQYAALQLIVA..ACYRSVNSVLA
Q7PKH1_ANOGA/14-409TGT-AF...........TNP--FLVDYDT---WCNFTALVGFIM-C.....NLVYIMTSCFCCVTLW.AIVYRYHNINAT
Q7PF39_ANOGA/19-415LTV-PI..............--.VMTTIL---WDIATIPYVMAQ-TVPFVVSSLILNQYFCVFVHLT..SILRKMNERLA
GR97A_DROME/41-418ITL-IL..........YHRR--SISESQW---TSVTTTKTMLPL-I....VSNQINNCFFGGLVLAN..LIFAAVNRKLH
GR22E_DROME/18-388VSM-LVLE......LGMSPN--YSAQFFI---GLGSLCLMLLAV-L.......LGASHFHLAVVFVY..RYVWIVNRELL
GR77A_DROME/37-447LSS-YLLSM....AQPIQIL--KDDPEVR---RNFMYACSLVFV-SVCQAILQLSLGMYTMAILFLG..HLVRHSNLLLA
GR36C_DROME/8-389QMA-MVLS.......AMGSV--DSQFYLG---LGLQYWMFVILN-M........AMMQQHMIMLFVR..TQFQLINTELR
GR98C_DROME/14-394III-GVIP.......RLTLG--RAGPFFH---WVNQVLTQIILI-M.....LQLKGPEYCLFVLLVY..ELILRTRHVLE
Q8MLS6_DROME/6-364VTD-VL.............F--LLYSTDA---LIWVNVLRFFFK-CNTNNILEMVPMGYFLALWHIA..RGFDCVNRRLD
Q7PKH4_ANOGA/15-393TGT-VF...........ALG--MSTISEF---SIRNHLINSFSY-ALTGIQFMIVNFHFVAAARLVS..FRLDAIKCSLK
Q7PKH2_ANOGA/13-388NFF-LMIS......TFFIVQ--DQSSQQF---TATEMVVFLRSS-L....VFTIFGSYITVALTTIY..MRFRALNKMIS
Q7PVJ7_ANOGA/11-395TSS-FVLAV....LAVLDAG--EETAIGS---ELLSLCIFYYPK-L....TIICSVSLYYAVMLFQQ..NLHYALNERLK
Q7PK40_ANOGA/8-372MMS-IN.............M--FYHRDMN---LRILSMSVALKI-F....GIGYLCIIHRVCVGAIG..VRMRQLSILGK
GR85A_DROME/27-394SIH-LA.............T--FTLSARM---GFNHPCNCFLPE-C....MIFSMNYLLFAILAEIT..RCWWSLQSGLK
Q7PVK1_ANOGA/8-381VNF-LL.............N--IFQPGST---FHLEIVNLLLST-A.....LSQLSKSAVMLIMYGS.GQYLQMALVQLK
GR22C_DROME/17-382LSY-LS..........IAYG--LPGNNFS---VEMVLINSLVQF-S.....FNCNIMHYYIGVLLIY..RYLWLINGQLL
G39AA_DROME/8-363VTH-FG...........INW--LTTMQIS---RVLTLIGFVYRC-V....LANFQFTCYTGMVVILK..KLLQVQVKQLE
GR59D_DROME/9-389VTL-AM..............--MRNRLSI---ALALRIWAVLSL-T...AIINVIITQYYVATACVR..GRYALLNKDLQ
GR92A_DROME/18-383EQT-YLW.........FTIR--KGFSWRF---LIDWWCDFYLVS-AT..NIFIHINSIGYLSLGVLY.SELNKYVYTNLR
GR08A_DROME/9-380AEV-AI............HL--GLWQFQA---LTQHMLLFWSTY-EPLVWLTYLRNLQFVLHLELLR..EQLTGLEREMG
Q7PVJ8_ANOGA/8-380VTL-LAN........LALQS--VFPEGMG---KIYPQTLLWIAL-SNLTKSAVLLTMYGSVQYLMIC.AVKLNELLPRLS
Q7PK13_ANOGA/41-414AQV-LY.............L--AWDDPSA---LAYWLVIMILHA-F...LRLRHLFHMFFIDILKIH.LQKLHHDLVDAG
GR22B_DROME/17-385LSF-FT..........LNFA--LPGLEFH---ICLVLLSCLMEF-S.....LNLNIMHYHVGVLLIY..RYVWLINEQLK
GR63A_DROME/100-456LSV-VI..............--...THVT---MSDLNINQVVPY-CILDNLTAMLGAWWFLICEAMS..ITAHLLAERFQ
GR94A_DROME/17-399EVA-FI...........LQQ--RRQHPEM---SLIWTLYRLFPL-I....ISNFLNNCYFGAMVVVK..EILYALNRRLE
Q7PKI5_ANOGA/30-402LLF-SLIM......YYVTQD--EVPTGAE---VVVGVTFSVFRY-V.....FTALVNLYLVGLMIVS..FNQGSINSKLT
GR36A_DROME/9-390QMA-IS..........MESL--DRLGFNE---FVGMASDFWMSA-I.....INMAISQHYLVILFVR..AYYHLLKTEVR
Q7PF38_ANOGA/19-415TVT-VW..............--ISTEHPV---STLLNVSYLAPY-V....TIAVYILLYRALLASIA..GIVGCLNDNLR
Q7PKH9_ANOGA/7-400LFA-MNSG......IKRHET--SAHVYRT---VNIYVVMMSSQF-T...NLLLLMLLFGSYVYGQIN..KQLDRTVHRLA
GR93C_DROME/18-394YSE-IC.............Q--LWHLPDS---LSLFATLCEIFL-EIGSLMIIHIGFVGYLSVAALY.SEVNSFARIELR
Q7PJT3_ANOGA/18-425LVV-CL...........AVF--ISSDTYP---SVTTWMAFLLPY-F....MMSMVIVLFLCFVNQTK..HRFHLLNKVLK
GR68A_DROME/7-379VAF-YY..........IHYR--SGIGAKR---QIILLLIYFLQL-L....YSTLLALYLRTLMMNLA..QRIGFLNQKLD
GR09A_DROME/6-339CNA-FL..............--VLSEYTI---RGIYLENLRYAY-S.....LQAVRARYLQMMVLV...DRLDGKLEQLH
Q7PQT4_ANOGA/106-466VCA-IV.............F--LLSLSFL---LEGFALWHTSAY-Y.....HIITMLNMNSALWYIN.SRGIRVASSSLS
Q7PK18_ANOGA/61-428LYF-VVNE.......SYLYL--CAEQMQT---KRFYVYFFALQY-I.....LNIKLQQIIYPAILLD..TYLRMTRAALE
GR32A_DROME/57-449YII-VLK.........IYAV--QGEITPT---SYILLAFYGIQN-G....LTATYIVFASALLRIVY..IRFHFINQLLN
GR22A_DROME/19-388GSS-LV...........LYF--GIPNSKI---VVYEAVCIYIVQ-L....EVLMVVMHFHLAVIYIY..RYLWIINGQLL
GR22_ANOGA/73-437SLS-LV.............I--ILSQYYL---QPDFQFCHTFAY-Y.....HIIAMLNGFCSLWFVN.CTAFGTASKAFA
Q7PF20_ANOGA/20-415TVD-LLYNDL...VVWRFAR--SSAVYTL---SNVINVLALLQY-A...YVLYVLYFCYYDTNRLLA..SYNRHLLVRGT
GR58A_DROME/3-389LGA-LI..........LFRI--HSVQRIS---KTAMIVAHITQF-I...YVVFMMTGICVILLVLHW...QSERLQIALK
GR10A_DROME/19-404MIQ-VCGIF....AQYGEVG--KGSVSQV---RVHFAIYAFVLW-N....YTENMADYCYFINGSVL..KYYRQFNLQLG
G39AC_DROME/9-372AYG-YW.............T--AGVRLTT---IPIYLLQYGFSY-L....FLGQVVVLFACIQQILL..SILKYYNQVVL
O18280_CAEEL/46-428ALS-FVQIA.....TKMRYL--DLPDTPD---LINRKIYFVILE-G....YVIFIASSCISLVAILF.FQLCRILQFSIG
Q7PVJ9_ANOGA/29-402VNV-ALNL......VLPGTG--IHEKYVK---ILSWSVLSQLTK-S.......IVLLIIYGTAQYLL..RMVDHLNDHLA
Q7PK41_ANOGA/8-377GTM-LY..........LSLL--ILSQYNS---STKFPLYVTILE-AVRVYVTMIAILIYIVCVLVVK..MHFRQLQDRVE
Q7PK36_ANOGA/8-375LYA-MY............NA--LFVNDHS---MVLMDMIILLRF-C....FMFLILELYRVCVRIIR..KRMKQLQVLLT
GR58B_DROME/10-387LCS-TVLQ......YQLLSV--INPQIFL---AFCARLTHFLHF-L.......CVKMGFFGVLVLLN..HQFLVIHLAIN
GR59C_DROME/9-394SLH-TI............SD--VSAQRKR---ITADLIVKLSLL-ATLTTIFNMIVCQYYLAMVQVI..GLYKILLQDLR
Q7PTR1_ANOGA/7-389GKT-VNARVYEARTCHWNYS--NLPEYYA---LA..HLRVLFPK-S....IIQLSLLYIFRALTMAW..TVQDVLLIMIS
LITE1_CAEEL/48-425AAT-YAMS......KWGYIL--YIVGTPN---LDTETIFCVLLD-S...YALFVSRAAISALAILFY..QHCSVIRRSIK
GR10B_DROME/11-372ALS-AIM........HWGLR--PFNVWDL---LANLYFVYNSLA-R......DAILVAYVLLLLNLS..EALRLNGQ...
Q7PI94_ANOGA/14-414LAT-AF..........DCYV--TVFRGFI---RVDYWIITILPQ-F....VNVIAVTQVVLLLLYIN..ARFRKLNQLLE
G39AD_DROME/8-362LHG-YT.............R--AGLATLP---LALCMLVYIFAF-L....VLCLLLMFFVSLKQVMT..AGLIHYNQQL.
GR36B_DROME/9-390VTL-SV...........DAL--DRQGTAE---MMGLLVKLCVSF-I.....MNLAISQHFLVILLIR..AQYRIMNAKLR
Q7PK17_ANOGA/41-408NVI-PAVS......EFFIIS--RISGNPV---WHRNWLLKVWFF-I....LIRLGDSFFLVHVLYLR..NRYRVLNNELQ
GR58C_DROME/7-410QQL-LTRD......SVVNCE--SNSSLRQ---AMVPYQSAAIVY-A....LIMILLMSYVDMTVYMV.EVAGNWLLVNMT
G39AB_DROME/8-372IKT-CI...........FEW--LTDASRL---FVITSLGFPLRY-L....VTSFTMGTYFCMVHIVR..LVLDWNQSQIN
GR98A_DROME/13-370VVT-IY.............S--NRALTIN---ATYSELVFLARF-S........EFTLYCAVILFIY.QELIVGGSNVLD
GR98D_DROME/12-392LLV-GLTP.......RFTLV--ALGPYLH---WTNKVLTEIILI-M.....LQLKCTEYCVFVLLIY..ELILRGRHILQ
GR22F_DROME/19-377VIS-IY............FC--LCQENSY---PKILKILCCLPS-V....GLQLIIMHFHTEIILVY..RYVWLVNETLE
Q9W1V0_DROME/5-363LSY-IL............AV--FIYQWKA---QNWSNLCNGLLV-NISLTILFVNTFFYFTSLWHIA..RGYDFVNQQLN
GR89A_DROME/10-356LLC-SVPF.......LKGAG--GRLPWSQ---LVAYGVQLYFQH-V.....ASVYGNGIFGGILLML..ECYNQLE....
Q7PF36_ANOGA/19-401ATG-LY..............--FIVEGAP---ATLINLCYIPPF-I....AIVINVLHYYALFGTIS..GIMSCSNDTLY
GR22D_DROME/17-386LAP-WM...........VHF--GMPDSKL---PVLNVLVVSMVK-L....GTLLLALHYHLGVVIIY..RFVWLINRELL
GR98B_DROME/12-392LMV-GSM........PRLTM--TAMGPFV---STLLKILTEFVM-I....MQQLKSLEYCVFVLIIY..ELVLRLRRTLS
GR59E_DROME/7-383LVD-VV.............N--YDFEFWT---TWSSNSVYNLPG-L....MMSLGVLQYAQPVHFLW..LVMDQMRMCLK
GR28B_DROME/45-447LVN-VLF.........TGGT--FSVLYSS---EVAPTMALHFTF-LIQHTVIAIAIALFSCFTYLVE..MRLVMVNKVLK
Q8IN22_DROME/11-375VFI-LV............IA--SRLCGFQ---HIIWWVSYTYVF-I.........ICNSIMCFGFIW.HLSLGVLYAELN

PF02949

OR22B_DROME/79-381...-KQ----------------FYI.SSI---AEVILRGWAVFM-D------LCTDVCPLISMVIAR--CHITLLKQRLR
OR24A_DROME/68-388LLR-LP----------------LYPITYI---LVHWHGYITVVC-F------VGADGFFLGFCLYFT--VLLLCLQDDVC
OR23A_DROME/59-365NSM-VA----------------YIG.ALV---FQEIGYVFQIMQ-C------FAADSFPPLVLYLIS--EQCQLLILRIS
OR85D_DROME/84-400TGY-SY----------------YFM.YIS---QNIGGQACLSG.-Q------LAADMLMCALVTLVV--MHFIRLSAHIE
OR45B_DROME/68-386AHR-MP----------------WFPVFYL---YSTWSGQVTVYA-F------AGTDGFFFGFTLYMA--FLLQALRYDIQ
OR43A_DROME/56-364TSS-PV----------------YEV.IYL---AQLPTPLLLSMM-Y------MPFVSLFAGLAIFGK--AMLQILVHRLG
OR98A_DROME/74-379ESR-SS----------------FWK.AAL---NETALMLFAVTQ-T------LMSDIYPLLYGLILR--VHLKLLRLRVE
OR94A_DROME/69-376.NE-RR----------------YWF.AYG---YDMAGMTLTCIS-N------ITLDTLGCYFLFHIS--LLYRLLGLRLR
OR22C_DROME/69-392AVQ-PG----------------VFPLTYV---LLTASGACTVFA-F------SFVDGFFICSCLYIC--GAFRLVQQDIR
OR2A_DROME/66-387HST-RN----------------YVL.INI---YQLFGLIVQAIQ-N------CASDSYPPAFLCLLT--GHMRALELRVR
OR45A_DROME/64-362.KP-HF----------------YWP.IYV---WGVLGVAAAAWL-A------IATDTLFSWLTHNVV--IQFQLLELVLE
OR33C_DROME/60-372SNR-FL----------------GAV.ALG---YQVFSMLVEGFQ-G------LGNDTYTPLTLCLLA--GHVHLWSIRMG
OR46A_DROME/62-365TGS-PA----------------YWL.LYC---YQCLALSVSCIT-N------IGFDSLCSSLFIFLK--CQLDILAVRLD
OR85C_DROME/62-369.EN-WT----------------YYVLLFC---QNFAGHTSASG.-Q------ISTDLLLCAVATQVV--MHFDYLARVVE
OR85B_DROME/63-370.DN-WS----------------YYPLLFS---QNFAGYTSAAG.-Q------ISTDVLLCAVATQLV--MHFDFLSNSME
OR42B_DROME/76-381DGT-LK----------------LWV.AST---LEYMVMSGAVLQ-D------QLSDSYPLIYTLILR--AHLDMLRERIR
OR47B_DROME/88-402LHP-YT----------------FWF.LYI---WQSLTSQHNLMS-I------LMVDMVGISTFLQTA--LNLKLLCIEIR
OR63A_DROME/74-403GLE-FP----------------YYHIQMY---LETCSLYICGMC-A------VSFDGVFIVLCLHSV--GLMRSLNQMVE
OR10A_DROME/70-396LLN-YP----------------FFPLTYI---FIAYTGYVTIFM-F------GGCDGFYFEFCAHLS--ALFEVLQAEIE
OR83B_DROME/70-476ASH-GM----------------FYMISFA---FQIYYVLFSMIH-S------NLCDVMFCSWLIFAC--EQLQHLKGIMK
OR59C_DROME/79-385KGH-WQ----------------LWI.ASI---LEYCVVSIGTMQ-E------LMSDTYAIVFISLFR--CHLAILRDRIA
OR9A_DROME/68-381LQV-VM----------------FYVPTYL---WNVMASYSAVTM-A------LCVDSLLFFFTYNVC--AIFKIAKHRMI
OR30A_DROME/58-366YAS-PY----------------YEI.FFV---IQAIMAPMGCCM-Y------IPYTNMVVTFTLFAI--LMCRVLQHKLR
OR47A_DROME/56-375IHI-IR----------------NYVLSFI---WSAFASTGVVLP-A------VSLDTIFCSFTSNLC--AFFKIAQYKVV
OR49B_DROME/52-364SPY-YE----------------MWY...I---FQMLITPMGCCM-Y------IPYTSLIVGLIMFGI--VRCKALQHRLR
OR85F_DROME/68-381KDP-VW----------------IYISIYA---LEWLHSTQMVIS-N------IGADIWLLYFQVQIN--LHFRGIIRSLA
OR94B_DROME/66-372.TR-ER----------------YFY.AWG---YNVVAMTLCCLS-N------ILLDTLGCYFMFHIA--SLFRLLGMRLE
OR59B_DROME/77-382DGM-GS----------------LWI.QAI---FEYITMSFAVLQ-D------QLSDTYPLMFTIMFR--AHMEVLKDHVR
OR56A_DROME/124-407...-..----------------....ITA---IPLWHTFITCL.-.------..........MKYVN--LKLQILNKRVE
OR85A_DROME/77-379...-DH----------------FYL.ATA---IESVTMAGIILA-N------LILDVYPIIYVVVLR--IHMELLSERIK
OR33B_DROME/61-369ATE-LI----------------FWL.SVT---YQIAGVSLAILQ-N------LANDSYPPMTFCVVA--GHVRLLAMRLS
OR46B_DROME/62-373...-IC----------------YWS.QYL---FHSICLLPTCVL-N------ITYDSVAYSLLCFLK--VQLQMLVLRLE
OR33A_DROME/60-367ATA-AI----------------YWI.SFS---YQAIGSSLLILE-N------LANDSYPPITFCVVS--GHVRLLIMRLS
OR88A_DROME/73-392RKD-PN----------------FYLLVWS---FDLMCTTCGVSF-F------VTFDNLFNVMQGHLV--MHLGHLARQFS
OR59A_DROME/64-386HST-RN----------------YYI.ANA---YQIVGISFQLLQ-N------YVSDCFPAVVLCLIS--SHIKMLYNRFE
OR7A_DROME/80-394RSQ-MQ----------------FCI.QAW---IEFLIMNWTCLH-Q------ASDDVYAVIYLYVVR--IQVQLLARRVE

PF03268

G5EG25_CAEEL/32-391VTN.RY----------------MLNDSTTFYSDSVVHQLAPFID.FIGCIASALAVVIYVTVNTALN--REIKHFNKELT
A8X6W9_CAEBR/10-368LQE.KI----------------LISGAVE...PAYKYSLFPALA.FLVWIITFSCLAFYALVQFSMT--REIEYFNKELQ
G0N357_CAEBE/15-367YKK.IV----------------IFGTITT...SSWYFYFDASVM.VLCAYVNFIYLPVHGLLHNAMA--REFHVFNVELE
H2W3U0_CAEJA/53-412VAG.KI----------------LFGGEPV...NKIICLAFPFIT.FLVCVVVTTCVIIYFLINCSMS--REIKYFNEELQ
O16244_CAEEL/60-411VHG.KV----------------YYGGPEQ...S.IAKRIFLIISNFYVWFISTVCLAIYIFISAALN--REVSYFNEELK
G0N363_CAEBE/25-374VHR.DI----------------TFEDAKH...SSWYWILNLITS.ILCGYSNFLFLPIHTLRAHAIT--REFEVFNLELE
O18140_CAEEL/17-370VKQ.KI----------------IVDTTTH...NNWYYFFDAGVM.ALCAYVNFLFLPIHALIQNAIA--REFHVFNEELE
E3LNY7_CAERE/33-393AAQ.KV----------------IISGKIV...IAPLYITMPFIT.LLACFIVTLCLIYYFLVNASLS--REIEYFNTELE
G0MS85_CAEBE/20-379LHE.KI----------------LYSGNVV...PPYQYSLFPALA.FLAWLITSTCLAMYVTVQFSMA--REIEYFNQELT
G0MS87_CAEBE/33-393IEG.KV----------------ILSGNDI...YPIIYFGMPCVT.LLVCFHVSAFLNCYFIVNSSLT--REIEYFNLELE
H2WA63_CAEJA/32-391VTN.RY----------------QLNDTSTFYSDSFVHQVAPFID.FIGCIASSLAIVMYVTVNTALN--REIKHFNKELT
E3LNY5_CAERE/55-405FQG.KI----------------FHGGDDA...D.IILRALLVGSSVYIWFISTICLVYYFVVFDALN--REVTYFNEELE
A8X6X0_CAEBR/35-395ATH.KI----------------LISGKPV...IAPLYIAMPFLT.LLSCFIVTHCLIYYFLVHVSLK--REIEYFNVELD
G0MS88_CAEBE/61-413FEG.KI----------------FFGGEET...N.ILFCGILVISNCYIWFISSICLAYYVLIFSAIN--RETKHFNEELE
H2W0A5_CAEJA/25-383LSE.KI----------------LWSGAVV...PSYKYSIFPALA.FLVWLITSTCLTFYALVQFSMT--REIEYFNDELQ
O45459_CAEEL/19-372CNR.VI----------------IVGTKTK...SSWYYYFDAPVM.ILCAYANFLHLPIHELIHTAFA--REFRVFNDELE
O16246_CAEEL/33-393IAQ.KI----------------LIANKTV...IAPLYIAMVFIN.LLSCFIVAICLIYYFLVNLSLS--REIRYFNTELE
G0N991_CAEBE/33-392ITN.RF----------------QLNDNSTFYSESVVHQIAPFID.FIGCIASSIAVVMYVTVNTALN--REIKHFNKELT
A8X6X1_CAEBR/32-394VQE.KV----------------ILSGHTI...YPILFYEILFIT.LLVCFHVSVFLNCFFIVNCSIT--REIEYFNSELA
E3LNY3_CAERE/17-368THN.KI----------------FYGGDET...N.IIFRVLLVVSNFYIWYISTICLAHYVLVTCAVS--REVQYFNQELE
E3LNY6_CAERE/32-392IEE.KV----------------ILSGDHI...YPIIFYGMPFVT.LLVCFHVSIFLNCYFLVNCSLY--REIEYFNTELE
O44618_CAEEL/25-384LQE.KI----------------LFSGAVV...PAYKYSLFPALA.FIVWMTTSTCLAFYALFQFSMV--RETEYFNKELQ
Q8IFZ2_CAEEL/17-368ING.KI----------------YYGGGEQ...N.FLSRIFILVTNFYIWYISTICLAIYIFISSALN--REVNYFNEELQ
E3MHA0_CAERE/16-369TKK.FV----------------IFGTSST...NSWYYYADAVIM.FLCAYVNFIFLPVHGLLQNSLA--REFGVFNEELE
G0MS86_CAEBE/36-396IGQ.KV----------------ILTGQVV...IVPLYIAMPFLT.LLACFIVTTCVIYYFIMNTSLS--REIEYFNMELE
G0PNV7_CAEBE/53-404TYG.KI----------------FYGGDES...N.IILRVLMLISNFYIWYISTVCLAHYVLVFSALN--REANYFNQELK
Q9XVJ4_CAEEL/45-398VENATI----------------YFGATEE...SKVIYRVALIISNFYIWFISTVCLAFFVLVFTSIN--REVSHFNQELE
H2WBG2_CAEJA/242-592SHK.MV----------------TYGGAKS...SHWYWIMDPIVA.ILCGYANFLFLPTHSLLHHQMA--REFDVFNDEME

PF06151

GR64A_DROME/1-455KGLSY------------------------------------------------------RFEQITTRIRKL---------
GR05A_DROME/40-438MGLSE------------------------------------------------------MLARLNRSLEQQ---------
GR64D_DROME/1-416RGLKI------------------------------------------------------RFQQLHWRIRQN---------
GR64C_DROME/1-407RGMQM------------------------------------------------------RFQQMHWRIRQH---------
GR61A_DROME/1-435IGLAQ------------------------------------------------------RFQQFAARVGAL---------
GR64F_DROME/63-463IGLAS------------------------------------------------------KFRQLNDDLRNF---------
GR64E_DROME/25-448VALAA------------------------------------------------------RFRQLNDYMMRE---------
GR64B_DROME/1-403IGLAA------------------------------------------------------RFHQLYRRIAAV---------

PF08395

Q7PKI1_ANOGA/57-400TVIGS------------------------------------------------------LLQLDDTDRQVRDSA...TGR
Q7PKI2_ANOGA/11-404LYIRQ------------------------------------------------------MRAPACHLKQ...........
Q7PKG3_ANOGA/26-401LEGDV------------------------------------------------------ADPPA................
GR93B_DROME/24-392AQLRS------------------------------------------------------LNGENNSFRN...........
GR21A_DROME/81-445DALQT------------------------------------------------------TI...................
Q7PK37_ANOGA/8-367.....------------------------------------------------------.....................
Q7PQ43_ANOGA/15-419SLQRQ------------------------------------------------------STPSVTLKGEKNPTNKVYPLN
Q7PK29_ANOGA/12-374D....------------------------------------------------------.....................
Q7PF19_ANOGA/20-402RYHDH------------------------------------------------------QARPK................
Q7PKH1_ANOGA/14-409FWYVS------------------------------------------------------LHQPVCLTGGRNHVLL.NSFA
Q7PF39_ANOGA/19-415RFLNM------------------------------------------------------LPGSATEPPV...........
GR97A_DROME/41-418GIVKE------------------------------------------------------ANMLQSPVQMNLH.......K
GR22E_DROME/18-388KLVNK------------------------------------------------------MA...................
GR77A_DROME/37-447KILAD------------------------------------------------------AEHIFESSQKA..........
GR36C_DROME/8-389QVIDE------------------------------------------------------AKDLLLSPRHQ..........
GR98C_DROME/14-394QLKDD------------------------------------------------------LEDFDCGA.............
Q8MLS6_DROME/6-364QIVKS------------------------------------------------------.....................
Q7PKH4_ANOGA/15-393KHLDT------------------------------------------------------GSWYIEQKQ............
Q7PKH2_ANOGA/13-388EKFPT------------------------------------------------------TRTADPYKHS...........
Q7PVJ7_ANOGA/11-395QLIVE------------------------------------------------------HTGGLVDRARG..........
Q7PK40_ANOGA/8-372LS...------------------------------------------------------.....................
GR85A_DROME/27-394MVLLN------------------------------------------------------RQ...................
Q7PVK1_ANOGA/8-381EHLLL------------------------------------------------------GVHRSTGPVQ...........
GR22C_DROME/17-382EMVTN------------------------------------------------------LKLD.................
G39AA_DROME/8-363HLVST------------------------------------------------------.....................
GR59D_DROME/9-389AIVTE------------------------------------------------------SQSLVPNGGG...........
GR92A_DROME/18-383IQLQK------------------------------------------------------LNTSGSKQ.............
GR08A_DROME/9-380LLAEY------------------------------------------------------SRFASETGR............
Q7PVJ8_ANOGA/8-380SWTDP------------------------------------------------------YRQET................
Q7PK13_ANOGA/41-414EYMAD------------------------------------------------------LVEQPQDTAV...........
GR22B_DROME/17-385DLVSQ------------------------------------------------------LKL..................
GR63A_DROME/100-456KALK.------------------------------------------------------.....................
GR94A_DROME/17-399AQLQE------------------------------------------------------VNLLQRKDQLKLY.......T
Q7PKI5_ANOGA/30-402SLVDR------------------------------------------------------.....................
GR36A_DROME/9-390QAIHE------------------------------------------------------SQMLSEIYPRR..........
Q7PF38_ANOGA/19-415EITIQ------------------------------------------------------DRIDPRRTYGKHTTIS.YIML
Q7PKH9_ANOGA/7-400SFETQ------------------------------------------------------QSYWSRRRV............
GR93C_DROME/18-394RQLRS------------------------------------------------------LERPVGGPVG...........
Q7PJT3_ANOGA/18-425HLKQA------------------------------------------------------ALEKRISPQRRP........S
GR68A_DROME/7-379TFNLQ------------------------------------------------------DC...................
GR09A_DROME/6-339HRVIS------------------------------------------------------GSSDY................
Q7PQT4_ANOGA/106-466RCFRQ------------------------------------------------------DV...................
Q7PK18_ANOGA/61-428HHVGL------------------------------------------------------LQCSERLGS............
GR32A_DROME/57-449GYTYG------------------------------------------------------QQHRRKEGGA...........
GR22A_DROME/19-388DMASR------------------------------------------------------LRR..................
GR22_ANOGA/73-437KELTD------------------------------------------------------VLA..................
Q7PF20_ANOGA/20-415DDTRY------------------------------------------------------ERRRGAHEIV...........
GR58A_DROME/3-389DLCSF------------------------------------------------------LNHEERNSLTL..........
GR10A_DROME/19-404SLRDE------------------------------------------------------MDGLRPGGM............
G39AC_DROME/9-372KNIKS------------------------------------------------------.....................
O18280_CAEEL/46-428QLIEE------------------------------------------------------MVPKEKEEC............
Q7PVJ9_ANOGA/29-402AGRLS------------------------------------------------------TNTVYQEQ.............
Q7PK41_ANOGA/8-377QFGAS------------------------------------------------------VYTARQ...............
Q7PK36_ANOGA/8-375QMEEI------------------------------------------------------N....................
GR58B_DROME/10-387ALHGR------------------------------------------------------.....................
GR59C_DROME/9-394CLVRQ------------------------------------------------------AECICSIRNRR..........
Q7PTR1_ANOGA/7-389DSIAG------------------------------------------------------YFKRINSRIQ...........
LITE1_CAEEL/48-425HLINE------------------------------------------------------MVPAEQDEC............
GR10B_DROME/11-372.....------------------------------------------------------.....................
Q7PI94_ANOGA/14-414EEQHP------------------------------------------------------VAGRKRFERASRLA....GNM
G39AD_DROME/8-362.....------------------------------------------------------.....................
GR36B_DROME/9-390MVIEE------------------------------------------------------SRRLSFLQLRN..........
Q7PK17_ANOGA/41-408QTAST------------------------------------------------------VGRAI................
GR58C_DROME/7-410QGVRE------------------------------------------------------MVQDLEVLPER..........
G39AB_DROME/8-372AIIDE------------------------------------------------------SAD..................
GR98A_DROME/13-370ELYRT------------------------------------------------------RYEMWS...............
GR98D_DROME/12-392QISVE------------------------------------------------------LEGNQSRDS............
GR22F_DROME/19-377D....------------------------------------------------------.....................
Q9W1V0_DROME/5-363EIVAC------------------------------------------------------QSMD.................
GR89A_DROME/10-356.....------------------------------------------------------.....................
Q7PF36_ANOGA/19-401GITVE------------------------------------------------------GKKDRHRSCSG..........
GR22D_DROME/17-386SLVCS------------------------------------------------------LRG..................
GR98B_DROME/12-392QLQEE------------------------------------------------------FQDCEQQDM............
GR59E_DROME/7-383ELKLL------------------------------------------------------QRPPQGST.............
GR28B_DROME/45-447NLAHQ------------------------------------------------------WDTRSLKAVN...........
Q8IN22_DROME/11-375DNLRF------------------------------------------------------ESGFQTAF.............

PF02949

OR22B_DROME/79-381NLRSE...........................................................................
OR24A_DROME/68-388DLLEVEN.........................................................................
OR23A_DROME/59-365EIGYG...........................................................................
OR85D_DROME/84-400SHVAG...........................................................................
OR45B_DROME/68-386DALKP...........................................................................
OR43A_DROME/56-364QIGGE...........................................................................
OR98A_DROME/74-379SLCTD...........................................................................
OR94A_DROME/69-376ETKNM...........................................................................
OR22C_DROME/69-392RIFADLHG........................................................................
OR2A_DROME/66-387RIGCRTEK........................................................................
OR45A_DROME/64-362EKDLN...........................................................................
OR33C_DROME/60-372QLGYF...........................................................................
OR46A_DROME/62-365KIGRLI..........................................................................
OR85C_DROME/62-369KQVLD...........................................................................
OR85B_DROME/63-370RHELSG..........................................................................
OR42B_DROME/76-381RLRSD...........................................................................
OR47B_DROME/88-402KLGDM...........................................................................
OR63A_DROME/74-403QATSEL..........................................................................
OR10A_DROME/70-396SMFRPYT.........................................................................
OR83B_DROME/70-476PLMELSASLDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVN
OR59C_DROME/79-385NLRQD...........................................................................
OR9A_DROME/68-381HLPAV...........................................................................
OR30A_DROME/58-366SLEKL...........................................................................
OR47A_DROME/56-375RFKGG...........................................................................
OR49B_DROME/52-364QVALK...........................................................................
OR85F_DROME/68-381DHKPS...........................................................................
OR94B_DROME/66-372ALKNA...........................................................................
OR59B_DROME/77-382SLRMD...........................................................................
OR56A_DROME/124-407EMDITRLNSKL...................................................................VI
OR85A_DROME/77-379TLRTD...........................................................................
OR33B_DROME/61-369RIGQG...........................................................................
OR46B_DROME/62-373KLGPV...........................................................................
OR33A_DROME/60-367RIGHD...........................................................................
OR88A_DROME/73-392AIDPR...........................................................................
OR59A_DROME/64-386EVGLD...........................................................................
OR7A_DROME/80-394KLGTDDSGQ.......................................................................

PF03268

G5EG25_CAEEL/32-391NSARF---------------------------------------------------------------------------
A8X6W9_CAEBR/10-368KASEE---------------------------------------------------------------------------
G0N357_CAEBE/15-367EASKN---------------------------------------------------------------------------
H2W3U0_CAEJA/53-412EAVNE---------------------------------------------------------------------------
O16244_CAEEL/60-411KAKEE---------------------------------------------------------------------------
G0N363_CAEBE/25-374KADKE---------------------------------------------------------------------------
O18140_CAEEL/17-370GASKN---------------------------------------------------------------------------
E3LNY7_CAERE/33-393EAKQE---------------------------------------------------------------------------
G0MS85_CAEBE/20-379KASEE---------------------------------------------------------------------------
G0MS87_CAEBE/33-393NIQKT---------------------------------------------------------------------------
H2WA63_CAEJA/32-391NSARF---------------------------------------------------------------------------
E3LNY5_CAERE/55-405KAKKE---------------------------------------------------------------------------
A8X6X0_CAEBR/35-395EAKQE---------------------------------------------------------------------------
G0MS88_CAEBE/61-413SAKKE---------------------------------------------------------------------------
H2W0A5_CAEJA/25-383KASED---------------------------------------------------------------------------
O45459_CAEEL/19-372NASKN---------------------------------------------------------------------------
O16246_CAEEL/33-393DAKQG---------------------------------------------------------------------------
G0N991_CAEBE/33-392NSARF---------------------------------------------------------------------------
A8X6X1_CAEBR/32-394EAQKK---------------------------------------------------------------------------
E3LNY3_CAERE/17-368KAKED---------------------------------------------------------------------------
E3LNY6_CAERE/32-392NAQRM---------------------------------------------------------------------------
O44618_CAEEL/25-384KASED---------------------------------------------------------------------------
Q8IFZ2_CAEEL/17-368KAKEE---------------------------------------------------------------------------
E3MHA0_CAERE/16-369AASKN---------------------------------------------------------------------------
G0MS86_CAEBE/36-396EAKQE---------------------------------------------------------------------------
G0PNV7_CAEBE/53-404KAKEE---------------------------------------------------------------------------
Q9XVJ4_CAEEL/45-398KSKNE---------------------------------------------------------------------------
H2WBG2_CAEJA/242-592QVSKK---------------------------------------------------------------------------

PF06151

GR64A_DROME/1-455----EHEEVCES--------------VF--IQIREHYVKM-C------------------ELLEFVDSAMS----SLIL-
GR05A_DROME/40-438----VRQPMPEA--------------YW--TWSRTLYRSI-V------------------ELIREVDDAVS----GIML-
GR64D_DROME/1-416----LGKPMAKE--------------FW--QEIRSDFLDL-D------------------SLLKLYDKELS----GLIL-
GR64C_DROME/1-407----VRQQMPNE--------------FW--QRIRCDLLDL-S------------------DLLGIYDKELS----GLIV-
GR61A_DROME/1-435----EGRHVPEA--------------LW--YDIRRDHIRL-C------------------ELASLVEASMS----NIVF-
GR64F_DROME/63-463----KGMNMAPS--------------YW--SERRIQYRNI-C------------------ILCDKMDDAIS----LITM-
GR64E_DROME/25-448----ARLPTTVD--------------YW--MQCRINFRNL-C------------------KLCEEVDDAIS----TITL-
GR64B_DROME/1-403----HRKVMPAV--------------FW--TEVREHYLAL-K------------------RLVHLLDAAIA----PLVL-

PF08395

Q7PKI1_ANOGA/57-400ERRFICNHIYLQ...............L..TILRTHHSAL.T------------------KCIQNIVEFYN....TPLA.
Q7PKI2_ANOGA/11-404..LRRQISTYEA...............L..KSVQRNHHLV.S------------------SNVKSFIHLQRSTDTVSNK.
Q7PKG3_ANOGA/26-401....LTVYDPKQT............LIL..RQIMQIFDKI.S------------------DLADKGSYYYG....IQIM.
GR93B_DROME/24-392.NPQPTRQAISN...............L..DKCLYLYDEI.H------------------QVSRSFQQLFD....LPLF.
GR21A_DROME/81-445....RGEKPAQK...............L..TEYRHLWVDL.S------------------HMMQQLGRAYS....NMYG.
Q7PK37_ANOGA/8-367....ASEELEQH...............L..DYFLHRYDRY.S------------------RLIGEVDDCYS....FPVV.
Q7PQ43_ANOGA/15-419RRPFVQEHELISG............ERL..TYMFVIHENV.A------------------KLAEFINGAYS....TQII.
Q7PK29_ANOGA/12-374....HQHEHDFEQ.............LL..CLFLERFRQY.I------------------AQIERINQCLS....APLL.
Q7PF19_ANOGA/20-402....VRDCAELV..................ETLRRTHLKL.G------------------DLTGRVVGRFG....PLIV.
Q7PKH1_ANOGA/14-409SMYFHTESGSNKQLYPL....SENETI...KTIAMIYMKL.G------------------TAVQVYNRCFF....IHIF.
Q7PF39_ANOGA/19-415..QLRGKPLIYNVLGESLKMESSRLDQL..EQLRLLHVRT.V------------------QTAGSLSEKFG....IVII.
GR97A_DROME/41-418PYYRMRRFCELAD............LL...DELARKYGFT.A------------------SRSKNYLRFTD....WSMV.
GR22E_DROME/18-388....IGETVESE..............RM..DLLLYLYHRL.L------------------DLGQRLASIYD....YQMV.
GR77A_DROME/37-447.GFWPNRQELYKGQQKWLA.LELWRLLHVHHQLLKLHRSI.C------------------SLCAVQAVCFL....GFVP.
GR36C_DROME/8-389.GVFMTKCCSLAD.............QI..ENIARIQSQL.Q------------------TIMNQMEEVFG....IQGA.
GR98C_DROME/14-394....RIQELCVT...............L..KQNQLLIGRI.W------------------RLVDEIGAYFR....WSMT.
Q8MLS6_DROME/6-364....KSTRKHRE...............L..QHLWLLHACL.T------------------KTALNINKIYA....PQML.
Q7PKH4_ANOGA/15-393..RWGRRVDPVD..............VV..SELAEDFAAL.V------------------DVVDRVNRIYS....NQIIA
Q7PKH2_ANOGA/13-388.NSSVTEVGGIV..................RCIGDIHERL.S------------------ETIVDFNYCFA....LQIL.
Q7PVJ7_ANOGA/11-395.YARLQHAVYVRS.............KL..NYLADARCRI.V------------------ACCTETHNLYQ....QMLL.
Q7PK40_ANOGA/8-372....CGRHPAQEK.............VV..YYFVERFELY.A------------------SQLRQIDQCFS....MPLT.
GR85A_DROME/27-394....LSTVAFNL...............WEIERLHTRFQCL.I------------------DLTSEVCSIFR....YVTL.
Q7PVK1_ANOGA/8-381.QETLRQLHVRP..................AGWMQYYGQL.W------------------QVCEILNDLFG....VPLI.
GR22C_DROME/17-382....CSVDSSRI..................RKYLSLYRRL.L------------------ELKGYMVATYE....YHMT.
G39AA_DROME/8-363....TTISMAGV..................AGCLRTHDEILL------------------LGQRELIAVYG....GVIL.
GR59D_DROME/9-389..VFVTKCCYLAD.............RL..ERIAKSQSDL.Q------------------ELVENLSTAYE....GEVV.
GR92A_DROME/18-383....KIRRVQNR...............L..EKCISLYREI.Y------------------HTSIMFHKLFV....PLLF.
GR08A_DROME/9-380..SFPGFESFLRR.............RL..VQKQRIYSHV.Y------------------DMLKCFQGAFN....FSIL.
Q7PVJ8_ANOGA/8-380....LRRLHFGR..................DGLMDFYGQL.W------------------QGAELANELFG....APLL.
Q7PK13_ANOGA/41-414.FRAMYAQSVDR...............L..LSLKSVYGQL.W------------------ELSDCINRNFG....WSQI.
GR22B_DROME/17-385....NPETDFSR...............I..HQFLSLYKRL.L------------------ELNRKLVIAYE....YQMT.
GR63A_DROME/100-456....HIGPAAMV..................ADYRVLWLRL.S------------------KLTRDTGNALC....YTFV.
GR94A_DROME/17-399KYYRMQRFCALAD............EL...DQLAYRYRLI.Y------------------VHSGKYLTPMS....LSMI.
Q7PKI5_ANOGA/30-402....SGEEKPST...............I..REVYMVHCEN.A------------------QLEKQFMAIMD....LPVL.
GR36A_DROME/9-390.AAFMTKCCYLAD............RI...DNIAKLQNQL.Q------------------SIVTQLNQVFG....IQGI.
Q7PF38_ANOGA/19-415QEGKERVTSPLDV............ATI..VRLSTMHMAL.M------------------RLARAANKHFG....VLML.
Q7PKH9_ANOGA/7-400..RVQQICCDASD.............TI..DRLCTLHQEL.T------------------EIVRAIVSIFQ....LPVL.
GR93C_DROME/18-394.RKQLRIVEYRV..................DECISVYDEI.E------------------RVGRTFHRLLE....LPVL.
Q7PJT3_ANOGA/18-425YWHAIKIQRPLGIASVYSNNDKSMPDVV..STVAEIQDAL.C------------------EACSYAEDYFT....IQML.
GR68A_DROME/7-379....GHMENWRE...............L..SNLIEVLCKF.R------------------YITENINCVAG....VSLL.
GR09A_DROME/6-339..............................KTLRLDYAHL.A------------------KVTRSLSHLFGL..SLLLL.
Q7PQT4_ANOGA/106-466....AIECTAAM...............I..SRYRFLWLNL.S------------------ELLQALGNAYA....RTYS.
Q7PK18_ANOGA/61-428....MRYMEFLAG.............KL..NALKALYSDL.F------------------QASVALNEAYG....RTYL.
GR32A_DROME/57-449..RARRQRGDVNPNVNPALMEHFPEDSL...FIYRMHNKL.L------------------RIYKGINDCCN....LILV.
GR22A_DROME/19-388....GDSVDPDR...............I..QLLLWLYSRL.L------------------DLNHRLTAIYD....IQVT.
GR22_ANOGA/73-437....TERPAAKL..................TEYRHLWVDL.S------------------HMMQQLGKAYS....NMYG.
Q7PF20_ANOGA/20-415..LPAGALYDYAH............LI...DLLRRTHLRL.A------------------QLLEQANGCFG....VLIV.
GR58A_DROME/3-389.SENKANRSLGK...............L..AKLFKLFAEN.Q------------------RLVREVFRTFD....LPIA.
GR10A_DROME/19-404...LLHHCCELSD............RL...EELRRRCREI.H------------------DLQRESFRMHQ....FQLI.
G39AC_DROME/9-372....SKESREFY..................YNFCKYNQVI.W------------------LSYTEINHCFG....LLLL.
O18280_CAEEL/46-428...PLPEQSLQQ...............I..HDVQIHYQEI.S------------------NAKLYIEQNFS....FSLF.
Q7PVJ9_ANOGA/29-402....IRQQHHGP..................AGYLEFYEQL.G------------------KMSETLNDLYG....VPLI.
Q7PK41_ANOGA/8-377...........................W..CLIVDRYGAA.V------------------NLVNEINHIFS....ELLL.
Q7PK36_ANOGA/8-375....TTACVEHV...............V..HVFLDRFQRY.Y------------------LLIDSVNKCFS....VPVT.
GR58B_DROME/10-387....KARKKWKA...............L..RSVAAMHLKT.L------------------RLARRIFDMFD....IANA.
GR59C_DROME/9-394GGVYSIQCCSLAD.............QL..DLIAERHYFL.K------------------DRLDEMSDLFQ....IQSL.
Q7PTR1_ANOGA/7-389.FYTTVQVVAREK.............FW..SEIHSDYVMV.C------------------ELLEHVMSICS....PLLV.
LITE1_CAEEL/48-425...PLPESSLQK...............I..HDCQISYQRI.F------------------NGKAVIEEYYS....FVLF.
GR10B_DROME/11-372....QEHDTYSD...............L..MKQLRRRERL.L------------------RIGRRVHRMFA....WLVA.
Q7PI94_ANOGA/14-414PANEPKKMSLHVIEVHGCGIDAANLKHLQLPKVLYRYNDL.Y------------------DICKLLDRYFG....LLFL.
G39AD_DROME/8-362........CQGD..............LI..SGLRGRQQIL.K------------------LCGGELNECFG....LLML.
GR36B_DROME/9-390.GAFMTRCCYLSD............QL...EDIGEVQSQL.Q------------------SMVGQLDEVFG....MQGL.
Q7PK17_ANOGA/41-408....SPEAIHRR...............L..VHLKAMQNLL.K------------------DLTGEVSDRFG....WQLF.
GR58C_DROME/7-410.NGIPREMGLMQIL...........AAW..RKLWRRCRRL.D------------------ALLKQFVDIFQ....WQVL.
G39AB_DROME/8-372....LKMTSPNR...............LRLRVCLEMHDRLML------------------LCNDEISLVYG....FIAW.
GR98A_DROME/13-370....IRRLSLQK...............L..AKLQAIHNSL.W------------------QAIRCLECYFQ....LSLI.
GR98D_DROME/12-392....VQELCVAL..................KRNQLLAGRI.W------------------GLVNEVSLYFT....LSLT.
GR22F_DROME/19-377....SHHLSSSR...............I..HALASLYDRL.L------------------KLSELVVACND....LQLI.
Q9W1V0_DROME/5-363....LERKSKEL..................RGLWALHRNL.S------------------YTARRINKHYG....PQML.
GR89A_DROME/10-356....REEPTNLA..................RLLQKEYSWL..------------------RLIQRFVKLFQ....LGIF.
Q7PF36_ANOGA/19-401RKSNTKENDITT...............I..DKLVRLHTAL.L------------------HLTWKTNAHYG....VLLL.
GR22D_DROME/17-386....NHKGSSSR...............V..RFLLKLYNKL.V------------------NLYSKLADCYD....CQTV.
GR98B_DROME/12-392....LQALCVAL..................KRNQLLLGRI.W------------------RLEGDVGSYFT....PTML.
GR59E_DROME/7-383....KLDACYESAFAVLVDAGGGSALMI..EEMRYTCNLI.E------------------QVHSQFLLRFG....LYLV.
GR28B_DROME/45-447.QKQRSLQCLDSFSMYTIV.TKDPAEII..QESMEIHHLI.C------------------EAAATANKYFT....YQLL.
Q8IN22_DROME/11-375....LRKQQRIR...............V..QKSMALFKEI.S------------------SVVTSLQDIFN....VHLF.

PF02949

OR22B_DROME/79-381....PGRTEDEY---------...LKEL--ADCVRDHRLI-L..................DYVDALRSVFS----GTIF-
OR24A_DROME/68-388..IEKSPSEAEE---------ARIVREM--EKLVDRHNEV-A..................ELTERLSGVMV----EITL-
OR23A_DROME/59-365....YKTLEENE---------....QDL--VNCIRDQNAL-Y..................RLLDVTKSLVS----YPMM-
OR85D_DROME/84-400....IGSFQHD.---------...LEFL--QATVAYHQSL-I..................HLCQDINEIFG----VSLL-
OR45B_DROME/68-386...IRDPSLRES---------KICCQRL--ADIVDRHNEI-E..................KIVKEFSGIMA----APTF-
OR43A_DROME/56-364.....EQSEEER---------...FQRL--ASCIAYHTQV-M..................RYVWQLNKLVA----NIVA-
OR98A_DROME/74-379....SGKSDAEN---------...EQDL--IKCIKDHNLI-I..................DYAAAIRPAVT----RTIF-
OR94A_DROME/69-376....KNDTIFG.---------....QQL--RAIFIMHQRI-R..................SLTLTCQRIVS----PYIL-
OR22C_DROME/69-392.DSVDVFTEEMN---------AEVRHRL--AQVVERHNAI-I..................DFCTDLTRQFT----VIVL-
OR2A_DROME/66-387.SNKGQTYEAWR---------EEVYQEL--IECIRDLARV-H..................RLREIIQRVLS----VPCM-
OR45A_DROME/64-362.....GGDSR..---------......L--TGFVSRHRIA-L..................DLAKELSSIFG----EIVF-
OR33C_DROME/60-372...DDETVVN..---------...HQRL--LDYIEQHKLL-V..................RFHNLVSRTIS----EVQL-
OR46A_DROME/62-365...TTSGGTVE.---------....QQL--KENIRYHMTI-V..................ELSKTVERLLC----KPIS-
OR85C_DROME/62-369....RDWSENS.---------....RFL--AKTVQYHQRI-L..................RLMDVLNDIFG----IPLL-
OR85B_DROME/63-370..DWKKDSRF..---------......L--VDIVRYHERI-L..................RLSDAVNDIFG----IPLL-
OR42B_DROME/76-381....ENLSEAES---------...YEEL--VKCVMDHKLI-L..................RYCAIIKPVIQ----GTIF-
OR47B_DROME/88-402....EVSDKR..---------..FHEEF--CRVVRFHQHI-I..................KLVGKANRAFN----GAFN-
OR63A_DROME/74-403...VPPDRRVEY---------......L--RCCIYQYQRV-A..................NFATEVNNCFR----HITF-
OR10A_DROME/70-396..DHLELSPVQL---------YILEQKM--RSVIIRHNAI-I..................DLTRFFRDRYT----IITL-
OR83B_DROME/70-476GANPNGLTKKQE---------MMVRSAI--KYWVERHKHV-V..................RLVAAIGDTYG----AALL-
OR59C_DROME/79-385....PKLSEMEH---------...YEQM--VACIQDHRTI-I..................QCSQIIRPILS----ITIF-
OR9A_DROME/68-381...GGKEELEG.---------......L--VQVLLLHQKG-L..................QIADHIADKYR----PLIF-
OR30A_DROME/58-366....KNEQVRGE---------......I--IWCIKYQLKL-S..................GFVDSMNALNT----HLHL-
OR47A_DROME/56-375.....SLKESQ.---------....ATL--NKVFALYQTS-L..................DMCNDLNQCYQ----PIIC-
OR49B_DROME/52-364....HPYGDRDP---------RELREEI--IACIRYQQSI-I..................EYMDHINELTT----MMFL-
OR85F_DROME/68-381....VKHDQEDR---------....KFI--AKIVDKQVHL-V..................SLQNDLNGIFG----KSLL-
OR94B_DROME/66-372....AEEKAR..---------....PEL--RRIFQLHTKV-R..................RLTRECEVLVS----PYVL-
OR59B_DROME/77-382....PERSEADN---------...YQDL--VNCVLDHKTI-L..................KCCDMIRPMIS----RTIF-
OR56A_DROME/124-407GRLTASELTFWQ---------...MQLF--KEFVKEQLRI-R..................KFVQELQYLIC----VPVM-
OR85A_DROME/77-379....VEKGDDQH---------...YAEL--VECVKDHKLI-V..................EYGNTLRPMIS----ATMF-
OR33B_DROME/61-369....PEETIYLT---------...GKQL--IESIEDHRKL-M..................KIVELLRSTMN----ISQL-
OR46B_DROME/62-373....IEPQDNEK---------..IAMEL--RECAAYYNRI-V..................RFKDLVELFIK----GPGS-
OR33A_DROME/60-367....VKLSSSEN---------...TRKL--IEGIQDHRKL-M..................KIIRLLRSTLH----LSQL-
OR88A_DROME/73-392....QSLTDEKR---------..FFVDL--RLLVQRQQLL-N..................GLCRKYNDIFK----VAFL-
OR59A_DROME/64-386....PARDAE..---------....KDL--EACITDHKHI-LEWAGGSLVRVLFTFQLFSRLFRRIEAFIS----LPML-
OR7A_DROME/80-394VEIYPDERRQEE---------..HCAEL--QRCIVDHQTM-L..................QLLDCISPVIS----RTIF-

PF03268

G5EG25_CAEEL/32-391----QQLTLPQV---------------L--NNYSKRHSDL-I------------------QLTRFVNQQMS----KYGS-
A8X6W9_CAEBR/10-368----KKLKDHTV---------------I--SEFSFRQKEL-I------------------KLVKKANESLS----SYAK-
G0N357_CAEBE/15-367----KDLVNPVT---------------L--QKFADRQIKL-F------------------EVTNRITGRLH----GFMS-
H2W3U0_CAEJA/53-412----NRLHNEQV---------------L--LDFCHRQAEL-I------------------RLVRKANESLT----SYAG-
O16244_CAEEL/60-411----KTLRNIGV---------------L--EKFDFRQNQI-L------------------EMILFAHESLS----SLGG-
G0N363_CAEBE/25-374----KKLTNLSV---------------I--REFGARQIKL-F------------------EYANFLTERME----RFMT-
O18140_CAEEL/17-370----KELLNPAI---------------F--QTFADRQIKM-F------------------EYTNALTTRLM----PFMS-
E3LNY7_CAERE/33-393----KRLHDSSI---------------L--LEFCHRQAEL-V------------------RLVEKANESLS----SYAT-
G0MS85_CAEBE/20-379----KKLKEHAT---------------I--IAFSTRQSDL-I------------------KLVKHSNEFLK----SYAM-
G0MS87_CAEBE/33-393----KQLHKPDV---------------L--LEFSHRQAEL-I------------------SFVRNANKSLG----SYTF-
H2WA63_CAEJA/32-391----QQLTLPQV---------------L--NSYSKRHSDL-I------------------QLTQFVNRNLS----KYGA-
E3LNY5_CAERE/55-405----RILTTAGV---------------L--ETFDIRQYEI-F------------------NLIIFTNHALS----FFGS-
A8X6X0_CAEBR/35-395----KRLHDPIT---------------L--MDFSHRQAEL-F------------------RLVAKANESLG----SYVQ-
G0MS88_CAEBE/61-413----KTLKNIEV---------------L--EKFDYRQNEI-L------------------NIVLFINESLS----FFGG-
H2W0A5_CAEJA/25-383----KKLKEANV---------------F--SEFSFRQKEL-F------------------KLVVKTNESLS----SYAR-
O45459_CAEEL/19-372----KELLNPQT---------------F--QRFADRQIKM-F------------------ECINPLTERMN----RLMA-
O16246_CAEEL/33-393----RRLQISGV---------------L--SDFCHRQAEL-I------------------RVVRETNESLQ----SYAT-
G0N991_CAEBE/33-392----QQLTLPQV---------------L--DNYSKRHSDL-I------------------QLTRFVNRHLT----VYGA-
A8X6X1_CAEBR/32-394----KNLANSDL---------------I--SRFSNRQCEL-I------------------DWVRNANKSVG----GYTC-
E3LNY3_CAERE/17-368----KFLKNIGV---------------L--EKFDFRQNEI-L------------------EMILLANGSLS----SLGT-
E3LNY6_CAERE/32-392----KQLNNPDL---------------M--AKYSNRQAEL-I------------------HLVRSANKSLG----GYTF-
O44618_CAEEL/25-384----KKLKDPTV---------------I--ADFSYRQREL-L------------------KLVNETNEFLQ----SYAK-
Q8IFZ2_CAEEL/17-368----KTLKNIGV---------------L--EKFDIRQNEI-L------------------EMILVTNGSLS----SLGG-
E3MHA0_CAERE/16-369----KELVNPQI---------------I--HKFADRQIKM-F------------------EMTNTITERLH----PFMS-
G0MS86_CAEBE/36-396----ERLHDPCI---------------L--MNFCHRQAEL-I------------------RLVTKANESLG----SYAT-
G0PNV7_CAEBE/53-404----RLLKNIGV---------------L--EKFDFRQNEI-L------------------EMILSANESLS----SFGC-
Q9XVJ4_CAEEL/45-398----KTLKSIGI---------------L--EKFDFRQNEI-L------------------ELILFANQSLS----SFGS-
H2WBG2_CAEJA/242-592----NMLANRET---------------L--RNFANRQLKL-F------------------EFTNTMTARMD----KLMI-

PF06151

GR64A_DROME/1-455-LSCVNNL-YFVCYQLL--NVFNKLR-------------.WPINYIY---FW------YSLLYLIGRT-----AFVFLTA
GR05A_DROME/40-438-ISFGSNL-YFICLQLL--KSINTMP-------------.SSAHAVY---FY------FSLLFLLSRS-----TAVLLFV
GR64D_DROME/1-416-VCCAHNM-YFICVQVY--HSFQVKG-------------.AFMDELY---FW------FCLLYVISRL-----MNMMLAA
GR64C_DROME/1-407-LSCAHNM-YFVCVQIY--HSFQSKG-------------.NYADELY---FW------FCLSYVIIRV-----LNMMFAA
GR61A_DROME/1-435-VSCANNV-YVICNQAL--AIFTKLR-------------.HPINYVY---FW------YSLIFLLART-----SLVFMTA
GR64F_DROME/63-463-VSFSNNL-YFICVQLL--RSLNTMP-------------.SVAHAVY---FY------FSLIFLIGRT-----LAVSLYS
GR64E_DROME/25-448-LCFSNNL-YFICGKIL--KSMQAKP-------------.SIWHALY---FW------FSLVYLLGRT-----LILSLYS
GR64B_DROME/1-403-LAFGNNM-SFICFQLF--NSFKNIG-------------VDFLVMLA---FW------YSLGFAVVRT-----LLTIFVA

PF08395

Q7PKI1_ANOGA/57-400.LIMLYQF.LIIIS.................................---..............................
Q7PKI2_ANOGA/11-404.LIVISFR.YNAPTQIF..YAYTSIVQDIK....NDVDVPLGTYMSS---IL......FAVFEAVQFY......YIVSAS
Q7PKG3_ANOGA/26-401.VSIAGSF.VYLMFYTFAFTLVIRSVL.........PAEIVFNAGPI---IS......YSMFAYNVFI.......VAFYG
GR93B_DROME/24-392.LSLAQSL.LAMSMVSY..HAILRRQ.............YSFNLWGL---VI......KLLIDVVLLT......MSVHSA
GR21A_DROME/81-445.MYCLVIF.FTTIIATY..GSISEII............DHGATYKEV---GL......FVIVFYCMGL.......LYIIC
Q7PK37_ANOGA/8-367.LVLLLVM.LQLIYLAE..HLYSTIETGTM....MPVADNFFYSLFG---QV......WQTMYGALGY.....YCISACG
Q7PQ43_ANOGA/15-419.AIVTVTF.VNTLFGFF...IVTKLLFWN......YQMLDLILRACR---YA......FECIPACLLV.....YYMLIVC
Q7PK29_ANOGA/12-374.GMLLQAL.IELAYFMYEWFRVISTG...........QVVNGNYVSV---QQ......WITSQFWQLMYGNVLLLLVPSC
Q7PF19_ANOGA/20-402.CTVLSSF.VVLNLELF..NVYKATGRGSK...RVWSASEGFRLVHT---LL......WIGLHGAKIL......LILYPG
Q7PKH1_ANOGA/14-409.YIIASAFGLNLVSCFTIIHVYLASSS..........YSIVDPIMIS---QL......FLSLFFILII.....MQVMFAG
Q7PF39_ANOGA/19-415.LIVIAAF.ASVNIELL..EFYQSIKL.........GTLTPTTIFMK---FL......YAASKFSFYI......LIAYPN
GR97A_DROME/41-418.LSMLMNL.LGITMGCY..NQYLAIADHYI....NEEPFDLFLAIVL---VV......FLAVPFLELV......MVARIS
GR22E_DROME/18-388.MVMVSFL.IANVLGIYFFIIYSISLN..........KSLDFKILVF---VQ......ALVINMLDFW......LNVEIC
GR77A_DROME/37-447.LECTIHL.FFTYFMKYSKFILRKYGR..........SFPLNYFAIA---FL......VGLFTNLLLV.....ILPTYYS
GR36C_DROME/8-389.MTYGGYY.LSSVGTCY..LAYSILKHGY.....ENLSMTLSTVILA---YS......WCFFYYLDGM......LNLSVM
GR98C_DROME/14-394.LLFLYNG.LTILHVVN..WAIIRSIDP........NDCCQLNRLGS---IT......FLSFNLLLTC......FFSECC
Q8MLS6_DROME/6-364.ASRFDNF.VNGVIQAYWGAVFTFDL.................STPF---FWV....VYGSVQYHVRC......LDYYLI
Q7PKH4_ANOGA/15-393LITGVGMFSIFVIYATS..FSYYVGR............SRETRLTLI---LL......TACVVYIIMI.....GLIFFTG
Q7PKH2_ANOGA/13-388.LMMASAFGYTLFSIFGLIHAFSQVEE..........DESHQVSMNN---MV......YGCIYLSFII......QVVVAG
Q7PVJ7_ANOGA/11-395.SCSFLCMTFIVTQLLY..LHYRTRS............ELSFAALGH---ET......FTCLLCYFEV.....YCIAEAC
Q7PK40_ANOGA/8-372.MIVLLVL.IEMVYLVF..DIYAVLALD.......RPVFMENLEIDY---VQ......WALRQLWQTIY...GAVVLLTV
GR85A_DROME/27-394.AYMARNL.WSGIVAGYLLVRFVIGN............GLQDVELVY---LV......FSFITCIQPL......MLSLLV
Q7PVK1_ANOGA/8-381.TYCLMSL.MHLTFICY..VMLTKMMV..........EWHNFSVVQN---VLAGVELMWTVFELLCLM......RIVSTF
GR22C_DROME/17-382.LVLTTGL.ASNFLAIYSWIVLDISM...........NINFIYLLIF---PL......FLLVNVWNLW......LSIAAS
G39AA_DROME/8-363.FLFIYQ..VMQCILIFYISNLEGFH............SSNDLVLIF---CW........LAPMLFYL......ILPLVV
GR59D_DROME/9-389.CLVITYY.LNMLGTSY..LLFSISKYGN.....FGNNLLVIITLCG---IV......YFVFYVVDCW......INAFNV
GR92A_DROME/18-383.LALIYKV.LLIALIGF..NVAVEFY...............LNSFIF---WI......LLGKHVLDLF......LVTVSV
GR08A_DROME/9-380.AVLLTIN.IRIAVDCY..FMYYSIY...............NNVINN---DY......YLIVPALLEI.....PAFIYAS
Q7PVJ8_ANOGA/8-380.AYLAIAF.IHTTTIYYRVWSQLAGGLEN......QPLVITVHLIVQ---LV......WVTMDLMFLM......AVVGSC
Q7PK13_ANOGA/41-414.CNFTGNF.VQLSCDLY..WLYMSMK...........WFEATEYKVV---IV......ITLLPSTSII.....VLLLSSA
GR22B_DROME/17-385.LFIIAQL.SGNIVVIYFLIVYGLSM...........RTYSIFLVAF---PN......SLLINIWDFW......LCIAAC
GR63A_DROME/100-456.FMSLYLF.FIITLSIY..GLMSQLSEG........FGIKDIGLTIT---AL......WNIGLLFYIC.....DEAHYAS
GR94A_DROME/17-399.LSLICHL.LGITVGFY..SLYYAIADTLI....MGKPYDGLGSLIN---LV......FLSISLAEIT......LLTHLC
Q7PKI5_ANOGA/30-402.LLNGWYF.YMIVVSVY..YMYTSTMVEVRRGFGVEDVTKYFNSVTF---FL......YLAVQLYYMM.........SIP
GR36A_DROME/9-390.MVYGGYY.IFSVATTYITYSLAINGIE.......ELHLSVRAAALV---FS......WFLFYYTSAI......LNLFVM
Q7PF38_ANOGA/19-415.IIVLSTF.IQINMLLL..ELYHNISH.........PVMPEYCLWVL---FL......HAIVHFTFFF......VIATSN
Q7PKH9_ANOGA/7-400.LMNLNQF.IVIVSRIYFVYILSAQVKHR......SDYMSYHRFFNS---IL......YICFEAVQCF......LLALGS
GR93C_DROME/18-394.IILLGKI.FATTILSYEVIIRPELY............ARKIGMWGL---VV......KSFADVILLT......LAVHEA
Q7PJT3_ANOGA/18-425.TIVTIVF.LIIVFNSY..YVLDALLGSTS...LDSPFSKGQFAMFF---LC......QAMVYGFGVF......NIVYGS
GR68A_DROME/7-379.FYFGFSF.YTVTNQSY..LAFATLTAGSL....SSKTEVADTIGLS---CI......WVLAETITMI......VICSAC
GR09A_DROME/6-339NVLCLGDW.IIVCNVYFMVAYLQVLP............ATLFLFGQV---MF......VVCPTLIKIW......SICAAS
Q7PQT4_ANOGA/106-466.TYCLFMF.VNITVAIY..GALSEII............DHGFGFSFK---EI......GLIVDTVYCS.....TLLFIFC
Q7PK18_ANOGA/61-428.IIYCKNY.IHILSNSY..WVVFWLL............NNQRHHAAR---II......SRLICRIILL.....GATFYIN
GR32A_DROME/57-449.SFLGYSF.YTVTTNCY..NLFVQITGK........GMVSPNILQWC---FA......WLCLHVSLLA......LLSRSC
GR22A_DROME/19-388.LFMATLFSVNIIVGHVLVICWINITR..........FSLLVIFLLF---PQ......ALIINFWDLW......QGIAFC
GR22_ANOGA/73-437.IYCLVIF.FTTIIATY..GSLSEII............EHGATYKEV---GL......FVIVFYCMSL.......LFIIC
Q7PF20_ANOGA/20-415.FTTTASF.VVLSLQFF..EIYRATTVRP......WTVTDTYLLVYT---VL......WIVLHAAKVL......MILYPA
GR58A_DROME/3-389.LLLLKMF.VTNVNLVYHGVQFGNDTI..........ETSSYTRIVG---QW......VVISHYWSAV.....LLMNVVD
GR10A_DROME/19-404.GLMLSTL.INNLTNFY..TLFHMLAKQ.......SLEEVSYPVVVG---SV......YATGFYIDTY......IVALIN
G39AC_DROME/9-372.LVTGLIL.LITPSGPF..YLVSTIFEGRF....RQNWQFSLMSFTA---IL......WSLPWIVLLV......LAMGRN
O18280_CAEEL/46-428.YTYGCCI.PLTCLLGY..IAFRNGI...........QADMAETFSV---AI......WLTNTMLALM......LFSIPA
Q7PVJ9_ANOGA/29-402.TYFLMTL.IHLTFVCY..MTLTKVLTK.......WSYLSWHALLIA---GI......AVTSNVIDLL.....CLMKIVG
Q7PK41_ANOGA/8-377.VMLVQVQ.VQLCCQYF..ILFCSTVDGL......VPIVTGLTVLHT---QL......WESLFLLMLL......VVGYAC
Q7PK36_ANOGA/8-375.HTLLLIV.LERTVAAY..DVFENLR...........GESKMILWDF---YRLLYRQVWEITYIVLMV......LLAINC
GR58B_DROME/10-387.TVFINMF.MTAINILYHAVQYSNSSIKSN....GWGILFGNGLIVF---NF......WGTMALMEML.....DSVVTSC
GR59C_DROME/9-394.SMSLVYF.FSTMGSIY..FSVCSILYSS.....TGFGSTYWGLLLI---VL......STASFYMDNW......LSVNIG
Q7PTR1_ANOGA/7-389.VSCGTNL.YLICYQLF..HLVDRTD.............DFIIVTVF---TY......FSLFFIILRT.....FLTMHYC
LITE1_CAEEL/48-425.YSYGVCI.PIFCFLMF..VGMSAQS............ICWSEVVSI---VI......WIVNAILVLL......LFSLPA
GR10B_DROME/11-372.IALIYLV.FFNTATIYLGYTMFIQKHDA.....LGLRGRGLKMLLT---VV......SFLVILWDVV......LLQVIC
Q7PI94_ANOGA/14-414.LTFTSIF.IVTTIQLY..YSYTILYWFT.....GENGFTIWSLMVC---LN......TISINLGVLL......TIVLLC
G39AD_DROME/8-362.PIVALVL.LMAPSGPF..FLISTVLEGK.....FRPDECLIMLLTS---ST......WDTPWMIMLV......LMLRTN
GR36B_DROME/9-390.MAYSEYY.LSIVGTSYMSYSIYKYGPH.......NLKLSAKTSIIV---CI......LITLFYLDAL......VNCNNM
Q7PK17_ANOGA/41-408.AVITMLF.ICTTIDGY..WMYASLH...........YDGNLYKVES---FL......CGISPVLMFF......VLFNTC
GR58C_DROME/7-410.FNLLTTY.IFSIAVLFRLWIYLEFD.............KNFHLWKG---IL......YAIIFLTHHV.....EIVMQFS
G39AB_DROME/8-372.LSWMFAS.LDVTGVIYLTMVIQTKK............SIVLKLITN---VV......WLSPTFMTCA.......ASFMS
GR98A_DROME/13-370.TLLMKFF.IDTSALPY..WLYLSRVE..........HTRVAVQHYV---AT......VECIKLLEIV......VPCYLC
GR98D_DROME/12-392.LLFLYNE.LTILQIVN..WALIKSVNP........NECCQYRRVGT---CL......LLSINIFLSC......LYSEFC
GR22F_DROME/19-377.LMLIIYL.IGNTVQIFFLIVLGVSM............NKRYIYLVA---SP......QLIINFWDFW......LNIVVC
Q9W1V0_DROME/5-363.AMRFDYF.IFSIINACIGTIYSTTDQ.........EPSLEKIFGSL---IY......WVRSFDFFLN........DYIC
GR89A_DROME/10-356.LLVLGSF.VNIMVNIYAFMSYYVSL...........HGVPLTISNN---CL......VLAIQLYAVI......LAAHLC
Q7PF36_ANOGA/19-401.IIMLYSF.IQISVILA..ELYFDNY...........DLPLVFVGIC---LT......HAAVYFMFFL......IIAHAN
GR22D_DROME/17-386.LMMAIFL.AANIIVCFYMIVYRISLS.........KMSFFVMLIMF---PL......AIANNFMDFW......LSMKVC
GR98B_DROME/12-392.LLFLYNG.LTILHMVN..WAYINKFLY........DSCCQYERFLV---CS......TLLVNLLLPC......LLSQRC
GR59E_DROME/7-383.LNLLNSL.VSICVELYLIFNFFETPL..........WEESVLLVYR---LL......WLAMHGGRIW......FILSVN
GR28B_DROME/45-447.TIISIAF.LIIVFDAY..YVLETLLGKSK....RESKFKTVEFVTF---FS......CQMILYLIAI.....ISIVEGS
Q8IN22_DROME/11-375.LSALLTL.LQVLVVWY..KMIIDLG............FSDFRIWSF---SL......KNLIQTLLPV.....LAIQEAA

PF02949

OR22B_DROME/79-381-VQFLLIG-IVLGLSMINIMFFST..-------------.LSTGVAV...VL------FMSCVSMQTF------PFCYLC
OR24A_DROME/68-388-AHFVTSS-LIIGTSVVDILLFSG..-------------..LGIIVY...VV------YTCAVGVEIF------LYCLGG
OR23A_DROME/59-365-VQFMVIG-INIAITLFVLIFYVE..-------------TLYDRIYY...LC------FLLGITVQTY------PLCYYG
OR85D_DROME/84-400-SNFVSSS-FIICFVGFQMT.IGS..-------------KIDNLVML...VL------FLFCAMVQVF------MIATHA
OR45B_DROME/68-386-VHFVSAS-LVIATSVIDILLYSG..-------------..YNIIRY...VV------YTFTVSSAIF------LYCYGG
OR43A_DROME/56-364-VEAIIFG-SIICSLLFCLNIITS..-------------.PTQVISI...VM------YILTMLYVLF------TYYNRA
OR98A_DROME/74-379-VQFLLIG-ICLGLSMINLLFFAD..-------------.IWTGLAT...VA------YINGLMVQTF------PFCFVC
OR94A_DROME/69-376-SQIILSA-LIICFSGYRLQHVGIRD-------------NPGQFISM...LQ------FVSVMILQIY------LPCYYG
OR22C_DROME/69-392-MHFLSAA-FVLCSTILDIMLNTS..-------------.SLSGLTY...IC------YIIAALTQLF------LYCFGG
OR2A_DROME/66-387-AQFVCSA-AVQCTVAMHFLYVADDH-------------DHTAMIIS...IV------FFSAVTLEVF------VICYFG
OR45A_DROME/64-362-VKYMLSY-LQLCMLAFRFSRSGW..-------------.SAQVPFR...AT------FLVAIIIQLS------SYCYGG
OR33C_DROME/60-372-VQLGGCG-ATLCIIVSYMLFFVG..-------------DTISLVYY...LV------FFGVVCVQLF------PSCYFA
OR46A_DROME/62-365-VQIFCSV-LVLTANFYAIAVLSD..-------------ERLELFKY...VT------YQACMLIQIF------ILCYYA
OR85C_DROME/62-369-LNFMVST-FVICFVGFQMTVGVP..-------------.PDIMIKL...FL------FLFSSLSQVY------LICHYG
OR85B_DROME/63-370-LNFMVSS-FVICFVGFQMTVGVP..-------------.PDIVVKL...FL------FLVSSMSQVY------LICHYG
OR42B_DROME/76-381-TQFLLIG-LVLGFTLINVFFFSD..-------------.IWTGIAS...FM------FVITILLQTF------PFCYTC
OR47B_DROME/88-402-AQLMASF-SLISISTFETMAAAAV.-------------DPKMAAKF...VL------LMLVAFIQLS------LWCVSG
OR63A_DROME/74-403-TQFLLSL-FNWGLALFQMSVGLGNN-------------SSITMIRM...TM------YLVAAGYQIV------VYCYNG
OR10A_DROME/70-396-AHFVSAA-MVIGFSMVNLLTLGN..-------------NGLGAMLY...VA------YTVAALSQLL------VYCYGG
OR83B_DROME/70-476-LHMLTST-IKLTLLAYQATKING..-------------VNVYAFTV...VG------YLGYALAQVF------HFCIFG
OR59C_DROME/79-385-AQFMLVG-IDLGLAAISILFFPN..-------------TIWTIMAN...VS------FIVAICTESF------PCCMLC
OR9A_DROME/68-381-LQFFLSA-LQICFIGFQVADLFP..-------------.NPQSLYF...IA------FVGSLLIALF------IYSKCG
OR30A_DROME/58-366-VEFLCFG-AMLCVLLFSLIIAQT..-------------.IAQTVIV...IA------YMVMIFANSV------VLYYVA
OR47A_DROME/56-375-AQFFISS-LQLCMLGYLFSITFA..-------------.QTEGVYY...AS------FIATIIIQAY------IYCYCG
OR49B_DROME/52-364-FELMAFS-ALLCALLFMLIIVSG..-------------.TSQLIIV...CM------YINMILAQIL------ALYWYA
OR85F_DROME/68-381-LSLLTTA-AVICTVAVYTLIQGP..-------------.TLEGFTY...VI------FIGTSVMQVY------LVCYYG
OR94B_DROME/66-372-SQVVFSA-FIICFSAYRLVHMGFKQ-------------RPGLFVTT...VQ------FVAVMIVQIF------LPCYYG
OR59B_DROME/77-382-VQFALIG-SVLGLTLVNVFFFSN..-------------.FWKGVAS...LL------FVITILLQTF------PFCYTC
OR56A_DROME/124-407-ADFIIFS-VLICFLFFALTVGVP..-------------SKMDYFFM...FI------YLFVMAGILW------IYHWHA
OR85A_DROME/77-379-IQLLSVG-LLLGLAAVSMQFYNT..-------------.VMERVVS...GV------YTIAILSQTF------PFCYVC
OR33B_DROME/61-369-GQFISSG-VNISITLVNILFFAD..-------------NNFAITYY...GV------YFLSMVLELF------PCCYYG
OR46B_DROME/62-373-VQLMCSV-LVLVSNLYDMSTMSI..-------------ANGDAIFMLKTCI------YQLVMLWQIF------IICYAS
OR33A_DROME/60-367-GQFLSSG-INISITLINILFFAE..-------------NNFAMLYY...AV------FFAAMLIELF------PSCYYG
OR88A_DROME/73-392-VSNFVGA-GSLCFYLFMLSETSD..-------------.VLIIAQY...IL------PTLVLVGFTF------EICLRG
OR59A_DROME/64-386-IQFTVTA-LNVCIGLAALVFFVS..-------------EPMARMYF...IF------YSLAMPLQIF------PSCFFG
OR7A_DROME/80-394-VQFLITA-AIMGTTMINIFIFAN..-------------.TNTKIAS...II------YLLAVTLQTA------PCCYQA

PF03268

G5EG25_CAEEL/32-391-LVPLFTL-ISFVNAAYIVGSFKSVM-------------DPAIYVLL---NG------WTIVCMGITV------AGLSPP
A8X6W9_CAEBR/10-368-VAPLFCF-FSIINAIFNLS.FFSAV-------------PLPYAFGL---IF------LLACTIGMTI------LSLLPA
G0N357_CAEBE/15-367-SAPFLIL-TALTNVTFLVTNLRADT-------------PTYYYVCL---IG------MMICCIIISS------NLLYPV
H2W3U0_CAEJA/53-412-IAPIFCF-YGFINGIYIAS.FQDVL-------------STLEFSIL---LF------NLIAVIAMTI------FTLQPT
O16244_CAEEL/60-411-FVPLFMY-WGLANGVYLTS.FVYDV-------------PLLYAIIV---GF------NLASIIFYNV------FVMFPA
G0N363_CAEBE/25-374-WAPAFAL-LAFVMAVYIITEFADKP-------------PVLYLICL---IA------WIITCFIINF------SLMYPV
O18140_CAEEL/17-370-SAPFLIL-TALANVTFIFTNLGSLI-------------DTYYYICM---IG------LMICCIIISS------NLMYPP
E3LNY7_CAERE/33-393-TAPMFCF-TSCINAVFIASGFSSSL-------------PSVIFAIL---LF------NLFAVIAITF------FTLRPA
G0MS85_CAEBE/20-379-VAPLFCF-FSIISAIYNLS.FSSIV-------------PVPYFIGL---IF------FMASIIGWLV------LSMMPA
G0MS87_CAEBE/33-393-TTPISMF-NACINGVYIFFAYHDDL-------------PLIQAVIL---SL------NVFATLFMTF------FSLRAA
H2WA63_CAEJA/32-391-IVPFFTL-TSFVNVAYIVGSFKESL-------------DPVMNVLF---YL------WMFLAMALTI------AGLAPL
E3LNY5_CAERE/55-405-LVPLFLF-YGLVNGVYLTT.FIETT-------------PLIYFGIL---GF------NLAAIMFYNL------TMLFPT
A8X6X0_CAEBR/35-395-VAPMFCF-NSCINAVYIASGFTDDL-------------PSVFFAIL---LF------NLFAVLAISF------MTLRPA
G0MS88_CAEBE/61-413-LVPLFLF-YGLVNGVYLTA.FMDSV-------------PLLYFAIL---MF------NLAAIIFYNL------AILLPA
H2W0A5_CAEJA/25-383-IAPLFCF-FSIINIIYSLS.FFTHV-------------PLPYAISL---IA------LLLNILGWTV------LTLIPA
O45459_CAEEL/19-372-FAPLFIL-TALTNVLYLVTNLRSAT-------------HTLYFICM---VG------MLISCIIISK------ILLYPP
O16246_CAEEL/33-393-VAPLFAF-NSLINAVFIASGFSSSL-------------PPVVFGVL---LF------DLFAVIGLTF------FTLRPA
G0N991_CAEBE/33-392-IVPSFSM-IALVNAGYIVGGFQTGV-------------DPVVRILL---YG------ITFICMGITV------AGLSPL
A8X6X1_CAEBR/32-394-TTPISLF-NSCIMAVYVFFSFHDNL-------------PFIQAVIL---NI------NVFATLFMTY------FSLKPV
E3LNY3_CAERE/17-368-FAPLFLF-YGLVNGVYLTS.FMDSV-------------PLFYFVIL---MF------NFAAVIVYNL------CILFPT
E3LNY6_CAERE/32-392-TTPISMF-NACINAIYIFFSFREEL-------------PLISGVIM---TL------NIFATIFMTY------FSIRPA
O44618_CAEEL/25-384-VAPLFCF-FSIINAIFNLS.FFSFV-------------PVPYAIML---VF------LLACIIGMII------LSLLPA
Q8IFZ2_CAEEL/17-368-FAPFFLL-WSLINGIYITS.FFNSN-------------PLLYSIIL---GF------NLAAIIFYIF------FVLIPP
E3MHA0_CAERE/16-369-AAPFLVF-TALANVSFLVTNLREGT-------------PTYYYVCM---IG------MMICCIIISS------NLLYPP
G0MS86_CAEBE/36-396-TAPMFCF-NGCINAVYIASGFNKAL-------------PSVIFAIL---LF------NLFAVLAMTF------FTLRAA
G0PNV7_CAEBE/53-404-FAPLFLF-YGLVNGVYLTS.FNDSV-------------PLLYFVIL---LF------NLAAIIFYNM------CILFPA
Q9XVJ4_CAEEL/45-398-VTPLFLF-YGLINGVYLTS.FFDDL-------------PTLYKVIL---GL------NLAAIIIYNF------IILSTA
H2WBG2_CAEJA/242-592-WAPFFTL-MALLMGTYIISVFAKTP-------------KVLYLLCI---IA------LTISTFFMSL------TLLYPI

PF06151

GR64A_DROME/1-455ADINE----ESKRGLGVL-----------------RRV------SSRSWCVE--VERLIFQMT-TQTV----ALSGKK-F
GR05A_DROME/40-438SAIND----QAREPLRLL-----------------RLV------PLKGYHPE--VFRFAAELA-SDQV----ALTGLK-F
GR64D_DROME/1-416SSIPQ----EIKDISNTL-----------------YEV------RSSPWCDE--LGRLSEMLR-NETF----ALSGMG-Y
GR64C_DROME/1-407SSIPQ----EAKEISYTL-----------------YEI------PTEFWCVE--LRRLNEIFL-SDHF----ALSGKG-Y
GR61A_DROME/1-435SKIHD----ASLLPLRSL-----------------YLV------PSDGWTQE--VQRFADQLT-SEFV----GLSGYR-L
GR64F_DROME/63-463SSVHD----ESRLTLRYL-----------------RCV------PKESWCPE--VKRFTEEVI-SDEV----ALTGMK-F
GR64E_DROME/25-448SSIND----ESKRPLVIF-----------------RLV------PREYWCDE--LKRFSEEVQ-MDNV----ALTGMK-F
GR64B_DROME/1-403SSIND----YERKIVTAL-----------------RDV------PSRAWSIE--VQRFSEQLG-NDTT----ALSGSG-F

PF08395

Q7PKI1_ANOGA/57-400.........EAEKTGVLL..N-EF.........L-PTD------PNPRVERC..IESFAIELL.HEDF....KINNCG-M
Q7PKI2_ANOGA/11-404SEITEEVRKHAEKTGVLL..N-EF.........L-PTD------PNPRVERC..IESFAIELL.HEDF....KINNCG-M
Q7PKG3_ANOGA/26-401NALKQ....QCAQLCFAS.TF-DFVL....VFGL-IST------LCESVKLT.LLRMFLMQLG.HRSP.....MITCG-L
GR93B_DROME/24-392VNGSR....LIRRLSFEN...-...........F-YVT------DSQSYHQK..LELFLGRLQ.HQEL....RVFPLG-L
GR21A_DROME/81-445NEAHY....ASRKVGLDFQTK-LLN.......IN-LTA------VDAATQKE..VEMLLVAIN.KNPP....IMNLDG-Y
Q7PK37_ANOGA/8-367T.ASE....EVEETALCT..R-HF........DD-YRL------QNTRAAKQ..IQNFLLKNL.HQKK....KFSACG-F
Q7PQ43_ANOGA/15-419ASTHS....ELFKSASLL..H-KLLQ....YKSN-YFI------DDQALFER..SKAIALQLL.HRKRF..SLFDGSG-L
Q7PK29_ANOGA/12-374EQASN....EVEETALCT..R-HF........DD-YRL------QNTRAAKQ..IQNFLLKNL.HQKK....KFSACG-F
Q7PF19_ANOGA/20-402HRARV....ECERTGPTL..Y-EIA.......SR-YEA------AG.RSNSA..LMKFAGQLL.LLHGK.RHHCKACG-L
Q7PKH1_ANOGA/14-409NLLHK....KAKQTAILL...-............-..H------KAAIYNDC..GSQIIEQLSHGIPK......ASCY-F
Q7PF39_ANOGA/19-415RLIQQ....ENQKALFML..Y-RI.........K-RIS------CSVELNEA..IEHFISQIS.NLHD....VHQACG-M
GR97A_DROME/41-418NQTLT......RRTGELL..Q-RF.........D-LQH------ADARFKQV..VNAFWLQVV.TINY....KLMPLG-L
GR22E_DROME/18-388ELAER....TGRQTSTIL..K-LF........ND-IEN------IDEKLERS..ITDFALFCS.HRRL....RFHHCG-L
GR77A_DROME/37-447ERRFNCTREIIKGGGLAF...-...........P-SRI------TVKQLRHT..MHFYGLYLKNVEHV...FAVSACG-L
GR36C_DROME/8-389LHVQD....DYWEMLQILGKR-TI.........F-VGL------DV.RLEEA..FENLNLQLI.RNPL....KITVVK-L
GR98C_DROME/14-394VKTYN....SISYILHQI..G-CL.........P-TAE------EFQMLKMG..LKEYILQMQ.HLKL....LFTCGG-L
Q8MLS6_DROME/6-364DNMCD....VAVEYHDSA...-...........K-HSW------SEVRWTKE..ISSYVIYAN.STKL....QLWSCG-L
Q7PKH4_ANOGA/15-393VDVEN....TSNDIVGLL..H-EA.........I-QRV------VDSSTKRK..LIWFSQQILFRRPK......LRCI-F
Q7PKH2_ANOGA/13-388SLVTK....ECKRTVIFV..H-KA........VC-YGY------YDMPILLQ..IKFLSQQLRSVAPR......VSCL-L
Q7PVJ7_ANOGA/11-395ELVRE....QSLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-M
Q7PK40_ANOGA/8-372TGCQRT.CGELQQTAQLV..R-RL........DD-DRN------RNSRVATQ..IHRFLLQNL.NRKI....NFSVCG-M
GR85A_DROME/27-394NSMTS....TTGSLVEVT..R-DIL.......KI-SHK------KSVNLERS..IEWLSLQLT.WQHT....HVTIFG-V
Q7PVK1_ANOGA/8-381ARTRE....ESLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-M
GR22C_DROME/17-382DLAEN....AGKSTQTVL..K-LF........AD-LEV------KDIELERS..VNEFALLCG.HCQF....NFHVCG-L
G39AA_DROME/8-363NDIHN....QANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-F
GR59D_DROME/9-389FYLLD....AHDKMVKLLNKR-TL.........F-QPG------LDHRLEMV..FENFALNLV.RNPL....KLHMYG-L
GR92A_DROME/18-383EGAVN....QFLNIGMQF...-...........G-NVG------DLSKFQTT..LDTLFLHLR.LGHF....RVSILG-L
GR08A_DROME/9-380QSCMV....VVPRIAHQL..H-NIV......TDS-GCC------SCPDLSLQ..IQNFSLQLL.HQPI....RIDCLG-L
Q7PVJ8_ANOGA/8-380GQMRQ....ESLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-M
Q7PK13_ANOGA/41-414ESCLG....VAASLQSAL..L-DI..........-PMG------NDSTFRKI..IYRFGLQIA.QQRI....RLTAHG-L
GR22B_DROME/17-385DLTEK....AGDETAIIL..K-IF........SD-LEH------RDDKLEMS..VNEFAWLCS.HRKF....RFQLCG-L
GR63A_DROME/100-456VNVRT....NFQKKLLMV...-...........E-LNW------MNSDAQTE..INMFLRATE.MNPS....TINCGG-F
GR94A_DROME/17-399NHLLV....ATRRSAVIL..Q-EM.........N-LQH------ADSRYRQA..VHGFTLLVT.VTKY....QIKPLG-L
Q7PKI5_ANOGA/30-402SQYTE....RSKKMLSIL..G-AI.........N-HRS------RGRRMERM..LDFITLDYM.QRDY....DVRNYG-L
GR36A_DROME/9-390LKLFD....DHKEMERILEER-TL.........F-TSA------LDVRLEQS..FESIQLQLI.RNPL....KIEVLD-I
Q7PF38_ANOGA/19-415HAIQQ....ENERTMLLL..H-EF..........-KCS------WSSEQNMT..IEHFISQIS.NLHD....VHQACG-M
Q7PKH9_ANOGA/7-400SVIAQ....EARRPGTTM..N-VF.........V-NAW------LDTRTERS..IELFTLAVL.TTDA....RIKIGG-M
GR93C_DROME/18-394VSSSR....MMRRLSLEN...-...........F-PIT------DHKAWHMK..WEMFLSRLN.FFEF....RVRPLG-L
Q7PJT3_ANOGA/18-425SSLVQ....ENDNIGSNV..H-KLL.......NA-AAG------ADSELAGK..LMHLSLQML.HRKV....RFSACG-L
GR68A_DROME/7-379DGLAS....EVNGTAQIL..A-RI..........-.YG------KSKQFQNL..IDKFLTKSI.KQDL....QFTAYG-F
GR09A_DROME/6-339HRCVS....KSKHLQQQL..K-DL..........-.PG------QTPVERSQ..IEGFALQIM.QDPI....QIDVCG-I
Q7PQT4_ANOGA/106-466DCSHNATLQVAQGVQDTL..L-SI.........N-LLK------VDQPTQKE..IDLFIQAIE.MNPA....IVSLKG-Y
Q7PK18_ANOGA/61-428SCAMK....SAQNLRHRLHTM-DL.........G-IQI------KCQALFTR..IESFLQQTQ.FESI....QLTAGD-F
GR32A_DROME/57-449GLTTT....EANATSQIL..A-RV..........-.YA------KSKEYQNI..IDKFLTKSI.KQEV....QFTAYG-F
GR22A_DROME/19-388DLAES....TGKKTSMIL..K-LF........ND-MEN------MDQETERR..VTEFTLFCS.HRRL....KVCHLG-L
GR22_ANOGA/73-437NEAHH....ASKRVGLNFQER-LLN.......VN-LTA------VDKATQKE..VEMFLVAID.KNPP....TMNLDG-Y
Q7PF20_ANOGA/20-415HLVQR....ERDRTGPIL..C-HF.........N-PAA------LDSALNSA..LAKFSSQLL.HVQG....PQTACG-V
GR58A_DROME/3-389DVTRR....SDLKMGDLL..R-EF........SH-LEL------VKRDFHLQ..LELFSDHLR.CHPS....TYKVCG-L
GR10A_DROME/19-404EHIKL....ELEAVALTM..R-RF........AE-PRE------MDERLTRE..IEHLSLELLNYQPP......MLCG-L
G39AC_DROME/9-372D.VQK....EANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-F
O18280_CAEEL/46-428FMIAE....EGDKLLTAS..F-KMY.......HE-TLC------EERDLLVLSQMSFLSFQMH.ATKL....TLTAGN-F
Q7PVJ9_ANOGA/29-402TFARTR..EESLKTQKLL..L-RL.........N-LSP------MDHKLKQS..IEVFALQTL.HQPI....EFTACR-M
Q7PK41_ANOGA/8-377DSCHN....QIQDVNVAV..R-NN.........V-GSL------NTQRVEARKWVDRFLLQKLSQTNQ...QRFMAGG-L
Q7PK36_ANOGA/8-375NATSL....QVEETALCT..R-HF........DD-YRL------QNTRAAKQ..IQNFLLKNL.HQKK....KFSACG-F
GR58B_DROME/10-387NNTGQ....QLRQLSDLP...-............-..K------VGPKMQRE..LDVFTMQLR.QNRL....VYKICG-I
GR59C_DROME/9-394FHIRD....QQDELFRVLADR-TL.........F-YRE------LDNRLEAA..FENFQLQLASNRHE.....FYVMG-L
Q7PTR1_ANOGA/7-389SAVHE....VARKPLKLF..R-RV..........-...------PTSNWCSE..LERFYSFIR.KSSI....AINAMG-L
LITE1_CAEEL/48-425FMINE....DGDRLVASS..F-RMY.......HE-TFH------EERDLTVLSQMTFFTFQIH.STKL....TLSACN-Y
GR10B_DROME/11-372EKLLA....EENKICDCP...-...........E-DVA------SSRTTYRQWEMSALRRAIT.RSSP....ENNVLG-M
Q7PI94_ANOGA/14-414EKISN....KTKHANDLL..A-DL..........-.QL------RGSRYMSSEEVIKLTVPFQAPNKV...FKFSAMG-F
G39AD_DROME/8-362G.ISE....EANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-F
GR36B_DROME/9-390LRVLD....HHKDFLGLLEER-TV.........F-ASS------LDIRLEES..FESLQLQLA.RNPL....KINVMG-M
Q7PK17_ANOGA/41-408QKCVD....EGEITFYYL..H-SV........LN-RVL------PQTTITL...IENFSKQLD.NEQI....NFSAAN-F
GR58C_DROME/7-410IFEIN....RCKWLGLLEDVG-NLWDINYSGRQC-IKS------SGTILSRKLEFSLLYMNRKLQLNPKRVRRLHIVG-L
G39AB_DROME/8-372NRVTI....QANKTAKML..T-KV..........-.PR------TGTGLDRM..IEKFLLKNL.RQKP....ILTAYG-F
GR98A_DROME/13-370TRCDA....MQRKFLSMF..Y-TV.........T-TDR------RSSQLNAA..LRSLNLQLS.QEKY....KFSAGG-M
GR98D_DROME/12-392IQTYN....SISRVLHQM..Y-CL..........-.SA------AEDYLILKMGLREYSLQME.HLKL....IFTCGG-L
GR22F_DROME/19-377DLAGK....CGDQTSKVL..K-LF........TD-LEH------DDEELERS..LNEFAWLCT.HRKF....RFQLCG-L
Q9W1V0_DROME/5-363DLVSE....YQMQPKFFA...-............-...------PESSMSNE..LSSYLIYES.STRL....DLLVCG-L
GR89A_DROME/10-356QVRSA....KLRKKCLQL...-...........E-YVP------EGLTQEQAMASTPFPVLTP.TGNV....KFRILG-V
Q7PF36_ANOGA/19-401HAIIM....ENERTLLLL..L-DI..........-NCI------WNSELNGM..VDYYFMQVS.NLQD....THQACG-M
GR22D_DROME/17-386DLLQK....TGRQTSMIL..K-LF........ND-IEN------MDKDLEIS..ISDFALYCS.HRRF....KFLHCG-L
GR98B_DROME/12-392INAYN....CFPRILHKI..R-CT.........S-ADP------NFAMLTRG..LREYSLQME.HLKL....RFTCGG-L
GR59E_DROME/7-383EQILE....QKCNLCQLL..N-EL..........-.EV------CSSRLQRT..INRFLLQLQRSIDQ....PLEACG-I
GR28B_DROME/45-447NRAIK....KSEKTGGIV..H-SL.........L-NKT------KSAEVKEK..LQQFSMQLM.HLKI....NFTAAG-L
Q8IN22_DROME/11-375NQFKQ....TRERALDIF...-............-LVG------KSKHWMKS..VEIFVTHLN.LSEF....RVNLLG-L

PF02949

OR22B_DROME/79-381NMIMD----DCQEMADSL--F.QS---------D.WTS......ADRRYKST--LVYFLHNLQ..QPI----ILTAGG.V
OR24A_DROME/68-388SHIME----ACSNLARST--F.SS---------H.WYG......HSVRVQKM--TLLMVARAQ..RVL----TIKIPF..
OR23A_DROME/59-365TMVQE----SFAELHYAV--F.CS---------N.WVD......QSASYRGH--MLILAERTK..RMQ----LLLAGN.L
OR85D_DROME/84-400QRLVD----ASEQIGQAV--Y.NH---------D.WFR......ADLRYRKM--LILIIKRAQ..QPS----RLKATM.F
OR45B_DROME/68-386TEMST----ESLSLGEAA--Y.SS---------A.WYT......WDRETRRR--VFLIILRAQ..RPI----TVRVPF..
OR43A_DROME/56-364NEICL----ENNRVAEAV--Y.NV---------P.WYE......AGTRFRKT--LLIFLMQTQ..HPM----EIRVGN.V
OR98A_DROME/74-379DLLKK----DCELLVSAI--F.HS---------N.WIN......SSRSYKSS--LRYFLKNAQ..KSI----AFTAGS.I
OR94A_DROME/69-376NEITV----YANQLTNEV--Y.HT---------N.WLE......CRPPIRKL--LNAYMEHLK..KPV----TIRAGN.F
OR22C_DROME/69-392NHVSE----SSAAVADVL--Y.DM---------E.WYK......CDARTRKV--ILMILRRSQ..RAK----TIAVPF..
OR2A_DROME/66-387DRMRT----QSEALCDAF--Y.DC---------N.WIE......QLPKFKRE--LLFTLARTQ..RPS----LIYAGN.Y
OR45A_DROME/64-362EYIKQ----QSLAIAQAV--YGQI---------N.WPE......MTPKKRRL--WQMVIMRAQ..RPA----KIFGFM..
OR33C_DROME/60-372SEVAE----ELERLPYAI--F.SS---------R.WYD......QSRDHRFD--LLIFTQLTLGNRGW----IIKAGG.L
OR46A_DROME/62-365GEVTQ----RSLDLPHEL--Y.KT---------S.WVD......WDYRSRRI--ALLFMQRLH..STL----RIRTLNPS
OR85C_DROME/62-369QLIAD----ASSSLSISA--Y.KQ---------N.WQN......ADIRYRRA--LVFFIARPQ..RTT----YLKATI..
OR85B_DROME/63-370QLVAD----ASYGFSVAT--Y.NQ---------K.WYK......ADVRYKRA--LVIIIARSQ..KVT----FLKATI..
OR42B_DROME/76-381NLIME----DCESLTHAI--F.QS---------N.WVD......ASRRYKTT--LLYFLQNVQ..QPI----VFIAGG.I
OR47B_DROME/88-402TLVYT----QSVEVAQAA--F.DI---------NDWHT......KSPGIQRD--ISFVILRAQ..KPL----MYVAEP.F
OR63A_DROME/74-403QRFAT----ASEEIANAF--Y.QV---------R.WYG......ESREFRHL--IRMMLMRTN..RGF----RLDVSW.F
OR10A_DROME/70-396TLVAE----SSTGLCRAM--F.SC---------P.WQL......FKPKQRRL--VQLLILRSQ..RPV----SMAVPF..
OR83B_DROME/70-476NRLIE----ESSSVMEAA--Y.SC---------H.WYD......GSEEAKTF--VQIVCQQCQ..KAM----SISGAK.F
OR59C_DROME/79-385EHLIE----DSVHVSNAL--F.HS---------N.WIT......ADRSYKSA--VLYFLHRAQ..QPI----QFTAGS.I
OR9A_DROME/68-381ENIKS----ASLDFGNGL--Y.ET---------N.WTD......FSPPTKRA--LLIAAMRAQ..RPC----QMKGYF..
OR30A_DROME/58-366NELYF----QSFDIAIAA--Y.ES---------N.WMD......FDVDTQKT--LKFLIMRSQ..KPL----AILVGG.T
OR47A_DROME/56-375ENLKT----ESASFEWAI--Y.DS---------P.WHESLGAGGASTSICRS--LLISMMRAH..RGF----RITGYF..
OR49B_DROME/52-364NELRE----QNLAVATAA--Y.ET---------E.WFT......FDVPLRKN--ILFMMMRAQ..RPA----AILLGN.I
OR85F_DROME/68-381QQVLD----LSGEVAHAV--Y.NH---------D.FHD......ASIAYKRY--LLIIIIRAQ..QPV----ELNAMG.Y
OR94B_DROME/66-372NELTF----HANALTNSV--F.GT---------N.WLE......YSVGTRKL--LNCYMEFLK..RPV----KVRAGV.F
OR59B_DROME/77-382NMLID----DAQDLSNEI--F.QS---------N.WVD......AEPRYKAT--LVLFMHHVQ..QPI----IFIAGG.I
OR56A_DROME/124-407TLIVE----CHDELSLAY--F.SC---------G.WYN......FEMPLQKM--LVFMMMHAQ..RPM----KMRALL..
OR85A_DROME/77-379EQLSS----DCESLTNTL--F.HS---------K.WIG......AERRYRTT--MLYFIHNVQ..QSI----LFTAGG.I
OR33B_DROME/61-369TLISV----EMNQLTYAI--Y.SS---------N.WMS......MNRSYSRI--LLIFMQLTL..AEV----QIKAGG.M
OR46B_DROME/62-373NEVTV----QSSRLCHSI--Y.SS---------Q.WTG......WNRANRRI--VLLMMQRFN..SPM----LLSTFNPT
OR33A_DROME/60-367ILMTM----EFDKLPYAI--F.SS---------N.WLK......MDKRYNRS--LIILMQLTL..VPV----NIKAGG.I
OR88A_DROME/73-392TQLEK----ASEGLESSL--R.SQ---------E.WYL......GSRRYRKF--YLLWTQYCQ..RTQ----QLGAFG.L
OR59A_DROME/64-386TDNEY----WFGRLHYAA--F.SC---------N.WHT......QNRSFKRK--MMLFVEQSL..KKS----TAVAGG.M
OR7A_DROME/80-394TSLML----DNERLALAI--F.QC---------Q.WLG......QSARFRKM--LLYYLHRAQ..QPI----TLTAMK.L

PF03268

G5EG25_CAEEL/32-391AKVQS----NIQETAEILMHDDVL-----------QTC------GDDQMHHT--YRVTLDRCL-HSNS----KMAFLN-A
A8X6W9_CAEBR/10-368AKVQD----QLTATSTILMESDEF-----------ENA------EDPKVYQT--YRVMVDRSL-ESET----RIFVVN-A
G0N357_CAEBE/15-367ANVQE----AMLHTSTVLMNDPFL-----------HHS------QDPQIYST--YRIMVDRAQ-KNRT----VNLVIQ-V
H2W3U0_CAEJA/53-412SNVQY----HLSDTTRILMDCEEF-----------EKN------KNCDNFRN--YHIIVDRSL-KTDT----RIRVVG-G
O16244_CAEEL/60-411IILQE----HLKTTTRILINNDEF-----------ECS------KDPIVYQT--YRIMIDRFQ-KVNT----NISIIA-S
G0N363_CAEBE/25-374AFIQE----AMLHTSRVLLNSTIL-----------QES------EDPLIFEN--YRMIIDRSL-HNRS----TNNVLR-V
O18140_CAEEL/17-370ALVQE----AMLHTSTVLMDDQYV-----------HHS------KDPQIYTT--YRSMVDRSI-NNRT----VNLVVQ-I
E3LNY7_CAERE/33-393SNVQF----YLSDTARILMDSEEF-----------ECS------QDSDVFKG--YQVMINRSL-KHNM----KIRVLR-G
G0MS85_CAEBE/20-379AKVQD----QITATSKILMESDEF-----------EGA------EDPKVYQA--YRVMVDRSL-SSDA----RIYVVN-A
G0MS87_CAEBE/33-393SKVQV----HIEDTSRILMESQEF-----------ETC------EDSDAINT--YHLMIDRSL-RHTA----KLRVLG-G
H2WA63_CAEJA/32-391VKVQD----NIQETAEILMHDDVL-----------QTC------GDDQMHHT--YRVTLDRCL-HSNS----KLLFMN-A
E3LNY5_CAERE/55-405CALQE----HLTATNKVLINNDEI-----------GRC------QDPIVYQT--YRIMIDRVQ-KIDT----KIHVVG-A
A8X6X0_CAEBR/35-395GNVQF----HLGDTARVLMDSEEF-----------EKS------VDSEVFKG--YQVMINRSL-KHNV----YIRVLG-A
G0MS88_CAEBE/61-413CALQE----HLTATSRILINNNEF-----------ECS------KNSVVYRT--YRVMVDRIE-KIDS----TIHVVG-A
H2W0A5_CAEJA/25-383CKVQH----QLTTTAKILMESNEF-----------ESA------E.PKVFQT--YRVMVDRSL-KNDT----RIFVLN-A
O45459_CAEEL/19-372ALVQE----AMLHTSTVLMNDQFI-----------HHS------KDPQIYSI--YRTMVDRSM-HNRS----VNVVIR-I
O16246_CAEEL/33-393SNVQY----DLAQTARILMDSEEF-----------EGS------QDVEVFKA--YQVMINRSL-KHTA----HIRVVG-A
G0N991_CAEBE/33-392AKVQN----NIQETAEILMHDDVL-----------QTC------GDAKMHHT--YRVTLDRCL-HSNS----KLSFLM-A
A8X6X1_CAEBR/32-394CNVQF----QLQHTSRILMKSREF-----------EKS------NDSDVINT--YHVMIDRSL-RHTA----RLRVLG-G
E3LNY3_CAERE/17-368VALQE----QLTTTTKILINNDEF-----------ECS------KDPIVYQT--YRVMVDRLQ-KVDT----RICVIA-A
E3LNY6_CAERE/32-392SNVQF----HIQDTSRILMESREF-----------ENS------KDADVMNT--YHVMIDRSL-RHTA----RLRVLG-G
O44618_CAEEL/25-384AKVQD----QIVATSKILMESEDF-----------ENA------ENQKVYQT--YRLMVDRSL-KSET----RIFVVN-A
Q8IFZ2_CAEEL/17-368CTLQE----HLKSTNCILINNDEF-----------ECT------KDPIVYQT--YRIMIDRLQ-KIET----RICIIA-S
E3MHA0_CAERE/16-369AFVQE----AMLHTSTVLMNDPFL-----------HYS------TDPQIYST--YRTMVDRSQ-KNRT----VNLVIQ-I
G0MS86_CAEBE/36-396SNVQF----YLADTSRILLDSEEF-----------ENT------DDSDIFKG--YQVMVNRSL-KHNT----YIRVLG-G
G0PNV7_CAEBE/53-404CGLQE----HLTTTRKILINNDEF-----------EVS------KDPIVYQT--YRVMIDRLQ-KVDA----RIWVIA-A
Q9XVJ4_CAEEL/45-398CALQE----HLATSTRILINHYEF-----------ECS------KDSTVYQT--YRLMVDRFQ-KVDT----RMYVVS-A
H2WBG2_CAEJA/242-592AFVQE----SMSKTSSILLNDSLV-----------QTS------DDPLVYQT--YRVIMDRCM-YNRA----CNNVLN-V

PF06151

GR64A_DROME/1-455YFLTRRLLFGMAGTIVTYELVLLQFDEPNRRKGLQPLC
GR05A_DROME/40-438FNVTRKLFLAMAGTVATYELVLIQFHEDKKTWD....C
GR64D_DROME/1-416FYVTRRLIFAMAGALMGYELVLFRQMQGAVVQKSI..C
GR64C_DROME/1-407FLLTRRLIFAMAATLMVYELVLINQMAGSEVQKSF..C
GR61A_DROME/1-435FCLTRKSLFGMLATLVTYELMLLQIDAKSHKGLR...C
GR64F_DROME/63-463FHLTRKLVLSVAGTIVTYELVLIQFHEDNDLWD....C
GR64E_DROME/25-448FRLTRGVVISVAGTIVTYELILLQFNGEEKVPG....C
GR64B_DROME/1-403FYLTRSLVLAMGTTIITYELMISDVINQGSIRQKTQYC

PF08395

Q7PKI1_ANOGA/57-400YDVDYTLMFSMIATITSYLIMLVQFQLAE---------
Q7PKI2_ANOGA/11-404YDVDYTLMFSMIATITSYLIMLVQFQLAE---------
Q7PKG3_ANOGA/26-401FPFDWTLIFSILSTAATYIIILLQFESAG---------
GR93B_DROME/24-392FEVSNELTLFFLSAMVTYLVFLVQYGMQS---------
GR21A_DROME/81-445ANINRELITTNISFMATYLVVLLQFKITE---------
Q7PK37_ANOGA/8-367FDIDNTVIYMVFSSIVTYLVILIQFKQLE---------
Q7PQ43_ANOGA/15-419FRLDFTFIFSVFSAATSYLIVLLQFDLSK---------
Q7PK29_ANOGA/12-374FDIDNTVIYMVFSSIVTYLVILIQFKQLE---------
Q7PF19_ANOGA/20-402ITLDLTLISKIVAGLTTYLMILIQFDSAF---------
Q7PKH1_ANOGA/14-409YDIDWTFLLSMISSFATYLNILVQFDIMQ---------
Q7PF39_ANOGA/19-415LNLDMKLISNAVAAITSIMVVLIQFSDTG---------
GR97A_DROME/41-418LELNTSLVNKVFSSAIGSLLILIQSDLTL---------
GR22E_DROME/18-388FYVNYEMGFRMAITSFLYLLFLIQFDYWN---------
GR77A_DROME/37-447FKLNNAILFCIVGAILEYLMILIQFDKVL---------
GR36C_DROME/8-389YDVTRSNTMAMFGNLITHSIFLIQYDIEH---------
GR98C_DROME/14-394FDINIKLFGGMLVTLCGYVIIIVQFKIQD---------
Q8MLS6_DROME/6-364FQANRSMWFAMISSVLYYILVLLQFHLVM---------
Q7PKH4_ANOGA/15-393YAYDWKTIYNMFGFVVTYLIILLQFDKFS---------
Q7PKH2_ANOGA/13-388FDFEWPFLVSVAATLVMHVVILVQFDLSI---------
Q7PVJ7_ANOGA/11-395FTLDYTVLFSIAAAVTNYLIILIQFEMAI---------
Q7PK40_ANOGA/8-372FDIDYAMIHMVLSSIFTYLVILVQFDQLQ---------
GR85A_DROME/27-394FRINRSLAFRSASLILVHVLYMVQSDYIS---------
Q7PVK1_ANOGA/8-381FTLDYTVLFSIAAAVTNYLIILIQFEMAI---------
GR22C_DROME/17-382FTINYKMGFQMIITSFLYLIYMIQFDFMN---------
G39AA_DROME/8-363FALDKSTLFKLFTAIFTYMVILVQFKEME---------
GR59D_DROME/9-389FEFGRGTSFAVFNSLLTHSLLLIQYDVQN---------
GR92A_DROME/18-383FDVTQMQYLQFLSALLSGLAFIAQYRMQV---------
GR08A_DROME/9-380TILDCSLLTRMACSVGTYMIYSIQFIPKF---------
Q7PVJ8_ANOGA/8-380FTLDYTVLFSIAAAVTNYLIILIQFEMAI---------
Q7PK13_ANOGA/41-414FEINYSLLKMFGTGITTYMIIFITFSKDI---------
GR22B_DROME/17-385FSMNCRMGFKMIITTFLYLVYLVQFDYMN---------
GR63A_DROME/100-456FDVNRTLFKGLLTTMVTYLVVLLQFQISI---------
GR94A_DROME/17-399YELDMRLISNVFSAVASFLLILVQADLSQ---------
Q7PKI5_ANOGA/30-402YDINRALLFGTIATVTSYVIILVQFHMQQ---------
GR36A_DROME/9-390FTITRSSSAAMIGSIITNSIFLIQYDMEY---------
Q7PF38_ANOGA/19-415LNLDMKLISNAVAAITSIMVVLIQFSDTG---------
Q7PKH9_ANOGA/7-400YVLNMAFVFSLATTVNMYLIVLVQFQLNI---------
GR93C_DROME/18-394FEVSNEVILLFLSSMITYFTYVVQYGIQT---------
Q7PJT3_ANOGA/18-425FSLDFSLIFTLVGAATTYLVILIQYELSM---------
GR68A_DROME/7-379FSIDNSTLFKIFSAVTTYLVILIQFKQLE---------
GR09A_DROME/6-339YHLNLQTLAGMFFFILEALVIFLQFVSLV---------
Q7PQT4_ANOGA/106-466AEVNRELLTSSIATIAIYLIVLLQFKLSL---------
Q7PK18_ANOGA/61-428FDLNFSPILTIIFSVGAYISIFIQQAINQ---------
GR32A_DROME/57-449FAIDNSTLFKIFSAVTTYLVILIQFKQLE---------
GR22A_DROME/19-388LDINYEMGFRMIITNILYVVFLVQFDYMN---------
GR22_ANOGA/73-437ANINRGLITSNISFMATYLVVLMQFKLTL---------
Q7PF20_ANOGA/20-415INLEMTLISTMVGALTTYLVILIQFDTAI---------
GR58A_DROME/3-389FIFNKQTSLAYFFYVLVQVLVLVQFDLKN---------
GR10A_DROME/19-404LHLDRRLVYLIAVTAFSYFITLVQFDLYL---------
G39AC_DROME/9-372FALDKSTLFKLFTAIFTYMVILVQFKEME---------
O18280_CAEEL/46-428FMMNRKIMISLFSAIFTYFLILVQFDAEK---------
Q7PVJ9_ANOGA/29-402FTLDYTVLFSIAAAVTNYLIILIQFEMAI---------
Q7PK41_ANOGA/8-377FVLDNKLVCTALTSMITYLVILIQFRKYD---------
Q7PK36_ANOGA/8-375FDIDNTVIYMVFSSIVTYLVILIQFKQLE---------
GR58B_DROME/10-387VELDKPACLSYIGSILSNVIILMQFDLRR---------
GR59C_DROME/9-394FKMERGRLIAMLSSVITHTMVLVQWEIQN---------
Q7PTR1_ANOGA/7-389FRLTKKTMLTMLGAVITYELVMLHFAQTT---------
LITE1_CAEEL/48-425FYMDRSILLSLFSAILTYFLILWEFDIKN---------
GR10B_DROME/11-372FRMDMRCAFALISCSLSYGIIIIQIGYIP---------
Q7PI94_ANOGA/14-414FQIDCNMLCGMIGAITTYLVIYIQFYILY---------
G39AD_DROME/8-362FALDKSTLFKLFTAIFTYMVILVQFKEME---------
GR36B_DROME/9-390FPITRGSTAAMCASVIVNSIFLIQFDMEF---------
Q7PK17_ANOGA/41-408FDIRLSSLTTIFGSITSYLVIYINFIPKT---------
GR58C_DROME/7-410FDLSNLTVHNMTRSIITNVLVLCQIAYKK---------
G39AB_DROME/8-372FALDKSTLFKLFTAIFTYMVILVQFKEME---------
GR98A_DROME/13-370VDINTEMLGKFFFGMISYIVICIQFSINF---------
GR98D_DROME/12-392FDINLKFFGGMVVTLFGYIIILVQFKIQF---------
GR22F_DROME/19-377FSINHNMGFQMIITSFLYLVYLLQFDFMN---------
Q9W1V0_DROME/5-363YRVNKRKWLQMVGSIVVHSSMLFQFHLVM---------
GR89A_DROME/10-356FILDNSFWLFLVSYAMNFIVVILQTSFEH---------
Q7PF36_ANOGA/19-401IKLDMQLVPNVIAVITSILFILMQFSDAD---------
GR22D_DROME/17-386FHVNREMGFKMFVASVLYLLYLVQFDYMN---------
GR98B_DROME/12-392FDINLKYFGGLLVTIFGYIIILIQFKVQA---------
GR59E_DROME/7-383VTLDTRSLGGFIGVLMAIVIFLIQIGLGN---------
GR28B_DROME/45-447FNIDRTLYFTISGALTTYLIILLQFTSNS---------
Q8IN22_DROME/11-375FNVSNELFLIIVSAMFCYLVFVTQCVIVY---------

PF02949

OR22B_DROME/79-381FPISMQTNLNMVKLAF----------------------
OR24A_DROME/68-388FSPSLETLTSILRFTG----------------------
OR23A_DROME/59-365VPIHLSTYVACWKGAY----------------------
OR85D_DROME/84-400LNISLVTVSDLLQLSY----------------------
OR45B_DROME/68-386FAPSLPVFTSVIKFTG----------------------
OR43A_DROME/56-364YPMTLAMFQSLLNASY----------------------
OR98A_DROME/74-379FPISTGSNIKVAKLAF----------------------
OR94A_DROME/69-376FAVGLPIFVKTINNAY----------------------
OR22C_DROME/69-392FTPSLPALRSILSTAG----------------------
OR2A_DROME/66-387IALSLETFEQVMRFTY----------------------
OR45A_DROME/64-362FVVDLPLL.....LWV----------------------
OR33C_DROME/60-372IELNLNAFFATLKMAY----------------------
OR46A_DROME/62-365LGFDLMLF.....SSI----------------------
OR85C_DROME/62-369.......FMNITRATM----------------------
OR85B_DROME/63-370.......FLDITRSTM----------------------
OR42B_DROME/76-381FQISMSSNISVAKFAF----------------------
OR47B_DROME/88-402LPFTLGTYMLVLKNCY----------------------
OR63A_DROME/74-403MQMSLPTL.....MAM----------------------
OR10A_DROME/70-396FSPSLATFAAILQTSG----------------------
OR83B_DROME/70-476FTVSLDLFASVLGAVV----------------------
OR59C_DROME/79-385FPISVQSNIAVAKFAF----------------------
OR9A_DROME/68-381FEASMATFSTIVRSAV----------------------
OR30A_DROME/58-366YPMNLKMLQSLLNAIY----------------------
OR47A_DROME/56-375FEANMEAFSSIVRTAM----------------------
OR49B_DROME/52-364RPITLELFQNLLNTTY----------------------
OR85F_DROME/68-381LSISLDTFKQLMSVSY----------------------
OR94B_DROME/66-372FEIGLPIFVKTINNAY----------------------
OR59B_DROME/77-382FPISMNSNITVAKFAF----------------------
OR56A_DROME/124-407VDLNLRTFIDIGRGAY----------------------
OR85A_DROME/77-379FPICLNTNIKMAKFAF----------------------
OR33B_DROME/61-369IGIGMNAFFATVRLAY----------------------
OR46B_DROME/62-373FAFSLEAFGSIVNCSY----------------------
OR33A_DROME/60-367VGIDMSAFFATVRMAY----------------------
OR88A_DROME/73-392IQVNMVHFTEIMQLAY----------------------
OR59A_DROME/64-386MRIHLDTFFSTLKGAY----------------------
OR7A_DROME/80-394FPINLATYFSIAKFSF----------------------

PF03268

G5EG25_CAEEL/32-391FHVDSNCFNRIIFFVPNI.-------------------
A8X6W9_CAEBR/10-368FGINSTNLNVAMFAVPNIG-------------------
G0N357_CAEBE/15-367FSVNRKNVERAYFVITNIV-------------------
H2W3U0_CAEJA/53-412IPINQTTMNTAMLLIPNLG-------------------
O16244_CAEEL/60-411LPITVQTFAACSFVAPNLG-------------------
G0N363_CAEBE/25-374FSVTRKNVERAFF......-------------------
O18140_CAEEL/17-370FSVNRKNIERAYFVITNIV-------------------
E3LNY7_CAERE/33-393IPIYPASMNFAMFIFPNLG-------------------
G0MS85_CAEBE/20-379FGINSRNFNIAMFAVPNLG-------------------
G0MS87_CAEBE/33-393IPICPATFNIAMFFIPSLG-------------------
H2WA63_CAEJA/32-391FPVDSQSFNRIMFFVPNI.-------------------
E3LNY5_CAERE/55-405FPITKAVLAAAMFVVPNLG-------------------
A8X6X0_CAEBR/35-395IPIYPTAVNLAMFLFPNLG-------------------
G0MS88_CAEBE/61-413FPINRKVLAAAAFIVPNLG-------------------
H2W0A5_CAEJA/25-383FGIDTTNFNVAMFAIPNLG-------------------
O45459_CAEEL/19-372FDVNRKNIERAYFIISNIV-------------------
O16246_CAEEL/33-393IPIYPTSAHFAFLLIPNLG-------------------
G0N991_CAEBE/33-392FPVDSNCFNRIMFIVPNI.-------------------
A8X6X1_CAEBR/32-394IPIYPTTFNIAMFFIPNLG-------------------
E3LNY3_CAERE/17-368FPIVRGVLAAALFIVPNMG-------------------
E3LNY6_CAERE/32-392IPIYPTTFHIAIFFIPSLG-------------------
O44618_CAEEL/25-384FGINSNNLNIAMFVIPNLG-------------------
Q8IFZ2_CAEEL/17-368LPITQNTFAACTFIIPNFG-------------------
E3MHA0_CAERE/16-369FSVNRKNIERAYFVITNIV-------------------
G0MS86_CAEBE/36-396IPIYPTTMNCAMFIVPNLG-------------------
G0PNV7_CAEBE/53-404FPITKNILAGALFVIPDLG-------------------
Q9XVJ4_CAEEL/45-398IPITRSTFAAASFIVPNMG-------------------
H2WBG2_CAEJA/242-592FTVTRKNIERVFFVH....-------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window