Sequence alignment for CL0178

PF09157

TRUB_XYLFA/245-300--------------------------------------------------------------------------------
TRUB_ACTSZ/247-304--------------------------------------------------------------------------------
TRUB_CHRVO/242-300--------------------------------------------------------------------------------
TRUB_AZOSB/241-294--------------------------------------------------------------------------------
Q609C4_METCA/59-115--------------------------------------------------------------------------------
TRUB_SHIDS/252-309--------------------------------------------------------------------------------
TRUB_YERPE/252-309--------------------------------------------------------------------------------
Q140U4_BURXL/245-306--------------------------------------------------------------------------------
TRUB_PSYIN/251-308--------------------------------------------------------------------------------
TRUB_MARHV/244-302--------------------------------------------------------------------------------
TRUB_SHEFN/251-308--------------------------------------------------------------------------------
TRUB_VIBF1/251-308--------------------------------------------------------------------------------
Q0VSR9_ALCBS/246-303--------------------------------------------------------------------------------
TRUB_NOSS1/234-289--------------------------------------------------------------------------------
TRUB_PSEHT/253-308--------------------------------------------------------------------------------
TRUB_ACTP2/246-303--------------------------------------------------------------------------------
TRUB_COXBU/250-306--------------------------------------------------------------------------------
TRUB_SACD2/250-310--------------------------------------------------------------------------------
TRUB_NITMU/246-307--------------------------------------------------------------------------------
TRUB_ACIAD/262-316--------------------------------------------------------------------------------
TRUB_GLOVI/235-289--------------------------------------------------------------------------------
TRUB_MANSM/246-303--------------------------------------------------------------------------------
TRUB_NITEU/231-291--------------------------------------------------------------------------------
TRUB_PSEA6/251-311--------------------------------------------------------------------------------
A4SY76_POLSQ/241-299--------------------------------------------------------------------------------
TRUB_BAUCH/253-312--------------------------------------------------------------------------------
A0KNE1_AERHH/266-323--------------------------------------------------------------------------------
TRUB_SODGM/249-306--------------------------------------------------------------------------------
A0ZIL4_NODSP/234-288--------------------------------------------------------------------------------
TRUB_PECAS/252-309--------------------------------------------------------------------------------
TRUB_BUCBP/244-301--------------------------------------------------------------------------------
Q0K9C1_CUPNH/232-294--------------------------------------------------------------------------------
TRUB_SHEAM/251-308--------------------------------------------------------------------------------
TRUB_HALHL/245-301--------------------------------------------------------------------------------
TRUB_PHOLL/251-310--------------------------------------------------------------------------------
TRUB_THIDA/239-293--------------------------------------------------------------------------------
TRUB_IDILO/246-303--------------------------------------------------------------------------------
TRUB_METFK/241-297--------------------------------------------------------------------------------
TRUB_MARMS/244-301--------------------------------------------------------------------------------
A5EWY7_DICNV/237-289--------------------------------------------------------------------------------
Q0A799_ALKEH/244-300--------------------------------------------------------------------------------
TRUB_HAHCH/247-303--------------------------------------------------------------------------------
TRUB_CHRSD/242-299--------------------------------------------------------------------------------
Q2JJL0_SYNJB/239-295--------------------------------------------------------------------------------
TRUB_AQUAE/232-286--------------------------------------------------------------------------------
TRUB_DECAR/241-295--------------------------------------------------------------------------------
TRUB_CALS4/230-285--------------------------------------------------------------------------------
A4G7S5_HERAR/244-306--------------------------------------------------------------------------------
TRUB_BUCAI/250-307--------------------------------------------------------------------------------
TRUB_CHESB/253-310--------------------------------------------------------------------------------
TRUB_PASMU/246-303--------------------------------------------------------------------------------
TRUB_SYNE7/234-291--------------------------------------------------------------------------------
TRUB_NITOC/247-303--------------------------------------------------------------------------------
TRUB_HAEDU/246-303--------------------------------------------------------------------------------
TRUB_AROAE/245-299--------------------------------------------------------------------------------
TRUB_HISS2/246-303--------------------------------------------------------------------------------
B4E7L3_BURCJ/247-306--------------------------------------------------------------------------------
TRUB_VIBTL/251-308--------------------------------------------------------------------------------
M1FAI4_9ALTE/245-303--------------------------------------------------------------------------------
M9X1B5_MANHA/247-303--------------------------------------------------------------------------------
TRUB_PSEAE/246-302--------------------------------------------------------------------------------
TRUB_LEGPH/243-299--------------------------------------------------------------------------------
TRUB_BURPS/246-307--------------------------------------------------------------------------------
TRUB_PHOPR/251-308--------------------------------------------------------------------------------
TRUB_XANCP/245-299--------------------------------------------------------------------------------
TRUB_RALSO/252-312--------------------------------------------------------------------------------
TRUB_VIBCH/251-308--------------------------------------------------------------------------------

PF09142

TRUB_LEIXX/238-297--------------------------------------------------------------------------------
TRUB_THEFY/236-291--------------------------------------------------------------------------------
TRUB_COREF/238-293--------------------------------------------------------------------------------
TRUB_RHOJR/245-300--------------------------------------------------------------------------------
TRUB_PROAC/237-295--------------------------------------------------------------------------------
TRUB_STRAW/243-301--------------------------------------------------------------------------------
Q0RDS8_FRAAA/250-305--------------------------------------------------------------------------------
A5UZQ6_ROSS1/240-296--------------------------------------------------------------------------------
TRUB_BIFLO/329-385--------------------------------------------------------------------------------
A1SLK5_NOCSJ/235-289--------------------------------------------------------------------------------
A1T7J3_MYCVP/243-298--------------------------------------------------------------------------------
TRUB_CORDI/241-296--------------------------------------------------------------------------------
Q2IPZ4_ANADE/244-300--------------------------------------------------------------------------------
A6W7Z8_KINRD/243-298--------------------------------------------------------------------------------
A4FM27_SACEN/227-282--------------------------------------------------------------------------------
TRUB_CORJK/248-303--------------------------------------------------------------------------------
TRUB_MYCLE/247-302--------------------------------------------------------------------------------
A7H9F6_ANADF/247-302--------------------------------------------------------------------------------
A8L6F8_FRASN/256-311--------------------------------------------------------------------------------
TRUB_NOCFA/245-300--------------------------------------------------------------------------------
A0QVP8_MYCS2/244-299--------------------------------------------------------------------------------
TRUB_MYCPA/234-289--------------------------------------------------------------------------------
A9WGQ0_CHLAA/234-289--------------------------------------------------------------------------------
B0RDY4_CLAMS/254-312--------------------------------------------------------------------------------
B2HKU5_MYCMM/242-297--------------------------------------------------------------------------------
TRUB_MYCTU/236-291--------------------------------------------------------------------------------

PF01472

TRUB_SULTO/251-323--------------------------------------------------------------------------------
PROB_BACSU/277-350--------------------------------------------------------------------------------
TRUB_AERPE/262-335--------------------------------------------------------------------------------
DKC1_HUMAN/297-370--------------------------------------------------------------------------------
ATGT_METJA/578-651--------------------------------------------------------------------------------
ATGT_METTH/579-652--------------------------------------------------------------------------------
Q9YEQ6_AERPE/84-160--------------------------------------------------------------------------------
TRUB_THEAC/210-279--------------------------------------------------------------------------------
PROB_YEAST/322-409--------------------------------------------------------------------------------
YHJ3_YEAST/316-403--------------------------------------------------------------------------------
PROB_VIBPA/286-360--------------------------------------------------------------------------------
PROB_VIBCH/284-358--------------------------------------------------------------------------------
PROB_SHEON/281-355--------------------------------------------------------------------------------
PROB_ECOLI/276-350--------------------------------------------------------------------------------
PROB_HAEIN/276-350--------------------------------------------------------------------------------
PROJ_BACSU/281-355--------------------------------------------------------------------------------
Q8H5T5_ORYSJ/311-384--------------------------------------------------------------------------------
CBF5_KLULA/266-339--------------------------------------------------------------------------------
DKC1_CAEEL/285-358--------------------------------------------------------------------------------
DKC1_DROME/295-368--------------------------------------------------------------------------------
Q8ILS0_PLAF7/269-342--------------------------------------------------------------------------------
Q8SRW0_ENCCU/263-336--------------------------------------------------------------------------------
TRUB_METTH/240-313--------------------------------------------------------------------------------
TRUB_ARCFU/237-310--------------------------------------------------------------------------------
TRUB_METJA/249-322--------------------------------------------------------------------------------
TRUB_METKA/248-321--------------------------------------------------------------------------------
TRUB_PYRAE/239-312--------------------------------------------------------------------------------
TRUB_SULSO/164-236--------------------------------------------------------------------------------
Q9HS38_HALSA/81-154--------------------------------------------------------------------------------
O29550_ARCFU/79-152--------------------------------------------------------------------------------
Q975U3_SULTO/92-165--------------------------------------------------------------------------------
ATGT_THEAC/554-627--------------------------------------------------------------------------------
Q8TWS6_METKA/77-150--------------------------------------------------------------------------------
Q8ZYG7_PYRAE/80-152--------------------------------------------------------------------------------
Q8TGZ2_METKA/63-136--------------------------------------------------------------------------------
Q8ZYJ6_PYRAE/89-161--------------------------------------------------------------------------------
Q9YD14_AERPE/93-165--------------------------------------------------------------------------------
Q8TXP0_METKA/124-195--------------------------------------------------------------------------------
Q9HNT2_HALSA/517-583--------------------------------------------------------------------------------
O27701_METTH/236-308--------------------------------------------------------------------------------
Q8U4L1_PYRFU/502-568--------------------------------------------------------------------------------
O29668_ARCFU/456-526--------------------------------------------------------------------------------
ARCS_METJA/501-568--------------------------------------------------------------------------------
Y066_METJA/132-206--------------------------------------------------------------------------------
Q8I3H2_PLAF7/91-168--------------------------------------------------------------------------------
Q8RZU5_ORYSJ/92-170--------------------------------------------------------------------------------
Q8MXH7_CAEEL/94-172--------------------------------------------------------------------------------
MCTS2_MOUSE/93-170--------------------------------------------------------------------------------
TMA20_YEAST/91-171--------------------------------------------------------------------------------
Y1432_METJA/79-153--------------------------------------------------------------------------------
O28867_ARCFU/71-144--------------------------------------------------------------------------------
O26746_METTH/77-151--------------------------------------------------------------------------------
Q8TYS3_METKA/83-157--------------------------------------------------------------------------------
Q9HM93_HALSA/77-150--------------------------------------------------------------------------------
Q8ZWT7_PYRAE/82-155--------------------------------------------------------------------------------
Q9HIB8_THEAC/71-144--------------------------------------------------------------------------------
Q97TZ1_SULSO/69-143--------------------------------------------------------------------------------
Y1649_METJA/6-80--------------------------------------------------------------------------------
PROB_CHLTE/278-354--------------------------------------------------------------------------------
PROB_BACTN/279-354--------------------------------------------------------------------------------
PROB_STRR6/276-349--------------------------------------------------------------------------------
PROB_AQUAE/266-339--------------------------------------------------------------------------------
PROB_THEMA/263-336--------------------------------------------------------------------------------
PROB_OCEIH/277-351--------------------------------------------------------------------------------
PROB_BACHD/277-351--------------------------------------------------------------------------------
PROB_COREF/278-352--------------------------------------------------------------------------------
PROB_STRCO/281-355--------------------------------------------------------------------------------
PROB_BIFLO/286-360--------------------------------------------------------------------------------
PROB_PSESM/281-355--------------------------------------------------------------------------------
PROB_PSEPK/281-355--------------------------------------------------------------------------------
PROB_PSEAE/281-355--------------------------------------------------------------------------------
PROB_RALSO/283-357--------------------------------------------------------------------------------
PROB_XANCP/268-345--------------------------------------------------------------------------------
PROB_DEIRA/272-346--------------------------------------------------------------------------------
PROB_BRADU/282-355--------------------------------------------------------------------------------
PROB_AGRFC/283-356--------------------------------------------------------------------------------
PROB1_RHIME/283-356--------------------------------------------------------------------------------
PROB1_RHILO/279-352--------------------------------------------------------------------------------
PROB_CAUCR/287-360--------------------------------------------------------------------------------
PROB_SCHPO/296-370--------------------------------------------------------------------------------
PROB_THEEB/277-351--------------------------------------------------------------------------------
PROB_NOSS1/287-361--------------------------------------------------------------------------------
PROB_SYNY3/282-356--------------------------------------------------------------------------------
PROB_CALS4/273-347--------------------------------------------------------------------------------
PROB_SERP5/276-350--------------------------------------------------------------------------------
D3PQW1_MEIRD/282-355--------------------------------------------------------------------------------
PROB_MYCTU/281-351--------------------------------------------------------------------------------
PROB_BRUA2/280-353--------------------------------------------------------------------------------
PROB_THET8/276-350--------------------------------------------------------------------------------
PROB_VIBVY/286-360--------------------------------------------------------------------------------
TRUB_METAC/246-319--------------------------------------------------------------------------------
Q8U1U0_PYRFU/88-161--------------------------------------------------------------------------------
Q8U444_PYRFU/4-78--------------------------------------------------------------------------------

PF03657

Y516_AERPE/11-172YRLRPPTPREERLVEGFLRAIGFKVNPYAEGMTVLDPGGKFKEVFYLPWGLRRAVERLPLHYSAGLNLGS.IGERGFRPS
Y1410_METJA/1-157MKVRKLKNAEINLIEEELSKYTDKD..FVKSFKYENLIVLEGKWLTVCYTNIETIK.KLNMFQDIFSVGNVFGEIKRKFR
Y058_ARCFU/1-167MAFRQPNTKELKVIRKALSYYGSGD..FLSHYALLVKEGEKKEVYGVSKELYGVIG.ELNPHYAGVKIG....EVGRRFR

PF14306

A8MAT6_CALMQ/8-187-----------------------------------------------------------PPPHG..G..KLVDAVIRDE.
Q8ZUU0_PYRAE/7-184-----------------------------------------------------------LEPHG..G..RLVYNVIEDR.
PAPS1_HUMAN/225-386-----------------------------------------------------------IVPVD..ASYEVKELYVPEN.
PAPS2_HUMAN/215-376-----------------------------------------------------------IVPYT..IIKDIHELFVPEN.
Q7PX77_ANOGA/219-385-----------------------------------------------------------IIPKFLKEDEPLPELFVADS.
Q8IQV1_DROME/247-415-----------------------------------------------------------IIPRSLRDVDLLPELYPSESI
Q22501_CAEEL/229-414-----------------------------------------------------------LLPEQIPDVPAVRELFVSDDL
APS3_ARATH/53-216-----------------------------------------------------------IEPDG....GKLVDLVVPEP.
MET3_PHANO/3-166-----------------------------------------------------------NPPHG..G..VLKDLIARDAP
A0A016PSU3_GIBZA/3-166-----------------------------------------------------------NTPHG..G..VLKDLFARDLP
A0A0D1E1R4_USTMA/3-166-----------------------------------------------------------NAPHG..G..VLKDLLVRDAP
MET3_DEBHA/4-174-----------------------------------------------------------PAPHG..G..KLQDLVIRDSS
MET3_CANAL/4-172-----------------------------------------------------------PTPHG..G..KLRDLVIRDAP
MET3_KLULA/2-163-----------------------------------------------------------PSPHG..G..VLQDLVARDAS
MET3_ASHGO/2-161-----------------------------------------------------------LSPHG..G..ILQDLVARDAE
A8ZWW7_DESOH/6-165-----------------------------------------------------------APPHG....GRLINLVADES.
Q54F74_DICDI/17-181-----------------------------------------------------------SIPHG..G..ELINLILEGE.
A5UYJ4_ROSS1/4-160-----------------------------------------------------------IPPYG....GRLINLLVASE.
B4U6B9_HYDS0/17-175-----------------------------------------------------------ITPYG....GKLVNLVVSED.
SAT_SYNFM/5-167-----------------------------------------------------------VPPHG..KEKKLKPLLLEGA.
SAT_CHLPB/4-165-----------------------------------------------------------VNPHG..KDKVLKPLLLSGE.
SAT_RUTMC/5-162-----------------------------------------------------------VPPHG..S.DTLKSLALEGN.
SAT_THIDA/5-162-----------------------------------------------------------VRPHG..G.GELKPLLLTGD.
SAT_PSYWF/16-179-----------------------------------------------------------VPPHG..S.DELKPLLLEGE.
Q72CI8_DESVH/5-177-----------------------------------------------------------VPAHG..G.KGLVCCLLEGA.
Q6AN73_DESPS/5-179-----------------------------------------------------------VAPHG..G.KGLVCALLEGD.
SAT_DESRM/4-163-----------------------------------------------------------VQPHG..G..KLTPVLAPKE.
SAT_ALCBS/5-169-----------------------------------------------------------VKPHG..A.DELTPLYVADE.
SAT_ALLVD/2-166-----------------------------------------------------------IKPVG..S.DELRPRFVYDP.
SAT_CENSY/6-156-----------------------------------------------------------IEPHG..G..RLISRLYSG..
SAT_NITMS/7-157-----------------------------------------------------------IKPHG..G..VLVNRITNV..
SAT_HYPBU/3-160-----------------------------------------------------------SRPHG..G..RLVDRTVSDK.
SAT_STAMF/3-160-----------------------------------------------------------PRPHG..G..KLVNRIVSSK.
SAT_IGNH4/3-160-----------------------------------------------------------SKPHG..G..KLVERVAKGK.
SAT_AERPE/3-162-----------------------------------------------------------SRPHG..G..RLVRRVLSGR.
Q9KCT2_BACHD/4-155-----------------------------------------------------------SQPHG..G..TLVQRFHPEA.
SAT_BACP2/4-154-----------------------------------------------------------T.PHG..G..VLINRVNEEY.
SAT1_BACSU/4-154-----------------------------------------------------------A.PHG..G..TLVNRVDESY.
SAT2_BACSU/4-155-----------------------------------------------------------NEPHG..G..VLINRCDPAC.
SAT_DEIRA/12-166-----------------------------------------------------------PTPLG..G..SLVRRIWRPG.
Q2JHJ0_SYNJB/14-172-----------------------------------------------------------IPPHG..G..TLINCIAPPE.
SAT_GLOVI/9-167-----------------------------------------------------------IAPHG..G..TLINQVATAE.
SAT_OCEIH/12-170-----------------------------------------------------------ILPHG..G..ELIDRELTGD.
SAT_LACPL/7-162-----------------------------------------------------------IKAHG..G..KLVNLE...D.
SAT_PELTS/3-161-----------------------------------------------------------VKPHG..G..TLIDRVLKGP.
SAT_RUBXD/9-167-----------------------------------------------------------ITPHG..G..TLVDRRVPVG.
SAT_SYMTH/5-163-----------------------------------------------------------IAPHG..G..RLVDRWLRGP.
SAT_PETMO/2-161-----------------------------------------------------------IEPHG..G..KLVNKIATEE.
SAT_HALOH/2-161-----------------------------------------------------------IKPHG..G..KLVNRIVEGA.
A4YFD2_METS5/3-148-----------------------------------------------------------ASPYG..G..RLIQNVIEEPH
SAT_CARHZ/2-158-----------------------------------------------------------VNYHG..R..KEVSNILTSE.
A9WF10_CHLAA/8-161-----------------------------------------------------------ISPYG..G..RLIDLCVSAE.
SAT_CHLAA/10-157-----------------------------------------------------------.KPHG..G..VLVERIRV...
SAT_LYSSC/4-153-----------------------------------------------------------.QPHG..G..FLVQAFHPDK.
B1WW78_CYAA5/57-215-----------------------------------------------------------IAPHG..G..QLINRIASPA.
B6HEK3_PENCW/4-165-----------------------------------------------------------.APHG..G..VLKDLLARDAP
C4LVD3_ENTHI/11-173-----------------------------------------------------------IKPHG..G..KLIKTLKYGA.
F7BBN1_CIOIN/226-379-----------------------------------------------------------..........PVMELFTSHS.
H3D716_TETNG/215-374-----------------------------------------------------------..PTG..IMEEINELFVAEN.
J9Z8G2_LEPFM/5-161-----------------------------------------------------------.EPHG..G..KLVSNVIVES.
M4DJ10_BRARP/17-179-----------------------------------------------------------IDPDG..G..ELVELVVPKS.
MET3_CRYNJ/4-171-----------------------------------------------------------.APHG..G..VLKDLLVRDAA
SAT_GEOKA/5-154-----------------------------------------------------------.IPHG..G..TLINRWNPDY.
Q73WR2_MYCPA/6-159-----------------------------------------------------------...HN..G.KPLVERVSTEN.
S2JG29_MUCC1/4-165-----------------------------------------------------------.TPHG..G..VLKDLYLRDAD

PF04146

U5DHQ3_AMBTC/203-345--------------------------------------------------------------------------------
G9NWF6_HYPAI/319-521--------------------------------------------------------------------------------
D8TNU7_VOLCA/3-131--------------------------------------------------------------------------------
B0CZ01_LACBS/621-947--------------------------------------------------------------------------------
K1VD20_TRIAC/114-250--------------------------------------------------------------------------------
Q6BPA7_DEBHA/127-264--------------------------------------------------------------------------------
C5L6K6_PERM5/34-174--------------------------------------------------------------------------------
D8PXT6_SCHCM/597-878--------------------------------------------------------------------------------
A0DYX2_PARTE/54-188--------------------------------------------------------------------------------
A6QW31_AJECN/628-764--------------------------------------------------------------------------------
G3B5F4_CANTC/46-183--------------------------------------------------------------------------------
G8BTN3_TETPH/177-314--------------------------------------------------------------------------------
K1XSV2_MARBU/377-579--------------------------------------------------------------------------------
M1WAB0_CLAP2/245-382--------------------------------------------------------------------------------
M9LMP9_PSEA3/630-1025--------------------------------------------------------------------------------
T1IEI7_RHOPR/176-317--------------------------------------------------------------------------------
C5E1V0_ZYGRC/178-314--------------------------------------------------------------------------------
T1EJA3_HELRO/16-152--------------------------------------------------------------------------------
B9PUV6_TOXGO/446-580--------------------------------------------------------------------------------
B9GKR9_POPTR/68-204--------------------------------------------------------------------------------
K9G8Z6_PEND2/207-404--------------------------------------------------------------------------------
G2QRC4_THITE/578-713--------------------------------------------------------------------------------
Q179P3_AEDAE/474-610--------------------------------------------------------------------------------
K1PII4_CRAGI/293-431--------------------------------------------------------------------------------
U1HHT6_ENDPU/832-968--------------------------------------------------------------------------------
B6K0R3_SCHJY/340-468--------------------------------------------------------------------------------
A7S845_NEMVE/5-139--------------------------------------------------------------------------------
J9FJT3_WUCBA/174-306--------------------------------------------------------------------------------
A7S9W8_NEMVE/1-137--------------------------------------------------------------------------------
Q2HAM8_CHAGB/185-397--------------------------------------------------------------------------------
A7S7H4_NEMVE/1272-1403--------------------------------------------------------------------------------
H2ZM81_CIOSA/317-452--------------------------------------------------------------------------------
U5H657_USTV1/931-1067--------------------------------------------------------------------------------
D7TI61_VITVI/437-575--------------------------------------------------------------------------------
T5ACT8_OPHSC/215-351--------------------------------------------------------------------------------
I1MJV8_SOYBN/128-270--------------------------------------------------------------------------------
K3Y698_SETIT/311-449--------------------------------------------------------------------------------
K3Y7A4_SETIT/80-223--------------------------------------------------------------------------------
B7Q1P2_IXOSC/1192-1325--------------------------------------------------------------------------------
D7TAY9_VITVI/331-469--------------------------------------------------------------------------------
G7EB12_MIXOS/559-886--------------------------------------------------------------------------------
J7S680_KAZNA/150-287--------------------------------------------------------------------------------
U7Q061_SPOS1/487-740--------------------------------------------------------------------------------
G9MG20_HYPVG/322-524--------------------------------------------------------------------------------
G8XZL1_PICSO/128-265--------------------------------------------------------------------------------
G2XF66_VERDV/192-394--------------------------------------------------------------------------------
K1QXM6_CRAGI/5-167--------------------------------------------------------------------------------
D0NFE9_PHYIT/251-393--------------------------------------------------------------------------------
K3XF31_SETIT/338-480--------------------------------------------------------------------------------
F6Q7U6_ORNAN/151-282--------------------------------------------------------------------------------
E9EVG6_METRA/418-621--------------------------------------------------------------------------------
I7M1Y9_TETTS/89-224--------------------------------------------------------------------------------
J3P7Z2_GAGT3/427-625--------------------------------------------------------------------------------
A0BIE6_PARTE/204-344--------------------------------------------------------------------------------
T5AGE9_OPHSC/374-574--------------------------------------------------------------------------------
F6QHV0_MONDO/340-475--------------------------------------------------------------------------------
E9E0K3_METAQ/180-317--------------------------------------------------------------------------------
G3JL26_CORMM/398-599--------------------------------------------------------------------------------
F9XGG0_ZYMTI/186-391--------------------------------------------------------------------------------
C4JRH9_UNCRE/337-473--------------------------------------------------------------------------------
G9P5M8_HYPAI/35-170--------------------------------------------------------------------------------
E5SQQ4_TRISP/509-644--------------------------------------------------------------------------------
Q23DI1_TETTS/133-269--------------------------------------------------------------------------------
M4F5R7_BRARP/228-363--------------------------------------------------------------------------------
R7YYG2_CONA1/426-624--------------------------------------------------------------------------------
A0BNI8_PARTE/17-156--------------------------------------------------------------------------------
K0KIR7_WICCF/195-342--------------------------------------------------------------------------------
E9GRU8_DAPPU/153-289--------------------------------------------------------------------------------
B2AM24_PODAN/407-619--------------------------------------------------------------------------------
Q6FY47_CANGA/158-294--------------------------------------------------------------------------------
K7K6W6_SOYBN/472-610--------------------------------------------------------------------------------
M3BUB4_SPHMS/369-565--------------------------------------------------------------------------------
F6HE16_VITVI/375-517--------------------------------------------------------------------------------
C4Y9B7_CLAL4/138-272--------------------------------------------------------------------------------
R9AVA4_WALI9/217-354--------------------------------------------------------------------------------
B9SK12_RICCO/287-425--------------------------------------------------------------------------------
H6C1G6_EXODN/112-376--------------------------------------------------------------------------------
U9TJV4_RHIID/1-136--------------------------------------------------------------------------------
G3AP02_SPAPN/37-179--------------------------------------------------------------------------------
R7Z4V4_CONA1/260-394--------------------------------------------------------------------------------
G0R5U6_ICHMG/90-225--------------------------------------------------------------------------------
A8Q7N5_MALGO/580-845--------------------------------------------------------------------------------
K2RJ90_MACPH/420-620--------------------------------------------------------------------------------
B0WKC0_CULQU/163-301--------------------------------------------------------------------------------
G0SA06_CHATD/570-705--------------------------------------------------------------------------------
C5GU86_AJEDR/670-806--------------------------------------------------------------------------------
W1NMN5_AMBTC/178-314--------------------------------------------------------------------------------
V2WZC4_MONRO/526-864--------------------------------------------------------------------------------
T1ETR1_HELRO/308-446--------------------------------------------------------------------------------
T1FX57_HELRO/6-141--------------------------------------------------------------------------------
N1PF88_DOTSN/177-372--------------------------------------------------------------------------------
A8NEN2_COPC7/474-610--------------------------------------------------------------------------------
A1CD65_ASPCL/281-513--------------------------------------------------------------------------------
A8QC89_MALGO/15-152--------------------------------------------------------------------------------
J5K4M9_BEAB2/397-598--------------------------------------------------------------------------------
G4U9D0_NEUT9/214-431--------------------------------------------------------------------------------
G9MVK2_HYPVG/4-139--------------------------------------------------------------------------------
K7K544_SOYBN/67-203--------------------------------------------------------------------------------
K4CIR0_SOLLC/70-206--------------------------------------------------------------------------------
Q500V8_ARATH/330-468--------------------------------------------------------------------------------
D0MU40_PHYIT/31-168--------------------------------------------------------------------------------
A0A0D2X8M3_FUSO4/186-387--------------------------------------------------------------------------------
E0VFT2_PEDHC/270-407--------------------------------------------------------------------------------
A0A0C4ELE8_PUCT1/377-584--------------------------------------------------------------------------------
A0A023B4A3_GRENI/252-386--------------------------------------------------------------------------------
Q2GU55_CHAGB/195-329--------------------------------------------------------------------------------
W5KNU3_ASTMX/1266-1402--------------------------------------------------------------------------------
A8JHY3_CHLRE/19-147--------------------------------------------------------------------------------
M2YKU0_DOTSN/375-566--------------------------------------------------------------------------------
A0BI26_PARTE/40-178--------------------------------------------------------------------------------
K4B806_SOLLC/250-386--------------------------------------------------------------------------------
A8NRM6_COPC7/377-678--------------------------------------------------------------------------------
Q5K6Y0_CRYNJ/435-735--------------------------------------------------------------------------------
C5YY10_SORBI/414-556--------------------------------------------------------------------------------
M0SQV1_MUSAM/439-577--------------------------------------------------------------------------------
F2UD73_SALR5/651-791--------------------------------------------------------------------------------
M1WE61_CLAP2/348-546--------------------------------------------------------------------------------
G7DU39_MIXOS/711-847--------------------------------------------------------------------------------
U4LEH5_PYROM/784-918--------------------------------------------------------------------------------
A0A068XD19_HYMMI/150-287--------------------------------------------------------------------------------
F0VF22_NEOCL/53-196--------------------------------------------------------------------------------
K7VKN2_MAIZE/372-514--------------------------------------------------------------------------------
A0EIT2_PARTE/53-193--------------------------------------------------------------------------------
G4VB52_SCHMA/567-702--------------------------------------------------------------------------------
G2R1Z8_THITE/334-546--------------------------------------------------------------------------------
T1KJU9_TETUR/1-134--------------------------------------------------------------------------------
D7KJU6_ARALL/231-373--------------------------------------------------------------------------------
Q6CPT1_KLULA/113-254--------------------------------------------------------------------------------
G4MRQ6_MAGO7/382-591--------------------------------------------------------------------------------
H6BKA5_EXODN/395-603--------------------------------------------------------------------------------
M3ZSP2_XIPMA/204-342--------------------------------------------------------------------------------
D7EHP9_TRICA/107-245--------------------------------------------------------------------------------
D7TGT4_VITVI/456-598--------------------------------------------------------------------------------
M2MNT8_BAUCO/2-142--------------------------------------------------------------------------------
B4JYU7_DROGR/406-542--------------------------------------------------------------------------------
M2R5C6_CERS8/312-622--------------------------------------------------------------------------------
I2G755_USTH4/614-1021--------------------------------------------------------------------------------
G2YI69_BOTF4/640-774--------------------------------------------------------------------------------
M2LBF0_BAUCO/297-486--------------------------------------------------------------------------------
W5FHC2_WHEAT/473-609--------------------------------------------------------------------------------
B8M0U8_TALSN/418-647--------------------------------------------------------------------------------
I7ME02_TETTS/181-321--------------------------------------------------------------------------------
B8NFL9_ASPFN/369-570--------------------------------------------------------------------------------
F7ADG8_MONDO/97-235--------------------------------------------------------------------------------
S9VPX4_SCHCR/340-468--------------------------------------------------------------------------------
B7GER0_PHATC/265-395--------------------------------------------------------------------------------
A0E4N3_PARTE/17-156--------------------------------------------------------------------------------
I3K0G5_ORENI/1247-1379--------------------------------------------------------------------------------
A0A0C4E4W3_MAGP6/566-701--------------------------------------------------------------------------------
Q4WG49_ASPFU/286-529--------------------------------------------------------------------------------
J3NGE7_GAGT3/571-706--------------------------------------------------------------------------------
Q23VX3_TETTS/28-165--------------------------------------------------------------------------------
S3C8R4_OPHP1/452-730--------------------------------------------------------------------------------
A0D256_PARTE/42-168--------------------------------------------------------------------------------
A7ANQ1_BABBO/246-380--------------------------------------------------------------------------------
K1WQI3_MARBU/640-774--------------------------------------------------------------------------------
N1RAN2_FUSC4/749-897--------------------------------------------------------------------------------
M0SL27_MUSAM/525-663--------------------------------------------------------------------------------
I1KSN3_SOYBN/457-595--------------------------------------------------------------------------------
A5DC36_PICGU/83-220--------------------------------------------------------------------------------
E9HGQ0_DAPPU/1-135--------------------------------------------------------------------------------
V5F1H8_PSEBG/297-702--------------------------------------------------------------------------------
E0VS89_PEDHC/1201-1325--------------------------------------------------------------------------------
U1NTW9_ASCSU/150-282--------------------------------------------------------------------------------
E7KM29_YEASL/155-291--------------------------------------------------------------------------------
M2ZLJ7_PSEFD/365-555--------------------------------------------------------------------------------
O77335_PLAF7/24-160--------------------------------------------------------------------------------
F0XUX5_GROCL/280-497--------------------------------------------------------------------------------
C3Y1F9_BRAFL/1604-1735--------------------------------------------------------------------------------
K1QIA1_CRAGI/1268-1399--------------------------------------------------------------------------------
Q0CTW5_ASPTN/425-627--------------------------------------------------------------------------------
W5MRF3_LEPOC/1280-1411--------------------------------------------------------------------------------
N1QE16_SPHMS/327-465--------------------------------------------------------------------------------
C1GVY0_PARBA/671-807--------------------------------------------------------------------------------
D5GAI5_TUBMM/941-1075--------------------------------------------------------------------------------
U4LG29_PYROM/546-681--------------------------------------------------------------------------------
A7TK77_VANPO/213-350--------------------------------------------------------------------------------
T1JES8_STRMM/1256-1387--------------------------------------------------------------------------------
F1NS70_CHICK/1295-1426--------------------------------------------------------------------------------
F8QD12_SERL3/161-493--------------------------------------------------------------------------------
I2GVC1_TETBL/450-593--------------------------------------------------------------------------------
B4J3H0_DROGR/281-419--------------------------------------------------------------------------------
F4R3K9_MELLP/487-752--------------------------------------------------------------------------------
G2Q1Z5_THIHA/160-391--------------------------------------------------------------------------------
T1JB38_STRMM/305-440--------------------------------------------------------------------------------
G0W470_NAUDC/181-318--------------------------------------------------------------------------------
D5GNV8_TUBMM/529-729--------------------------------------------------------------------------------
F0X9L9_GROCL/466-601--------------------------------------------------------------------------------
I1FS50_AMPQE/319-455--------------------------------------------------------------------------------
A0C791_PARTE/169-302--------------------------------------------------------------------------------
U1GGT6_ENDPU/374-579--------------------------------------------------------------------------------
F2U4B6_SALR5/26-157--------------------------------------------------------------------------------
Q0UXB1_PHANO/123-324--------------------------------------------------------------------------------
M3D6T2_SPHMS/5-146--------------------------------------------------------------------------------
J4IAX7_FIBRA/582-930--------------------------------------------------------------------------------
R9PLK4_PSEHS/830-1245--------------------------------------------------------------------------------
K3WL53_PYTUL/60-197--------------------------------------------------------------------------------
MMI1_SCHPO/350-477--------------------------------------------------------------------------------
F4RX17_MELLP/35-171--------------------------------------------------------------------------------
G0T2B8_RHOG2/670-1019--------------------------------------------------------------------------------
K5VXL5_PHACS/571-840--------------------------------------------------------------------------------
S8AI65_DACHA/477-669--------------------------------------------------------------------------------
J9JSF7_ACYPI/99-234--------------------------------------------------------------------------------
A0A0D1E4L6_USTMA/726-863--------------------------------------------------------------------------------
U5HCN5_USTV1/575-723--------------------------------------------------------------------------------
M7X3Z8_RHOT1/666-1012--------------------------------------------------------------------------------
S7ZRN7_PENO1/422-658--------------------------------------------------------------------------------
A0A068YDE4_ECHMU/401-537--------------------------------------------------------------------------------
M3AKS3_PSEFD/271-466--------------------------------------------------------------------------------
S8EIQ3_FOMPI/603-928--------------------------------------------------------------------------------
H3GWX4_PHYRM/253-395--------------------------------------------------------------------------------
A7E4D0_SCLS1/650-784--------------------------------------------------------------------------------
G0RBB9_HYPJQ/259-394--------------------------------------------------------------------------------
B2ARG7_PODAN/13-148--------------------------------------------------------------------------------
M1CBM7_SOLTU/322-464--------------------------------------------------------------------------------
C5DJE4_LACTC/115-250--------------------------------------------------------------------------------
E9CW19_COCPS/506-642--------------------------------------------------------------------------------
A2R166_ASPNC/418-622--------------------------------------------------------------------------------
A0A023B246_GRENI/12-144--------------------------------------------------------------------------------
K1V256_TRIAC/598-935--------------------------------------------------------------------------------
H2AVY0_KAZAF/114-253--------------------------------------------------------------------------------
U9SY90_RHIID/16-149--------------------------------------------------------------------------------
D7FPL2_ECTSI/246-375--------------------------------------------------------------------------------
M3AKK0_PSEFD/1-137--------------------------------------------------------------------------------
G4V1D5_NEUT9/504-639--------------------------------------------------------------------------------
M4BLQ1_HYAAE/253-395--------------------------------------------------------------------------------
E3L1K1_PUCGT/165-453--------------------------------------------------------------------------------
Q8ILQ1_PLAF7/371-505--------------------------------------------------------------------------------
S3CZX6_GLAL2/392-590--------------------------------------------------------------------------------
D7KVZ9_ARALL/316-458--------------------------------------------------------------------------------
K3WDK3_PYTUL/256-398--------------------------------------------------------------------------------
C1G9S2_PARBD/356-556--------------------------------------------------------------------------------
A7ANR0_BABBO/25-162--------------------------------------------------------------------------------
V5I0K1_BYSSN/496-699--------------------------------------------------------------------------------
C8V3R8_EMENI/419-625--------------------------------------------------------------------------------
G8JU51_ERECY/138-279--------------------------------------------------------------------------------
U5H5H6_USTV1/766-1126--------------------------------------------------------------------------------
J9K832_ACYPI/334-468--------------------------------------------------------------------------------
S3CNK2_OPHP1/560-695--------------------------------------------------------------------------------
D8QT35_SELML/2-137--------------------------------------------------------------------------------
A0D629_PARTE/49-182--------------------------------------------------------------------------------
A9USV5_MONBE/253-383--------------------------------------------------------------------------------
F9X648_ZYMTI/3-143--------------------------------------------------------------------------------
G2QHR3_THIHA/207-342--------------------------------------------------------------------------------
Q6C164_YARLI/197-381--------------------------------------------------------------------------------
A0A068Y5Q0_ECHMU/21-159--------------------------------------------------------------------------------
Q4UE68_THEAN/26-159--------------------------------------------------------------------------------
N1PQZ2_DOTSN/317-457--------------------------------------------------------------------------------

PF01878

P74098_SYNY3/2-139--------------------------------------------------------------------------------
Q9WWK9_SYNP2/2-141--------------------------------------------------------------------------------
A6BZ09_9PLAN/29-165--------------------------------------------------------------------------------
A7I926_METB6/3-143--------------------------------------------------------------------------------
A3JN92_9RHOB/3-135--------------------------------------------------------------------------------
A8LMB8_DINSH/3-149--------------------------------------------------------------------------------
A1U8X5_MYCSK/2-132--------------------------------------------------------------------------------
YOUG_BACLI/5-143--------------------------------------------------------------------------------
A6EIT2_9SPHI/6-138--------------------------------------------------------------------------------
YDCG_BACSU/4-136--------------------------------------------------------------------------------
A5CUD6_CLAM3/3-135--------------------------------------------------------------------------------
Y1062_HELHP/2-131--------------------------------------------------------------------------------
Y442_STRMU/3-132--------------------------------------------------------------------------------
Y254_STRSV/3-132--------------------------------------------------------------------------------
A0A0A8UTV7_LEGHA/3-136--------------------------------------------------------------------------------
A1WQL9_VEREI/5-137--------------------------------------------------------------------------------
Q2KBY7_RHIEC/3-135--------------------------------------------------------------------------------
Y8638_RHILO/3-120--------------------------------------------------------------------------------
Y3206_RHILO/3-137--------------------------------------------------------------------------------
Q2GIJ6_ANAPZ/5-132--------------------------------------------------------------------------------
Q73H50_WOLPM/2-129--------------------------------------------------------------------------------
Q2GF45_EHRCR/2-130--------------------------------------------------------------------------------
Q5FGQ0_EHRRG/2-130--------------------------------------------------------------------------------
Q024K9_SOLUE/2-130--------------------------------------------------------------------------------
Q5KKF6_CRYNJ/7-162--------------------------------------------------------------------------------
B4U7S2_HYDS0/2-128--------------------------------------------------------------------------------
Q1D7F1_MYXXD/5-135--------------------------------------------------------------------------------
Q7S515_NEUCR/88-252--------------------------------------------------------------------------------
Q0U623_PHANO/118-277--------------------------------------------------------------------------------
Q0CLU5_ASPTN/109-262--------------------------------------------------------------------------------
Q7NK15_GLOVI/2-148--------------------------------------------------------------------------------
Q4E145_TRYCC/13-158--------------------------------------------------------------------------------
Q4Q067_LEIMA/12-157--------------------------------------------------------------------------------
Q1QBK5_PSYCK/2-150--------------------------------------------------------------------------------
THYN1_HUMAN/55-219--------------------------------------------------------------------------------
Q6MNE3_BDEBA/2-149--------------------------------------------------------------------------------
Q4K403_PSEF5/2-148--------------------------------------------------------------------------------
A4B9S6_9GAMM/2-149--------------------------------------------------------------------------------
A0YIC7_LYNSP/2-148--------------------------------------------------------------------------------
Q10WF5_TRIEI/2-148--------------------------------------------------------------------------------
Q8YY67_NOSS1/2-148--------------------------------------------------------------------------------
Q5SK57_THET8/2-146--------------------------------------------------------------------------------
Q2JN10_SYNJB/2-148--------------------------------------------------------------------------------
P74153_SYNY3/2-148--------------------------------------------------------------------------------
Q31PN6_SYNE7/2-148--------------------------------------------------------------------------------
A2BYF2_PROM5/5-151--------------------------------------------------------------------------------
A5GV42_SYNR3/7-153--------------------------------------------------------------------------------
Q7V5V1_PROMM/7-153--------------------------------------------------------------------------------
Q7VA84_PROMA/7-153--------------------------------------------------------------------------------
Q46J77_PROMT/7-153--------------------------------------------------------------------------------
A4CF59_9GAMM/2-149--------------------------------------------------------------------------------
Q080Z6_SHEFN/2-151--------------------------------------------------------------------------------
M6BZG6_LEPBO/2-151--------------------------------------------------------------------------------
Q7UMR5_RHOBA/2-156--------------------------------------------------------------------------------
A6G9B9_9DELT/7-159--------------------------------------------------------------------------------
Q1IWR4_DEIGD/15-161--------------------------------------------------------------------------------
Q21FZ3_SACD2/2-148--------------------------------------------------------------------------------
A3ZLP5_9PLAN/16-165--------------------------------------------------------------------------------
Q3A4Z6_PELCD/6-155--------------------------------------------------------------------------------
B3E7D4_GEOLS/2-150--------------------------------------------------------------------------------
Q74AS6_GEOSL/6-154--------------------------------------------------------------------------------
A1ATY5_PELPD/2-150--------------------------------------------------------------------------------
Q312I8_DESAG/2-150--------------------------------------------------------------------------------
Q1MR11_LAWIP/2-150--------------------------------------------------------------------------------
Q729D5_DESVH/2-149--------------------------------------------------------------------------------
A1U5E7_MARHV/2-150--------------------------------------------------------------------------------
A6VZD9_MARMS/3-149--------------------------------------------------------------------------------
A0XX89_9GAMM/2-150--------------------------------------------------------------------------------
Q15ZW9_PSEA6/6-155--------------------------------------------------------------------------------
Q2SNU3_HAHCH/2-150--------------------------------------------------------------------------------
Q2C4F7_9GAMM/2-148--------------------------------------------------------------------------------
A7K5A8_VIBAE/2-149--------------------------------------------------------------------------------
Q143L8_BURXL/2-150--------------------------------------------------------------------------------
B7WUP3_COMTE/10-158--------------------------------------------------------------------------------
Q7P0R4_CHRVO/4-152--------------------------------------------------------------------------------
Q129F1_POLSJ/2-150--------------------------------------------------------------------------------
A6SVM1_JANMA/2-150--------------------------------------------------------------------------------
A3RRU2_RALSL/81-227--------------------------------------------------------------------------------
B2JES7_BURP8/2-150--------------------------------------------------------------------------------
Q82TJ8_NITEU/2-150--------------------------------------------------------------------------------
Q478H8_DECAR/2-148--------------------------------------------------------------------------------
Q0HU59_SHESR/2-151--------------------------------------------------------------------------------
B4SI17_STRM5/6-155--------------------------------------------------------------------------------
Q83BN8_COXBU/2-151--------------------------------------------------------------------------------
A1WW93_HALHL/2-151--------------------------------------------------------------------------------
Q60BW0_METCA/2-151--------------------------------------------------------------------------------
Q0A5L0_ALKEH/2-151--------------------------------------------------------------------------------
A4BS86_9GAMM/2-151--------------------------------------------------------------------------------
Q1K2S0_DESAC/2-151--------------------------------------------------------------------------------
A0RTQ4_CENSY/6-139--------------------------------------------------------------------------------
A9A4S8_NITMS/3-136--------------------------------------------------------------------------------
Q2IM08_ANADE/10-138--------------------------------------------------------------------------------
A9AWV2_HERA2/2-132--------------------------------------------------------------------------------
B8GCZ0_CHLAD/3-133--------------------------------------------------------------------------------
A0ZBN7_NODSP/2-132--------------------------------------------------------------------------------
A2XKL1_ORYSI/18-161--------------------------------------------------------------------------------
Q1N713_SPHSS/19-149--------------------------------------------------------------------------------
A5V5W6_SPHWW/16-146--------------------------------------------------------------------------------
A3HZ69_9BACT/9-137--------------------------------------------------------------------------------
Q1GUB4_SPHAL/4-135--------------------------------------------------------------------------------
Q2G8P8_NOVAD/13-143--------------------------------------------------------------------------------
Q2NBR4_ERYLH/3-133--------------------------------------------------------------------------------
A3W9K5_9SPHN/3-133--------------------------------------------------------------------------------
Q1V170_PELUQ/2-134--------------------------------------------------------------------------------
A6EJQ3_9SPHI/2-132--------------------------------------------------------------------------------
Q11YZ0_CYTH3/2-132--------------------------------------------------------------------------------
A5G2F8_ACICJ/2-132--------------------------------------------------------------------------------
Q5FQF2_GLUOX/2-132--------------------------------------------------------------------------------
Q2RNC8_RHORT/2-132--------------------------------------------------------------------------------
A4TWZ7_9PROT/2-132--------------------------------------------------------------------------------
A7HSS8_PARL1/2-134--------------------------------------------------------------------------------
Q0C4X5_HYPNA/2-134--------------------------------------------------------------------------------
Q0G4A9_9RHIZ/2-134--------------------------------------------------------------------------------
Q2K3E0_RHIEC/2-135--------------------------------------------------------------------------------
Q98EI4_RHILO/2-134--------------------------------------------------------------------------------
Q8KZ39_9PROT/2-134--------------------------------------------------------------------------------
A3JM70_9RHOB/2-134--------------------------------------------------------------------------------
A4EH47_9RHOB/9-141--------------------------------------------------------------------------------
B0UCG1_METS4/2-134--------------------------------------------------------------------------------
E0TE14_PARBH/2-135--------------------------------------------------------------------------------
A7IEB4_XANP2/28-160--------------------------------------------------------------------------------
Q13DX9_RHOPS/2-134--------------------------------------------------------------------------------
A6EMU5_9BACT/174-313--------------------------------------------------------------------------------
Q8ZZI9_PYRAE/3-147--------------------------------------------------------------------------------
A4WL01_PYRAR/3-147--------------------------------------------------------------------------------
A3CVK7_METMJ/19-161--------------------------------------------------------------------------------
Q2FT29_METHJ/14-155--------------------------------------------------------------------------------
Q2FP01_METHJ/2-143--------------------------------------------------------------------------------
A6UNC0_METVS/2-141--------------------------------------------------------------------------------
A6VFA8_METM7/22-163--------------------------------------------------------------------------------
Y1033_PYRHO/2-143--------------------------------------------------------------------------------
Y875_PYRAB/2-141--------------------------------------------------------------------------------
Y2356_ARCFU/2-145--------------------------------------------------------------------------------
Y3536_METJA/2-144--------------------------------------------------------------------------------
Q4JC14_SULAC/2-142--------------------------------------------------------------------------------
A4YGW0_METS5/2-141--------------------------------------------------------------------------------
Y2595_SULSO/2-141--------------------------------------------------------------------------------

PF12961

B0T870_CAUSK/4-75--------------------------------------------------------------------------------
R9TBY5_9EURY/3-77--------------------------------------------------------------------------------
A2SN47_METPP/13-94--------------------------------------------------------------------------------
R6E210_9FIRM/7-77--------------------------------------------------------------------------------
J9RHJ8_9ACTN/3-74--------------------------------------------------------------------------------
R5Y974_9FIRM/3-77--------------------------------------------------------------------------------
R7BMW7_9FIRM/17-92--------------------------------------------------------------------------------
D3UZP9_XENBS/15-94--------------------------------------------------------------------------------
X2H0U5_9BACI/244-319--------------------------------------------------------------------------------
R6TFC5_9FIRM/329-401--------------------------------------------------------------------------------
R5F6I4_9CLOT/7-75--------------------------------------------------------------------------------
A7MEP6_CROS8/3-73--------------------------------------------------------------------------------
M9SC14_9EURY/4-81--------------------------------------------------------------------------------
K8EIC3_CARML/4-76--------------------------------------------------------------------------------
W8FAL7_9BACT/20-95--------------------------------------------------------------------------------
R5KJ01_9CLOT/4-86--------------------------------------------------------------------------------
A6LYH9_CLOB8/3-77--------------------------------------------------------------------------------
R9VFQ2_9ENTR/5-83--------------------------------------------------------------------------------
F0LNE9_VIBFN/7-81--------------------------------------------------------------------------------
R6T3D1_9FIRM/130-204--------------------------------------------------------------------------------
B2TNZ8_CLOBB/5-89--------------------------------------------------------------------------------
D4MVL8_9FIRM/411-483--------------------------------------------------------------------------------
R9TAF8_9EURY/14-88--------------------------------------------------------------------------------
A8E2L6_BPPHE/105-175--------------------------------------------------------------------------------
A8FAI2_BACP2/6-76--------------------------------------------------------------------------------
Q8CWZ2_STRMU/4-76--------------------------------------------------------------------------------
Q832V0_ENTFA/113-183--------------------------------------------------------------------------------
W8FCI0_9BACT/21-96--------------------------------------------------------------------------------
K8E4A8_CARML/4-76--------------------------------------------------------------------------------

PF04266

Q7PS17_ANOGA/408-520--------------------------------------------------------------------------------
Q1Z8F3_PHOPR/9-107--------------------------------------------------------------------------------
O59345_PYRHO/1-111--------------------------------------------------------------------------------
Q669U5_YERPS/14-127--------------------------------------------------------------------------------
O28749_ARCFU/4-103--------------------------------------------------------------------------------
Q57H41_SALCH/24-141--------------------------------------------------------------------------------
Q2P9X4_BPP2/8-81--------------------------------------------------------------------------------
B9WV89_STRSU/24-154--------------------------------------------------------------------------------
B1YID4_EXIS2/5-113--------------------------------------------------------------------------------
Q1ZT49_PHOAS/30-153--------------------------------------------------------------------------------
Q82ZD1_ENTFA/26-150--------------------------------------------------------------------------------
Q3EQG9_BACTI/8-116--------------------------------------------------------------------------------
Q5WBH3_BACSK/27-150--------------------------------------------------------------------------------
Q8ZYT1_PYRAE/11-109--------------------------------------------------------------------------------
Q666W1_YERPS/141-216--------------------------------------------------------------------------------
Q8ZVS1_PYRAE/5-102--------------------------------------------------------------------------------
A6TNT9_ALKMQ/35-158--------------------------------------------------------------------------------
Q8A7V1_BACTN/8-125--------------------------------------------------------------------------------
TRIP4_HUMAN/437-549--------------------------------------------------------------------------------
B7MCE4_ECO45/27-144--------------------------------------------------------------------------------
Q5SM30_THET8/8-102--------------------------------------------------------------------------------
Q8G683_BIFLO/18-143--------------------------------------------------------------------------------
Q28T99_JANSC/34-145--------------------------------------------------------------------------------
Q1Z8W3_PHOPR/30-153--------------------------------------------------------------------------------
Q38XJ8_LACSS/28-150--------------------------------------------------------------------------------
Q74J94_LACJO/27-149--------------------------------------------------------------------------------
O59585_PYRHO/4-98--------------------------------------------------------------------------------
Y1447_PASMU/6-104--------------------------------------------------------------------------------
Q3M1U7_ANAVT/4-110--------------------------------------------------------------------------------
Q8TY14_METKA/239-342--------------------------------------------------------------------------------
Q4DDP1_TRYCC/470-580--------------------------------------------------------------------------------
Q8TV24_METKA/9-109--------------------------------------------------------------------------------
Q4SHG6_TETNG/424-545--------------------------------------------------------------------------------
Q5FJH1_LACAC/26-145--------------------------------------------------------------------------------
Q8LGK4_ARATH/109-212--------------------------------------------------------------------------------
O28463_ARCFU/4-98--------------------------------------------------------------------------------
Q39AD2_BURL3/6-102--------------------------------------------------------------------------------
Q49VC6_STAS1/27-147--------------------------------------------------------------------------------
O58093_PYRHO/5-109--------------------------------------------------------------------------------
Q8DSX1_STRMU/61-181--------------------------------------------------------------------------------
Q97KB9_CLOAB/33-156--------------------------------------------------------------------------------
Q29GM2_DROPS/388-499--------------------------------------------------------------------------------
YO91_BPP2/8-81--------------------------------------------------------------------------------
Q8ES55_OCEIH/29-152--------------------------------------------------------------------------------
Q74MN0_NANEQ/4-103--------------------------------------------------------------------------------
A0A0B8RBU5_LISMN/29-152--------------------------------------------------------------------------------
Q5JIS1_THEKO/5-129--------------------------------------------------------------------------------
Q57UA7_TRYB2/469-579--------------------------------------------------------------------------------
Q9KEN6_BACHD/5-112--------------------------------------------------------------------------------
Y1576_VIBCH/7-105--------------------------------------------------------------------------------
Q6DAK1_PECAS/16-132--------------------------------------------------------------------------------
Q8DQF2_STRR6/24-144--------------------------------------------------------------------------------
Q7Y1E7_ORYSJ/14-135--------------------------------------------------------------------------------
A5VL14_LACRD/4-98--------------------------------------------------------------------------------
Q5JEH0_THEKO/6-109--------------------------------------------------------------------------------
F8Y0N6_STRAG/6-81--------------------------------------------------------------------------------
Q5JHR0_THEKO/9-103--------------------------------------------------------------------------------
Q6FET4_ACIAD/8-104--------------------------------------------------------------------------------
Y267_MORMI/5-104--------------------------------------------------------------------------------
Q9AA41_CAUCR/6-84--------------------------------------------------------------------------------
Q6MN09_BDEBA/6-102--------------------------------------------------------------------------------
Q9CH09_LACLA/21-146--------------------------------------------------------------------------------
Q5JEG9_THEKO/4-104--------------------------------------------------------------------------------
Q8TYL3_METKA/4-109--------------------------------------------------------------------------------
O58177_PYRHO/25-125--------------------------------------------------------------------------------
Q6ZM46_DANRE/402-514--------------------------------------------------------------------------------
Q6F0Z5_MESFL/5-88--------------------------------------------------------------------------------
A9VQI1_BACWK/25-145--------------------------------------------------------------------------------
Q5JEL3_THEKO/6-109--------------------------------------------------------------------------------
O86782_STRCO/58-183--------------------------------------------------------------------------------
Q4QIG2_LEIMA/490-600--------------------------------------------------------------------------------
O58178_PYRHO/7-110--------------------------------------------------------------------------------
Q1WTR7_LACS1/28-149--------------------------------------------------------------------------------
Q53LS7_ORYSJ/126-229--------------------------------------------------------------------------------
Q5JG45_THEKO/12-113--------------------------------------------------------------------------------
Y2524_SHEB5/6-104--------------------------------------------------------------------------------
Y1394_HAEIN/6-104--------------------------------------------------------------------------------
Q1ZQA8_PHOAS/10-108--------------------------------------------------------------------------------
H7C704_ENTFA/11-82--------------------------------------------------------------------------------
A0A0E1EJ20_STRAG/24-144--------------------------------------------------------------------------------

PF02190

LONM_ASHGO/157-410--------------------------------------------------------------------------------
LONM1_DICDI/158-355--------------------------------------------------------------------------------
A5DBM7_PICGU/11-325--------------------------------------------------------------------------------
A5DAP1_PICGU/270-494--------------------------------------------------------------------------------
Q0UIT5_PHANO/192-422--------------------------------------------------------------------------------
A1SL63_NOCSJ/4-197--------------------------------------------------------------------------------
LON1_BDEBA/7-200--------------------------------------------------------------------------------
LON_CLOPH/7-201--------------------------------------------------------------------------------
LON_AQUAE/16-212--------------------------------------------------------------------------------
Q9X1W8_THEMA/31-225--------------------------------------------------------------------------------
A8L4P8_FRASN/6-237--------------------------------------------------------------------------------
LON_NEOSM/32-229--------------------------------------------------------------------------------
A5CDI0_ORITB/12-207--------------------------------------------------------------------------------
LON_DESVH/17-214--------------------------------------------------------------------------------
A7HIT3_ANADF/21-218--------------------------------------------------------------------------------
LONM_CAEEL/88-357--------------------------------------------------------------------------------
LONM_ORYSJ/101-311--------------------------------------------------------------------------------
LON_FLAJ1/43-237--------------------------------------------------------------------------------
LON_FUSNN/3-196--------------------------------------------------------------------------------
Q176B8_AEDAE/115-373--------------------------------------------------------------------------------
B1YJV9_EXIS2/5-196--------------------------------------------------------------------------------
LON_DESOH/21-214--------------------------------------------------------------------------------
Q4UE63_THEAN/226-447--------------------------------------------------------------------------------
LON_KORVE/24-217--------------------------------------------------------------------------------
LON_SYNAS/22-218--------------------------------------------------------------------------------
A4RYB7_OSTLU/20-244--------------------------------------------------------------------------------
Q39SL1_GEOMG/12-202--------------------------------------------------------------------------------
Q5SJA3_THET8/5-197--------------------------------------------------------------------------------
YOXA_SCHPO/252-470--------------------------------------------------------------------------------
A1TLG4_ACIAC/20-217--------------------------------------------------------------------------------
A9AWT0_HERA2/15-210--------------------------------------------------------------------------------
C1DQT6_AZOVD/30-226--------------------------------------------------------------------------------
Q7MWJ0_PORGI/9-205--------------------------------------------------------------------------------
LONP2_NEUCR/10-256--------------------------------------------------------------------------------
A6L531_BACV8/39-234--------------------------------------------------------------------------------
Q9S2T2_STRCO/5-222--------------------------------------------------------------------------------
LONM_YARLI/202-503--------------------------------------------------------------------------------
Q3A8K2_PELCD/13-206--------------------------------------------------------------------------------
LONP2_YARLI/4-302--------------------------------------------------------------------------------
LONP2_BOVIN/12-220--------------------------------------------------------------------------------
LON2_SYNFM/17-208--------------------------------------------------------------------------------
LONP2_CANAL/21-402--------------------------------------------------------------------------------
LON1_HERA2/13-209--------------------------------------------------------------------------------
Q4FNU4_PELUB/9-201--------------------------------------------------------------------------------
Q057E4_BUCCC/10-202--------------------------------------------------------------------------------
Q1D5A0_MYXXD/32-225--------------------------------------------------------------------------------
A4FLR4_SACEN/3-200--------------------------------------------------------------------------------
Q4X3M7_PLACH/41-324--------------------------------------------------------------------------------
LON_DICNV/5-198--------------------------------------------------------------------------------
LON_NITOC/5-198--------------------------------------------------------------------------------
Q67SJ7_SYMTH/11-204--------------------------------------------------------------------------------
A4YSN7_BRASO/70-260--------------------------------------------------------------------------------
LONP2_ASPNC/10-255--------------------------------------------------------------------------------
Q0U2R2_PHANO/14-258--------------------------------------------------------------------------------
Q4FM92_PELUB/7-199--------------------------------------------------------------------------------
Q8ILU7_PLAF7/45-357--------------------------------------------------------------------------------
LON_MYCPE/15-212--------------------------------------------------------------------------------
CRBN_RAT/83-320--------------------------------------------------------------------------------
A5K180_PLAVS/44-319--------------------------------------------------------------------------------
LON2_HERA2/18-210--------------------------------------------------------------------------------
LON_MAGMM/41-240--------------------------------------------------------------------------------
LON1_DESPS/34-236--------------------------------------------------------------------------------
LON_MYCMO/2-196--------------------------------------------------------------------------------
LONP2_PICST/18-364--------------------------------------------------------------------------------
B1HVE4_LYSSC/9-197--------------------------------------------------------------------------------
E4XTK2_OIKDI/43-290--------------------------------------------------------------------------------
G1TBZ8_RABIT/210-407--------------------------------------------------------------------------------
I1QQQ1_ORYGL/12-253--------------------------------------------------------------------------------
J9Z7L8_LEPFM/44-237--------------------------------------------------------------------------------
J9ZC05_LEPFM/4-193--------------------------------------------------------------------------------
J9ZD27_LEPFM/11-209--------------------------------------------------------------------------------
M4B6H0_HYAAE/97-299--------------------------------------------------------------------------------
LON2_BORBU/9-200--------------------------------------------------------------------------------
P96280_MYCTU/8-204--------------------------------------------------------------------------------
LON1_BORBU/31-231--------------------------------------------------------------------------------
Q5E916_ARATH/98-437--------------------------------------------------------------------------------
Q5NH45_FRATT/7-203--------------------------------------------------------------------------------
Q63XL2_BURPS/11-205--------------------------------------------------------------------------------
Q6FD62_ACIAD/18-212--------------------------------------------------------------------------------
Q87YR8_PSESM/6-197--------------------------------------------------------------------------------
R5K463_9CLOT/9-200--------------------------------------------------------------------------------
R6MYW8_9CLOT/11-203--------------------------------------------------------------------------------

PF09157

TRUB_XYLFA/245-300---------------PALELDAQR--------------L-------------------------------ACFRL--GQ-
TRUB_ACTSZ/247-304---------------PPLVLNEQQ--------------T-------------------------------KAVGF--GQ-
TRUB_CHRVO/242-300---------------PQLELADEE--------------I-------------------------------GKFLH--GQ-
TRUB_AZOSB/241-294---------------PKVELQPAE--------------A-------------------------------AAILQ--GR-
Q609C4_METCA/59-115---------------PAAWLDAGT--------------A-------------------------------RLFRH--GQ-
TRUB_SHIDS/252-309---------------PVVNLPLTS--------------S-------------------------------VYFKN--GN-
TRUB_YERPE/252-309---------------PEVNLLPSV--------------A-------------------------------AYVKQ--GQ-
Q140U4_BURXL/245-306---------------PLVQLNEDA--------------T-------------------------------RRFLH--GQ-
TRUB_PSYIN/251-308---------------PEVNISDEM--------------G-------------------------------EYVLH--GQ-
TRUB_MARHV/244-302---------------PEYRLSGVP--------------L-------------------------------VSILN--GQ-
TRUB_SHEFN/251-308---------------AEINLPEAM--------------L-------------------------------YYVMQ--GQ-
TRUB_VIBF1/251-308---------------PEVNMIPEL--------------A-------------------------------DHVLH--GQ-
Q0VSR9_ALCBS/246-303---------------PRVELGDNA--------------A-------------------------------YYLQQ--GQ-
TRUB_NOSS1/234-289---------------PSVTLPSIS--------------A-------------------------------QKWCQ--GQ-
TRUB_PSEHT/253-308---------------PVVEISKEQ--------------G-------------------------------SIFSH--GQ-
TRUB_ACTP2/246-303---------------PKLNLTAEQ--------------T-------------------------------KAVGF--GQ-
TRUB_COXBU/250-306---------------PAIKLSSST--------------A-------------------------------FYLQQ--GQ-
TRUB_SACD2/250-310---------------PSLELDDNS--------------A-------------------------------FYFSR--GQ-
TRUB_NITMU/246-307---------------PPVVVDSAA--------------A-------------------------------LSLLQ--GR-
TRUB_ACIAD/262-316---------------PQVQIPEGR--------------L-------------------------------KYFCN--GQ-
TRUB_GLOVI/235-289---------------AAVHLEPPL--------------A-------------------------------ARWLM--GQ-
TRUB_MANSM/246-303---------------PVLSLSEEQ--------------T-------------------------------KAVGF--GQ-
TRUB_NITEU/231-291---------------PSIVLDDDE--------------A-------------------------------LRLRQ--GQ-
TRUB_PSEA6/251-311---------------PSVELTPAS--------------R-------------------------------DSFLH--GQ-
A4SY76_POLSQ/241-299---------------PHLTVDEQQ--------------A-------------------------------KRLEM--GQ-
TRUB_BAUCH/253-312---------------PAIKLSKDS--------------V-------------------------------ARVRK--GQ-
A0KNE1_AERHH/266-323---------------PEVNMLAAV--------------A-------------------------------AYVNQ--GQ-
TRUB_SODGM/249-306---------------PLVNLPSDL--------------A-------------------------------ARLRL--GQ-
A0ZIL4_NODSP/234-288---------------PSVALPAIS--------------A-------------------------------QKWCQ--GQ-
TRUB_PECAS/252-309---------------PEVNLPPVV--------------A-------------------------------GYLKL--GQ-
TRUB_BUCBP/244-301---------------PEVNIVPNV--------------I-------------------------------KNLQN--GQ-
Q0K9C1_CUPNH/232-294---------------APVHLDEVS--------------A-------------------------------ARFLQ--GQ-
TRUB_SHEAM/251-308---------------PEVNIPDAV--------------A-------------------------------PYLMN--GN-
TRUB_HALHL/245-301---------------TGVELADDL--------------A-------------------------------YFVVQ--GQ-
TRUB_PHOLL/251-310---------------PEVNLIPVV--------------A-------------------------------AYFKQ--GQ-
TRUB_THIDA/239-293---------------PSVHLGETA--------------A-------------------------------ASLRQ--GR-
TRUB_IDILO/246-303---------------PEVTVTQAQ--------------T-------------------------------RDFLH--GQ-
TRUB_METFK/241-297---------------PIVTLDADS--------------A-------------------------------FYLLQ--GQ-
TRUB_MARMS/244-301---------------AKVELPESD--------------T-------------------------------VNMMF--GR-
A5EWY7_DICNV/237-289---------------PPLAIPEDK--------------I-------------------------------RFICH--GN-
Q0A799_ALKEH/244-300---------------PAVELAEDV--------------A-------------------------------FFLMQ--GQ-
TRUB_HAHCH/247-303---------------SEIILDEAN--------------T-------------------------------GSIIQ--GQ-
TRUB_CHRSD/242-299---------------PSLEVAASA--------------S-------------------------------RRLLH--GQ-
Q2JJL0_SYNJB/239-295---------------GAVQLSSAE--------------A-------------------------------KQWLQ--GR-
TRUB_AQUAE/232-286---------------PEVRLNTFE--------------A-------------------------------GKILQ--GK-
TRUB_DECAR/241-295---------------PIVGVEGPE--------------A-------------------------------ERFRH--GN-
TRUB_CALS4/230-285---------------PSVELDEVS--------------S-------------------------------NKILN--GQ-
A4G7S5_HERAR/244-306---------------PALRLSEEL--------------A-------------------------------KRFLH--GQ-
TRUB_BUCAI/250-307---------------PKVYLFPQQ--------------S-------------------------------YNFQL--GQ-
TRUB_CHESB/253-310---------------PEIVLGDDA--------------A-------------------------------GRIRL--GN-
TRUB_PASMU/246-303---------------PALHLNQEQ--------------S-------------------------------KAISF--GQ-
TRUB_SYNE7/234-291---------------AKVQLSAET--------------S-------------------------------DRWRQ--GQ-
TRUB_NITOC/247-303---------------PAVNLIADL--------------A-------------------------------YYLRQ--GQ-
TRUB_HAEDU/246-303---------------PKIKLTTMQ--------------T-------------------------------KAIGF--GQ-
TRUB_AROAE/245-299---------------PRIELDAFQ--------------A-------------------------------GLLLQ--GR-
TRUB_HISS2/246-303---------------PGLHLTKEQ--------------A-------------------------------RAVGF--GQ-
B4E7L3_BURCJ/247-306---------------PAIRLDDAS--------------A-------------------------------KRFLH--GQ-
TRUB_VIBTL/251-308---------------PEVNLNAEL--------------T-------------------------------DLVQH--GM-
M1FAI4_9ALTE/245-303---------------PEHRLSGPV--------------L-------------------------------VSILN--GQ-
M9X1B5_MANHA/247-303---------------.KINLSSEQ--------------T-------------------------------KAVGF--GQ-
TRUB_PSEAE/246-302---------------PVLQLSEHS--------------A-------------------------------YYWLH--GQ-
TRUB_LEGPH/243-299---------------.PVILSDSE--------------V-------------------------------TAIRQ--GK-
TRUB_BURPS/246-307---------------PCVKLDAAL--------------A-------------------------------TRFLH--GQ-
TRUB_PHOPR/251-308---------------PEANVTVEG--------------G-------------------------------DAILH--GQ-
TRUB_XANCP/245-299---------------.QITLDATL--------------A-------------------------------ARFRM--GQ-
TRUB_RALSO/252-312---------------PRVELGAED--------------S-------------------------------RRFLH--GQ-
TRUB_VIBCH/251-308---------------PEVNVIPEL--------------M-------------------------------TLIQH--GQ-

PF09142

TRUB_LEIXX/238-297--------------FERLRLTEQQ--------------A-------------------------------TDLAH--GK-
TRUB_THEFY/236-291--------------FPVRRLSAGE--------------A-------------------------------RRVVH--GH-
TRUB_COREF/238-293--------------YPVLEITEAE--------------G-------------------------------EALSM--GK-
TRUB_RHOJR/245-300--------------FPHRQVDADE--------------A-------------------------------ESISQ--GR-
TRUB_PROAC/237-295--------------FPVVHVTADQ--------------A-------------------------------AAIRV--GR-
TRUB_STRAW/243-301--------------FPRWDVDTKR--------------A-------------------------------RLLLN--GV-
Q0RDS8_FRAAA/250-305--------------FARRDVAGDA--------------A-------------------------------VDVRH--GR-
A5UZQ6_ROSS1/240-296--------------WYAVQVDEAS--------------A-------------------------------RRLRH--GM-
TRUB_BIFLO/329-385--------------MPALDITPEE--------------A-------------------------------SELRF--GR-
A1SLK5_NOCSJ/235-289--------------FASRDLDDAQ--------------A-------------------------------TDVRF--GR-
A1T7J3_MYCVP/243-298--------------FARRDITEAE--------------A-------------------------------ESASH--GR-
TRUB_CORDI/241-296--------------YPVLSVSEKE--------------A-------------------------------SDLAM--GK-
Q2IPZ4_ANADE/244-300--------------LAAIRLGERE--------------A-------------------------------WDLVH--GR-
A6W7Z8_KINRD/243-298--------------FPARELTVAE--------------V-------------------------------ATVSH--GG-
A4FM27_SACEN/227-282--------------FRRTDVDTAA--------------A-------------------------------RALAH--GQ-
TRUB_CORJK/248-303--------------FDTREISESE--------------G-------------------------------VDLSL--GK-
TRUB_MYCLE/247-302--------------FPRRDLTVSE--------------V-------------------------------EATSN--GR-
A7H9F6_ANADF/247-302--------------FPVLEVSWAE--------------A-------------------------------RDLAH--GR-
A8L6F8_FRASN/256-311--------------FPRRDVDGEQ--------------A-------------------------------RDVAY--GR-
TRUB_NOCFA/245-300--------------FPHRAIDARE--------------A-------------------------------ESLRD--GR-
A0QVP8_MYCS2/244-299--------------FPRRDLSAEE--------------T-------------------------------EDTRH--GR-
TRUB_MYCPA/234-289--------------FGRRDLSADE--------------A-------------------------------EAAGN--GR-
A9WGQ0_CHLAA/234-289--------------WPLVQVDADD--------------A-------------------------------NRLRH--GM-
B0RDY4_CLAMS/254-312--------------FDVLHLTDQE--------------A-------------------------------VDLGH--GK-
B2HKU5_MYCMM/242-297--------------FPRRDLTVDE--------------S-------------------------------QSVGN--GR-
TRUB_MYCTU/236-291--------------FARRDLTAAE--------------A-------------------------------SAAAN--GR-

PF01472

TRUB_SULTO/251-323---------------PKILIDDNA--------------V-------------------------------DAISY..GA.
PROB_BACSU/277-350---------------GEIIIDAGA--------------E-------------------------------EAMIH.NGS.
TRUB_AERPE/262-335---------------PKVLVRDSA--------------V-------------------------------ESLTH..GA.
DKC1_HUMAN/297-370---------------KRLVMKDSA--------------V-------------------------------NAICY..GA.
ATGT_METJA/578-651---------------YRVVVNKEA--------------E-------------------------------EFARE..GR.
ATGT_METTH/579-652---------------WRVAVNEES--------------E-------------------------------PFARK..GK.
Q9YEQ6_AERPE/84-160---------------GVVLVDKGA--------------A-------------------------------IALAK..GA.
TRUB_THEAC/210-279---------------PKIVVKRSA--------------M-------------------------------RNIAH..GS.
PROB_YEAST/322-409---------------GAVVIDQGA--------------Y-------------------------------AALTRKNKA.
YHJ3_YEAST/316-403---------------GAIIIDENS--------------Y-------------------------------DKLLSKDMA.
PROB_VIBPA/286-360---------------GDIIIDDGA--------------V-------------------------------NAVVG.KGS.
PROB_VIBCH/284-358---------------GDIVIDDGA--------------V-------------------------------KAVQT.KGS.
PROB_SHEON/281-355---------------GSLVLDAGA--------------V-------------------------------KAVTE.KGR.
PROB_ECOLI/276-350---------------GEITVDEGA--------------T-------------------------------AAILE.RGS.
PROB_HAEIN/276-350---------------GIITIDNGA--------------Q-------------------------------NAILE.QNK.
PROJ_BACSU/281-355---------------GEMILSDDC--------------S-------------------------------RKITN..GQS
Q8H5T5_ORYSJ/311-384---------------KRLVVKDSA--------------V-------------------------------NAICY..GA.
CBF5_KLULA/266-339---------------KRIVVKDSA--------------V-------------------------------NAVCY..GA.
DKC1_CAEEL/285-358---------------KRVVVKDSC--------------I-------------------------------NAICY..GA.
DKC1_DROME/295-368---------------KRIIMKDSS--------------V-------------------------------NAVCY..GA.
Q8ILS0_PLAF7/269-342---------------PRIVIKDSA--------------V-------------------------------NAICY..GA.
Q8SRW0_ENCCU/263-336---------------PRIMIKDSC--------------V-------------------------------NAICY..GA.
TRUB_METTH/240-313---------------PRVVILDSA--------------V-------------------------------DAICH..GA.
TRUB_ARCFU/237-310---------------PKIVIKDSA--------------V-------------------------------DAICH..GA.
TRUB_METJA/249-322---------------KKVVVKDSA--------------V-------------------------------DAICH..GA.
TRUB_METKA/248-321---------------PRIEIRDTA--------------V-------------------------------DAICH..GA.
TRUB_PYRAE/239-312---------------PKIWVRDSA--------------V-------------------------------DAICN..GA.
TRUB_SULSO/164-236---------------PKIVIEDSA--------------V-------------------------------NALAY..GA.
Q9HS38_HALSA/81-154---------------ARVVVGDES--------------E-------------------------------PFVRD..GK.
O29550_ARCFU/79-152---------------MRVVVMDEV--------------S-------------------------------DFIAA..GK.
Q975U3_SULTO/92-165---------------FRFIIKNEV--------------A-------------------------------SFIRE..GR.
ATGT_THEAC/554-627---------------MRVTVSKES--------------A-------------------------------EYNAK..GY.
Q8TWS6_METKA/77-150---------------HRVVCADEW--------------V-------------------------------EAVRR..GR.
Q8ZYG7_PYRAE/80-152---------------RRVVISREA--------------A-------------------------------EYVKQ..GR.
Q8TGZ2_METKA/63-136---------------HVVVADKFA--------------A-------------------------------ESVYV..GA.
Q8ZYJ6_PYRAE/89-161---------------KVVVVDKKA--------------A-------------------------------ESVML..GA.
Q9YD14_AERPE/93-165---------------KRVVADKVA--------------S-------------------------------ESVLM..GS.
Q8TXP0_METKA/124-195---------------KSIEVDRGA--------------A-------------------------------EAVRE..GK.
Q9HNT2_HALSA/517-583---------------KRVEIDGFV--------------P-------------------------------QG........
O27701_METTH/236-308---------------YMLGVKWVE--------------I-------------------------------DFNLE..SN.
Q8U4L1_PYRFU/502-568---------------YWVEIDFDV--------------.-------------------------------.......RG.
O29668_ARCFU/456-526---------------EKNIYTVEI--------------G-------------------------------DFEVK..G..
ARCS_METJA/501-568---------------NYIEVNYEI--------------K-------------------------------KG........
Y066_METJA/132-206---------------KIIKIKNDV--------------V-------------------------------EFLKN.RKG.
Q8I3H2_PLAF7/91-168---------------PQIQVDKGA--------------I-------------------------------KHVLR..GS.
Q8RZU5_ORYSJ/92-170---------------KKFQVDRGA--------------I-------------------------------KFVLS..GA.
Q8MXH7_CAEEL/94-172---------------PHQQVDKGA--------------I-------------------------------KFILN..GS.
MCTS2_MOUSE/93-170---------------PHQQVDKGA--------------I-------------------------------KFVLS..GA.
TMA20_YEAST/91-171---------------PTVQVDRGA--------------I-------------------------------KFVLS..GA.
Y1432_METJA/79-153---------------NLVVVDIGA--------------I-------------------------------KFLIN..GA.
O28867_ARCFU/71-144---------------YRVTVDEGA--------------L-------------------------------KFVMN..GA.
O26746_METTH/77-151---------------GYVVVDMGA--------------V-------------------------------RFLAN..GA.
Q8TYS3_METKA/83-157---------------HVVIVDMGA--------------V-------------------------------KPVAS..GA.
Q9HM93_HALSA/77-150---------------GVVTVDAGA--------------V-------------------------------SFVSD..GA.
Q8ZWT7_PYRAE/82-155---------------PKAVVDAGA--------------V-------------------------------KRIIN..GA.
Q9HIB8_THEAC/71-144---------------NIVTVDEGA--------------E-------------------------------PHILN..GS.
Q97TZ1_SULSO/69-143---------------PYVIIDEGA--------------V-------------------------------KAVSK..GA.
Y1649_METJA/6-80---------------IKLEIDRRA--------------Y-------------------------------NSIKN..FS.
PROB_CHLTE/278-354---------------GAVIINQGA--------------I-------------------------------DALTSGQRAT
PROB_BACTN/279-354---------------GEIHINECA--------------T-------------------------------DILSSEKAA.
PROB_STRR6/276-349---------------GSIWVDKGA--------------A-------------------------------EALSQ.HGK.
PROB_AQUAE/266-339---------------GIIVVDRGA--------------Q-------------------------------EALKA..GK.
PROB_THEMA/263-336---------------GKIYVNKGA--------------E-------------------------------EALKS..GN.
PROB_OCEIH/277-351---------------GKVFIDDGA--------------T-------------------------------QALMH.NGG.
PROB_BACHD/277-351---------------GVVRIDQGA--------------E-------------------------------RAIMN.EGK.
PROB_COREF/278-352---------------GKIRLDQGA--------------T-------------------------------EAVTS.GGK.
PROB_STRCO/281-355---------------GALVLDDGA--------------V-------------------------------RAVVE.GRK.
PROB_BIFLO/286-360---------------GTIVVDAGA--------------G-------------------------------QAIRG.GRA.
PROB_PSESM/281-355---------------GTLVLDDGA--------------V-------------------------------SALAS.DHK.
PROB_PSEPK/281-355---------------GTLVLDAGA--------------V-------------------------------QALRQ.ANK.
PROB_PSEAE/281-355---------------GTLVLDDGA--------------V-------------------------------KAVSQ.DHK.
PROB_RALSO/283-357---------------GRVVLDAGA--------------V-------------------------------DKLTA.GGK.
PROB_XANCP/268-345---------------GTILIDAGA--------------A-------------------------------LALTD.KGA.
PROB_DEIRA/272-346---------------GRLLLDGGA--------------A-------------------------------QAVRE.RGS.
PROB_BRADU/282-355---------------GTLTIDAGA--------------V-------------------------------TALRA..GA.
PROB_AGRFC/283-356---------------GEIHVDAGA--------------E-------------------------------KALYA..GK.
PROB1_RHIME/283-356---------------GSLSIDAGA--------------E-------------------------------TALRS..GK.
PROB1_RHILO/279-352---------------GRLTVDAGA--------------V-------------------------------GALAS..GK.
PROB_CAUCR/287-360---------------GWVTVDAGA--------------A-------------------------------SALLA..GK.
PROB_SCHPO/296-370---------------GSLEIDRGA--------------F-------------------------------EAITRTNRA.
PROB_THEEB/277-351---------------GELWLDEGA--------------V-------------------------------KAITV.GGK.
PROB_NOSS1/287-361---------------GKLYLDSGA--------------I-------------------------------AAIVK.AGK.
PROB_SYNY3/282-356---------------GKIFIDAGA--------------V-------------------------------QALKA.RGK.
PROB_CALS4/273-347---------------GFLFVDEGA--------------A-------------------------------KALVK.HGK.
PROB_SERP5/276-350---------------GEITVDDGA--------------V-------------------------------DAIMA.RGS.
D3PQW1_MEIRD/282-355---------------GEVVVDAGA--------------A-------------------------------KALRQ.GGA.
PROB_MYCTU/281-351---------------GALTLDAGA--------------V-------------------------------RAVVR.QRR.
PROB_BRUA2/280-353---------------GRLTVDAGA--------------V-------------------------------KALKS..GK.
PROB_THET8/276-350---------------GELVLDRGA--------------V-------------------------------RALKE.RGA.
PROB_VIBVY/286-360---------------GDIVIDQGA--------------V-------------------------------KAVVE.KGS.
TRUB_METAC/246-319---------------PKIILRDSA--------------V-------------------------------DAVCS..GA.
Q8U1U0_PYRFU/88-161---------------KRVVVDEGA--------------V-------------------------------PHILN..GA.
Q8U444_PYRFU/4-78---------------.RVIVDAQA--------------A-------------------------------RAIGK..GAM

PF03657

Y516_AERPE/11-172LHLARELAPLCGSPVKCIRLSPRG--------------E-------------------------------KLFLY--SR-
Y1410_METJA/1-157LSLEGFTLISPNIINNYAIVNEKA--------------E-------------------------------ALFLY--GR-
Y058_ARCFU/1-167FSLEGTFWLLRNSRN.RVWVNERG--------------E-------------------------------MLFLY--GR-

PF14306

A8MAT6_CALMQ/8-187GKAISMAAGA.....PAYDIKPTR--------------SIIDGNPIRNIYREIMSIAYGFFSPLDRFMSRNEVENVLKER
Q8ZUU0_PYRAE/7-184DKAAAMIQGL.....PSIEIEPTL--------------GPDGSP.IRNPYREIMSIAYGFFSPVEGFMTRNEVESILKER
PAPS1_HUMAN/225-386KLHLAKTDAET..L.PALKINKVD--------------M...........QWVQVLAEGWATPLNGFMREREYLQCLHFD
PAPS2_HUMAN/215-376KLDHVRAEAET..L.PSLSITKLD--------------L...........QWVQVLSEGWATPLKGFMREKEYLQVMHFD
Q7PX77_ANOGA/219-385LKTALEAEAKT..L.PALALTEVE--------------L...........QWLQILAEGWAYPLKGFMREQEYLQALHFN
Q8IQV1_DROME/247-415ATEALRHEAES..L.QAIEISTVE--------------L...........QWVQVLAEGWAYPLRGFMREDEYLQTLHFN
Q22501_CAEEL/229-414TVAELLKESQN..L.PTVELTKVD--------------L...........QWLQVLAEGWATPLSGFMRERQYLQSMHFG
APS3_ARATH/53-216RRREKKHEAAD..L.PRVRLTAID--------------L...........QWMHVLSEGWASPLRGFMRESEFLQTLHFN
MET3_PHANO/3-166RRQELYAEAEK..L.PAIVLSDRQ--------------L...........CDLELILNGGFSPLEGFMNEKDYTGVVAEN
A0A016PSU3_GIBZA/3-166RQSELEAEAQK..L.PALTLSERH--------------L...........CDLELILNGGFSPLEGFLTEKDYNGVVENN
A0A0D1E1R4_USTMA/3-166IAAQLRQEADT..L.PEIVLTERQ--------------L...........CDLELIINGGFSPLQGFMNQTDYNGCLDNM
MET3_DEBHA/4-174IRSDLFKEIADKKY.KTLTLSPRQ--------------L...........CDLELILNGGFSPLTGFLNEEDYNSVVHDM
MET3_CANAL/4-172LKQQLLQEAKT..L.PALTLTARQ--------------L...........CDLELILNGGFSPLTGFLNQEDYNSVVNDL
MET3_KLULA/2-163KKAELLEIAQSGDL.TSWSLTARQ--------------I...........CDLELILNGGFSPLDGFLNQQDYQSVVEKS
MET3_ASHGO/2-161KKDRLLHEAQG..L.PQWNLTARQ--------------L...........CDIELILNGGFSPLTGFLGKEDYESVVQNS
A8ZWW7_DESOH/6-165RVAGLKEQALN..L.EEIVLSGRQ--------------L...........CDFDMLATGVFSPLSRFMTRTDYEAVVAQM
Q54F74_DICDI/17-181ELVELKQRSIS..L.PSLLLTKKQ--------------L...........CDIELLMNGGFSPLSTFMDETIYNNVVETM
A5UYJ4_ROSS1/4-160ERRALLEEAAR..L.PSIQISPRS--------------L...........CDLELLATGGFSPLDRFMGRADYERVLHDM
B4U6B9_HYDS0/17-175EKRDLKERSIY..L.KSIQLSNRF--------------V...........CDLEMLATGALSSLDKFMGKNDYESVIETM
SAT_SYNFM/5-167ALAAEKEKAKT..L.KVVPMTSRE--------------A...........SDLIMLGIGAFTPLDGFMGYADWKGVCDKY
SAT_CHLPB/4-165ELQNEMEKAKS..L.KEVRLSSRE--------------T...........GDLIMLGIGGFTPLEGFMGYDDWKGSVENC
SAT_RUTMC/5-162ALTVELERAK...LLPKINCSSRE--------------E...........GDIIMMGVGGFTPLEGFMGKADWQSVCDNM
SAT_THIDA/5-162ALSAEKARAAS..L.PQLKMSSRE--------------T...........GDLIMMGIGGFTPLDGFMTKSDWQGVCDGY
SAT_PSYWF/16-179ALSQALHNAKN..L.PKITLSSRE--------------R...........GDLIMLGIGGFTPLDGFMNQADWQGVVDEM
Q72CI8_DESVH/5-177DREAELKKAAG..L.KQIEISSRA--------------K...........GDLIMMGIGGFSPLNGFMKKADWKSVCEKM
Q6AN73_DESPS/5-179ALAAELKKATG..L.KQIEISDRA--------------K...........GDLIMMGIGGFSPLTGFMTKADWKGVCENL
SAT_DESRM/4-163QRAELKAKAEK..L.PVIRMSSRE--------------S...........SDCLMLGMGAFSPLTGFMTQADYQGVIDNM
SAT_ALCBS/5-169DARVALQREAE.TL.PSVVISSSA--------------A...........ANAVMMAAGYFTPLTGYMNKADMLSVADNL
SAT_ALLVD/2-166EQHHRLSSEAE.SL.PSVIVSSQA--------------A...........GNAVMLGAGYFSPLDGFMNLADALSSAQSM
SAT_CENSY/6-156DASGMEK..........AAISQEL--------------A...........SDVENIADGIFSPLEGFLGRNDFEAVLEKG
SAT_NITMS/7-157DPSGLFS..........ITISEDL--------------A...........NDVENIADGIFSPLEGFLGQQDFESVISRG
SAT_HYPBU/3-160RRERLREEARE..L.PAIRLTAGL--------------A...........ADVANIAHGVYSPLEGFMLQEDYLSVLDEM
SAT_STAMF/3-160RRTALLKETHE..L.PSIEISYER--------------L...........IDLLDIANGAFSPLEGFMVQEDYLHVLYDM
SAT_IGNH4/3-160TRERLVEEAKE..M.VNVQVDEGL--------------A...........ADVANVAHGVYSPLEGFMVREDYLSVLEFM
SAT_AERPE/3-162RREIFESQYRE..M.PRLEVPLER--------------A...........IDAEDLARGVFSPLEGFMVEDDYLSVLSRM
Q9KCT2_BACHD/4-155NVESVEKS.........IELDAFS--------------L...........SDLELIGIGAFSPLTGFLTEKDYRSVVESM
SAT_BACP2/4-154DLSTVAKE.........IELDAIS--------------F...........ADLELIAIGGYSPIEGFLTKADYEAVVSSM
SAT1_BACSU/4-154DVSGIQKE.........IELDLIS--------------F...........ADLELIGIGAYSPIEGFFNEKDYVSVVENM
SAT2_BACSU/4-155HFEGCACQ.........AELDQLA--------------L...........SDLELIAIGGYSPLTGFLGEKDYHSVVKEM
SAT_DEIRA/12-166QDFDPAELAGR....PRLELSSRS--------------L...........ADLEMIATGAYSPLTGFVGEADYLSIIEHL
Q2JHJ0_SYNJB/14-172QAQELRSKAEH..C.PILYLDERA--------------Q...........SDLEMIAIGGFSPLTGFMGREDYQAVLETM
SAT_GLOVI/9-167QRQKYQDGAGG..F.KRVRIDDRA--------------V...........SDLELIAIGGFSPLTGFMGSEDYHSVVEKM
SAT_OCEIH/12-170RKESYLHKSKS..L.LALKLDAWS--------------L...........SDLELIANGGFSPLTGFMGEEDYQSVIENV
SAT_LACPL/7-162FSEATRQAAEQ..L.PSLTINNWN--------------I...........SDLELIGIGGFSPLTGFMVSDDYHSVVNTM
SAT_PELTS/3-161AREEALKRAKE..L.PRLFLDRWE--------------A...........SDLELIANGAFSPLAGFMNKADYENVVDNM
SAT_RUBXD/9-167EREERRQRAAE..L.PRIVLGPRN--------------L...........SDLEMIGTGVFSPLTGFMGREDYESVVEEM
SAT_SYMTH/5-163AREEALERARR..L.PRVRLDARE--------------A...........ADLEMIGDGALSPLTGFMGQADYRSVVAEM
SAT_PETMO/2-161EKNEWLNKSKE..L.KSISVTYFD--------------L...........SELENIATGLFSPLEGFMTKEDYDSVLNSM
SAT_HALOH/2-161KREELIKKAGE..M.PRIMLNRDE--------------L...........TAVDNIATGLFSPLEGFLTSEDYNRVVEEM
A4YFD2_METS5/3-148EDL............PMLEIGRRY--------------A...........LDAEKIGIGAYSPLEGFMGSSDLENVLYKN
SAT_CARHZ/2-158EYEELKGQNFL.K....LSVSKTE--------------Y...........FDLFLLGVGLYAPLEGFMDEDDYYSTLEQF
A9WF10_CHLAA/8-161ERDDVLAEASR..L.PSIQISMRS--------------M...........CDLELLATGGFSPLTGFMGRADYERVLEEM
SAT_CHLAA/10-157...AHPREYDH..L.PALELDERA--------------Y...........ADLELIATGVYSPLEGFMGQADYLSVLEEM
SAT_LYSSC/4-153EITSIHKE.........IELDAIS--------------L...........SDLELIAIGGYSPIQGFLTQADYESVVEKS
B1WW78_CYAA5/57-215EKAEFLAQADK..L.PKITLDERA--------------T...........SDLVMIAIGGFSPLKGFMERADYETVVEDM
B6HEK3_PENCW/4-165RQAELAAEAES..L.PAVTLTERQ--------------L...........CDLELIMNGGFSPLEGFMNQADYDRVCEDN
C4LVD3_ENTHI/11-173ERDECIKEAKS..L.PKIDISSRE--------------F...........GDLVMMGIGGFSPLNGFMKKEDWFSVCKNF
F7BBN1_CIOIN/226-379QVGKKRAEAEA..L.PSIDITKLD--------------M...........QWLQVLSEGWATPLTGFMREREFLQCQHFG
H3D716_TETNG/215-374KLNAAVAEANT..L.PTISITKLD--------------R...........QWVQVLAEGWASPLKGFMREREFLQVLHFG
J9Z8G2_LEPFM/5-161ERNAFLRELSR..A.PVLTLDSRE--------------L...........SDLVLLSQGALSPLTGFMDGETYHSVIDRM
M4DJ10_BRARP/17-179EIELKKKEADS..M.PMVKLTKID--------------M...........EWVHVISEGWASPLKGFMREDEYLQSLHFN
MET3_CRYNJ/4-171LHDSLLQEARS..L.NDIFLTERQ--------------L...........CDLELILNGGFSPLEGFMNERDYTSVVETL
SAT_GEOKA/5-154PLDEATK.........TIELSKAE--------------L...........SDLELIGTGAYSPLTGFLTKTDYDAVVETM
Q73WR2_MYCPA/6-159A....AARIEG..L.PRVPISKAT--------------A...........HEVISLSYGFFTPLTGFMGRREVDATLDEF
S2JG29_MUCC1/4-165KQESLAAEAAT..L.PSVVLTDRQ--------------L...........CDLELLLNGGFSPLEGFLNQKDYEGVVENM

PF04146

U5DHQ3_AMBTC/203-345--------------ALFYVIKS----------------F-------------------------------S.EDDV--HK
G9NWF6_HYPAI/319-521--------------DRFFILKS----------------L-------------------------------T.VDDL--EL
D8TNU7_VOLCA/3-131--------------VRYFIIRS----------------S-------------------------------T.MQNI--FI
B0CZ01_LACBS/621-947--------------KRYFILKS----------------L-------------------------------T.RYDL--DL
K1VD20_TRIAC/114-250--------------ARFFVIKS----------------Y-------------------------------T.EDDV--QK
Q6BPA7_DEBHA/127-264--------------ARFFVIKS----------------Y-------------------------------S.GMDV--DA
C5L6K6_PERM5/34-174--------------LNIVLCRS----------------P-------------------------------S.AEVA--QE
D8PXT6_SCHCM/597-878--------------KRYFILKS----------------L-------------------------------T.QYDL--DL
A0DYX2_PARTE/54-188--------------AHTYILRS----------------N-------------------------------N.DDDI--HK
A6QW31_AJECN/628-764--------------VTYFLIKC----------------V-------------------------------A.YEMV--DA
G3B5F4_CANTC/46-183--------------SKFFVIKS----------------Y-------------------------------T.LLDV--NA
G8BTN3_TETPH/177-314--------------SKFFVIKS----------------S-------------------------------N.IEHI--QK
K1XSV2_MARBU/377-579--------------DKFFIVKS----------------L-------------------------------T.VEDM--DL
M1WAB0_CLAP2/245-382--------------TRYFLVKS----------------S-------------------------------T.MTNV--MR
M9LMP9_PSEA3/630-1025--------------HRFFILKS----------------L-------------------------------R.ADDL--ER
T1IEI7_RHOPR/176-317--------------ARFYMIKS----------------N-------------------------------N.AENV--TL
C5E1V0_ZYGRC/178-314--------------SRFFVIKS----------------S-------------------------------S.LEHV--KK
T1EJA3_HELRO/16-152--------------SKFFVIKC----------------S-------------------------------N.KDAI--RR
B9PUV6_TOXGO/446-580--------------KRFFIIKS----------------N-------------------------------R.MSNI--YT
B9GKR9_POPTR/68-204--------------TRYFIIKS----------------L-------------------------------N.QHNI--QL
K9G8Z6_PEND2/207-404--------------DRYFIVKS----------------L-------------------------------T.VEDL--EL
G2QRC4_THITE/578-713--------------TRFFIVKS----------------F-------------------------------N.EENV--RS
Q179P3_AEDAE/474-610--------------ARFFVIKS----------------Y-------------------------------S.EDDI--HR
K1PII4_CRAGI/293-431--------------ARYFLIKS----------------N-------------------------------N.HENV--AL
U1HHT6_ENDPU/832-968--------------VRFFLLKS----------------W-------------------------------N.YENI--AT
B6K0R3_SCHJY/340-468--------------SRYFIMLV----------------D-------------------------------N.ETAI--SH
A7S845_NEMVE/5-139--------------ARFFIIKS----------------Y-------------------------------S.EDDI--HR
J9FJT3_WUCBA/174-306--------------AQFFLARA----------------C-------------------------------..EENI--KL
A7S9W8_NEMVE/1-137--------------.RYFVMKS----------------N-------------------------------N.AENV--LL
Q2HAM8_CHAGB/185-397--------------DRFFVLKS----------------L-------------------------------T.VEDL--EL
A7S7H4_NEMVE/1272-1403--------------ARFFIMKC----------------N-------------------------------N.QRNL--DI
H2ZM81_CIOSA/317-452--------------ARFFVIKS----------------Y-------------------------------S.EDDI--HR
U5H657_USTV1/931-1067--------------ARFFVIKS----------------Y-------------------------------T.EEDV--HK
D7TI61_VITVI/437-575--------------AKFFIIKS----------------Y-------------------------------S.EDDV--HK
T5ACT8_OPHSC/215-351--------------TRFFLVKC----------------F-------------------------------D.SANI--YM
I1MJV8_SOYBN/128-270--------------AKFYVIKS----------------F-------------------------------N.EDDV--HK
K3Y698_SETIT/311-449--------------AKFFVIKS----------------Y-------------------------------T.EDHI--HK
K3Y7A4_SETIT/80-223--------------AKFFVIKS----------------Y-------------------------------N.EADI--HK
B7Q1P2_IXOSC/1192-1325--------------RRFYVVKA----------------S-------------------------------S.QRTV--DV
D7TAY9_VITVI/331-469--------------AKFFVIKS----------------Y-------------------------------S.EDNV--HK
G7EB12_MIXOS/559-886--------------KRYFILKS----------------H-------------------------------T.EEDL--QK
J7S680_KAZNA/150-287--------------SKFFIIKS----------------N-------------------------------S.LDHI--KK
U7Q061_SPOS1/487-740--------------DRYFILKS----------------L-------------------------------T.VEDL--EL
G9MG20_HYPVG/322-524--------------DRFFILKS----------------L-------------------------------T.IDDL--EL
G8XZL1_PICSO/128-265--------------SRFFVIKS----------------Y-------------------------------N.AVDV--GA
G2XF66_VERDV/192-394--------------DKFFILKS----------------L-------------------------------T.VEDL--DL
K1QXM6_CRAGI/5-167--------------VQYFVVKC----------------A-------------------------------N.FPSL--KT
D0NFE9_PHYIT/251-393--------------AKYFLLQS----------------A-------------------------------S.YLNL--AH
K3XF31_SETIT/338-480--------------AKFFVIKS----------------I-------------------------------G.EADV--HK
F6Q7U6_ORNAN/151-282--------------VRYFIMKS----------------S-------------------------------N.SRNL--EI
E9EVG6_METRA/418-621--------------DKFFILKS----------------L-------------------------------T.TEDL--DL
I7M1Y9_TETTS/89-224--------------ALCYVIRS----------------N-------------------------------N.DDDV--HK
J3P7Z2_GAGT3/427-625--------------DKYFILKS----------------L-------------------------------T.VEDL--EQ
A0BIE6_PARTE/204-344--------------SHFVLIRP----------------K-------------------------------NGFQNI--HK
T5AGE9_OPHSC/374-574--------------DKFFILKS----------------L-------------------------------T.LEDL--EL
F6QHV0_MONDO/340-475--------------GRVFIIKS----------------Y-------------------------------S.EDDI--HR
E9E0K3_METAQ/180-317--------------TRYFLVKS----------------S-------------------------------N.TTNV--YM
G3JL26_CORMM/398-599--------------DRFFVLKS----------------L-------------------------------T.REDM--EK
F9XGG0_ZYMTI/186-391--------------EKYFIVKS----------------L-------------------------------T.AQDL--EA
C4JRH9_UNCRE/337-473--------------ARFFMIKS----------------H-------------------------------T.LETV--TA
G9P5M8_HYPAI/35-170--------------ARFFLVKS----------------F-------------------------------N.SMNV--EM
E5SQQ4_TRISP/509-644--------------TRFFVVRA----------------Q-------------------------------N.ENEI--AL
Q23DI1_TETTS/133-269--------------ARFFQMKA----------------Y-------------------------------Q.WEAI--KA
M4F5R7_BRARP/228-363--------------AKFFVIKS----------------Y-------------------------------S.EDDV--HN
R7YYG2_CONA1/426-624--------------EKFFIVKS----------------L-------------------------------T.LQDL--EL
A0BNI8_PARTE/17-156--------------NKFFIIKY----------------K-------------------------------T.RGQA--DL
K0KIR7_WICCF/195-342--------------SRFFVIKS----------------F-------------------------------N.QQDI--NS
E9GRU8_DAPPU/153-289--------------ARFFVIKS----------------Y-------------------------------S.EDDI--HR
B2AM24_PODAN/407-619--------------DRFFVLKS----------------L-------------------------------T.VEDL--EL
Q6FY47_CANGA/158-294--------------SRFFVIKS----------------I-------------------------------S.LDHI--KK
K7K6W6_SOYBN/472-610--------------AKFFVIKS----------------Y-------------------------------S.EDDI--HK
M3BUB4_SPHMS/369-565--------------EKYYIVKS----------------L-------------------------------T.AQDL--EA
F6HE16_VITVI/375-517--------------AKFFVIKS----------------Y-------------------------------S.EDDV--HK
C4Y9B7_CLAL4/138-272--------------ARFFVIKS----------------Y-------------------------------S.PLDV--EA
R9AVA4_WALI9/217-354--------------ARFFVIKS----------------Y-------------------------------T.EDDV--HK
B9SK12_RICCO/287-425--------------AKFFIIKS----------------F-------------------------------S.EDNV--HK
H6C1G6_EXODN/112-376--------------KKYFIIKS----------------G-------------------------------S.LDAL--SQ
U9TJV4_RHIID/1-136--------------ARYFVIKS----------------Y-------------------------------T.EDDV--HK
G3AP02_SPAPN/37-179--------------SKFFVIKS----------------Y-------------------------------N.ILDV--NA
R7Z4V4_CONA1/260-394--------------NRYFIIKS----------------W-------------------------------N.HENV--QI
G0R5U6_ICHMG/90-225--------------AICLVMRS----------------N-------------------------------N.DDDI--HK
A8Q7N5_MALGO/580-845--------------NRYFILKS----------------R-------------------------------S.ADAL--VT
K2RJ90_MACPH/420-620--------------EKFFIVKS----------------L-------------------------------T.LQDL--EL
B0WKC0_CULQU/163-301--------------TRFFLIKS----------------N-------------------------------N.TENV--TI
G0SA06_CHATD/570-705--------------TRFFIVKS----------------F-------------------------------N.EENV--RR
C5GU86_AJEDR/670-806--------------VSYFLIKC----------------V-------------------------------A.YDMV--NT
W1NMN5_AMBTC/178-314--------------TRYFVIKS----------------L-------------------------------N.HQNI--QL
V2WZC4_MONRO/526-864--------------KRFFILKS----------------L-------------------------------S.QYDL--DL
T1ETR1_HELRO/308-446--------------ARFFLIKS----------------N-------------------------------N.HENV--SL
T1FX57_HELRO/6-141--------------ARFFVIKS----------------Y-------------------------------S.EDDI--HR
N1PF88_DOTSN/177-372--------------DRYFIVKS----------------L-------------------------------T.KEDL--QN
A8NEN2_COPC7/474-610--------------ARYFVIKS----------------Y-------------------------------T.EDDV--HK
A1CD65_ASPCL/281-513--------------SRYFVVKS----------------L-------------------------------T.VGDL--EL
A8QC89_MALGO/15-152--------------ERAFVIKS----------------F-------------------------------T.EVDV--KV
J5K4M9_BEAB2/397-598--------------DRFFILKS----------------L-------------------------------T.HEDL--VQ
G4U9D0_NEUT9/214-431--------------DRYFVLKS----------------L-------------------------------T.VEDL--EL
G9MVK2_HYPVG/4-139--------------SRYFLVKS----------------F-------------------------------N.MTNV--EM
K7K544_SOYBN/67-203--------------IKYFIIKS----------------L-------------------------------N.HQNI--HL
K4CIR0_SOLLC/70-206--------------IRYFVIKS----------------L-------------------------------N.HENI--QL
Q500V8_ARATH/330-468--------------AKFFVIKS----------------Y-------------------------------S.EDNV--HK
D0MU40_PHYIT/31-168--------------CRCFVLKS----------------F-------------------------------S.EANF--HK
A0A0D2X8M3_FUSO4/186-387--------------DKFFILKS----------------L-------------------------------T.VEDL--EL
E0VFT2_PEDHC/270-407--------------ARFFVIKS----------------Y-------------------------------S.EDDI--HR
A0A0C4ELE8_PUCT1/377-584--------------RRYFILKA----------------Y-------------------------------T.DEDL--RI
A0A023B4A3_GRENI/252-386--------------IRCFVIKS----------------G-------------------------------K.IENI--LT
Q2GU55_CHAGB/195-329--------------NRYFILRS----------------D-------------------------------N.ATDI--ET
W5KNU3_ASTMX/1266-1402--------------VRYFIMKS----------------S-------------------------------N.MRNI--EL
A8JHY3_CHLRE/19-147--------------IRYFIIRS----------------N-------------------------------S.LQNI--FI
M2YKU0_DOTSN/375-566--------------EKYFIVKS----------------L-------------------------------T.AQDL--EA
A0BI26_PARTE/40-178--------------SKYFIIRT----------------Q-------------------------------G.EDNV--HR
K4B806_SOLLC/250-386--------------SRYFIVKS----------------C-------------------------------N.RENL--EL
A8NRM6_COPC7/377-678--------------TRFFILKS----------------L-------------------------------S.EDDL--AL
Q5K6Y0_CRYNJ/435-735--------------RRVFILKS----------------L-------------------------------T.TAEL--EE
C5YY10_SORBI/414-556--------------AKFFMIKS----------------Y-------------------------------S.EDDI--HK
M0SQV1_MUSAM/439-577--------------AKFFIIKS----------------Y-------------------------------S.EDDI--HK
F2UD73_SALR5/651-791--------------TRFYVIRS----------------F-------------------------------G.EDDV--HK
M1WE61_CLAP2/348-546--------------DKFFILKS----------------L-------------------------------T.IQDL--DA
G7DU39_MIXOS/711-847--------------ARFFVIKS----------------Y-------------------------------T.EEDV--YK
U4LEH5_PYROM/784-918--------------VRYFMIKS----------------F-------------------------------N.QDNV--KM
A0A068XD19_HYMMI/150-287--------------TKYFLIKS----------------N-------------------------------N.YENV--VI
F0VF22_NEOCL/53-196--------------VRFFILRS----------------R-------------------------------I.AYNI--EV
K7VKN2_MAIZE/372-514--------------ALFFVIKS----------------Y-------------------------------S.EDDI--HK
A0EIT2_PARTE/53-193--------------CRFFIIRT----------------Q-------------------------------G.EDNV--HR
G4VB52_SCHMA/567-702--------------ARFFVIKS----------------F-------------------------------S.EDDI--HR
G2R1Z8_THITE/334-546--------------DRFFILKS----------------L-------------------------------T.VEDL--EL
T1KJU9_TETUR/1-134--------------.....MKS----------------N-------------------------------N.HENV--VL
D7KJU6_ARALL/231-373--------------AKFFVIKS----------------Y-------------------------------S.EDDV--HK
Q6CPT1_KLULA/113-254--------------SKFFVIKS----------------F-------------------------------N.ERNV--KL
G4MRQ6_MAGO7/382-591--------------EKYFILKS----------------L-------------------------------T.VEDL--EQ
H6BKA5_EXODN/395-603--------------EKFFVVKS----------------L-------------------------------T.VEDL--ER
M3ZSP2_XIPMA/204-342--------------ARFFLIKS----------------N-------------------------------N.HENV--SL
D7EHP9_TRICA/107-245--------------ARFFVIKS----------------N-------------------------------N.AENI--TL
D7TGT4_VITVI/456-598--------------AKFYVIKS----------------F-------------------------------S.EDDI--HK
M2MNT8_BAUCO/2-142--------------VRYFILKS----------------W-------------------------------N.MENV--VN
B4JYU7_DROGR/406-542--------------ARFFVIKS----------------Y-------------------------------S.EDDI--HR
M2R5C6_CERS8/312-622--------------KRYFILKS----------------L-------------------------------T.QFDL--DL
I2G755_USTH4/614-1021--------------HRYFILKS----------------R-------------------------------R.ADDL--DR
G2YI69_BOTF4/640-774--------------TRYFIVKS----------------F-------------------------------N.DENV--IK
M2LBF0_BAUCO/297-486--------------EKYYILKS----------------L-------------------------------T.VSDL--ES
W5FHC2_WHEAT/473-609--------------AKFFIIKS----------------Y-------------------------------S.EDDV--HK
B8M0U8_TALSN/418-647--------------DRFFIVKS----------------L-------------------------------T.LEDL--EL
I7ME02_TETTS/181-321--------------KKYFIIRN----------------R-------------------------------N.EYFR--KI
B8NFL9_ASPFN/369-570--------------NRYFIVKS----------------L-------------------------------S.MDDL--EL
F7ADG8_MONDO/97-235--------------ARFFLIKS----------------S-------------------------------N.RENI--SL
S9VPX4_SCHCR/340-468--------------SRYFIMLC----------------D-------------------------------N.ETAI--AH
B7GER0_PHATC/265-395--------------AKFYIVRA----------------A-------------------------------T.HHDL--AI
A0E4N3_PARTE/17-156--------------SKFFTVKY----------------K-------------------------------S.KAQA--DS
I3K0G5_ORENI/1247-1379--------------VRYFIMKS----------------S-------------------------------N.IRNL--EI
A0A0C4E4W3_MAGP6/566-701--------------TRFFIIKS----------------S-------------------------------N.QANV--ET
Q4WG49_ASPFU/286-529--------------NRYFIVKS----------------L-------------------------------T.VGDL--ES
J3NGE7_GAGT3/571-706--------------TRFFAIKS----------------F-------------------------------N.DANI--HT
Q23VX3_TETTS/28-165--------------ARFFFIRS----------------C-------------------------------N.QENI--TF
S3C8R4_OPHP1/452-730--------------NRYFILKS----------------L-------------------------------T.VEDL--AL
A0D256_PARTE/42-168--------------ATYFLIRA----------------P-------------------------------T.KDNV--HR
A7ANQ1_BABBO/246-380--------------TKCFMIKS----------------N-------------------------------N.MMNI--YF
K1WQI3_MARBU/640-774--------------TRYFIVKS----------------F-------------------------------N.EENV--LR
N1RAN2_FUSC4/749-897--------------DKFFILKS----------------L-------------------------------T.VEDL--EL
M0SL27_MUSAM/525-663--------------AKFFIIKS----------------Y-------------------------------S.EDNV--HK
I1KSN3_SOYBN/457-595--------------AKFFVIKS----------------Y-------------------------------S.EDDI--HK
A5DC36_PICGU/83-220--------------SRFFIIKS----------------F-------------------------------T.EKDV--AS
E9HGQ0_DAPPU/1-135--------------.....MKS----------------N-------------------------------N.PENI--SL
V5F1H8_PSEBG/297-702--------------HRFFILKS----------------L-------------------------------R.ADDL--DR
E0VS89_PEDHC/1201-1325--------------SRYFVIKV----------------H-------------------------------S.LKAF--DN
U1NTW9_ASCSU/150-282--------------AHFFLSRS----------------C-------------------------------..HENI--RL
E7KM29_YEASL/155-291--------------SRFFVIKS----------------S-------------------------------S.LKHV--KR
M2ZLJ7_PSEFD/365-555--------------EKYFIVKS----------------L-------------------------------T.AQDL--EA
O77335_PLAF7/24-160--------------TKFFLIKS----------------S-------------------------------S.DKNI--AI
F0XUX5_GROCL/280-497--------------DRFFILKS----------------L-------------------------------T.VEDL--ES
C3Y1F9_BRAFL/1604-1735--------------NRYFILKC----------------N-------------------------------N.QRNL--DI
K1QIA1_CRAGI/1268-1399--------------VKYFVVKP----------------N-------------------------------N.QKAL--DI
Q0CTW5_ASPTN/425-627--------------NRYFIVKS----------------L-------------------------------T.VEDL--EH
W5MRF3_LEPOC/1280-1411--------------VRYFIMKS----------------S-------------------------------N.LRNI--EI
N1QE16_SPHMS/327-465--------------SVVINIKT----------------E-------------------------------F.FENL--IA
C1GVY0_PARBA/671-807--------------VSYFLIKC----------------L-------------------------------A.YEMV--DA
D5GAI5_TUBMM/941-1075--------------TRYFVVKS----------------F-------------------------------N.HDNV--KM
U4LG29_PYROM/546-681--------------ARFYVIKA----------------M-------------------------------N.EYDI--LA
A7TK77_VANPO/213-350--------------SRFFVIKS----------------S-------------------------------R.LDHV--QK
T1JES8_STRMM/1256-1387--------------CRYYIIKS----------------N-------------------------------S.QKMI--EV
F1NS70_CHICK/1295-1426--------------VRYFIMKS----------------S-------------------------------N.LQNL--DI
F8QD12_SERL3/161-493--------------KRFFILKS----------------L-------------------------------S.QSDL--DT
I2GVC1_TETBL/450-593--------------SRFFVIKS----------------C-------------------------------S.LEHI--KK
B4J3H0_DROGR/281-419--------------TRFFLIKS----------------N-------------------------------N.IDNV--QL
F4R3K9_MELLP/487-752--------------RRYFILKS----------------Y-------------------------------T.EEDL--NL
G2Q1Z5_THIHA/160-391--------------DRFFVLKS----------------L-------------------------------T.VEDL--EL
T1JB38_STRMM/305-440--------------PRYFIIKS----------------Y-------------------------------S.EDDI--HR
G0W470_NAUDC/181-318--------------SRFFVIKS----------------I-------------------------------N.LEHI--KK
D5GNV8_TUBMM/529-729--------------DRIFIVKS----------------L-------------------------------T.VEDL--DL
F0X9L9_GROCL/466-601--------------TRFFMLKS----------------F-------------------------------N.EGNV--RR
I1FS50_AMPQE/319-455--------------ARFFVIKS----------------Y-------------------------------A.EDDV--HR
A0C791_PARTE/169-302--------------AVFFIVKS----------------N-------------------------------T.EQNV--IL
U1GGT6_ENDPU/374-579--------------EKFFVLKS----------------L-------------------------------T.VEDL--DA
F2U4B6_SALR5/26-157--------------CAFYLVRS----------------H-------------------------------T.EENI--RL
Q0UXB1_PHANO/123-324--------------SKYFIVKS----------------L-------------------------------T.LQDL--EL
M3D6T2_SPHMS/5-146--------------VRYFMIKS----------------W-------------------------------N.HDNV--YE
J4IAX7_FIBRA/582-930--------------KRYFILKS----------------L-------------------------------T.QKDL--DI
R9PLK4_PSEHS/830-1245--------------HRFFILKS----------------L-------------------------------R.TDDL--DR
K3WL53_PYTUL/60-197--------------CRCFILKS----------------F-------------------------------S.DANL--HK
MMI1_SCHPO/350-477--------------SRYFIMLC----------------D-------------------------------N.ETAI--AH
F4RX17_MELLP/35-171--------------ARFFVIKS----------------Y-------------------------------T.EEDV--HK
G0T2B8_RHOG2/670-1019--------------RRYFILKS----------------H-------------------------------D.EADL--RK
K5VXL5_PHACS/571-840--------------KRYFILKS----------------L-------------------------------T.QYDL--DL
S8AI65_DACHA/477-669--------------ERFFIVKS----------------L-------------------------------T.LEDL--DT
J9JSF7_ACYPI/99-234--------------ARFFIIKS----------------N-------------------------------N.YENI--EL
A0A0D1E4L6_USTMA/726-863--------------ARFFVIKS----------------Y-------------------------------T.EDDV--HK
U5HCN5_USTV1/575-723--------------KRFFVLKA----------------K-------------------------------E.SEHL--QE
M7X3Z8_RHOT1/666-1012--------------RRYFILKS----------------H-------------------------------D.EADL--RK
S7ZRN7_PENO1/422-658--------------DRYFIVKS----------------L-------------------------------T.VEDL--EL
A0A068YDE4_ECHMU/401-537--------------ARFFVIKS----------------F-------------------------------S.EDDI--HR
M3AKS3_PSEFD/271-466--------------DRYFVLKS----------------L-------------------------------T.KEDL--NE
S8EIQ3_FOMPI/603-928--------------KRYFILKS----------------L-------------------------------T.QKDL--DI
H3GWX4_PHYRM/253-395--------------AKYVLVQS----------------A-------------------------------S.YLNL--AH
A7E4D0_SCLS1/650-784--------------TRYFIVKS----------------F-------------------------------N.DENV--IK
G0RBB9_HYPJQ/259-394--------------SRYFLVKS----------------F-------------------------------N.ESNV--EM
B2ARG7_PODAN/13-148--------------TRFFIVKS----------------F-------------------------------N.EQNV--EQ
M1CBM7_SOLTU/322-464--------------AKFYIIKS----------------Y-------------------------------S.EDDI--HK
C5DJE4_LACTC/115-250--------------SRFFVIKS----------------C-------------------------------R.SEHI--QI
E9CW19_COCPS/506-642--------------TKFFILKS----------------L-------------------------------S.LENV--IA
A2R166_ASPNC/418-622--------------SRYFIVKS----------------L-------------------------------T.VDDL--EL
A0A023B246_GRENI/12-144--------------VCYFLIKS----------------F-------------------------------Q.VDHI--EI
K1V256_TRIAC/598-935--------------ERYFILKS----------------L-------------------------------S.....--AD
H2AVY0_KAZAF/114-253--------------SLFFVIKS----------------S-------------------------------S.VDHI--MK
U9SY90_RHIID/16-149--------------NRYFILKS----------------L-------------------------------T.QDDL--DI
D7FPL2_ECTSI/246-375--------------ARFFVLRS----------------L-------------------------------N.HDNL--AV
M3AKK0_PSEFD/1-137--------------....MIKS----------------W-------------------------------T.HENV--NA
G4V1D5_NEUT9/504-639--------------TRFFVLKS----------------F-------------------------------N.NENL--DK
M4BLQ1_HYAAE/253-395--------------VKYFLLQS----------------A-------------------------------S.YLNL--AH
E3L1K1_PUCGT/165-453--------------RRYFILKA----------------Y-------------------------------T.DEDL--RI
Q8ILQ1_PLAF7/371-505--------------MKVFIIKC----------------N-------------------------------Q.ISHL--YL
S3CZX6_GLAL2/392-590--------------DKYFIVKS----------------L-------------------------------T.VEDL--EL
D7KVZ9_ARALL/316-458--------------AIFFVIKS----------------Y-------------------------------S.EDDI--HK
K3WDK3_PYTUL/256-398--------------CKYFLLQS----------------Q-------------------------------S.YHNL--AH
C1G9S2_PARBD/356-556--------------ERYFIVKS----------------L-------------------------------T.IEDL--ER
A7ANR0_BABBO/25-162--------------NVYYIVKS----------------F-------------------------------S.DQNV--RA
V5I0K1_BYSSN/496-699--------------ERYFIVKS----------------L-------------------------------T.VEDL--EL
C8V3R8_EMENI/419-625--------------NRYFILKS----------------L-------------------------------T.VEDL--EL
G8JU51_ERECY/138-279--------------SRFFVIKS----------------F-------------------------------N.LENI--KA
U5H5H6_USTV1/766-1126--------------KRYFILKS----------------H-------------------------------D.ENDL--HL
J9K832_ACYPI/334-468--------------SRFFIIKS----------------Y-------------------------------S.EDDI--HR
S3CNK2_OPHP1/560-695--------------TKFYLIKP----------------V-------------------------------S.DKLV--DD
D8QT35_SELML/2-137--------------AKFFIIKS----------------Y-------------------------------S.EDDV--HK
A0D629_PARTE/49-182--------------AIFLILRS----------------A-------------------------------S.LDNI--HK
A9USV5_MONBE/253-383--------------RKFFLLWI----------------R-------------------------------E.ARHF--IL
F9X648_ZYMTI/3-143--------------VKYFVIKS----------------W-------------------------------N.LANV--HA
G2QHR3_THIHA/207-342--------------TRFFILKS----------------F-------------------------------N.EENV--RR
Q6C164_YARLI/197-381--------------DRYFVCKS----------------L-------------------------------T.VRDL--EV
A0A068Y5Q0_ECHMU/21-159--------------TKYFLIKS----------------N-------------------------------N.YENV--EI
Q4UE68_THEAN/26-159--------------CVYFILKG----------------L-------------------------------S.PESI--TT
N1PQZ2_DOTSN/317-457--------------TRVVNIKS----------------E-------------------------------Y.PKNV--IT

PF01878

P74098_SYNY3/2-139---------------AYWLFQGNPK...Y.........Y-------------------------------R-ILQA..IE
Q9WWK9_SYNP2/2-141---------------AYWLFQGNPR...Y.........H-------------------------------R-VLDA..IR
A6BZ09_9PLAN/29-165---------------QAWIFQANPK...Y.........Y-------------------------------D-IVEA..LK
A7I926_METB6/3-143---------------NVWIFQSNPK...Y.........Y-------------------------------D-LIRDLGEL
A3JN92_9RHOB/3-135---------------KYWIGVAHRK..............-------------------------------.-..QA...L
A8LMB8_DINSH/3-149---------------RYWIGLAERD..............-------------------------------S-VQAA...V
A1U8X5_MYCSK/2-132---------------TNWINTVSRD..............-------------------------------.-..HV...E
YOUG_BACLI/5-143---------------AEWNEKKVLD...........RRT-------------------------------S-RDHV...L
A6EIT2_9SPHI/6-138---------------KYWVIVASKD..............-------------------------------.-.....HVK
YDCG_BACSU/4-136---------------NYWIGVVSEQ..............-------------------------------.-..HV...L
A5CUD6_CLAM3/3-135---------------RYWVGVVSRD.............R-------------------------------V-LDGL....
Y1062_HELHP/2-131---------------RYFIGIASKN..............-------------------------------.-..HI...Q
Y442_STRMU/3-132---------------KFWVGVVSEN..............-------------------------------.-..HV...K
Y254_STRSV/3-132---------------RFWIGVVSKE..............-------------------------------.-..HV...L
A0A0A8UTV7_LEGHA/3-136---------------QNWLAVACAT..............-------------------------------.-..HV...R
A1WQL9_VEREI/5-137---------------KYWCGVVSRE..............-------------------------------.-..HI...K
Q2KBY7_RHIEC/3-135---------------RNWIAVASAN..............-------------------------------.-..HV...R
Y8638_RHILO/3-120---------------AYWIAVASAQ..............-------------------------------.-..HV...R
Y3206_RHILO/3-137---------------AYWIAVASAQ..............-------------------------------.-..HV...R
Q2GIJ6_ANAPZ/5-132---------------RFWLLKSEPA...D.........F-------------------------------A-WGDM...L
Q73H50_WOLPM/2-129---------------QFWLLKSEPS...E.........Y-------------------------------S-WQKM...E
Q2GF45_EHRCR/2-130---------------SYWLLKTEPQ...D.........F-------------------------------S-WDDM...V
Q5FGQ0_EHRRG/2-130---------------SYWLLKTEPQ...D.........F-------------------------------S-WNDM...V
Q024K9_SOLUE/2-130---------------KYFLAKTEPS...V.........Y-------------------------------S-IDDL...E
Q5KKF6_CRYNJ/7-162---------------EFWQTANGKF...C..........-------------------------------.-........
B4U7S2_HYDS0/2-128---------------KYFLLKTEPS...S.........Y-------------------------------S-YDML...E
Q1D7F1_MYXXD/5-135---------------QYWLIKSEPS...V.........Y-------------------------------A-YAQL...E
Q7S515_NEUCR/88-252---------------QYWLLKAEPL...PRLENGYDVHF-------------------------------S-IDDL..AA
Q0U623_PHANO/118-277---------------VFWLLKAEPL...PRYENGVNVAF-------------------------------S-IDDL..AA
Q0CLU5_ASPTN/109-262---------------SYWLMKAEPE...SRIEKGVDVKF-------------------------------S-IDDL..RE
Q7NK15_GLOVI/2-148---------------ARWLFKSEPG...A.........Y-------------------------------S-IADL...K
Q4E145_TRYCC/13-158---------------QYWLMKSDFH...T.........F-------------------------------S-IDDL...K
Q4Q067_LEIMA/12-157---------------HYWLLKSEPH...K.........F-------------------------------S-IDDL...A
Q1QBK5_PSYCK/2-150---------------AYWLIKSNPS...C.........F-------------------------------S-IKDL...E
THYN1_HUMAN/55-219---------------SHWLMKSEPE...SRLEKGVDVKF-------------------------------S-IEDL.KAQ
Q6MNE3_BDEBA/2-149---------------KYWLMKSEPD...V.........F-------------------------------S-LDQL...K
Q4K403_PSEF5/2-148---------------AYWLMKSEPD...E.........L-------------------------------S-IQGL...Q
A4B9S6_9GAMM/2-149---------------AVWLLKTEPG...E.........F-------------------------------S-IDDL.AER
A0YIC7_LYNSP/2-148---------------NYWLMKSEPN...V.........Y-------------------------------S-IEKM...Q
Q10WF5_TRIEI/2-148---------------KYWLIKSEPK...T.........Y-------------------------------S-ISDM...K
Q8YY67_NOSS1/2-148---------------NYWLMKSEPE...V.........Y-------------------------------G-ITHL...Q
Q5SK57_THET8/2-146---------------AYWLLKSEPQ...V.........Y-------------------------------G-IEDL...E
Q2JN10_SYNJB/2-148---------------NYWLMKSEPS...I.........Y-------------------------------S-IWDL...Q
P74153_SYNY3/2-148---------------AFWLMKSEPV...T.........Y-------------------------------G-IHHL...K
Q31PN6_SYNE7/2-148---------------AFWLLKSEPD...V.........Y-------------------------------G-IADL...E
A2BYF2_PROM5/5-151---------------NYWLMKSEPD...A.........Y-------------------------------S-IDTL...K
A5GV42_SYNR3/7-153---------------KWWLMKSEPD...V.........Y-------------------------------G-IDHL...K
Q7V5V1_PROMM/7-153---------------NYWLMKSEPD...A.........Y-------------------------------G-IDHL...Q
Q7VA84_PROMA/7-153---------------SYWLMKSEPS...A.........Y-------------------------------G-IKDL...Q
Q46J77_PROMT/7-153---------------NYWLMKSEPD...A.........Y-------------------------------S-IKDL...E
A4CF59_9GAMM/2-149---------------AYWLFKTEPD...V.........F-------------------------------S-ITDL...A
Q080Z6_SHEFN/2-151---------------NYWLMKSEPD...D.........F-------------------------------S-IDNL.QMS
M6BZG6_LEPBO/2-151---------------KHWLFKTEPD...V.........F-------------------------------S-IDDL.YKA
Q7UMR5_RHOBA/2-156---------------KYWLMKTEPN...T.........F-------------------------------S-IDDL.AEQ
A6G9B9_9DELT/7-159---------------RYWLMKSEPE...V.........Y-------------------------------S-IEDL...E
Q1IWR4_DEIGD/15-161---------------RFWLLKSEPH...V.........F-------------------------------G-YPDL...V
Q21FZ3_SACD2/2-148---------------ACWLFKSEPD...E.........Y-------------------------------S-IADL...Q
A3ZLP5_9PLAN/16-165---------------RYWLLKTEPE...S.........Y-------------------------------S-IDDL.ANE
Q3A4Z6_PELCD/6-155---------------RYWLMKSEPG...C.........F-------------------------------S-IDDL.KDC
B3E7D4_GEOLS/2-150---------------RYWLFKSEPG...C.........F-------------------------------S-FQDL.QAR
Q74AS6_GEOSL/6-154---------------RYWLFKSEPS...C.........F-------------------------------S-FDDL.GSR
A1ATY5_PELPD/2-150---------------NYWLFKTEPG...C.........F-------------------------------S-FDNL.KNR
Q312I8_DESAG/2-150---------------RYWLMKSEPE...C.........F-------------------------------S-LEDL.VNA
Q1MR11_LAWIP/2-150---------------QYWLFKSDTD...C.........Y-------------------------------S-INDL.QSA
Q729D5_DESVH/2-149---------------NYWLFKSETD...C.........F-------------------------------S-VDDL.AAS
A1U5E7_MARHV/2-150---------------AKWLVKTEPS...E.........C-------------------------------G-IDDF.ARQ
A6VZD9_MARMS/3-149---------------NYWLMKSEPD...A.........F-------------------------------S-IDDL...K
A0XX89_9GAMM/2-150---------------AYWLFKTEPD...A.........F-------------------------------S-IDDL.KHA
Q15ZW9_PSEA6/6-155---------------QYWLFKTEPD...A.........F-------------------------------S-IDDL.AAK
Q2SNU3_HAHCH/2-150---------------AYWLMKTEPD...A.........F-------------------------------S-IDDL.ANS
Q2C4F7_9GAMM/2-148---------------AYWLFKTEPD...T.........F-------------------------------S-IDTL...K
A7K5A8_VIBAE/2-149---------------AYWLFKTEPD...T.........F-------------------------------S-IDTL...R
Q143L8_BURXL/2-150---------------RHWLLKSEPS...E.........F-------------------------------G-IDDL.AQS
B7WUP3_COMTE/10-158---------------RYWLMKNEPD...E.........Y-------------------------------S-IDHA.LAA
Q7P0R4_CHRVO/4-152---------------RYWLMKSEPD...E.........T-------------------------------S-IDHL.AAE
Q129F1_POLSJ/2-150---------------NYWLMKSEPE...E.........C-------------------------------S-VDDA.LAA
A6SVM1_JANMA/2-150---------------RYWLMKSEPS...E.........V-------------------------------S-IDDA.WSA
A3RRU2_RALSL/81-227---------------QYWLMKSEPD...E.........A-------------------------------S-IDTL...Q
B2JES7_BURP8/2-150---------------RYWLMKSEPD...E.........A-------------------------------S-IDDL.ANA
Q82TJ8_NITEU/2-150---------------RYWLMKSEPS...E.........V-------------------------------S-IDDL.AAR
Q478H8_DECAR/2-148---------------QYWLMKSEPD...E.........V-------------------------------S-IDDL...A
Q0HU59_SHESR/2-151---------------NYWLMKSEPD...E.........F-------------------------------S-IDDL.KAC
B4SI17_STRM5/6-155---------------RYWLMKSEPD...A.........F-------------------------------S-IDDL...A
Q83BN8_COXBU/2-151---------------NYWLLKSEPT...S.........Y-------------------------------S-IDDL.FRE
A1WW93_HALHL/2-151---------------NRWVMKSEPD...V.........F-------------------------------G-IDDL.AAA
Q60BW0_METCA/2-151---------------RYWLMKTEPG...E.........F-------------------------------G-IDDL.AAR
Q0A5L0_ALKEH/2-151---------------NYWLMKSEPD...E.........F-------------------------------G-IEDL.KQR
A4BS86_9GAMM/2-151---------------SYWVMKSEPS...V.........Y-------------------------------G-IDDL.AAQ
Q1K2S0_DESAC/2-151---------------NYWLMKSEPE...A.........F-------------------------------G-IDDL.QQM
A0RTQ4_CENSY/6-139---------------AYWLVKQEPGGPRG.........Y-------------------------------S-LDQM...Q
A9A4S8_NITMS/3-136---------------NYWLAKQEPSGPRG.........Y-------------------------------N-FEQL...K
Q2IM08_ANADE/10-138---------------AYWLLKTEPG...T.........Y-------------------------------A-WSDL...V
A9AWV2_HERA2/2-132---------------AFWLLKTEPN...E.........F-------------------------------S-WEDL...L
B8GCZ0_CHLAD/3-133---------------NYWLLKTEPS...V.........Y-------------------------------S-FADL...V
A0ZBN7_NODSP/2-132---------------AYWLLKTEPE...K.........Y-------------------------------S-YFNL...E
A2XKL1_ORYSI/18-161---------------KYWLLKTEPG...E.........W-------------------------------S-WSDQARAP
Q1N713_SPHSS/19-149---------------HYWLMKSEPD...V.........F-------------------------------S-YDDL...V
A5V5W6_SPHWW/16-146---------------SHWLVKSEPN...S.........Y-------------------------------S-YADL...E
A3HZ69_9BACT/9-137---------------NYWMVKSEPG...S.........Y-------------------------------S-WEDF...K
Q1GUB4_SPHAL/4-135---------------QYWLMKSEPD...A.........Y-------------------------------A-WGQL...V
Q2G8P8_NOVAD/13-143---------------NLWLMKSEPD...V.........Y-------------------------------G-WDDL...V
Q2NBR4_ERYLH/3-133---------------RYWLMKSEPS...K.........Y-------------------------------G-WDDL...V
A3W9K5_9SPHN/3-133---------------NYWLMKSEPF...K.........Y-------------------------------S-WDDL...V
Q1V170_PELUQ/2-134---------------NYWLMKSEPD...V.........W-------------------------------S-IDQQ.KKA
A6EJQ3_9SPHI/2-132---------------NHWLVKSEPF...K.........Y-------------------------------S-WDKF...N
Q11YZ0_CYTH3/2-132---------------NYWLIKSEPF...K.........Y-------------------------------S-FDQF...V
A5G2F8_ACICJ/2-132---------------NYWLVKSEPD...A.........F-------------------------------S-WDQQ...V
Q5FQF2_GLUOX/2-132---------------AFWLVKSEPE...A.........F-------------------------------S-WAQQ...L
Q2RNC8_RHORT/2-132---------------AYWLVKSEPS...T.........W-------------------------------S-WQNQ...L
A4TWZ7_9PROT/2-132---------------AYWLVKSEPG...A.........W-------------------------------S-WDDQ...V
A7HSS8_PARL1/2-134---------------AYWLFKSEPS...T.........W-------------------------------S-WDDQ.KKK
Q0C4X5_HYPNA/2-134---------------QYWLMKSEPD...A.........W-------------------------------S-WEQQ.VKK
Q0G4A9_9RHIZ/2-134---------------RYWLFKSEPF...K.........W-------------------------------S-FEQQ.KEK
Q2K3E0_RHIEC/2-135---------------AHWLYKSEPA...S.........W-------------------------------S-WEQQ.KAA
Q98EI4_RHILO/2-134---------------NYWLFKSEPS...V.........F-------------------------------S-FEAL.KAK
Q8KZ39_9PROT/2-134---------------AYWLFKSEPA...T.........W-------------------------------S-WADQ.QAK
A3JM70_9RHOB/2-134---------------AYWLFKSEPD...A.........W-------------------------------S-WDKQ.VAK
A4EH47_9RHOB/9-141---------------ARWLFKSEPD...V.........W-------------------------------G-WDAQ.VAK
B0UCG1_METS4/2-134---------------PHWLFKSEPS...T.........W-------------------------------S-WDQQ.EAA
E0TE14_PARBH/2-135---------------AYWLMKSEPS...T.........W-------------------------------S-WQDQ.LAK
A7IEB4_XANP2/28-160---------------AHWLYKSEPF...K.........W-------------------------------S-WDMQ.VKA
Q13DX9_RHOPS/2-134---------------AYWLVKSEPS...V.........W-------------------------------S-WDQQ.VAK
A6EMU5_9BACT/174-313---------------NYWVFQGNPK...I.........Y-------------------------------D-ITNA..LK
Q8ZZI9_PYRAE/3-147---------------NYWL.TMLPE..............-------------------------------.-.ENF...K
A4WL01_PYRAR/3-147---------------DYWLTMLDED...N.........F-------------------------------R-YTVE....
A3CVK7_METMJ/19-161---------------TRWLAISNRT..............-------------------------------N-WEIT....
Q2FT29_METHJ/14-155---------------AIWIASGNRQ..............-------------------------------N-WEVV....
Q2FP01_METHJ/2-143---------------SYWIASSNRP..............-------------------------------N-WEII....
A6UNC0_METVS/2-141---------------NYFLCITTEE..............-------------------------------N-WNII....
A6VFA8_METM7/22-163---------------NYFMCITNEE..............-------------------------------N-WNVV....
Y1033_PYRHO/2-143---------------TYWICITNRE..............-------------------------------N-WEVI....
Y875_PYRAB/2-141---------------SYWLCITNRD..............-------------------------------N-WKVV....
Y2356_ARCFU/2-145---------------AYWLCITNED..............-------------------------------N-WRVI....
Y3536_METJA/2-144---------------AYWLCITNED..............-------------------------------N-WKVI....
Q4JC14_SULAC/2-142---------------TYWIIPVQED..............-------------------------------F-WEAV....
A4YGW0_METS5/2-141---------------TFWLVPIQED..............-------------------------------M-WDNI....
Y2595_SULSO/2-141---------------TYWLVPIQED..............-------------------------------.-........

PF12961

B0T870_CAUSK/4-75------------HELK----------------------T---------------------------------WPQ-----
R9TBY5_9EURY/3-77------------HELK----------------------I---------------------------------MPD-----
A2SN47_METPP/13-94------------HVLK----------------------T---------------------------------DPD-----
R6E210_9FIRM/7-77------------...K----------------------I---------------------------------LPI-----
J9RHJ8_9ACTN/3-74------------HELK----------------------I---------------------------------NER-----
R5Y974_9FIRM/3-77------------HALK----------------------T---------------------------------KPE-----
R7BMW7_9FIRM/17-92------------HKLK----------------------I---------------------------------KED-----
D3UZP9_XENBS/15-94------------HSLI----------------------I---------------------------------SGV-----
X2H0U5_9BACI/244-319------------HELD----------------------S---------------------------------YPE-----
R6TFC5_9FIRM/329-401------------HELK----------------------I---------------------------------VAS-----
R5F6I4_9CLOT/7-75------------...K----------------------I---------------------------------LPE-----
A7MEP6_CROS8/3-73------------HHLK----------------------I---------------------------------LPE-----
M9SC14_9EURY/4-81------------HDLK----------------------I---------------------------------LPQ-----
K8EIC3_CARML/4-76------------HELK----------------------I---------------------------------EPK-----
W8FAL7_9BACT/20-95------------HELK----------------------V---------------------------------WPA-----
R5KJ01_9CLOT/4-86------------HHIK----------------------L---------------------------------KEQ-----
A6LYH9_CLOB8/3-77------------HELK----------------------I---------------------------------TPN-----
R9VFQ2_9ENTR/5-83------------HQLR----------------------I---------------------------------RPE-----
F0LNE9_VIBFN/7-81------------HELK----------------------I---------------------------------STE-----
R6T3D1_9FIRM/130-204------------HTLK----------------------L---------------------------------EEC-----
B2TNZ8_CLOBB/5-89------------HELK----------------------I---------------------------------LPQ-----
D4MVL8_9FIRM/411-483------------HRLK----------------------L---------------------------------AKM-----
R9TAF8_9EURY/14-88------------HKLK----------------------I---------------------------------LLQ-----
A8E2L6_BPPHE/105-175------------HNLK----------------------I---------------------------------APT-----
A8FAI2_BACP2/6-76------------HDLK----------------------I---------------------------------MPQ-----
Q8CWZ2_STRMU/4-76------------HKIK----------------------L---------------------------------SHC-----
Q832V0_ENTFA/113-183------------HELK----------------------I---------------------------------LPE-----
W8FCI0_9BACT/21-96------------HELK----------------------V---------------------------------WPG-----
K8E4A8_CARML/4-76------------HELK----------------------I---------------------------------ASE-----

PF04266

Q7PS17_ANOGA/408-520--------------LS.........-------------M---------------------------------HQP.....
Q1Z8F3_PHOPR/9-107--------------MT.........-------------F---------------------------------FAR.....
O59345_PYRHO/1-111--------------MKVVQIRKFIL-------------L---------------------------------DNK.....
Q669U5_YERPS/14-127--------------WA.........-------------F---------------------------------GDTEQV..
O28749_ARCFU/4-103--------------IN.........-------------F---------------------------------DSE.....
Q57H41_SALCH/24-141--------------WS.........-------------F---------------------------------GDSPAL..
Q2P9X4_BPP2/8-81--------------VK.........-------------L---------------------------------HAK.....
B9WV89_STRSU/24-154--------------WA.........-------------F---------------------------------GAEA....
B1YID4_EXIS2/5-113--------------MG.........-------------L---------------------------------YEE.....
Q1ZT49_PHOAS/30-153--------------DY.........-------------F---------------------------------CADEYN..
Q82ZD1_ENTFA/26-150--------------WM.........-------------F---------------------------------GDGSSE..
Q3EQG9_BACTI/8-116--------------MG.........-------------L---------------------------------YNK.....
Q5WBH3_BACSK/27-150--------------WA.........-------------F---------------------------------GNTEEM..
Q8ZYT1_PYRAE/11-109--------------LR.........-------------F---------------------------------KRK.....
Q666W1_YERPS/141-216--------------LK.........-------------I---------------------------------LPE.....
Q8ZVS1_PYRAE/5-102--------------LM.........-------------L---------------------------------SQK.....
A6TNT9_ALKMQ/35-158--------------WH.........-------------F---------------------------------CNNEKD..
Q8A7V1_BACTN/8-125--------------IQ.........-------------F---------------------------------GCDT....
TRIP4_HUMAN/437-549--------------LS.........-------------V---------------------------------HQP.....
B7MCE4_ECO45/27-144--------------CT.........-------------F---------------------------------GDSAAL..
Q5SM30_THET8/8-102--------------LI.........-------------V---------------------------------REP.....
Q8G683_BIFLO/18-143--------------MF.........-------------P---------------------------------GPER....
Q28T99_JANSC/34-145--------------AT.........-------------L---------------------------------SAE.....
Q1Z8W3_PHOPR/30-153--------------DY.........-------------F---------------------------------CADEQN..
Q38XJ8_LACSS/28-150--------------YS.........-------------F---------------------------------GNTVQM..
Q74J94_LACJO/27-149--------------WA.........-------------F---------------------------------GATAED..
O59585_PYRHO/4-98--------------LI.........-------------I---------------------------------KQP.....
Y1447_PASMU/6-104--------------IT.........-------------F---------------------------------FTR.....
Q3M1U7_ANAVT/4-110--------------LT.........-------------V---------------------------------RQP.....
Q8TY14_METKA/239-342--------------MG.........-------------L---------------------------------EEE.....
Q4DDP1_TRYCC/470-580--------------LS.........-------------M---------------------------------HQP.....
Q8TV24_METKA/9-109--------------LE.........-------------I---------------------------------SGE.....
Q4SHG6_TETNG/424-545--------------LS.........-------------M---------------------------------HQP.....
Q5FJH1_LACAC/26-145--------------YA.........-------------Y---------------------------------GANSQD..
Q8LGK4_ARATH/109-212--------------LH.........-------------V---------------------------------QEP.....
O28463_ARCFU/4-98--------------LE.........-------------F---------------------------------KGK.....
Q39AD2_BURL3/6-102--------------LS.........-------------I---------------------------------VKP.....
Q49VC6_STAS1/27-147--------------WS.........-------------F---------------------------------GVDE....
O58093_PYRHO/5-109--------------MG.........-------------L---------------------------------QEE.....
Q8DSX1_STRMU/61-181--------------WQ.........-------------F---------------------------------GAEP....
Q97KB9_CLOAB/33-156--------------WY.........-------------F---------------------------------GGDKNS..
Q29GM2_DROPS/388-499--------------MS.........-------------M---------------------------------HQP.....
YO91_BPP2/8-81--------------VK.........-------------L---------------------------------HAK.....
Q8ES55_OCEIH/29-152--------------WA.........-------------F---------------------------------GDAPDH..
Q74MN0_NANEQ/4-103--------------LE.........-------------F---------------------------------KGE.....
A0A0B8RBU5_LISMN/29-152--------------WA.........-------------F---------------------------------GNSNQM..
Q5JIS1_THEKO/5-129--------------IA.........-------------L---------------------------------HQV.....
Q57UA7_TRYB2/469-579--------------LS.........-------------L---------------------------------HQP.....
Q9KEN6_BACHD/5-112--------------MG.........-------------L---------------------------------FKV.....
Y1576_VIBCH/7-105--------------IT.........-------------F---------------------------------FEF.....
Q6DAK1_PECAS/16-132--------------WA.........-------------F---------------------------------GDSSEL..
Q8DQF2_STRR6/24-144--------------WA.........-------------F---------------------------------GVEP....
Q7Y1E7_ORYSJ/14-135--------------LT.........-------------M---------------------------------HQP.....
A5VL14_LACRD/4-98--------------LS.........-------------I---------------------------------HPE.....
Q5JEH0_THEKO/6-109--------------LF.........-------------V---------------------------------KDE.....
F8Y0N6_STRAG/6-81--------------LN.........-------------C---------------------------------YPE.....
Q5JHR0_THEKO/9-103--------------LI.........-------------V---------------------------------REP.....
Q6FET4_ACIAD/8-104--------------LS.........-------------I---------------------------------VAP.....
Y267_MORMI/5-104--------------IT.........-------------F---------------------------------FQR.....
Q9AA41_CAUCR/6-84--------------LK.........-------------T---------------------------------WPK.....
Q6MN09_BDEBA/6-102--------------LS.........-------------I---------------------------------VHP.....
Q9CH09_LACLA/21-146--------------WA.........-------------F---------------------------------CNEVDGPI
Q5JEG9_THEKO/4-104--------------LE.........-------------F---------------------------------DGR.....
Q8TYL3_METKA/4-109--------------IM.........-------------T---------------------------------REE.....
O58177_PYRHO/25-125--------------LK.........-------------F---------------------------------DGR.....
Q6ZM46_DANRE/402-514--------------LS.........-------------M---------------------------------HQP.....
Q6F0Z5_MESFL/5-88--------------LS.........-------------M---------------------------------KKE.....
A9VQI1_BACWK/25-145--------------WQ.........-------------F---------------------------------GDSP....
Q5JEL3_THEKO/6-109--------------MG.........-------------L---------------------------------QEE.....
O86782_STRCO/58-183--------------GF.........-------------P---------------------------------GPLR....
Q4QIG2_LEIMA/490-600--------------LS.........-------------M---------------------------------HQP.....
O58178_PYRHO/7-110--------------LY.........-------------L---------------------------------RDE.....
Q1WTR7_LACS1/28-149--------------YS.........-------------F---------------------------------GDPES...
Q53LS7_ORYSJ/126-229--------------LH.........-------------V---------------------------------QEP.....
Q5JG45_THEKO/12-113--------------ML.........-------------I---------------------------------DSA.....
Y2524_SHEB5/6-104--------------IT.........-------------F---------------------------------FER.....
Y1394_HAEIN/6-104--------------IT.........-------------F---------------------------------YQR.....
Q1ZQA8_PHOAS/10-108--------------MT.........-------------F---------------------------------FER.....
H7C704_ENTFA/11-82--------------LK.........-------------I---------------------------------ETE.....
A0A0E1EJ20_STRAG/24-144--------------WQ.........-------------F---------------------------------GAEP....

PF02190

LONM_ASHGO/157-410-------------ELMVLPMSNRP.-------------L-------------------------------..FPGYYKSV
LONM1_DICDI/158-355-------------EVVIYPS.NSV.-------------N-------------------------------..FIGTTGPI
A5DBM7_PICGU/11-325-------------VLPTYRLDSNLV-------------L-------------------------------..LPGIIYNV
A5DAP1_PICGU/270-494-------------PLLAIPMKDRP.-------------P-------------------------------..LPGRPFAI
Q0UIT5_PHANO/192-422-------------SMPLFIC..TL.-------------S-------------------------------..LPAMPTFL
A1SL63_NOCSJ/4-197-------------TLPMFPL.NAV.-------------L-------------------------------..FPGVSVPL
LON1_BDEBA/7-200-------------YVPVIPLKNSV.-------------L-------------------------------..FPDISMPL
LON_CLOPH/7-201-------------QLPVVALRNMA.-------------V-------------------------------..MPGMLIHF
LON_AQUAE/16-212-------------EYPLMPLRDIV.-------------I-------------------------------..FPTMVQPL
Q9X1W8_THEMA/31-225-------------SLPCIPLRNGMG-------------V-------------------------------..FPNTVVPF
A8L4P8_FRASN/6-237-------------LLPLLPLDDAV.-------------V-------------------------------..LPGMVVPL
LON_NEOSM/32-229-------------NLPVLPLREVI.-------------F-------------------------------..FPGDYLPI
A5CDI0_ORITB/12-207-------------VLPLFPIRNTV.-------------L-------------------------------..FPGLVLPI
LON_DESVH/17-214-------------ELPLMSLREVV.-------------M-------------------------------..FPRSIVPL
A7HIT3_ANADF/21-218-------------GLKVFPLYGVA.-------------V-------------------------------..LPGTPTPF
LONM_CAEEL/88-357-------------NVPMLAINRYP.-------------L-------------------------------..FPGFIKKV
LONM_ORYSJ/101-311-------------SVIALPLPHRP.-------------L-------------------------------..FPGFYMPI
LON_FLAJ1/43-237-------------SLPILPLRNTV.-------------L-------------------------------..FPGVVIPI
LON_FUSNN/3-196-------------KAPFLPIRDLV.-------------I-------------------------------..FPNVVTPI
Q176B8_AEDAE/115-373-------------HLPVIATKRNP.-------------V-------------------------------..FPRFMKIL
B1YJV9_EXIS2/5-196-------------QYPLLPLRGVV.-------------A-------------------------------..YPLIGLTI
LON_DESOH/21-214-------------TVPIMPLSDGV.-------------L-------------------------------..FPKMIIPV
Q4UE63_THEAN/226-447-------------ALPALALFRKP.-------------A-------------------------------..FPGFYQVL
LON_KORVE/24-217-------------TLPLLPVRDTV.-------------L-------------------------------..FPHAVLPL
LON_SYNAS/22-218-------------ILPIMPIFHTV.-------------A-------------------------------..FPKMMFPM
A4RYB7_OSTLU/20-244-------------TLRIVVLDASV.-------------.-------------------------------...PKQVLPL
Q39SL1_GEOMG/12-202-------------VVPLYPVREIV.-------------A-------------------------------..FPYMIFPL
Q5SJA3_THET8/5-197-------------TMPVCPVRGSV.-------------I-------------------------------..YPTMVMPI
YOXA_SCHPO/252-470-------------WLPLFISM....-------------L-------------------------------.AYPRMPTFL
A1TLG4_ACIAC/20-217-------------SLPLFPL.GTV.-------------L-------------------------------..FPGGLLTL
A9AWT0_HERA2/15-210-------------TLPLVVLGEIV.-------------I-------------------------------..MPHMTVPL
C1DQT6_AZOVD/30-226-------------QVYVIPIHNRP.-------------F-------------------------------..FPAQVLPV
Q7MWJ0_PORGI/9-205-------------EMPILALRNMI.-------------L-------------------------------..FPGVAMPI
LONP2_NEUCR/10-256-------------TIPLLPLPKQTV-------------L-------------------------------..LPGVVQRV
A6L531_BACV8/39-234-------------EIPVMPLRNMV.-------------M-------------------------------..FPSVVMPV
Q9S2T2_STRCO/5-222-------------RLPLFPL.NSV.-------------L-------------------------------..FPGLVLPL
LONM_YARLI/202-503-------------EILAVPISDRP.-------------L-------------------------------..LPGFHRAL
Q3A8K2_PELCD/13-206-------------ALPLLPVRDAV.-------------I-------------------------------..FPHMILPL
LONP2_YARLI/4-302-------------TLPLLTLPADTV-------------V-------------------------------..LPGVSMKV
LONP2_BOVIN/12-220-------------RLPLLLTHEGV.-------------L-------------------------------..LPGSTMRT
LON2_SYNFM/17-208-------------KLRILPLRNMV.-------------L-------------------------------..YPDLVLPL
LONP2_CANAL/21-402-------------VLPTYTLDSNLV-------------L-------------------------------..LPGIMYNV
LON1_HERA2/13-209-------------EIAILPLLGTV.-------------A-------------------------------..YPQTIMPL
Q4FNU4_PELUB/9-201-------------TIPVFPLSNFI.-------------I-------------------------------..FPHTTVPL
Q057E4_BUCCC/10-202-------------DIPILPLRDIV.-------------I-------------------------------..YPYMVTPL
Q1D5A0_MYXXD/32-225-------------VLPILPLRNSV.-------------F-------------------------------..FPGGVLPL
A4FLR4_SACEN/3-200-------------TLPLFPL.STV.-------------L-------------------------------..LPGASLPL
Q4X3M7_PLACH/41-324-------------NILCFSLLNKP.-------------L-------------------------------..FPGLSYVL
LON_DICNV/5-198-------------IYPILPLRDVV.-------------V-------------------------------..FPHVIVPL
LON_NITOC/5-198-------------AYPTLPLKNTV.-------------L-------------------------------..FPHLVLPL
Q67SJ7_SYMTH/11-204-------------NLPLLPLKGQI.-------------V-------------------------------..FPTMIVPL
A4YSN7_BRASO/70-260-------------RRPALPLRDFV.-------------P-------------------------------..FPGATHPL
LONP2_ASPNC/10-255-------------KLPLVPLPKGSV-------------L-------------------------------..LPGITLRI
Q0U2R2_PHANO/14-258-------------VLPLIPLAPPLA-------------V-------------------------------..LPGTTLKI
Q4FM92_PELUB/7-199-------------ERPLLPLRDIV.-------------V-------------------------------..FPNMVVPL
Q8ILU7_PLAF7/45-357-------------EVKCVVLLNKP.-------------L-------------------------------..FPGLTYVL
LON_MYCPE/15-212-------------IANVLVTRGIV.-------------F-------------------------------..YPNTKIRI
CRBN_RAT/83-320-------------VIPVLPEVMMI.-------------L-------------------------------..IPGQTLPL
A5K180_PLAVS/44-319-------------EVECFSLLNKP.-------------L-------------------------------..FPGLSYVL
LON2_HERA2/18-210-------------ELPVLPLINTV.-------------L-------------------------------..FPTMVTPL
LON_MAGMM/41-240-------------ELVIYPLGGRP.-------------F-------------------------------..FPGMLTPI
LON1_DESPS/34-236-------------MLMVIPLYERP.-------------M-------------------------------..FPKMMGPI
LON_MYCMO/2-196-------------KYPFMATRGVI.-------------T-------------------------------..FIGNSSTI
LONP2_PICST/18-364-------------VLPTCKLDSNLV-------------L-------------------------------..LPGIIYNV
B1HVE4_LYSSC/9-197-------------NVPLLPLRGLL.-------------V-------------------------------..FPSMVLHI
E4XTK2_OIKDI/43-290-------------.LPVMPYGTQD.-------------L-------------------------------IHFPGQDVPI
G1TBZ8_RABIT/210-407-------------NVPIFVC..TM.-------------A-------------------------------..YPTVPCPL
I1QQQ1_ORYGL/12-253-------------.LAILPFRNKV.-------------L-------------------------------..LPGAIVRI
J9Z7L8_LEPFM/44-237-------------TLPCISSRDMV.-------------I-------------------------------..FPNMVVPI
J9ZC05_LEPFM/4-193-------------TIPLFPLPNVV.-------------L-------------------------------..FPKTLRPL
J9ZD27_LEPFM/11-209-------------ECPVVVLPETV.-------------V-------------------------------..FPHILSSL
M4B6H0_HYAAE/97-299-------------...ALPA.RRP.-------------F-------------------------------..FPGIVLPL
LON2_BORBU/9-200-------------.LPIVILKENV.-------------L-------------------------------..FPNITLWV
P96280_MYCTU/8-204-------------ELAMFPLESAP.-------------.-------------------------------..LPDEDLPL
LON1_BORBU/31-231-------------.VPLIAVPSHP.-------------V-------------------------------..FPGMFIPI
Q5E916_ARATH/98-437-------------KIPLFYLEGVV.-------------L-------------------------------..FPEATLPL
Q5NH45_FRATT/7-203-------------VVPVIPLRDVV.-------------I-------------------------------..YPSMTLPL
Q63XL2_BURPS/11-205-------------.LPLFPL.HTV.-------------L-------------------------------..FPGGLLPL
Q6FD62_ACIAD/18-212-------------VLPLLALRDVV.-------------V-------------------------------..YPHMQIAL
Q87YR8_PSESM/6-197-------------ELPLLPLRDVV.-------------V-------------------------------..YPHMVIPL
R5K463_9CLOT/9-200-------------..PMIVLNNIV.-------------I-------------------------------..MPDTSSHL
R6MYW8_9CLOT/11-203-------------.LPVLSLRGLV.-------------L-------------------------------..FPKMMLHF

PF09157

TRUB_XYLFA/245-300RL--.-------------.--------.....--...R--------------------DHS----FQ.------------
TRUB_ACTSZ/247-304RI--.-------------.--------.RF..--...N--------------------NEE----NI.------------
TRUB_CHRVO/242-300PV--.-------------.--------.RF..--..E.--------------------QKC----EK.------------
TRUB_AZOSB/241-294EL--.-------------.--------.....--...R--------------------KPE----DG.------------
Q609C4_METCA/59-115AV--.-------------.--------.....--...E--------------------GGD----FP.------------
TRUB_SHIDS/252-309PV--.-------------.--------.....--..RT--------------------SGA----PL.------------
TRUB_YERPE/252-309PV--.-------------.--------.....--..HV--------------------SGA----PS.------------
Q140U4_BURXL/245-306RL--.-------------.--------.KLSE--LTIT--------------------GDA----VN.------------
TRUB_PSYIN/251-308PV--.-------------.--------.....--..QV--------------------FGA----PD.------------
TRUB_MARHV/244-302PV--.-------------.--------.RI..--....--------------------PGQ----PF.------------
TRUB_SHEFN/251-308AI--.-------------.--------.....--..QA--------------------AGL----KP.------------
TRUB_VIBF1/251-308PV--.-------------.--------.....--..QV--------------------FGA----PQ.------------
Q0VSR9_ALCBS/246-303PV--.-------------.--------.....--..MA--------------------SDR----PL.------------
TRUB_NOSS1/234-289RI--.-------------.--------.....--...E--------------------LNL----ET.------------
TRUB_PSEHT/253-308AI--.-------------.--------.DL..--....--------------------DID----LP.------------
TRUB_ACTP2/246-303RV--.-------------.--------.KF..--...E--------------------NND----QI.------------
TRUB_COXBU/250-306AV--.-------------.--------.....--..MV--------------------PNA----PT.------------
TRUB_SACD2/250-310AV--M-------------D--------SRV..--....--------------------YRL----GD.------------
TRUB_NITMU/246-307AI--P-------------G--------THP..--...A--------------------GES----LL.------------
TRUB_ACIAD/262-316ES--.-------------.--------.....--...N--------------------IDH----DA.------------
TRUB_GLOVI/235-289RV--.-------------.--------.....--....--------------------.PG----DC.------------
TRUB_MANSM/246-303RV--.-------------.--------.KF..--...D--------------------NLQ----QL.------------
TRUB_NITEU/231-291KI--.-------------.--------.RKNM--.SR.--------------------YGL----PV.------------
TRUB_PSEA6/251-311PV--.-------------.--------.PY..--..VS--------------------EAT----ID.------------
A4SY76_POLSQ/241-299RV--.-------------.--------.PL..--...N--------------------LPS----IE.------------
TRUB_BAUCH/253-312MV--.-------------.--------.AV..--..D.--------------------.QC----WQ.------------
A0KNE1_AERHH/266-323AV--.-------------.--------.....--..QV--------------------AGA----PQ.------------
TRUB_SODGM/249-306TV--.-------------.--------.....--..AV--------------------TAQ----PQ.------------
A0ZIL4_NODSP/234-288KI--.-------------.--------.....--...P--------------------QTL----DF.------------
TRUB_PECAS/252-309AV--.-------------.--------.....--..QA--------------------ANA----PL.------------
TRUB_BUCBP/244-301KV--.-------------.--------.KT..--..H.--------------------.SG----FI.------------
Q0K9C1_CUPNH/232-294RI--.-------------.--------.AQRD--LPAD--------------------TGL----AE.------------
TRUB_SHEAM/251-308PV--.-------------.--------.....--..RV--------------------AGV----SS.------------
TRUB_HALHL/245-301PV--.-------------.--------.....--..FV--------------------PKA----PS.------------
TRUB_PHOLL/251-310AV--.-------------.--------.....--..RS--------------------AKS----PAL------------
TRUB_THIDA/239-293SV--.-------------.--------.....--...P--------------------DAA----DR.------------
TRUB_IDILO/246-303PI--.-------------.--------.PL..--...P--------------------EQN----GN.------------
TRUB_METFK/241-297EV--.-------------.--------.....--..WK--------------------SGL----SI.------------
TRUB_MARMS/244-301TV--.-------------.--------.PS..--...P--------------------VSL----EH.------------
A5EWY7_DICNV/237-289DI--.-------------.--------.....--....--------------------AIT----AT.------------
Q0A799_ALKEH/244-300PV--.-------------.--------.....--..WV--------------------PRI----PE.------------
TRUB_HAHCH/247-303TV--.-------------.--------.KI..--....--------------------SPL----SS.------------
TRUB_CHRSD/242-299RA--.-------------.--------.QI..--..DT--------------------AGL----AA.------------
Q2JJL0_SYNJB/239-295AI--.-------------.--------.LL..--....--------------------DRP----II.------------
TRUB_AQUAE/232-286RI--.-------------.--------.LI..--....--------------------KNY----DY.------------
TRUB_DECAR/241-295PV--.-------------.--------.....--...S--------------------LPA----GL.------------
TRUB_CALS4/230-285FI--.-------------.--------.....--...R--------------------NTY----NV.------------
A4G7S5_HERAR/244-306RL--.-------------.--------.ALGK--ENI.--------------------VLP----EG.------------
TRUB_BUCAI/250-307TV--.-------------.--------.IF..--..F.--------------------.SD----IK.------------
TRUB_CHESB/253-310PV--.-------------.--------.....--....--------------------.IV----RG.------------
TRUB_PASMU/246-303RV--.-------------.--------.KF..--...D--------------------NPT----QL.------------
TRUB_SYNE7/234-291AM--.-------------.--------.PV..--...P--------------------DSV----LP.------------
TRUB_NITOC/247-303SV--.-------------.--------.....--..RV--------------------PQA----PS.------------
TRUB_HAEDU/246-303RV--.-------------.--------.KF..--...D--------------------NLA----QI.------------
TRUB_AROAE/245-299VL--.-------------.--------.....--...A--------------------APC----GA.------------
TRUB_HISS2/246-303RI--.-------------.--------.KF..--...L--------------------NEQ----GI.------------
B4E7L3_BURCJ/247-306RL--.-------------.--------.PLS.--.ALE--------------------PID----AA.------------
TRUB_VIBTL/251-308PV--.-------------.--------..Q..--...V--------------------SGA----PT.------------
M1FAI4_9ALTE/245-303AV--.-------------.--------.RI..--....--------------------EAQ----LD.------------
M9X1B5_MANHA/247-303RI--.-------------.--------.RF..--...D--------------------NLN----QL.------------
TRUB_PSEAE/246-302PV--.-------------.--------..R..--...A--------------------PEA----PK.------------
TRUB_LEGPH/243-299VI--.-------------.--------..S..--...N--------------------KTG----AV.------------
TRUB_BURPS/246-307RL--.-------------.--------.KLSE--.LAA--------------------RPD----AA.------------
TRUB_PHOPR/251-308PV--.-------------.--------..K..--...A--------------------SQL----PE.------------
TRUB_XANCP/245-299RL--.-------------.--------.....--...R--------------------DPA----FP.------------
TRUB_RALSO/252-312RL--.-------------.--------.PL..--...Q--------------------LSL----PS.------------
TRUB_VIBCH/251-308AV--.-------------.--------..Q..--...V--------------------SGA----PS.------------

PF09142

TRUB_LEIXX/238-297RL--------------------------------------------------------HLAGWEGPR-------------
TRUB_THEFY/236-291RI--------------------------------------------------------SPS....GH-------------
TRUB_COREF/238-293WL--------------------------------------------------------EPR....GL-------------
TRUB_RHOJR/245-300WL--------------------------------------------------------EPI....GI-------------
TRUB_PROAC/237-295RL--------------------------------------------------------SFT....VP-------------
TRUB_STRAW/243-301RL--------------------------------------------------------EMPE.EYAG-------------
Q0RDS8_FRAAA/250-305RL--------------------------------------------------------APV....GR-------------
A5UZQ6_ROSS1/240-296PL--------------------------------------------------------VAP...SGA-------------
TRUB_BIFLO/329-385RI--------------------------------------------------------ER.....TI-------------
A1SLK5_NOCSJ/235-289AL--------------------------------------------------------DL.....DL-------------
A1T7J3_MYCVP/243-298AL--------------------------------------------------------PVA....GI-------------
TRUB_CORDI/241-296WL--------------------------------------------------------TPR....GL-------------
Q2IPZ4_ANADE/244-300PV--------------------------------------------------------PRP...PGT-------------
A6W7Z8_KINRD/243-298FL--------------------------------------------------------RAG....EH-------------
A4FM27_SACEN/227-282AV--------------------------------------------------------PAA....GL-------------
TRUB_CORJK/248-303WL--------------------------------------------------------KPV....GN-------------
TRUB_MYCLE/247-302PI--------------------------------------------------------SSA....GI-------------
A7H9F6_ANADF/247-302AL--------------------------------------------------------RRE....LA-------------
A8L6F8_FRASN/256-311RL--------------------------------------------------------PML....GS-------------
TRUB_NOCFA/245-300WL--------------------------------------------------------DPV....GI-------------
A0QVP8_MYCS2/244-299PL--------------------------------------------------------RPA....GI-------------
TRUB_MYCPA/234-289AL--------------------------------------------------------AAA....GI-------------
A9WGQ0_CHLAA/234-289AI--------------------------------------------------------TAT...EPD-------------
B0RDY4_CLAMS/254-312KL--------------------------------------------------------TTPD.EAPT-------------
B2HKU5_MYCMM/242-297PL--------------------------------------------------------EPA....GI-------------
TRUB_MYCTU/236-291SL--------------------------------------------------------PAV....GI-------------

PF01472

TRUB_SULTO/251-323ML----------------------------------TA--------------------PGIVAYQR.F.....-------
PROB_BACSU/277-350SL----------------------------------LP--------------------AGVVGVNGSF.....-------
TRUB_AERPE/262-335QL----------------------------------AA--------------------PGVAAVEEGV.....-------
DKC1_HUMAN/297-370KI----------------------------------ML--------------------PGVLRYEDGI.....-------
ATGT_METJA/578-651NV----------------------------------FA--------------------KFVIDCDEEL.....-------
ATGT_METTH/579-652SV----------------------------------FA--------------------KFIIDCDNNI.....-------
Q9YEQ6_AERPE/84-160HL----------------------------------MI--------------------PGVVGVEGSF.....-------
TRUB_THEAC/210-279DL----------------------------------YA--------------------GGIKIIDGKF.....-------
PROB_YEAST/322-409GL----------------------------------LP--------------------AGVIDVQGTF.....-------
YHJ3_YEAST/316-403SL----------------------------------TP--------------------NAVIEVRDNF.....-------
PROB_VIBPA/286-360SL----------------------------------LA--------------------KGVIKVSGDF.....-------
PROB_VIBCH/284-358SL----------------------------------LA--------------------KGVVRVQGQF.....-------
PROB_SHEON/281-355SL----------------------------------LS--------------------KGIIGVKGEF.....-------
PROB_ECOLI/276-350SL----------------------------------LP--------------------KGIKSVTGNF.....-------
PROB_HAEIN/276-350SL----------------------------------LP--------------------AGIINVEGRF.....-------
PROJ_BACSU/281-355SL----------------------------------YL--------------------DGVQKIKGKF.....-------
Q8H5T5_ORYSJ/311-384KL----------------------------------MI--------------------PGLLRFENDI.....-------
CBF5_KLULA/266-339KL----------------------------------MI--------------------PGLLRYEEGI.....-------
DKC1_CAEEL/285-358KI----------------------------------LI--------------------PGILRYDDDI.....-------
DKC1_DROME/295-368KI----------------------------------TL--------------------PGVLRYEDGI.....-------
Q8ILS0_PLAF7/269-342KL----------------------------------TI--------------------PGVLRFDNNI.....-------
Q8SRW0_ENCCU/263-336KL----------------------------------SI--------------------TGVLRFDRDI.....-------
TRUB_METTH/240-313DL----------------------------------AR--------------------GGIAGLDDNI.....-------
TRUB_ARCFU/237-310NL----------------------------------SV--------------------RGVAYVEKNV.....-------
TRUB_METJA/249-322DV----------------------------------YV--------------------RGIAKLSKGI.....-------
TRUB_METKA/248-321NL----------------------------------AA--------------------PGIVRVEKGI.....-------
TRUB_PYRAE/239-312PL----------------------------------AA--------------------PGISKFETPF.....-------
TRUB_SULSO/164-236QL----------------------------------AV--------------------PGVV.AYQNF.....-------
Q9HS38_HALSA/81-154NV----------------------------------FA--------------------KFVTDVDDDA.....-------
O29550_ARCFU/79-152SV----------------------------------FA--------------------KHVVEVDEEI.....-------
Q975U3_SULTO/92-165NA----------------------------------FC--------------------KFVINSDPSI.....-------
ATGT_THEAC/554-627SV----------------------------------FF--------------------KFILGSDENI.....-------
Q8TWS6_METKA/77-150DL----------------------------------FC--------------------EYALRGWEEL.....-------
Q8ZYG7_PYRAE/80-152NV----------------------------------PA--------------------KYVIEAAPHA.....-------
Q8TGZ2_METKA/63-136DL----------------------------------YA--------------------PGVVQADPDI.....-------
Q8ZYJ6_PYRAE/89-161DL----------------------------------YA--------------------PAVIKTDR.V.....-------
Q9YD14_AERPE/93-165DL----------------------------------YA--------------------PGVVYARG.V.....-------
Q8TXP0_METKA/124-195NL----------------------------------FA--------------------PGVTSADD.V.....-------
Q9HNT2_HALSA/517-583SV----------------------------------LA--------------------PGVIDASDDI.....-------
O27701_METTH/236-308TL----------------------------------FA--------------------PGVSDADTGI.....-------
Q8U4L1_PYRFU/502-568DI----------------------------------FA--------------------AGVGSADEKI.....-------
O29668_ARCFU/456-526TI----------------------------------FA--------------------GGVLRADEKI.....-------
ARCS_METJA/501-568SL----------------------------------FP--------------------PGFVDCNENI.....-------
Y066_METJA/132-206SV----------------------------------LR--------------------PGIVEFTDDI.....-------
Q8I3H2_PLAF7/91-168NI----------------------------------MC--------------------PGVTSPGGKLD...D-------
Q8RZU5_ORYSJ/92-170NI----------------------------------MC--------------------PGLTSPGGSLDV..E-------
Q8MXH7_CAEEL/94-172SI----------------------------------MC--------------------PGLTSPGAKLTP..L-------
MCTS2_MOUSE/93-170NI----------------------------------MC--------------------PGLTSPGAKLY...T-------
TMA20_YEAST/91-171NI----------------------------------MC--------------------PGLTSAGADLPPAPG-------
Y1432_METJA/79-153DV----------------------------------MA--------------------PGIVDADENI.....-------
O28867_ARCFU/71-144DV----------------------------------MK--------------------PGIVYADERI.....-------
O26746_METTH/77-151DV----------------------------------MS--------------------PGIVDADPEI.....-------
Q8TYS3_METKA/83-157DI----------------------------------MV--------------------PGIVEVRGEF.....-------
Q9HM93_HALSA/77-150DV----------------------------------MR--------------------PGITAASPEI.....-------
Q8ZWT7_PYRAE/82-155DV----------------------------------MR--------------------PGIKKLEGDF.....-------
Q9HIB8_THEAC/71-144DL----------------------------------FA--------------------PGIVSMDDSI.....-------
Q97TZ1_SULSO/69-143DL----------------------------------FA--------------------PGIVEYNCEC.....-------
Y1649_METJA/6-80RL----------------------------------VY--------------------TKAIKNRGDL.....-------
PROB_CHLTE/278-354SL----------------------------------LP--------------------VGITGVEGSF.....-------
PROB_BACTN/279-354SI----------------------------------LP--------------------VGITHIEGEF.....-------
PROB_STRR6/276-349SL----------------------------------LL--------------------SGIVEAEGVF.....-------
PROB_AQUAE/266-339SL----------------------------------LP--------------------AGVVSVQGNF.....-------
PROB_THEMA/263-336SL----------------------------------LP--------------------VGVTGVEGTF.....-------
PROB_OCEIH/277-351SL----------------------------------LS--------------------AGVINTQGDF.....-------
PROB_BACHD/277-351SL----------------------------------LP--------------------AGVTSVHGTF.....-------
PROB_COREF/278-352SL----------------------------------LA--------------------VGITEVIGDF.....-------
PROB_STRCO/281-355SL----------------------------------LP--------------------AGIAGVEGDF.....-------
PROB_BIFLO/286-360SL----------------------------------LA--------------------AGALEVHGDF.....-------
PROB_PSESM/281-355SL----------------------------------LP--------------------VGVKLVQGSF.....-------
PROB_PSEPK/281-355SL----------------------------------LP--------------------VGVKTVQGSF.....-------
PROB_PSEAE/281-355SL----------------------------------LP--------------------VGVKAVQGSF.....-------
PROB_RALSO/283-357SL----------------------------------LP--------------------IGVTEVQGEF.....-------
PROB_XANCP/268-345SL----------------------------------LP--------------------GGVAGAEGDF.....-------
PROB_DEIRA/272-346SL----------------------------------LP--------------------AGIRQVEGDF.....-------
PROB_BRADU/282-355SL----------------------------------LP--------------------AGVIKVEGQF.....-------
PROB_AGRFC/283-356SL----------------------------------LP--------------------AGVRQVKGNF.....-------
PROB1_RHIME/283-356SL----------------------------------LP--------------------AGVRQVTGSF.....-------
PROB1_RHILO/279-352SL----------------------------------LP--------------------AGVKLVSGNF.....-------
PROB_CAUCR/287-360SL----------------------------------LP--------------------AGVRAVEGPF.....-------
PROB_SCHPO/296-370GL----------------------------------LP--------------------VGVTKVHGHF.....-------
PROB_THEEB/277-351SL----------------------------------LA--------------------AGITRVEGEF.....-------
PROB_NOSS1/287-361SL----------------------------------LP--------------------AGVKTVAGEF.....-------
PROB_SYNY3/282-356SL----------------------------------LA--------------------IGVVALEGEF.....-------
PROB_CALS4/273-347SL----------------------------------LP--------------------SGIVKTEGQY.....-------
PROB_SERP5/276-350SL----------------------------------LP--------------------KGIREVKGDF.....-------
D3PQW1_MEIRD/282-355SL----------------------------------LP--------------------AGILEVRGQF.....-------
PROB_MYCTU/281-351SL----------------------------------LA--------------------AGITAVSGRF.....-------
PROB_BRUA2/280-353SL----------------------------------LP--------------------AGVKEVDGDF.....-------
PROB_THET8/276-350SL----------------------------------LP--------------------AGVKEVRGRF.....-------
PROB_VIBVY/286-360SL----------------------------------LA--------------------KGVTKVLGEF.....-------
TRUB_METAC/246-319SL----------------------------------AV--------------------PGITSLDSSL.....-------
Q8U1U0_PYRFU/88-161DV----------------------------------MA--------------------PGIVDADENI.....-------
Q8U444_PYRFU/4-78IV----------------------------------FK--------------------KGVVRTEGEI.....-------

PF03657

Y516_AERPE/11-172DV----------------------------------YG--------------------DNIASHTSG-------------
Y1410_METJA/1-157DI----------------------------------FK--------------------ESIIEVKGF-------------
Y058_ARCFU/1-167DI----------------------------------FA--------------------GSVERASEF-------------

PF14306

A8MAT6_CALMQ/8-187RL..L.............D........GWL..--.FPF--------------------PIIFDISEEDLRKLG-------
Q8ZUU0_PYRAE/7-184RL..L.............N........GWL..--.FPF--------------------PLIYDVDEEKIKG..-------
PAPS1_HUMAN/225-386CL.LD.............G........GVI..--NLSV--------------------PIVLTATHEDKER..-------
PAPS2_HUMAN/215-376TL.LD.............D........GVI..--NMSI--------------------PIVLPVSAEDKTR..-------
Q7PX77_ANOGA/219-385CL.LN............ED........ETLRV--NQSV--------------------PIVLSATEADKQR..-------
Q8IQV1_DROME/247-415TL.QSG...........MD........GSYRE--NHSV--------------------PIVLSATQADKDR..-------
Q22501_CAEEL/229-414QL.LDLKHKVAFVGEKSDDKEDSWPMMDDI..--NQSI--------------------PIVLPISDDVKKG..-------
APS3_ARATH/53-216LL.NL............DD........GSVV.--NMSV--------------------PIVLAIDDQQKAL..-------
MET3_PHANO/3-166RL..A.............D........GNL..--.FSI--------------------PITLDVSKETIDEVG-------
A0A016PSU3_GIBZA/3-166RL..A.............D........GAL..--.FSM--------------------PINLDVNQAEIDQLG-------
A0A0D1E1R4_USTMA/3-166RL..A.............D........GNL..--.FPM--------------------PITLDVDEQQIEALK-------
MET3_DEBHA/4-174RL..S.............SVKNEKNGKGLL..--.WSM--------------------PITLDVGQEFAGK..-------
MET3_CANAL/4-172RL..S.............SVKNESNGKGLL..--.WPI--------------------PITLDVDETTSKK..-------
MET3_KLULA/2-163RL..Q.............N........GLV..--.WTI--------------------PITLDVDAEFASQ..-------
MET3_ASHGO/2-161RL..T.............S........GLL..--.WTI--------------------PITLDVDEEFAKS..-------
A8ZWW7_DESOH/6-165RL..A.............S........GEL..--.FPL--------------------PVCLDVSNERART..-------
Q54F74_DICDI/17-181TI.DG.............DK.....DEGLL..--.FPM--------------------PIVLDISKECLDTVL-------
A5UYJ4_ROSS1/4-160RL..A.............G........GTL..--.FPL--------------------PITLPVSGKTLAR..-------
B4U6B9_HYDS0/17-175RL..K.............N........GLV..--.FPI--------------------PVYLPVDKDTLKD..-------
SAT_SYNFM/5-167TM..A.............D........GVF..--.WPI--------------------PITLSADKAVADS..-------
SAT_CHLPB/4-165MM..A.............D........GTF..--.WPI--------------------PITLSTSKELGDT..-------
SAT_RUTMC/5-162TI..E.............S........GLF..--.WPI--------------------PITLSTDNEG.....-------
SAT_THIDA/5-162KM..T.............N........GLF..--.WPI--------------------PITLSTDDES.....-------
SAT_PSYWF/16-179TL..KTG.........ANK........GLF..--.WPI--------------------PITLSTSKEQADS..-------
Q72CI8_DESVH/5-177TL..A.............D........GTF..--.WPV--------------------PVTLDVSKDDAAA..-------
Q6AN73_DESPS/5-179QM..A.............D........GTF..--.WPV--------------------PITLDISAADATD..-------
SAT_DESRM/4-163HL..A.............S........GLA..--.WPL--------------------PVTLAVTKDQAAS..-------
SAT_ALCBS/5-169TT..A.............D........GLF..--.WPV--------------------PIL..NMLKDVSA..-------
SAT_ALLVD/2-166TL..T.............D........GRF..--.FPV--------------------PLL..CLLESADA..-------
SAT_CENSY/6-156RL..A.............D........GTA..--.WTI--------------------PIVFDADAAEAAR..-------
SAT_NITMS/7-157RL..A.............N........DLA..--.WTI--------------------PIVLDVDEETANK..-------
SAT_HYPBU/3-160RL..S.............N........DLP..--.WTI--------------------PIILDVDPGEIAG..-------
SAT_STAMF/3-160RL..S.............N........DLP..--.WTI--------------------PVILDVDPEEISN..-------
SAT_IGNH4/3-160RL..S.............N........DLP..--.WTI--------------------PIILDVDENVKKS..-------
SAT_AERPE/3-162RL..S.............N........DLP..--.WTI--------------------PIVLDANREWVLNEG-------
Q9KCT2_BACHD/4-155RL..E.............N........GTV..--.WSI--------------------PIALPVTEEKAAT..-------
SAT_BACP2/4-154RL..A.............S........GVV..--.WSL--------------------PITLPVTKEKAAE..-------
SAT1_BACSU/4-154RL..S.............S........GVV..--.WSL--------------------PITLPVDAQKAAE..-------
SAT2_BACSU/4-155RL..A.............N........GLP..--.WSL--------------------PITLPVGEKTARQ..-------
SAT_DEIRA/12-166RL..A.............D........GTP..--.WSL--------------------PITLPVTAEQAAG..-------
Q2JHJ0_SYNJB/14-172HL..A.............N........GLA..--.WSL--------------------PVTLPVSSEVAAG..-------
SAT_GLOVI/9-167RL..T.............S........GVV..--.WSI--------------------PITLPVSAEVAET..-------
SAT_OCEIH/12-170CL..K.............D........GTV..--.WSI--------------------PITLAVNKEQADS..-------
SAT_LACPL/7-162HL..K.............S........GVI..--.WSV--------------------PITLGVSQADADK..-------
SAT_PELTS/3-161RL..A.............D........GTV..--.WTI--------------------PIVLGVASGEAGS..-------
SAT_RUBXD/9-167RL..A.............D........GLP..--.WSI--------------------PITLSVSEEEARS..-------
SAT_SYMTH/5-163RL..A.............S........GLL..--.WAL--------------------PVTLAVSRAEAES..-------
SAT_PETMO/2-161RL..S.............N........GTV..--.WSI--------------------PIILSVKKEIADE..-------
SAT_HALOH/2-161RL..A.............D........GTV..--.WSI--------------------PEVLGVTREEADN..-------
A4YFD2_METS5/3-148EL..N.............N........GLP..--.WTI--------------------PIILPVMAP......-------
SAT_CARHZ/2-158TL..S.............S........GFL..--.WSI--------------------PIVLRVSEEEAR...-------
A9WF10_CHLAA/8-161RL..A.............D........GTL..--.WPI--------------------PVTLPVEKSHF....-------
SAT_CHLAA/10-157RL..T.............N........GLP..--.WSI--------------------PITLGVSAQDAAS..-------
SAT_LYSSC/4-153RL..V.............S........GIV..--.WSI--------------------PITLPVTEEKAAT..-------
B1WW78_CYAA5/57-215HL..S.............N........GVP..--.WSI--------------------PVTLSVSEEVADS..-------
B6HEK3_PENCW/4-165RL..A.............D........GNV..--.FSM--------------------PITLDASQEVIDEKK-------
C4LVD3_ENTHI/11-173TL..A.............D........GTF..--.WPI--------------------PITMSVSEEEAKK..-------
F7BBN1_CIOIN/226-379CL.LK.............N........EPI..--NQSV--------------------PIVLPVHSADKER..-------
H3D716_TETNG/215-374NL.LD.............G........GTI..--NLTV--------------------PIVLPVSTECKQK..-------
J9Z8G2_LEPFM/5-161RL..P.............G........GLL..--.FPL--------------------PVVLSLPEDLYRK..-------
M4DJ10_BRARP/17-179SLRLK.............D........GSFV.--NMSL--------------------PIVLAIDDQTKEQ..-------
MET3_CRYNJ/4-171RL..APYN.......GQKH........GDV..--.FPI--------------------PITLDVSQEDINTLG-------
SAT_GEOKA/5-154RL..S.............D........GTV..--.WSI--------------------PITLAVTEEKAKE..-------
Q73WR2_MYCPA/6-159AL..P.............D........STL..--.WSI--------------------PIVFDMSADDIAERD-------
S2JG29_MUCC1/4-165RL..A.............N........GLL..--.WTI--------------------PITLDVSKEQIEESK-------

PF04146

U5DHQ3_AMBTC/203-345S----------------------------LKY--N.VW--------------------ASTDFGN.....KKL-------
G9NWF6_HYPAI/319-521S----------------------------FRT--G.IW--------------------ATQSHNE.....ETL-------
D8TNU7_VOLCA/3-131S----------------------------VRV--G.AW--------------------ATTRQND.....DKL-------
B0CZ01_LACBS/621-947S----------------------------VES--G.LW--------------------ATQKHNE.....GIL-------
K1VD20_TRIAC/114-250S----------------------------LKH--E.IW--------------------SSTVLGN.....KRL-------
Q6BPA7_DEBHA/127-264S----------------------------IAN--N.IW--------------------ASTNLGN.....KRL-------
C5L6K6_PERM5/34-174A----------------------------FEL--G.VW--------------------PLSKQTA.....RKL-------
D8PXT6_SCHCM/597-878S----------------------------VEK--G.IW--------------------ATQKHNE.....GIL-------
A0DYX2_PARTE/54-188S----------------------------IKY--G.IW--------------------TSSKENN.....EKL-------
A6QW31_AJECN/628-764A----------------------------KKE--G.TW--------------------ATQVKNL.....EKF-------
G3B5F4_CANTC/46-183S----------------------------FIN--N.IW--------------------ASTELGN.....KRL-------
G8BTN3_TETPH/177-314S----------------------------YYN--R.IW--------------------SSTYFGN.....KRL-------
K1XSV2_MARBU/377-579S----------------------------VRN--G.IW--------------------ATQSHNE.....DAL-------
M1WAB0_CLAP2/245-382S----------------------------QQD--N.LW--------------------VTQNKNG.....SLL-------
M9LMP9_PSEA3/630-1025S----------------------------IET--G.YW--------------------ATQPHNE.....AVL-------
T1IEI7_RHOPR/176-317S----------------------------KVK--G.VW--------------------STLPMNE.....AKL-------
C5E1V0_ZYGRC/178-314S----------------------------FYN--G.IW--------------------SSTFYGN.....KRL-------
T1EJA3_HELRO/16-152S----------------------------IRH--S.LW--------------------SSTLYGG.....QRL-------
B9PUV6_TOXGO/446-580S----------------------------IQH--G.VW--------------------ATSKGNS.....RKL-------
B9GKR9_POPTR/68-204S----------------------------IEN--G.IW--------------------ATQVRNE.....PIL-------
K9G8Z6_PEND2/207-404S----------------------------KQS--G.IW--------------------ATQSHNE.....AAM-------
G2QRC4_THITE/578-713C----------------------------MED--S.LW--------------------TTQVQNG.....PTF-------
Q179P3_AEDAE/474-610S----------------------------IKY--E.IW--------------------CSTEHGN.....QRL-------
K1PII4_CRAGI/293-431A----------------------------KAK--G.VW--------------------STPPQNE.....IRL-------
U1HHT6_ENDPU/832-968A----------------------------QRE--G.TW--------------------ATQTKNE.....DTF-------
B6K0R3_SCHJY/340-468A----------------------------KRS--S.VW--------------------SLKQNYA.....NAI-------
A7S845_NEMVE/5-139S----------------------------IKY--C.VW--------------------TSTEHGN.....RRL-------
J9FJT3_WUCBA/174-306A----------------------------MET--S.LW--------------------TTHPFVE.....KLL-------
A7S9W8_NEMVE/1-137S----------------------------KAK--G.VW--------------------STPRTNE.....KKL-------
Q2HAM8_CHAGB/185-397S----------------------------VRT--N.IW--------------------ATQSHNE.....EML-------
A7S7H4_NEMVE/1272-1403S----------------------------MAK--G.IW--------------------ATTIANE.....KKL-------
H2ZM81_CIOSA/317-452S----------------------------IKY--N.IW--------------------CSTEHGN.....KRL-------
U5H657_USTV1/931-1067S----------------------------LKY--E.IW--------------------ASTDLGN.....KRL-------
D7TI61_VITVI/437-575S----------------------------IKY--N.MW--------------------ASTANGN.....KKL-------
T5ACT8_OPHSC/215-351S----------------------------QRD--G.LW--------------------ATQAKNG.....IIF-------
I1MJV8_SOYBN/128-270S----------------------------VKY--N.VW--------------------TSTPNGN.....KKL-------
K3Y698_SETIT/311-449S----------------------------IKY--N.VW--------------------ASTASGN.....RKL-------
K3Y7A4_SETIT/80-223S----------------------------IKY--G.VW--------------------STSSVGN.....LKL-------
B7Q1P2_IXOSC/1192-1325S----------------------------VST--G.LW--------------------SLGPATD.....RKV-------
D7TAY9_VITVI/331-469S----------------------------IKY--G.VW--------------------VSTPNGN.....KRL-------
G7EB12_MIXOS/559-886A----------------------------VEH--S.IW--------------------STQSHNE.....PVL-------
J7S680_KAZNA/150-287S----------------------------FYN--G.IW--------------------SSTHFGN.....KRL-------
U7Q061_SPOS1/487-740S----------------------------VRT--G.IW--------------------ATQSHNE.....ETL-------
G9MG20_HYPVG/322-524S----------------------------VRT--G.IW--------------------ATQSHNE.....ETL-------
G8XZL1_PICSO/128-265S----------------------------IEN--K.IW--------------------TSTNLGN.....KRL-------
G2XF66_VERDV/192-394S----------------------------VRT--G.IW--------------------ATQSHNE.....DTL-------
K1QXM6_CRAGI/5-167C----------------------------IRS--E.KW--------------------ACKDRVNPPHPREVL-------
D0NFE9_PHYIT/251-393S----------------------------VHH--E.RW--------------------AVPPAVL.....QQI-------
K3XF31_SETIT/338-480S----------------------------IKY--G.VW--------------------SSSSNGN.....SKL-------
F6Q7U6_ORNAN/151-282S----------------------------QQK--G.VW--------------------STTPVNE.....GKL-------
E9EVG6_METRA/418-621S----------------------------VQT--G.IW--------------------ATQSHNE.....NNL-------
I7M1Y9_TETTS/89-224A----------------------------IKY--G.IW--------------------TSVPGNN.....VKL-------
J3P7Z2_GAGT3/427-625S----------------------------IKT--G.IW--------------------ATQSHNE.....KAL-------
A0BIE6_PARTE/204-344A----------------------------IKY--G.IW--------------------CSSSLVN.....QEL-------
T5AGE9_OPHSC/374-574S----------------------------VRT--G.IW--------------------ATQSHNE.....ESL-------
F6QHV0_MONDO/340-475S----------------------------IKY--S.IW--------------------CSTEHGN.....KRL-------
E9E0K3_METAQ/180-317S----------------------------RRD--G.LW--------------------ITQAKNG.....PLF-------
G3JL26_CORMM/398-599S----------------------------VKT--G.IW--------------------ATQSHNE.....ELL-------
F9XGG0_ZYMTI/186-391S----------------------------VRN--G.IW--------------------ATQSHNE.....EIL-------
C4JRH9_UNCRE/337-473S----------------------------QTE--G.AW--------------------VTQRKNV.....EKL-------
G9P5M8_HYPAI/35-170A----------------------------QRD--G.LW--------------------ITKAENG.....PML-------
E5SQQ4_TRISP/509-644S----------------------------VKF--G.LW--------------------WPTEDII.....ACL-------
Q23DI1_TETTS/133-269G----------------------------VLY--G.TW--------------------STSIDQN.....ILL-------
M4F5R7_BRARP/228-363S----------------------------IKY--G.MW--------------------SSTPTGN.....KKL-------
R7YYG2_CONA1/426-624S----------------------------VRN--G.IW--------------------ATQAHNE.....EVL-------
A0BNI8_PARTE/17-156S----------------------------LNN--Q.VI--------------------FLQKRFD.....QQL-------
K0KIR7_WICCF/195-342S----------------------------FIH--K.IW--------------------SSTDIGN.....NRL-------
E9GRU8_DAPPU/153-289S----------------------------IKY--E.IW--------------------CSVEHRN.....KRL-------
B2AM24_PODAN/407-619S----------------------------VRT--N.IW--------------------ATQSHNE.....GTL-------
Q6FY47_CANGA/158-294S----------------------------FYN--S.IW--------------------SSTHFGN.....RKL-------
K7K6W6_SOYBN/472-610S----------------------------IKY--K.VW--------------------ASTFNGN.....KKL-------
M3BUB4_SPHMS/369-565S----------------------------VRN--G.IW--------------------ATQSHNE.....QTL-------
F6HE16_VITVI/375-517S----------------------------IKY--N.VW--------------------SSTPNGN.....KKL-------
C4Y9B7_CLAL4/138-272A----------------------------LKH--C.VW--------------------TSTELGN.....KKL-------
R9AVA4_WALI9/217-354S----------------------------LKY--N.IW--------------------ASTELGN.....QRL-------
B9SK12_RICCO/287-425S----------------------------IKY--S.VW--------------------ASTPHGN.....KKL-------
H6C1G6_EXODN/112-376S----------------------------LES--G.QW--------------------FIPNRHV.....KRL-------
U9TJV4_RHIID/1-136S----------------------------LKY--D.IW--------------------ASTEIGN.....RRL-------
G3AP02_SPAPN/37-179S----------------------------FTN--N.IW--------------------TSTELGN.....RRL-------
R7Z4V4_CONA1/260-394A----------------------------QRD--G.TW--------------------ATQPHNV.....ETF-------
G0R5U6_ICHMG/90-225A----------------------------IKY--G.IW--------------------TSVPQNN.....VKL-------
A8Q7N5_MALGO/580-845A----------------------------LRT--N.VW--------------------CTQPHNE.....PVL-------
K2RJ90_MACPH/420-620S----------------------------VRN--G.IW--------------------ATQSHNE.....DVL-------
B0WKC0_CULQU/163-301S----------------------------KTK--G.VW--------------------STLPPNE.....ANL-------
G0SA06_CHATD/570-705C----------------------------MED--G.IW--------------------TTQVQNG.....EIL-------
C5GU86_AJEDR/670-806A----------------------------KIE--G.TW--------------------ATQLKNV.....EKF-------
W1NMN5_AMBTC/178-314S----------------------------IEK--G.IW--------------------ATQVMNE.....QIL-------
V2WZC4_MONRO/526-864S----------------------------VEK--G.LW--------------------ATQKHNE.....GIL-------
T1ETR1_HELRO/308-446A----------------------------KAR--N.IW--------------------STPPQNE.....ARL-------
T1FX57_HELRO/6-141S----------------------------IKY--Q.IW--------------------CSTEYGN.....KRL-------
N1PF88_DOTSN/177-372S----------------------------LQT--G.TW--------------------ETQPHNQ.....RGF-------
A8NEN2_COPC7/474-610S----------------------------LKY--E.IW--------------------SSTDPGN.....KRL-------
A1CD65_ASPCL/281-513S----------------------------RQS--G.IW--------------------ATQSHNE.....VNL-------
A8QC89_MALGO/15-152S----------------------------LTH--G.VW--------------------ASTEKGN.....HRL-------
J5K4M9_BEAB2/397-598S----------------------------VKT--S.VW--------------------ATQSHNE.....HLL-------
G4U9D0_NEUT9/214-431S----------------------------VRT--K.VW--------------------ATQSHNE.....ETL-------
G9MVK2_HYPVG/4-139S----------------------------QRD--G.LW--------------------ITSETNG.....IRF-------
K7K544_SOYBN/67-203S----------------------------IEK--G.IW--------------------ATQIMNE.....PIL-------
K4CIR0_SOLLC/70-206S----------------------------VNR--G.IW--------------------ATQAMNE.....AIL-------
Q500V8_ARATH/330-468S----------------------------IKH--C.VW--------------------ASTKNGN.....KKL-------
D0MU40_PHYIT/31-168S----------------------------LKY--G.IW--------------------STTTMHN.....ALL-------
A0A0D2X8M3_FUSO4/186-387S----------------------------VST--G.IW--------------------ATQSHNE.....EAL-------
E0VFT2_PEDHC/270-407S----------------------------IKY--E.IW--------------------CSTEHGN.....KRL-------
A0A0C4ELE8_PUCT1/377-584S----------------------------VDR--S.IW--------------------VSQTHNE.....PVL-------
A0A023B4A3_GRENI/252-386S----------------------------VQR--G.IW--------------------ATGKNNQ.....EKL-------
Q2GU55_CHAGB/195-329S----------------------------AAH--D.VW--------------------TSSSRVN.....NML-------
W5KNU3_ASTMX/1266-1402S----------------------------QQR--S.IW--------------------STTPNNE.....HKL-------
A8JHY3_CHLRE/19-147S----------------------------VRT--G.AW--------------------ATTRTND.....PKL-------
M2YKU0_DOTSN/375-566S----------------------------VRN--G.IW--------------------ATQSHNE.....EAL-------
A0BI26_PARTE/40-178A----------------------------MKY--G.IW--------------------TSSSRKN.....ERL-------
K4B806_SOLLC/250-386S----------------------------VQQ--G.VW--------------------ATQRSNE.....AKL-------
A8NRM6_COPC7/377-678S----------------------------VKN--G.LW--------------------ATQKHNE.....LLL-------
Q5K6Y0_CRYNJ/435-735S----------------------------VRT--G.MW--------------------RTQQHNE.....PIL-------
C5YY10_SORBI/414-556G----------------------------IKY--N.VW--------------------ASTPNGN.....NKL-------
M0SQV1_MUSAM/439-577S----------------------------IKY--N.VW--------------------ASTPHGN.....KKL-------
F2UD73_SALR5/651-791S----------------------------VKY--N.IW--------------------TSTARGN.....GVL-------
M1WE61_CLAP2/348-546S----------------------------VRT--G.KW--------------------ATQSHNE.....KKL-------
G7DU39_MIXOS/711-847S----------------------------LKH--E.IW--------------------SSTELGN.....QRL-------
U4LEH5_PYROM/784-918A----------------------------QQD--C.IW--------------------ATQQKNA.....EIL-------
A0A068XD19_HYMMI/150-287A----------------------------KEN--N.AW--------------------STPVGNE.....HRL-------
F0VF22_NEOCL/53-196A----------------------------MQY--N.MW--------------------ATRPHND.....AIL-------
K7VKN2_MAIZE/372-514S----------------------------IKY--N.VW--------------------ASTPNGN.....KRL-------
A0EIT2_PARTE/53-193A----------------------------MKY--G.IW--------------------TSSSRKN.....ERL-------
G4VB52_SCHMA/567-702S----------------------------IKY--S.IW--------------------CSTELGN.....KKL-------
G2R1Z8_THITE/334-546S----------------------------VRN--N.TW--------------------ATQAHNE.....ERL-------
T1KJU9_TETUR/1-134S----------------------------KAK--G.VW--------------------STPPQNE.....HKL-------
D7KJU6_ARALL/231-373S----------------------------IKY--S.VW--------------------SSTINGN.....KKL-------
Q6CPT1_KLULA/113-254A----------------------------LQN--S.VW--------------------SSTRKGN.....RRL-------
G4MRQ6_MAGO7/382-591S----------------------------IKT--G.IW--------------------ATQAHNE.....KAL-------
H6BKA5_EXODN/395-603S----------------------------VVS--G.IW--------------------ATQAHNE.....EAL-------
M3ZSP2_XIPMA/204-342A----------------------------KAK--G.VW--------------------STLPVNE.....KKL-------
D7EHP9_TRICA/107-245S----------------------------KAK--G.VW--------------------STLPQNE.....ANL-------
D7TGT4_VITVI/456-598C----------------------------IKY--D.VW--------------------ASTPNGN.....KKL-------
M2MNT8_BAUCO/2-142A----------------------------QRD--S.LW--------------------ATQVHNE.....NLL-------
B4JYU7_DROGR/406-542S----------------------------IKY--E.IW--------------------CSTDHGN.....KRL-------
M2R5C6_CERS8/312-622S----------------------------VEK--G.LW--------------------ATQKHNE.....GIL-------
I2G755_USTH4/614-1021S----------------------------IET--G.YW--------------------ATQPHNE.....NVL-------
G2YI69_BOTF4/640-774C----------------------------IED--G.IW--------------------TTQAQNG.....PIF-------
M2LBF0_BAUCO/297-486S----------------------------VRN--G.IW--------------------ATQAHNE.....ETL-------
W5FHC2_WHEAT/473-609S----------------------------IKY--N.VW--------------------ASTPNGN.....RKL-------
B8M0U8_TALSN/418-647S----------------------------RRS--G.IW--------------------ATQTHNE.....AAL-------
I7ME02_TETTS/181-321A----------------------------QEQ--S.IF--------------------LI.HKNY.....EKL-------
B8NFL9_ASPFN/369-570S----------------------------RQS--G.IW--------------------ATQAHNE.....GNL-------
F7ADG8_MONDO/97-235A----------------------------KAR--G.IW--------------------STLPANE.....KKL-------
S9VPX4_SCHCR/340-468A----------------------------KKT--S.IW--------------------AVKHEAA.....SRV-------
B7GER0_PHATC/265-395S----------------------------TVQ--N.EW--------------------YLQRKHA.....QAM-------
A0E4N3_PARTE/17-156S----------------------------LNN--K.HI--------------------FIQRKFD.....KLI-------
I3K0G5_ORENI/1247-1379S----------------------------QQK--G.IW--------------------STTPSNE.....TKL-------
A0A0C4E4W3_MAGP6/566-701S----------------------------IKE--G.VW--------------------VTQSHNG.....KLL-------
Q4WG49_ASPFU/286-529S----------------------------RQS--G.IW--------------------ATQSHNE.....DNL-------
J3NGE7_GAGT3/571-706S----------------------------IKE--G.LW--------------------TTQPQNV.....KPL-------
Q23VX3_TETTS/28-165A----------------------------LQQ--S.IW--------------------ATTQKNE.....KAL-------
S3C8R4_OPHP1/452-730S----------------------------VRT--G.IW--------------------ATQSHNE.....QVL-------
A0D256_PARTE/42-168A----------------------------IKY--G.IW--------------------TSSSRNN.....QKL-------
A7ANQ1_BABBO/246-380S----------------------------ICY--G.IW--------------------ATGINNT.....AKL-------
K1WQI3_MARBU/640-774C----------------------------IQD--S.VW--------------------TTQVQNG.....HIF-------
N1RAN2_FUSC4/749-897S----------------------------VST--G.IW--------------------ATQSHNE.....EAL-------
M0SL27_MUSAM/525-663S----------------------------IKY--G.VW--------------------ASTSNGN.....KKL-------
I1KSN3_SOYBN/457-595S----------------------------IKY--N.VW--------------------ASTQNGN.....KKL-------
A5DC36_PICGU/83-220S----------------------------VEH--G.VW--------------------TSTDLGN.....KRL-------
E9HGQ0_DAPPU/1-135A----------------------------KSK--GCVW--------------------STPPQNE.....AKL-------
V5F1H8_PSEBG/297-702S----------------------------VET--G.YW--------------------ATQPHNE.....NVL-------
E0VS89_PEDHC/1201-1325S----------------------------ITK--E.TW--------------------NFAPNTE.....RRI-------
U1NTW9_ASCSU/150-282A----------------------------KER--S.FW--------------------TTSRHVE.....ESL-------
E7KM29_YEASL/155-291S----------------------------FYN--G.IW--------------------SSTHFGN.....KRL-------
M2ZLJ7_PSEFD/365-555S----------------------------VRN--G.TW--------------------ATQSHNE.....DGL-------
O77335_PLAF7/24-160S----------------------------LNY--N.IW--------------------ATTPKNE.....YKF-------
F0XUX5_GROCL/280-497S----------------------------MRT--G.IW--------------------ATQSHNE.....ETL-------
C3Y1F9_BRAFL/1604-1735A----------------------------MNQ--S.IW--------------------ATTPSNE.....KKL-------
K1QIA1_CRAGI/1268-1399A----------------------------LSN--S.VF--------------------ATTPKSE.....TKF-------
Q0CTW5_ASPTN/425-627S----------------------------RRS--G.VW--------------------ATQSHNE.....IAL-------
W5MRF3_LEPOC/1280-1411S----------------------------QQK--G.IW--------------------STTPSNE.....LKL-------
N1QE16_SPHMS/327-465S----------------------------VKA--S.RY--------------------SCMDKVS.....ERI-------
C1GVY0_PARBA/671-807A----------------------------KVE--G.TW--------------------ATQPKNI.....EKF-------
D5GAI5_TUBMM/941-1075A----------------------------QKD--E.LW--------------------ATQKKNS.....ETF-------
U4LG29_PYROM/546-681S----------------------------LKW--G.IW--------------------TSTDMGN.....KRL-------
A7TK77_VANPO/213-350S----------------------------FYN--G.IW--------------------SSTYFGN.....KRL-------
T1JES8_STRMM/1256-1387S----------------------------LIR--G.VW--------------------AFTPSTE.....RKL-------
F1NS70_CHICK/1295-1426S----------------------------QQK--G.IW--------------------STTPSNE.....QKL-------
F8QD12_SERL3/161-493S----------------------------VEE--G.LW--------------------ATQTHNE.....GIL-------
I2GVC1_TETBL/450-593S----------------------------FYN--G.IW--------------------SSTFFGN.....KRL-------
B4J3H0_DROGR/281-419S----------------------------KNK--N.VW--------------------ATLPQND.....ANL-------
F4R3K9_MELLP/487-752S----------------------------VER--S.VW--------------------ASQSHNE.....PIL-------
G2Q1Z5_THIHA/160-391S----------------------------VRT--K.TW--------------------ATQSHNE.....ETL-------
T1JB38_STRMM/305-440S----------------------------IKY--G.IW--------------------CSTEHGN.....KRL-------
G0W470_NAUDC/181-318S----------------------------FYN--G.IW--------------------SSTHFGN.....KRL-------
D5GNV8_TUBMM/529-729S----------------------------VRN--R.IW--------------------ATQSHNE.....STL-------
F0X9L9_GROCL/466-601A----------------------------MAD--G.VW--------------------TTQLKNE.....ELL-------
I1FS50_AMPQE/319-455S----------------------------IKY--N.VW--------------------CSTDHGN.....RRL-------
A0C791_PARTE/169-302A----------------------------KTH--D.VW--------------------ATTRRNF.....GTL-------
U1GGT6_ENDPU/374-579S----------------------------VCN--G.SW--------------------ATQTQNE.....AAL-------
F2U4B6_SALR5/26-157S----------------------------QQH--D.LW--------------------ATPKRNM.....SKL-------
Q0UXB1_PHANO/123-324S----------------------------VRN--G.IW--------------------ATQSHNE.....DVL-------
M3D6T2_SPHMS/5-146A----------------------------QRT--N.VW--------------------ATQEKNE.....EML-------
J4IAX7_FIBRA/582-930S----------------------------VEK--G.LW--------------------ATQRHNE.....TTL-------
R9PLK4_PSEHS/830-1245S----------------------------IET--G.YW--------------------ATQPHNE.....SVL-------
K3WL53_PYTUL/60-197S----------------------------LKY--G.IW--------------------SSTYAHN.....MQL-------
MMI1_SCHPO/350-477A----------------------------KKT--S.IW--------------------AVKKDSS.....KRI-------
F4RX17_MELLP/35-171S----------------------------LKY--E.IW--------------------ASTDLGN.....KRL-------
G0T2B8_RHOG2/670-1019S----------------------------VET--G.VW--------------------ATQPHNE.....PVL-------
K5VXL5_PHACS/571-840S----------------------------VEK--G.LW--------------------ATQRHNE.....GIL-------
S8AI65_DACHA/477-669S----------------------------VSN--G.IW--------------------ATQTHNE.....PAL-------
J9JSF7_ACYPI/99-234A----------------------------KIK--N.CW--------------------STRPWNE.....TKL-------
A0A0D1E4L6_USTMA/726-863S----------------------------LKY--E.IW--------------------ASTDKGN.....QRL-------
U5HCN5_USTV1/575-723S----------------------------IRS--G.LW--------------------STQGHNE.....DVL-------
M7X3Z8_RHOT1/666-1012S----------------------------VET--G.VW--------------------ATQPHNE.....PVL-------
S7ZRN7_PENO1/422-658S----------------------------RYS--G.IW--------------------ATQTHNE.....VNL-------
A0A068YDE4_ECHMU/401-537S----------------------------IKY--S.IW--------------------CSTEAGN.....KKL-------
M3AKS3_PSEFD/271-466S----------------------------LQK--G.TW--------------------ETQPHNQ.....TLL-------
S8EIQ3_FOMPI/603-928S----------------------------VKE--G.LW--------------------ATQKHNE.....MTL-------
H3GWX4_PHYRM/253-395A----------------------------VHF--G.KW--------------------AVPAEVL.....QQV-------
A7E4D0_SCLS1/650-784C----------------------------IED--G.VW--------------------TTQAQNG.....PIF-------
G0RBB9_HYPJQ/259-394S----------------------------QRD--G.LW--------------------ITKAKNG.....SLF-------
B2ARG7_PODAN/13-148C----------------------------MED--N.IW--------------------TTQAKNS.....STF-------
M1CBM7_SOLTU/322-464C----------------------------VKY--D.VW--------------------SSTPNGN.....KKL-------
C5DJE4_LACTC/115-250S----------------------------TKN--G.VW--------------------SSTELGN.....RRL-------
E9CW19_COCPS/506-642S----------------------------QHE--G.TW--------------------STQVKNI.....DKL-------
A2R166_ASPNC/418-622S----------------------------RQN--N.IW--------------------ATQTHNE.....KQL-------
A0A023B246_GRENI/12-144S----------------------------QRH--G.VW--------------------ATTSRNE.....KTL-------
K1V256_TRIAC/598-935S----------------------------VKT--G.QW--------------------KTQRHNQ.....PIL-------
H2AVY0_KAZAF/114-253S----------------------------FDN--G.IW--------------------SSTHYGN.....KRL-------
U9SY90_RHIID/16-149S----------------------------VKS--G.YW--------------------ATQPHNE.....AAL-------
D7FPL2_ECTSI/246-375S----------------------------AVQ--N.KW--------------------YARRFNI.....MPF-------
M3AKK0_PSEFD/1-137A----------------------------QRE--G.VW--------------------ATQEKNE.....QLL-------
G4V1D5_NEUT9/504-639A----------------------------MDD--A.IW--------------------VTQTSNE.....EKF-------
M4BLQ1_HYAAE/253-395A----------------------------VHH--G.QW--------------------TVPAHVL.....QSI-------
E3L1K1_PUCGT/165-453S----------------------------VDR--S.IW--------------------VSQAHNE.....PIL-------
Q8ILQ1_PLAF7/371-505S----------------------------ILY--G.VW--------------------ATGKNNT.....RKF-------
S3CZX6_GLAL2/392-590S----------------------------VRN--G.IW--------------------ATQSHNE.....QAL-------
D7KVZ9_ARALL/316-458S----------------------------IKY--N.VW--------------------SSTLNGN.....KKL-------
K3WDK3_PYTUL/256-398S----------------------------VHH--N.QW--------------------TAPKEIQ.....KQL-------
C1G9S2_PARBD/356-556S----------------------------RIS--G.VW--------------------ATQRHNE.....SAL-------
A7ANR0_BABBO/25-162A----------------------------LIH--N.VW--------------------ATTPKNE.....VIL-------
V5I0K1_BYSSN/496-699S----------------------------RQS--G.VW--------------------ATQTHNE.....ATL-------
C8V3R8_EMENI/419-625S----------------------------WQS--G.IW--------------------ATQTHNE.....ESL-------
G8JU51_ERECY/138-279S----------------------------FQH--S.VW--------------------TSTKRGN.....KRL-------
U5H5H6_USTV1/766-1126S----------------------------VER--S.LW--------------------ATQSHNE.....PIL-------
J9K832_ACYPI/334-468S----------------------------IKY--E.IW--------------------CSTDHGN.....RRL-------
S3CNK2_OPHP1/560-695A----------------------------MED--N.LW--------------------STSQSNG.....DIL-------
D8QT35_SELML/2-137S----------------------------IKY--G.VW--------------------ASTPNGN.....KRL-------
A0D629_PARTE/49-182G----------------------------MKY--G.VW--------------------TSTPKSN.....ARI-------
A9USV5_MONBE/253-383G----------------------------ETA--S.RW--------------------TLVTTVV.....RKL-------
F9X648_ZYMTI/3-143A----------------------------QRS--S.VW--------------------STQTKNE.....TLL-------
G2QHR3_THIHA/207-342C----------------------------MED--C.LW--------------------TTQIPNA.....EVL-------
Q6C164_YARLI/197-381S----------------------------REN--S.LW--------------------STQSHNE.....AML-------
A0A068Y5Q0_ECHMU/21-159A----------------------------KKK--N.AW--------------------STPIGNE.....SRL-------
Q4UE68_THEAN/26-159A----------------------------IEY--D.VW--------------------GTRSSVQ.....RTL-------
N1PQZ2_DOTSN/317-457S----------------------------IRI--G.KY--------------------SVMRKVA.....DRI-------

PF01878

P74098_SYNY3/2-139E----------------------------QEE--L-PW--------------------LVTRY..........-------
Q9WWK9_SYNP2/2-141E----------------------------QTE--M-PW--------------------LVTRY..........-------
A6BZ09_9PLAN/29-165H----------------------------LDH--F-CW--------------------SVNQH..........-------
A7I926_METB6/3-143T----------------------------RME--S-GW--------------------.PIRQ.........Q-------
A3JN92_9RHOB/3-135S----------------------------AKS--V-GF--------------------VALSH...GKKSAVS-------
A8LMB8_DINSH/3-149A----------------------------NGV--C-LF--------------------SGGKA.......AAV-------
A1U8X5_MYCSK/2-132R----------------------------AVR--G-RF--------------------TQANH...GKPQALR-------
YOUG_BACLI/5-143K----------------------------GVS--G-GF--------------------AQLCH...GKEAPLK-------
A6EIT2_9SPHI/6-138T----------------------------GIA--E-GI--------------------AQTCH...GKASPLK-------
YDCG_BACSU/4-136K----------------------------GAA--G-GF--------------------AQLCH...GKKAPLA-------
A5CUD6_CLAM3/3-135.----------------------------..D--L-GI--------------------AQVNR....GAREPV-------
Y1062_HELHP/2-131I----------------------------GQA--G-GF--------------------CQLCH...GKAAPLK-------
Y442_STRMU/3-132R----------------------------GVD--G-GF--------------------CQVCH...GKGGPLR-------
Y254_STRSV/3-132R----------------------------GVE--G-GF--------------------CQVCH...GKKAPLN-------
A0A0A8UTV7_LEGHA/3-136I----------------------------GVE--G-EF--------------------MQVCH...GKLAPLK-------
A1WQL9_VEREI/5-137R----------------------------GEQ--G-GF--------------------CQVCH...GKRAPLA-------
Q2KBY7_RHIEC/3-135I----------------------------GRE--A-GF--------------------MQVCH...GKAAPLK-------
Y8638_RHILO/3-120R----------------------------GRN--D-GF--------------------MQVNH...GKAAPLR-------
Y3206_RHILO/3-137R----------------------------GRN--D-GF--------------------MQVNH...GKAAPLR-------
Q2GIJ6_ANAPZ/5-132A----------------------------VCV--T-TW--------------------DGVKN...YQAQGNL-------
Q73H50_WOLPM/2-129K----------------------------EQV--V-EW--------------------DGVRN...YQAQNYM-------
Q2GF45_EHRCR/2-130R----------------------------DNV--T-VW--------------------DNVLN...YQAQNYL-------
Q5FGQ0_EHRRG/2-130R----------------------------SNI--T-VW--------------------DNVLN...YQAQGYL-------
Q024K9_SOLUE/2-130R----------------------------DQE--T-VW--------------------DGVTN...PQAVRAI-------
Q5KKF6_CRYNJ/7-162.----------------------------.RV--S-PW--------------------DGVRN...HEAKKIM-------
B4U7S2_HYDS0/2-128K----------------------------EGK--T-VW--------------------DGVKN...PLAQKFI-------
Q1D7F1_MYXXD/5-135K----------------------------DGK--T-EW--------------------TGVRN...FEARNNI-------
Q7S515_NEUCR/88-252R----------------------------TSP--E-PW--------------------DGIRN...YSARNNL-------
Q0U623_PHANO/118-277C----------------------------TVP--E-PW--------------------GGVRN...PQARNNM-------
Q0CLU5_ASPTN/109-262R----------------------------TKP--E-PW--------------------D.........ARNNM-------
Q7NK15_GLOVI/2-148A----------------------------DGT--T-DW--------------------SGVRN...YQARNFM-------
Q4E145_TRYCC/13-158K----------------------------SGC--S-PW--------------------DGVRN...YAARNNM-------
Q4Q067_LEIMA/12-157K----------------------------QKT--S-PW--------------------DGVRN...YAARNNM-------
Q1QBK5_PSYCK/2-150G----------------------------AGT--E-MW--------------------DGVRN...YRARNFM-------
THYN1_HUMAN/55-219P----------------------------KQT--T-CW--------------------DGVRN...YQARNFL-------
Q6MNE3_BDEBA/2-149K----------------------------DKT--T-WW--------------------TGVRN...YQARNFM-------
Q4K403_PSEF5/2-148Q----------------------------LGQ--A-RW--------------------DGVRN...YQARNFL-------
A4B9S6_9GAMM/2-149G----------------------------SDG--E-PW--------------------NGIRN...YQARNFL-------
A0YIC7_LYNSP/2-148Q----------------------------EKS--C-IW--------------------DGVRN...YQARNFL-------
Q10WF5_TRIEI/2-148Q----------------------------EKN--C-IW--------------------DGVRN...YQARNFL-------
Q8YY67_NOSS1/2-148K----------------------------DNQ--T-IW--------------------DGVRN...YQARNFM-------
Q5SK57_THET8/2-146R----------------------------EGR--A-IW--------------------DGVRN...YQARNYL-------
Q2JN10_SYNJB/2-148R----------------------------EGQ--T-LW--------------------DGVRN...YQARNYL-------
P74153_SYNY3/2-148A----------------------------EGE--T-LW--------------------DGVRN...YQARNFL-------
Q31PN6_SYNE7/2-148R----------------------------EGE--T-LW--------------------DGVRN...YQARNFL-------
A2BYF2_PROM5/5-151R----------------------------DGV--T-LW--------------------DGIRN...YQARNFM-------
A5GV42_SYNR3/7-153A----------------------------EQT--T-LW--------------------DGIRN...YQARNFM-------
Q7V5V1_PROMM/7-153K----------------------------EGS--T-LW--------------------DGIRN...YQARNFM-------
Q7VA84_PROMA/7-153N----------------------------EKE--T-LW--------------------DGIRN...YQARNFM-------
Q46J77_PROMT/7-153K----------------------------EEE--T-LW--------------------DGIRN...YQARNFM-------
A4CF59_9GAMM/2-149E----------------------------KNT--A-DW--------------------EGVRN...YQARNFL-------
Q080Z6_SHEFN/2-151E----------------------------QQT--V-AW--------------------QGIRN...YQARNYI-------
M6BZG6_LEPBO/2-151P----------------------------SRI--A-PW--------------------EGVRN...YQARNFL-------
Q7UMR5_RHOBA/2-156P----------------------------EQI--T-CW--------------------EGVRN...YQARNLL-------
A6G9B9_9DELT/7-159R----------------------------DGQ--E-PW--------------------DGVRN...YQARNSM-------
Q1IWR4_DEIGD/15-161R----------------------------LGR--E-PW--------------------NGVRN...YQARNFL-------
Q21FZ3_SACD2/2-148R----------------------------DKT--T-VW--------------------NGIRN...YQARNFL-------
A3ZLP5_9PLAN/16-165K----------------------------KQT--T-FW--------------------SGVRN...YQARNFM-------
Q3A4Z6_PELCD/6-155P----------------------------DGI--S-PW--------------------DGVRN...YQARNLL-------
B3E7D4_GEOLS/2-150P----------------------------NAT--E-QW--------------------DGVRN...FQARNFL-------
Q74AS6_GEOSL/6-154P----------------------------NGT--E-HW--------------------DGVRN...FQARNLL-------
A1ATY5_PELPD/2-150P----------------------------NMT--E-PW--------------------DGVRN...FQARNYL-------
Q312I8_DESAG/2-150P----------------------------EQT--T-PW--------------------DGVRN...YQARNFM-------
Q1MR11_LAWIP/2-150P----------------------------NQT--T-SW--------------------DGVRN...YQARNFM-------
Q729D5_DESVH/2-149P----------------------------DAT--S-SW--------------------DGVRN...YQARNFM-------
A1U5E7_MARHV/2-150P----------------------------EGV--I-PW--------------------DGVRN...YQARNFL-------
A6VZD9_MARMS/3-149R----------------------------LKH--S-PW--------------------DGVRN...YQARNFM-------
A0XX89_9GAMM/2-150P----------------------------NQT--T-LW--------------------EGVRN...YQARNFL-------
Q15ZW9_PSEA6/6-155P----------------------------EQT--E-HW--------------------DGIRN...YQARNFL-------
Q2SNU3_HAHCH/2-150P----------------------------DGV--S-GW--------------------DGVRN...YQARNFM-------
Q2C4F7_9GAMM/2-148L----------------------------QKV--S-PW--------------------EGVRN...YQARNML-------
A7K5A8_VIBAE/2-149T----------------------------QKV--S-CW--------------------EGVRN...YQARNMM-------
Q143L8_BURXL/2-150S----------------------------KQT--A-PW--------------------TGIRN...YQARNFL-------
B7WUP3_COMTE/10-158P----------------------------GQT--I-AW--------------------NGVRN...YQARNFM-------
Q7P0R4_CHRVO/4-152P----------------------------ARL--F-EW--------------------TGVRN...YQARNFM-------
Q129F1_POLSJ/2-150P----------------------------KAT--V-PW--------------------VGVRN...YQARNFM-------
A6SVM1_JANMA/2-150P----------------------------KRT--V-AW--------------------TGVRN...YQARNFM-------
A3RRU2_RALSL/81-227T----------------------------EGT--L-PW--------------------TGVRN...YQARNFM-------
B2JES7_BURP8/2-150P----------------------------QRT--L-PW--------------------TGVRN...YQARNFM-------
Q82TJ8_NITEU/2-150P----------------------------GQT--V-PW--------------------DGVRN...YQARNFM-------
Q478H8_DECAR/2-148R----------------------------NGT--V-PW--------------------FGVRN...YQARNFM-------
Q0HU59_SHESR/2-151P----------------------------NQT--E-AW--------------------FGIRN...YQARNFM-------
B4SI17_STRM5/6-155K----------------------------VKV--E-PW--------------------NGVRN...YQARNFM-------
Q83BN8_COXBU/2-151K----------------------------NKI--T-RW--------------------DGVRN...YQARNFM-------
A1WW93_HALHL/2-151P----------------------------QGT--D-RW--------------------DGVRN...YQVRNMI-------
Q60BW0_METCA/2-151P----------------------------AQT--E-PW--------------------DGVRN...YQARNMM-------
Q0A5L0_ALKEH/2-151P----------------------------DQI--E-PW--------------------DGVRN...YQARNMM-------
A4BS86_9GAMM/2-151P----------------------------SQT--D-HW--------------------EGVRN...YQARNML-------
Q1K2S0_DESAC/2-151P----------------------------EQT--E-HW--------------------DGVRN...YQARNMM-------
A0RTQ4_CENSY/6-139K----------------------------DKK--T-VW--------------------DGVRN...NLALKHI-------
A9A4S8_NITMS/3-136K----------------------------DKT--T-VW--------------------DGVHN...NLALKHM-------
Q2IM08_ANADE/10-138A----------------------------DGT--T-PW--------------------TGVAN...PQAQANL-------
A9AWV2_HERA2/2-132R----------------------------DGS--T-VW--------------------NGVTN...AQALINL-------
B8GCZ0_CHLAD/3-133R----------------------------EGR--T-VW--------------------DGVEN...TVALKHL-------
A0ZBN7_NODSP/2-132Q----------------------------DGS--T-VW--------------------DGVNN...ALALKHL-------
A2XKL1_ORYSI/18-161G----------------------------GGV--A-PW--------------------DGVRN...RQAVNGL-------
Q1N713_SPHSS/19-149A----------------------------KGQ--A-EW--------------------DGVRN...HAAQGHM-------
A5V5W6_SPHWW/16-146R----------------------------DGR--T-VW--------------------DGVRN...NAAALHL-------
A3HZ69_9BACT/9-137K----------------------------AKE--D-IW--------------------DGVRN...YQARNFL-------
Q1GUB4_SPHAL/4-135K----------------------------DGT--G-IW--------------------DGVRN...HTAKLNL-------
Q2G8P8_NOVAD/13-143A----------------------------EGE--G-TW--------------------DGVRN...HLAARNL-------
Q2NBR4_ERYLH/3-133A----------------------------EGE--G-VW--------------------DGVRN...HRAKNNL-------
A3W9K5_9SPHN/3-133A----------------------------EEE--G-TW--------------------DGVRN...HSAKLNL-------
Q1V170_PELUQ/2-134G----------------------------AKG--A-PW--------------------DGVRN...YQAAKNL-------
A6EJQ3_9SPHI/2-132E----------------------------DGR--T-FW--------------------DGVRN...YQARNNL-------
Q11YZ0_CYTH3/2-132A----------------------------DKK--T-FW--------------------DGVRN...YQARNNL-------
A5G2F8_ACICJ/2-132A----------------------------NGV--E-PW--------------------TGVRN...HAARNNL-------
Q5FQF2_GLUOX/2-132D----------------------------HGV--E-PW--------------------TGVRN...YQARNNL-------
Q2RNC8_RHORT/2-132D----------------------------KGI--E-HW--------------------DGVRN...HQASNHM-------
A4TWZ7_9PROT/2-132R----------------------------DGV--T-AW--------------------TGVRN...YQASNFL-------
A7HSS8_PARL1/2-134G----------------------------AKG--E-PW--------------------NGVRN...YQANNNM-------
Q0C4X5_HYPNA/2-134G----------------------------EAG--E-IW--------------------SGVRN...YTARNHM-------
Q0G4A9_9RHIZ/2-134G----------------------------EAG--Q-EW--------------------DGVRN...YQARNFM-------
Q2K3E0_RHIEC/2-135G----------------------------DKG--T-EW--------------------TGVRN...YLARNNM-------
Q98EI4_RHILO/2-134G----------------------------KAG--T-QW--------------------DGVRN...YAARNNM-------
Q8KZ39_9PROT/2-134G----------------------------AVG--E-EW--------------------DGVRN...YQARNNM-------
A3JM70_9RHOB/2-134G----------------------------DIG--E-EW--------------------DGVRN...YQARNFM-------
A4EH47_9RHOB/9-141G----------------------------EAG--E-EW--------------------DGVRN...YQARNNM-------
B0UCG1_METS4/2-134G----------------------------EAG--T-FW--------------------NGVRN...HLAKKHL-------
E0TE14_PARBH/2-135G----------------------------EAG--E-PW--------------------DGVRN...HQAKNYM-------
A7IEB4_XANP2/28-160G----------------------------AKG--T-HW--------------------DGVRN...HLAKQQL-------
Q13DX9_RHOPS/2-134G----------------------------AKG--E-AW--------------------TGVRN...HSAKLHM-------
A6EMU5_9BACT/174-313A----------------------------AHL--K-SW--------------------KVAAH..........-------
Q8ZZI9_PYRAE/3-147R----------------------------VVE--L-GL--------------------YGLPA....SVAEMA-------
A4WL01_PYRAR/3-147.----------------------------...--R-GI--------------------YGLPE....GAGDEA-------
A3CVK7_METMJ/19-161.----------------------------RKK--N-IW--------------------.GVPQ....RNKSII-------
Q2FT29_METHJ/14-155.----------------------------KKH--N-IW--------------------.GVPK....RSKGLH-------
Q2FP01_METHJ/2-143.----------------------------RNN--D-IW--------------------.GVPK....RNKSLL-------
A6UNC0_METVS/2-141.----------------------------KEK--K-IW--------------------.GVSK....KYQNTI-------
A6VFA8_METM7/22-163.----------------------------KDK--K-VW--------------------.GVSE....MYKNTI-------
Y1033_PYRHO/2-143.----------------------------KRH--N-VW--------------------.GVPK....KHKNTL-------
Y875_PYRAB/2-141.----------------------------KEK--N-VW--------------------.GVPR....RHENTM-------
Y2356_ARCFU/2-145.----------------------------KEK--N-IW--------------------.GVPE....RHKNTI-------
Y3536_METJA/2-144.----------------------------KEK--K-IW--------------------.GVAE....RYKNTI-------
Q4JC14_SULAC/2-142.----------------------------SSL--N-VF--------------------.GHNK......ERAT-------
A4YGW0_METS5/2-141.----------------------------...--.-QY--------------------DGV.....YGYKTNL-------
Y2595_SULSO/2-141.----------------------------...--.-MW--------------------DVIRDKGIYGYKENL-------

PF12961

B0T870_CAUSK/4-75-----------------------------YFA..A-VR--------------------SGKKRFE-------I-------
R9TBY5_9EURY/3-77-----------------------------YFE..A-VV--------------------IGAKTFE-------L-------
A2SN47_METPP/13-94-----------------------------AFD..S-VA--------------------RGLKTVE-------I-------
R6E210_9FIRM/7-77-----------------------------YFD..A-VE--------------------SRQKNFE-------I-------
J9RHJ8_9ACTN/3-74-----------------------------WYY..H-VR--------------------DLTKNVE-------I-------
R5Y974_9FIRM/3-77-----------------------------YFG..S-VR--------------------NGEKTFE-------V-------
R7BMW7_9FIRM/17-92-----------------------------FAN..A-II--------------------TGDKNFE-------I-------
D3UZP9_XENBS/15-94-----------------------------HFNFMA-VV--------------------DGDRKTA-------F-------
X2H0U5_9BACI/244-319-----------------------------QFE..A-IL--------------------QGLKTFM-------C-------
R6TFC5_9FIRM/329-401-----------------------------DYE..D-VI--------------------SGKKSFE-------L-------
R5F6I4_9CLOT/7-75-----------------------------YFR..V-VR--------------------ARKKNFE-------I-------
A7MEP6_CROS8/3-73-----------------------------HFI..P-VL--------------------EGVKLAE-------L-------
M9SC14_9EURY/4-81-----------------------------FFQ..A-VV--------------------DGRKTFE-------L-------
K8EIC3_CARML/4-76-----------------------------YFE..A-VK--------------------DGRKKFE-------I-------
W8FAL7_9BACT/20-95-----------------------------CFA..A-VE--------------------TGAKPFD-------V-------
R5KJ01_9CLOT/4-86-----------------------------FCD..A-VL--------------------SGEKPFE-------I-------
A6LYH9_CLOB8/3-77-----------------------------NYK..V-IR--------------------DGSKTFE-------L-------
R9VFQ2_9ENTR/5-83-----------------------------HFR..D-VL--------------------LGIKKAE-------F-------
F0LNE9_VIBFN/7-81-----------------------------HFI..E-VL--------------------AGRKTHE-------V-------
R6T3D1_9FIRM/130-204-----------------------------FCE..A-VV--------------------TGKKCFE-------I-------
B2TNZ8_CLOBB/5-89-----------------------------YFS..D-VV--------------------SGKKIFE-------L-------
D4MVL8_9FIRM/411-483-----------------------------FFD..A-VD--------------------TGNKSFE-------L-------
R9TAF8_9EURY/14-88-----------------------------DFE..Q-AI--------------------TGIKNFE-------Q-------
A8E2L6_BPPHE/105-175-----------------------------YFK..A-VK--------------------EGRKLFE-------I-------
A8FAI2_BACP2/6-76-----------------------------YLW..A-IK--------------------TGIKGFE-------I-------
Q8CWZ2_STRMU/4-76-----------------------------FFD..D-VA--------------------SGRKNFE-------L-------
Q832V0_ENTFA/113-183-----------------------------YFE..A-VV--------------------SGDKRFE-------I-------
W8FCI0_9BACT/21-96-----------------------------CFA..A-VE--------------------AGTKPFD-------V-------
K8E4A8_CARML/4-76-----------------------------FFE..A-VK--------------------DGRKKFE-------I-------

PF04266

Q7PS17_ANOGA/408-520....--....-------------------WAS--L-LV--------------------AGIKRHE-......G-------
Q1Z8F3_PHOPR/9-107....--....-------------------FES--D-IL--------------------SSKKTIT-......I-------
O59345_PYRHO/1-111....--....-------------------YKS--K-VI--------------------SGKKVTT-......I-------
Q669U5_YERPS/14-127....--.ADE-------------------LLA--L-VL--------------------NGTKTAT-CA..AL.-------
O28749_ARCFU/4-103....--....-------------------FVE--R-II--------------------NGEKITT-......V-------
Q57H41_SALCH/24-141....--.ADE-------------------LAA--L-VV--------------------AGKKRGT-CSSLVSY-------
Q2P9X4_BPP2/8-81....--....-------------------YFD--L-VL--------------------EGKKRAE-......F-------
B9WV89_STRSU/24-154....--..DR-------------------LAD--L-VA--------------------RGIKTST-SSAHALY-------
B1YID4_EXIS2/5-113....--....-------------------PFH--S-IQ--------------------TGKKVIE-......I-------
Q1ZT49_PHOAS/30-153....--.ANL-------------------CAD--L-IL--------------------RGEKRAS-CSLEVWY-------
Q82ZD1_ENTFA/26-150....--MGNR-------------------LGQ--L-VV--------------------SGRKTAT-CSSLDIY-------
Q3EQG9_BACTI/8-116....--....-------------------PFQ--S-IQ--------------------SGKKVYE-......V-------
Q5WBH3_BACSK/27-150....--.ADE-------------------LAE--L-VL--------------------AGKKTAT-SSNYTLY-------
Q8ZYT1_PYRAE/11-109....--....-------------------YLE--G-IL--------------------DGKKRVT-......V-------
Q666W1_YERPS/141-216....--....-------------------YFQ--S-VI--------------------EGRKKAE-......L-------
Q8ZVS1_PYRAE/5-102....--....-------------------YVK--A-LL--------------------DGRKRST-......I-------
A6TNT9_ALKMQ/35-158....--.ANE-------------------LAE--L-VL--------------------KGIKRAT-ASLYDGY-------
Q8A7V1_BACTN/8-125....--..DE-------------------LAD--K-VL--------------------SGEKTAT-SS.LYDY-------
TRIP4_HUMAN/437-549....--....-------------------WAS--L-LV--------------------RGIKRVE-......G-------
B7MCE4_ECO45/27-144....--.ADH-------------------LAT--L-IA--------------------TGVKTAS-CG.SLAG-------
Q5SM30_THET8/8-102....--....-------------------YAS--L-IV--------------------DGRKVWE-......I-------
Q8G683_BIFLO/18-143....--..DR-------------------LVK--L-IL--------------------DGVKTAT-AALMIEY-------
Q28T99_JANSC/34-145....--....-------------------LLA--L-VR--------------------KGVKRAT-CTAMADV-------
Q1Z8W3_PHOPR/30-153....--.ANL-------------------CAE--L-IR--------------------IGQKTAT-CSLNVWY-------
Q38XJ8_LACSS/28-150....--.ANE-------------------LAV--L-VI--------------------SSQKTAT-TLAIDLY-------
Q74J94_LACJO/27-149....--.ADE-------------------LAD--L-VN--------------------RRIKTAT-TSAYEFY-------
O59585_PYRHO/4-98....--....-------------------YAN--W-IV--------------------EGKKVWE-......I-------
Y1447_PASMU/6-104....--....-------------------FEQ--D-IL--------------------AGRKTIT-......I-------
Q3M1U7_ANAVT/4-110....--....-------------------WAW--A-II--------------------CANKNIE-......N-------
Q8TY14_METKA/239-342....--....-------------------YLN--L-IK--------------------EGKKTVE-......G-------
Q4DDP1_TRYCC/470-580....--....-------------------WAG--L-LV--------------------SGIKFHE-......G-------
Q8TV24_METKA/9-109....--....-------------------YRD--K-LL--------------------RGEKRAT-......I-------
Q4SHG6_TETNG/424-545....--....-------------------WAS--L-LV--------------------RGIKRVE-......G-------
Q5FJH1_LACAC/26-145....--.ADI-------------------LSD--L-IN--------------------RKIITAT-TS.VYD.-------
Q8LGK4_ARATH/109-212....--....-------------------YFT--Q-LK--------------------DGLKTVE-......G-------
O28463_ARCFU/4-98....--....-------------------YAK--A-LI--------------------EGRKRLT-......I-------
Q39AD2_BURL3/6-102....--....-------------------AVD--D-IV--------------------AGRKQVE-......I-------
Q49VC6_STAS1/27-147....--..DE-------------------LAN--L-VK--------------------QGEKTAT-TSGYETY-------
O58093_PYRHO/5-109....--....-------------------YIE--L-IK--------------------AGKKKIE-......G-------
Q8DSX1_STRMU/61-181....--..DQ-------------------LAQ--L-VL--------------------KGVKTAT-ASAYDLY-------
Q97KB9_CLOAB/33-156....--.ANN-------------------LAD--L-VM--------------------KGTKRGT-TSLYYFY-------
Q29GM2_DROPS/388-499....--....-------------------WAS--L-LV--------------------AGIKKHE-......G-------
YO91_BPP2/8-81....--....-------------------YFD--L-VL--------------------EGKKRAE-......F-------
Q8ES55_OCEIH/29-152....--.ADG-------------------LAK--L-VL--------------------EGKKTAT-SSSYRNY-------
Q74MN0_NANEQ/4-103....--....-------------------YKD--L-II--------------------SGKKVAT-......I-------
A0A0B8RBU5_LISMN/29-152....--.ANE-------------------LGG--L-VM--------------------DGIKTGT-SSLFYWY-------
Q5JIS1_THEKO/5-129....--....-------------------YAE--L-IF--------------------RGLKTVE-......L-------
Q57UA7_TRYB2/469-579....--....-------------------WAG--L-LV--------------------AGIKVHE-......G-------
Q9KEN6_BACHD/5-112....--....-------------------PFE--S-IK--------------------AGRKTVE-......V-------
Y1576_VIBCH/7-105....--....-------------------LTP--L-VA--------------------SGQKTIT-......I-------
Q6DAK1_PECAS/16-132....--.ADE-------------------LLQ--L-VR--------------------EGHKTAS-CG..SYH-------
Q8DQF2_STRR6/24-144....--..DL-------------------LAD--L-VF--------------------KGEKTAT-ASAYDLY-------
Q7Y1E7_ORYSJ/14-135....--....-------------------WAS--L-LV--------------------HGIKRVE-......G-------
A5VL14_LACRD/4-98....--....-------------------YGM--E-IL--------------------SGTKTEE-......Y-------
Q5JEH0_THEKO/6-109....--....-------------------YLN--F-IR--------------------SGEKRIE-......V-------
F8Y0N6_STRAG/6-81....--....-------------------YFE--A-IM--------------------DGTKTFE-......C-------
Q5JHR0_THEKO/9-103....--....-------------------YAT--L-IV--------------------EGEKVWE-......I-------
Q6FET4_ACIAD/8-104....--....-------------------SGT--R-IA--------------------QGLKTLE-......V-------
Y267_MORMI/5-104....--....-------------------LER--S-IL--------------------SGNKTAT-......I-------
Q9AA41_CAUCR/6-84....--....-------------------YFA--A-VR--------------------AGQKRFE-......I-------
Q6MN09_BDEBA/6-102....--....-------------------NGT--R-IA--------------------NGEKIIE-......V-------
Q9CH09_LACLA/21-146TEPE--LADK-------------------LLD--L-VL--------------------EGKKSAT-ASAVAEY-------
Q5JEG9_THEKO/4-104....--....-------------------YAE--D-IL--------------------RGKKRAT-......V-------
Q8TYL3_METKA/4-109....--....-------------------FFD--L-IT--------------------EGLKTAE-......I-------
O58177_PYRHO/25-125....--....-------------------YKD--D-II--------------------SGKKKAT-......I-------
Q6ZM46_DANRE/402-514....--....-------------------WAS--L-LV--------------------KGIKRVE-......G-------
Q6F0Z5_MESFL/5-88....--....-------------------YFD--L-IK--------------------TGKKKYE-......Y-------
A9VQI1_BACWK/25-145....--..DY-------------------LAQ--L-VI--------------------DGVKTAT-CSGHIFY-------
Q5JEL3_THEKO/6-109....--....-------------------YLR--A-IA--------------------EGKKKIE-......G-------
O86782_STRCO/58-183....--..DR-------------------LVA--A-VL--------------------DGSKTST-TGLVADY-------
Q4QIG2_LEIMA/490-600....--....-------------------WAS--L-LV--------------------AGIKRHE-......G-------
O58178_PYRHO/7-110....--....-------------------YLE--M-VK--------------------SGKKRIE-......V-------
Q1WTR7_LACS1/28-149....--.ADY-------------------IAD--L-VK--------------------NGIKTAT-SSALELY-------
Q53LS7_ORYSJ/126-229....--....-------------------YFT--Q-LR--------------------AGTKKVE-......G-------
Q5JG45_THEKO/12-113....--....-------------------YKS--R-IL--------------------RGDKVTT-......I-------
Y2524_SHEB5/6-104....--....-------------------FEH--D-IL--------------------SGAKTIT-......L-------
Y1394_HAEIN/6-104....--....-------------------FEA--D-IL--------------------AGHKTIS-......I-------
Q1ZQA8_PHOAS/10-108....--....-------------------FEN--D-IL--------------------SGKKTIT-......I-------
H7C704_ENTFA/11-82....--....-------------------FFK--A-VK--------------------ERRKTFE-......I-------
A0A0E1EJ20_STRAG/24-144....--..DL-------------------LAK--L-VV--------------------DGTKTAT-ASAYDLY-------

PF02190

LONM_ASHGO/157-410T.VY..DPAV...........IE......AIC--G-LL....................RR.NIP.-YLGAFLL.......
LONM1_DICDI/158-355N.LG.................FQ......FIT--R-LV...................PNA.SGKT-FLGFFLC.......
A5DBM7_PICGU/11-325T.FS..RFKA...........AA......LLS--R-FRHYVGEVSMIRSLISEYDFDNDQ.DTH.-...VPVI.......
A5DAP1_PICGU/270-494N.IT..DPDV...........IR......SIY--T-II....................DK.REP.-YFLLFHV.......
Q0UIT5_PHANO/192-422H.VF..EPRY...........RL......MMR--R-VI....................EG.NKQ.-.FGMVMY.......
A1SL63_NOCSJ/4-197T.VF..EDRY...........RA......LVH--H-LLR..................IED.PAAR-VFGSVAI.......
LON1_BDEBA/7-200R.IG..REKS...........IA......ALQ--K-AL....................RD.NHW.-...VILL.......
LON_CLOPH/7-201D.VN..RKVS...........IE......AIE--A-AM....................LL.NQQ.-...VLLV.......
LON_AQUAE/16-212F.VG..RRFS...........IR......AIE--E-AN....................KK.DKL.-...IFLV.......
Q9X1W8_THEMA/31-225Y.VG..RTGS...........LI......ALE--E-AM....................EKYNRL.-...LLVV.......
A8L4P8_FRASN/6-237D.LS..DAGT...........RA......AVD--A-ARGGRPDSTP....DARAPGISSR.SFQR-TAEILLV.......
LON_NEOSM/32-229F.IG..RKGS...........IQ......AMD--K-AL....................AETSENT-GR.MLLI.......
A5CDI0_ORITB/12-207L.IG..RDDS...........VK......NLL--R-LG....................NDSENQH-T..ILLT.......
LON_DESVH/17-214F.VG..REAS...........IK......AIE--S-AI....................SDYGKK.-...IFLV.......
A7HIT3_ANADF/21-218H.IF..EPRY...........KA......LVK--D-AL....................AG.DRVV-AVPALLH.......
LONM_CAEEL/88-357DIVK..DDNL...........KA......LIR--R-QL....................SL.KQP.-YAGVFVK.......
LONM_ORYSJ/101-311Y.VK..DQKL...........LQ......ALV--E-NR....................KR.SIP.-YAGAFLVKD.....
LON_FLAJ1/43-237S.AG..RDKS...........IK......LIN--D-AN....................AG.GKI.-...IGVV.......
LON_FUSNN/3-196Y.VG..RANS...........IA......TLE--K-AI....................AN.KTK.-...LVLG.......
Q176B8_AEDAE/115-373E.VT..NPML...........ID......LIR--R-KV....................KL.NQP.-YAGIFLK.......
B1YJV9_EXIS2/5-196D.VG..RPVS...........LK......ALL--A-SK....................EH.EID.-...LVVV.......
LON_DESOH/21-214V.IT..QNEY...........MT......LID--E-VM....................SG.NRL.-...VALI.......
Q4UE63_THEAN/226-447Q.VQ..DQAV...........IK......CLS--N-VK....................QN.SGHD-YVGGFLTKA.....
LON_KORVE/24-217T.VG..RESS...........VQ......LIN--.-SL....................GE.DKT.-...IVVV.......
LON_SYNAS/22-218DIVG...NRF...........IQ......LVD--E-AM....................AK.DRL.-...LGLV.......
A4RYB7_OSTLU/20-244E.FD..GANV...........ER......TLN--A-GTAL................GRDA.RVGD-RFGMLGQ.......
Q39SL1_GEOMG/12-202F.LK..DEEL............A......RFE--E-ML....................ED.DQL.-...VTLV.......
Q5SJA3_THET8/5-197D.AG..RPIS...........IR......AID--E-AL....................AR.DRV.-...LLIV.......
YOXA_SCHPO/252-470H.IF..ELRY...........HI......MIK--K-CL....................ET.SKRF-CIAMPLR.......
A1TLG4_ACIAC/20-217R.VF..EVRY...........LD......MVR--K-CRQ..................AGA.P...-.FGVVAL.......
A9AWT0_HERA2/15-210Q.VG..QGKS...........YR......AME--Q-AM....................ED.DQH.-...VLLI.......
C1DQT6_AZOVD/30-226V.VN..PDPW...........AE......TLK--R-VV....................KT.PQH.-SLALFYM.......
Q7MWJ0_PORGI/9-205M.VG..REKS...........LK......LIR--Y-VE....................KK.GVY.-...FGAV.......
LONP2_NEUCR/10-256A.VSSTRPDI...........AS......LLA--A-VYAKAA...........SQTPNGR.IDTI-PIACVPLASP..LI
A6L531_BACV8/39-234T.IG..RPST...........LK......LIN--A-AY....................KK.KLP.-...IAVV.......
Q9S2T2_STRCO/5-222N.IF..EERY...........RA......MMR--E-LLK..................TPE.DEPR-RFAV.VAIRD...G
LONM_YARLI/202-503V.IR..DPNV...........MK......AID--E-MI....................TR.GEP.-YLACFFL.......
Q3A8K2_PELCD/13-206Y.IG..RSQS...........LA......AVE--Q-AL....................AG.DRL.-...IMLA.......
LONP2_YARLI/4-302G.LS..KETAVAMLKLFEKPKDKDVAYSKATQ--D-LMSSVNKLQAF..FKLKRTSADGY.RNAS-LITIACVPRI..TQ
LONP2_BOVIN/12-220S.VD..SARN...........LQ......LVR--S-RL....................LK.GTSL-QSTILGV.......
LON2_SYNFM/17-208H.VT..RAGY...........RR......LAD--E-VY....................RE.NGL.-...LAVV.......
LONP2_CANAL/21-402T.FSRFKAAALLYRYKNFISQVS......IIN--N-LLNEYDFNS......GNTNEEERF.EAEQ-KLEQPETYHEINPS
LON1_HERA2/13-209A.IG..QPES...........IR......LID--D-LM....................AG.QRI.-...VGLM.......
Q4FNU4_PELUB/9-201N.IF..EPRY...........IE......MIN--D-SMK..................TNK.M...-.IGLIQP.......
Q057E4_BUCCC/10-202F.IG..RKNS...........IK......CIE--F-SM....................QT.NKK.-...ILLI.......
Q1D5A0_MYXXD/32-225A.VG..RQKT...........IA......LIK--D-AV....................RD.DQV.-...IGVV.......
A4FLR4_SACEN/3-200H.VF..EPRY...........RQ......LTM--D-LL...................NEV.VPDR-RFGVVAI.......
Q4X3M7_PLACH/41-324N.....ADKS...................FIQ--I-LE....................NYKKKNI-YVGLFFNKKSENDI
LON_DICNV/5-198F.IG..REKS...........IA......ALD--A-AM....................NG.SQE.-...LLLV.......
LON_NITOC/5-198S.VG..RAGS...........IA......AVE--A-AL....................SSEDKL.-...IAVF.......
Q67SJ7_SYMTH/11-204E.VG..REKS...........MR......AVE--A-AM....................NE.GRR.-...MVLA.......
A4YSN7_BRASO/70-260F.VG..RAKT...........IN......ALN--D-AF....................TK.QSD.-...VVIA.......
LONP2_ASPNC/10-255P.VS.NRPDL...........AN......LLS--T-IVDRSA...........VAKRDGT...AI-TFGCVPLSSP..YL
Q0U2R2_PHANO/14-258P.IT.NRSDV...........AA......ILA--K-IYSISP...........TAKPD.A...SI-TVACVPLNSN..TI
Q4FM92_PELUB/7-199F.VG..RDKS...........IA......ALN--E-VM....................KK.DKK.-...IVLV.......
Q8ILU7_PLAF7/45-357N.....SDKN...................VVK--Y-LGVH................NDYKEKKNI-FVGLFFHKEKTIET
LON_MYCPE/15-212E.IG..REKS...........IA......AIN--D-SK....................EK.KQN.-...MIVV.......
CRBN_RAT/83-320Q.LS..HPQE...........VS......MVR--N-LIQ..................KDR.T...-.FAVLAY.......
A5K180_PLAVS/44-319N.....ADGN...................LVR--L-FE....................KCKRKSA-HIGLFLLKSV...G
LON2_HERA2/18-210F.VA..RELS...........MA......AIE--A-AM....................SA.DRQ.-...IVAV.......
LON_MAGMM/41-240Q.VE..GSPY...........YE......TIK--K-AM....................DS.HGR.-LFGILAS.......
LON1_DESPS/34-236I.IE..DMRL...........QK......FIL--S-QK....................DK.KVP.-LFFALLL.......
LON_MYCMO/2-196E.VG..RPLS...........LA......AID--L-AK....................SDFENK.-...LVLI.......
LONP2_PICST/18-364T.FSRFKAAALLYRYKDLVSQVS......IIN--N-LLNEYE...........FNPSKDS.DSVE-EDDMVTSPITI.SK
B1HVE4_LYSSC/9-197D.VG..RNRS...........VA......ALE--Q-AM....................LE.DQM.-...ILLV.......
E4XTK2_OIKDI/43-290NAVY...PST...........RA......LLD--A-VL....................KS.DSK.-LMGFFVDI......
G1TBZ8_RABIT/210-407H.VF..EPRY...........RL......MIR--R-SI....................QT.GTK.-QFGMCVS.......
I1QQQ1_ORYGL/12-253R.CT..NPSS...........VK......LVE--Q-EL...................WQR.EEKG-LIGVLPVH......
J9Z7L8_LEPFM/44-237V.VS..KPRS...........IL......ALE--A-SL....................AE.GRL.-...LFVS.......
J9ZC05_LEPFM/4-193H.IF..EPRY...........RA......LVS--E-AI....................RT.DSL.-.VGMVLL.......
J9ZD27_LEPFM/11-209A.FH..DAKS...........LA......AID--E-AM....................NR.EPK.-.M.LVCVA......
M4B6H0_HYAAE/97-299T.IT..NPEV...........TR......ALL--A-LK....................ES.GQK.-YVGVFLKR......
LON2_BORBU/9-200T.FD..NEYV...........IN......SIA--Q-SM....................LE.E...-RLILFAY.......
P96280_MYCTU/8-204H.IF..EPRY...........AA......LVR--D-CM....................DT.ADP.-RFGVVLI.......
LON1_BORBU/31-231V.LI..SDSD...........MK......AID--Y-AM....................KG.NG..-IIALFVLN......
Q5E916_ARATH/98-437R.II..QPSF...........LA......AVE--R-AL....................NQANAPS-TIGVIRV.......
Q5NH45_FRATT/7-203N.VG..RKKS...........IE......AVK--Q-AS....................NN.YNN.-Y..ILLA.......
Q63XL2_BURPS/11-205K.VF..EARY...........LD......MAR--A-CL....................RD.DAP.-.FGVCLL.......
Q6FD62_ACIAD/18-212F.VG..REKS...........IN......AVD--V-AR....................NS.DNL.-...VFVV.......
Q87YR8_PSESM/6-197F.VG..REKS...........IE......ALE--A-AM....................TG.DKQ.-...ILLL.......
R5K463_9CLOT/9-200D.VI..SKES...........CE......AVA--N-AM....................KG.DCS.-...ILLV.......
R6MYW8_9CLOT/11-203D.VG..RKKS...........IL......ALN--A-AM....................QN.NQS.-...IYLA.......

PF09157

TRUB_XYLFA/245-300--------------------------------------------------------------------------------
TRUB_ACTSZ/247-304--------------------------------------------------------------------------------
TRUB_CHRVO/242-300--------------------------------------------------------------------------------
TRUB_AZOSB/241-294--------------------------------------------------------------------------------
Q609C4_METCA/59-115--------------------------------------------------------------------------------
TRUB_SHIDS/252-309--------------------------------------------------------------------------------
TRUB_YERPE/252-309--------------------------------------------------------------------------------
Q140U4_BURXL/245-306--------------------------------------------------------------------------------
TRUB_PSYIN/251-308--------------------------------------------------------------------------------
TRUB_MARHV/244-302--------------------------------------------------------------------------------
TRUB_SHEFN/251-308--------------------------------------------------------------------------------
TRUB_VIBF1/251-308--------------------------------------------------------------------------------
Q0VSR9_ALCBS/246-303--------------------------------------------------------------------------------
TRUB_NOSS1/234-289--------------------------------------------------------------------------------
TRUB_PSEHT/253-308--------------------------------------------------------------------------------
TRUB_ACTP2/246-303--------------------------------------------------------------------------------
TRUB_COXBU/250-306--------------------------------------------------------------------------------
TRUB_SACD2/250-310--------------------------------------------------------------------------------
TRUB_NITMU/246-307--------------------------------------------------------------------------------
TRUB_ACIAD/262-316--------------------------------------------------------------------------------
TRUB_GLOVI/235-289--------------------------------------------------------------------------------
TRUB_MANSM/246-303--------------------------------------------------------------------------------
TRUB_NITEU/231-291--------------------------------------------------------------------------------
TRUB_PSEA6/251-311--------------------------------------------------------------------------------
A4SY76_POLSQ/241-299--------------------------------------------------------------------------------
TRUB_BAUCH/253-312--------------------------------------------------------------------------------
A0KNE1_AERHH/266-323--------------------------------------------------------------------------------
TRUB_SODGM/249-306--------------------------------------------------------------------------------
A0ZIL4_NODSP/234-288--------------------------------------------------------------------------------
TRUB_PECAS/252-309--------------------------------------------------------------------------------
TRUB_BUCBP/244-301--------------------------------------------------------------------------------
Q0K9C1_CUPNH/232-294--------------------------------------------------------------------------------
TRUB_SHEAM/251-308--------------------------------------------------------------------------------
TRUB_HALHL/245-301--------------------------------------------------------------------------------
TRUB_PHOLL/251-310--------------------------------------------------------------------------------
TRUB_THIDA/239-293--------------------------------------------------------------------------------
TRUB_IDILO/246-303--------------------------------------------------------------------------------
TRUB_METFK/241-297--------------------------------------------------------------------------------
TRUB_MARMS/244-301--------------------------------------------------------------------------------
A5EWY7_DICNV/237-289--------------------------------------------------------------------------------
Q0A799_ALKEH/244-300--------------------------------------------------------------------------------
TRUB_HAHCH/247-303--------------------------------------------------------------------------------
TRUB_CHRSD/242-299--------------------------------------------------------------------------------
Q2JJL0_SYNJB/239-295--------------------------------------------------------------------------------
TRUB_AQUAE/232-286--------------------------------------------------------------------------------
TRUB_DECAR/241-295--------------------------------------------------------------------------------
TRUB_CALS4/230-285--------------------------------------------------------------------------------
A4G7S5_HERAR/244-306--------------------------------------------------------------------------------
TRUB_BUCAI/250-307--------------------------------------------------------------------------------
TRUB_CHESB/253-310--------------------------------------------------------------------------------
TRUB_PASMU/246-303--------------------------------------------------------------------------------
TRUB_SYNE7/234-291--------------------------------------------------------------------------------
TRUB_NITOC/247-303--------------------------------------------------------------------------------
TRUB_HAEDU/246-303--------------------------------------------------------------------------------
TRUB_AROAE/245-299--------------------------------------------------------------------------------
TRUB_HISS2/246-303--------------------------------------------------------------------------------
B4E7L3_BURCJ/247-306--------------------------------------------------------------------------------
TRUB_VIBTL/251-308--------------------------------------------------------------------------------
M1FAI4_9ALTE/245-303--------------------------------------------------------------------------------
M9X1B5_MANHA/247-303--------------------------------------------------------------------------------
TRUB_PSEAE/246-302--------------------------------------------------------------------------------
TRUB_LEGPH/243-299--------------------------------------------------------------------------------
TRUB_BURPS/246-307--------------------------------------------------------------------------------
TRUB_PHOPR/251-308--------------------------------------------------------------------------------
TRUB_XANCP/245-299--------------------------------------------------------------------------------
TRUB_RALSO/252-312--------------------------------------------------------------------------------
TRUB_VIBCH/251-308--------------------------------------------------------------------------------

PF09142

TRUB_LEIXX/238-297--------------------------------------------------------------------------------
TRUB_THEFY/236-291--------------------------------------------------------------------------------
TRUB_COREF/238-293--------------------------------------------------------------------------------
TRUB_RHOJR/245-300--------------------------------------------------------------------------------
TRUB_PROAC/237-295--------------------------------------------------------------------------------
TRUB_STRAW/243-301--------------------------------------------------------------------------------
Q0RDS8_FRAAA/250-305--------------------------------------------------------------------------------
A5UZQ6_ROSS1/240-296--------------------------------------------------------------------------------
TRUB_BIFLO/329-385--------------------------------------------------------------------------------
A1SLK5_NOCSJ/235-289--------------------------------------------------------------------------------
A1T7J3_MYCVP/243-298--------------------------------------------------------------------------------
TRUB_CORDI/241-296--------------------------------------------------------------------------------
Q2IPZ4_ANADE/244-300--------------------------------------------------------------------------------
A6W7Z8_KINRD/243-298--------------------------------------------------------------------------------
A4FM27_SACEN/227-282--------------------------------------------------------------------------------
TRUB_CORJK/248-303--------------------------------------------------------------------------------
TRUB_MYCLE/247-302--------------------------------------------------------------------------------
A7H9F6_ANADF/247-302--------------------------------------------------------------------------------
A8L6F8_FRASN/256-311--------------------------------------------------------------------------------
TRUB_NOCFA/245-300--------------------------------------------------------------------------------
A0QVP8_MYCS2/244-299--------------------------------------------------------------------------------
TRUB_MYCPA/234-289--------------------------------------------------------------------------------
A9WGQ0_CHLAA/234-289--------------------------------------------------------------------------------
B0RDY4_CLAMS/254-312--------------------------------------------------------------------------------
B2HKU5_MYCMM/242-297--------------------------------------------------------------------------------
TRUB_MYCTU/236-291--------------------------------------------------------------------------------

PF01472

TRUB_SULTO/251-323--------------------------------------------------------------------------------
PROB_BACSU/277-350--------------------------------------------------------------------------------
TRUB_AERPE/262-335--------------------------------------------------------------------------------
DKC1_HUMAN/297-370--------------------------------------------------------------------------------
ATGT_METJA/578-651--------------------------------------------------------------------------------
ATGT_METTH/579-652--------------------------------------------------------------------------------
Q9YEQ6_AERPE/84-160--------------------------------------------------------------------------------
TRUB_THEAC/210-279--------------------------------------------------------------------------------
PROB_YEAST/322-409--------------------------------------------------------------------------------
YHJ3_YEAST/316-403--------------------------------------------------------------------------------
PROB_VIBPA/286-360--------------------------------------------------------------------------------
PROB_VIBCH/284-358--------------------------------------------------------------------------------
PROB_SHEON/281-355--------------------------------------------------------------------------------
PROB_ECOLI/276-350--------------------------------------------------------------------------------
PROB_HAEIN/276-350--------------------------------------------------------------------------------
PROJ_BACSU/281-355--------------------------------------------------------------------------------
Q8H5T5_ORYSJ/311-384--------------------------------------------------------------------------------
CBF5_KLULA/266-339--------------------------------------------------------------------------------
DKC1_CAEEL/285-358--------------------------------------------------------------------------------
DKC1_DROME/295-368--------------------------------------------------------------------------------
Q8ILS0_PLAF7/269-342--------------------------------------------------------------------------------
Q8SRW0_ENCCU/263-336--------------------------------------------------------------------------------
TRUB_METTH/240-313--------------------------------------------------------------------------------
TRUB_ARCFU/237-310--------------------------------------------------------------------------------
TRUB_METJA/249-322--------------------------------------------------------------------------------
TRUB_METKA/248-321--------------------------------------------------------------------------------
TRUB_PYRAE/239-312--------------------------------------------------------------------------------
TRUB_SULSO/164-236--------------------------------------------------------------------------------
Q9HS38_HALSA/81-154--------------------------------------------------------------------------------
O29550_ARCFU/79-152--------------------------------------------------------------------------------
Q975U3_SULTO/92-165--------------------------------------------------------------------------------
ATGT_THEAC/554-627--------------------------------------------------------------------------------
Q8TWS6_METKA/77-150--------------------------------------------------------------------------------
Q8ZYG7_PYRAE/80-152--------------------------------------------------------------------------------
Q8TGZ2_METKA/63-136--------------------------------------------------------------------------------
Q8ZYJ6_PYRAE/89-161--------------------------------------------------------------------------------
Q9YD14_AERPE/93-165--------------------------------------------------------------------------------
Q8TXP0_METKA/124-195--------------------------------------------------------------------------------
Q9HNT2_HALSA/517-583--------------------------------------------------------------------------------
O27701_METTH/236-308--------------------------------------------------------------------------------
Q8U4L1_PYRFU/502-568--------------------------------------------------------------------------------
O29668_ARCFU/456-526--------------------------------------------------------------------------------
ARCS_METJA/501-568--------------------------------------------------------------------------------
Y066_METJA/132-206--------------------------------------------------------------------------------
Q8I3H2_PLAF7/91-168--------------------------------------------------------------------------------
Q8RZU5_ORYSJ/92-170--------------------------------------------------------------------------------
Q8MXH7_CAEEL/94-172--------------------------------------------------------------------------------
MCTS2_MOUSE/93-170--------------------------------------------------------------------------------
TMA20_YEAST/91-171--------------------------------------------------------------------------------
Y1432_METJA/79-153--------------------------------------------------------------------------------
O28867_ARCFU/71-144--------------------------------------------------------------------------------
O26746_METTH/77-151--------------------------------------------------------------------------------
Q8TYS3_METKA/83-157--------------------------------------------------------------------------------
Q9HM93_HALSA/77-150--------------------------------------------------------------------------------
Q8ZWT7_PYRAE/82-155--------------------------------------------------------------------------------
Q9HIB8_THEAC/71-144--------------------------------------------------------------------------------
Q97TZ1_SULSO/69-143--------------------------------------------------------------------------------
Y1649_METJA/6-80--------------------------------------------------------------------------------
PROB_CHLTE/278-354--------------------------------------------------------------------------------
PROB_BACTN/279-354--------------------------------------------------------------------------------
PROB_STRR6/276-349--------------------------------------------------------------------------------
PROB_AQUAE/266-339--------------------------------------------------------------------------------
PROB_THEMA/263-336--------------------------------------------------------------------------------
PROB_OCEIH/277-351--------------------------------------------------------------------------------
PROB_BACHD/277-351--------------------------------------------------------------------------------
PROB_COREF/278-352--------------------------------------------------------------------------------
PROB_STRCO/281-355--------------------------------------------------------------------------------
PROB_BIFLO/286-360--------------------------------------------------------------------------------
PROB_PSESM/281-355--------------------------------------------------------------------------------
PROB_PSEPK/281-355--------------------------------------------------------------------------------
PROB_PSEAE/281-355--------------------------------------------------------------------------------
PROB_RALSO/283-357--------------------------------------------------------------------------------
PROB_XANCP/268-345--------------------------------------------------------------------------------
PROB_DEIRA/272-346--------------------------------------------------------------------------------
PROB_BRADU/282-355--------------------------------------------------------------------------------
PROB_AGRFC/283-356--------------------------------------------------------------------------------
PROB1_RHIME/283-356--------------------------------------------------------------------------------
PROB1_RHILO/279-352--------------------------------------------------------------------------------
PROB_CAUCR/287-360--------------------------------------------------------------------------------
PROB_SCHPO/296-370--------------------------------------------------------------------------------
PROB_THEEB/277-351--------------------------------------------------------------------------------
PROB_NOSS1/287-361--------------------------------------------------------------------------------
PROB_SYNY3/282-356--------------------------------------------------------------------------------
PROB_CALS4/273-347--------------------------------------------------------------------------------
PROB_SERP5/276-350--------------------------------------------------------------------------------
D3PQW1_MEIRD/282-355--------------------------------------------------------------------------------
PROB_MYCTU/281-351--------------------------------------------------------------------------------
PROB_BRUA2/280-353--------------------------------------------------------------------------------
PROB_THET8/276-350--------------------------------------------------------------------------------
PROB_VIBVY/286-360--------------------------------------------------------------------------------
TRUB_METAC/246-319--------------------------------------------------------------------------------
Q8U1U0_PYRFU/88-161--------------------------------------------------------------------------------
Q8U444_PYRFU/4-78--------------------------------------------------------------------------------

PF03657

Y516_AERPE/11-172--------------------------------------------------------------------------------
Y1410_METJA/1-157--------------------------------------------------------------------------------
Y058_ARCFU/1-167--------------------------------------------------------------------------------

PF14306

A8MAT6_CALMQ/8-187--------------------------------------------------------------------------------
Q8ZUU0_PYRAE/7-184--------------------------------------------------------------------------------
PAPS1_HUMAN/225-386--------------------------------------------------------------------------------
PAPS2_HUMAN/215-376--------------------------------------------------------------------------------
Q7PX77_ANOGA/219-385--------------------------------------------------------------------------------
Q8IQV1_DROME/247-415--------------------------------------------------------------------------------
Q22501_CAEEL/229-414--------------------------------------------------------------------------------
APS3_ARATH/53-216--------------------------------------------------------------------------------
MET3_PHANO/3-166--------------------------------------------------------------------------------
A0A016PSU3_GIBZA/3-166--------------------------------------------------------------------------------
A0A0D1E1R4_USTMA/3-166--------------------------------------------------------------------------------
MET3_DEBHA/4-174--------------------------------------------------------------------------------
MET3_CANAL/4-172--------------------------------------------------------------------------------
MET3_KLULA/2-163--------------------------------------------------------------------------------
MET3_ASHGO/2-161--------------------------------------------------------------------------------
A8ZWW7_DESOH/6-165--------------------------------------------------------------------------------
Q54F74_DICDI/17-181--------------------------------------------------------------------------------
A5UYJ4_ROSS1/4-160--------------------------------------------------------------------------------
B4U6B9_HYDS0/17-175--------------------------------------------------------------------------------
SAT_SYNFM/5-167--------------------------------------------------------------------------------
SAT_CHLPB/4-165--------------------------------------------------------------------------------
SAT_RUTMC/5-162--------------------------------------------------------------------------------
SAT_THIDA/5-162--------------------------------------------------------------------------------
SAT_PSYWF/16-179--------------------------------------------------------------------------------
Q72CI8_DESVH/5-177--------------------------------------------------------------------------------
Q6AN73_DESPS/5-179--------------------------------------------------------------------------------
SAT_DESRM/4-163--------------------------------------------------------------------------------
SAT_ALCBS/5-169--------------------------------------------------------------------------------
SAT_ALLVD/2-166--------------------------------------------------------------------------------
SAT_CENSY/6-156--------------------------------------------------------------------------------
SAT_NITMS/7-157--------------------------------------------------------------------------------
SAT_HYPBU/3-160--------------------------------------------------------------------------------
SAT_STAMF/3-160--------------------------------------------------------------------------------
SAT_IGNH4/3-160--------------------------------------------------------------------------------
SAT_AERPE/3-162--------------------------------------------------------------------------------
Q9KCT2_BACHD/4-155--------------------------------------------------------------------------------
SAT_BACP2/4-154--------------------------------------------------------------------------------
SAT1_BACSU/4-154--------------------------------------------------------------------------------
SAT2_BACSU/4-155--------------------------------------------------------------------------------
SAT_DEIRA/12-166--------------------------------------------------------------------------------
Q2JHJ0_SYNJB/14-172--------------------------------------------------------------------------------
SAT_GLOVI/9-167--------------------------------------------------------------------------------
SAT_OCEIH/12-170--------------------------------------------------------------------------------
SAT_LACPL/7-162--------------------------------------------------------------------------------
SAT_PELTS/3-161--------------------------------------------------------------------------------
SAT_RUBXD/9-167--------------------------------------------------------------------------------
SAT_SYMTH/5-163--------------------------------------------------------------------------------
SAT_PETMO/2-161--------------------------------------------------------------------------------
SAT_HALOH/2-161--------------------------------------------------------------------------------
A4YFD2_METS5/3-148--------------------------------------------------------------------------------
SAT_CARHZ/2-158--------------------------------------------------------------------------------
A9WF10_CHLAA/8-161--------------------------------------------------------------------------------
SAT_CHLAA/10-157--------------------------------------------------------------------------------
SAT_LYSSC/4-153--------------------------------------------------------------------------------
B1WW78_CYAA5/57-215--------------------------------------------------------------------------------
B6HEK3_PENCW/4-165--------------------------------------------------------------------------------
C4LVD3_ENTHI/11-173--------------------------------------------------------------------------------
F7BBN1_CIOIN/226-379--------------------------------------------------------------------------------
H3D716_TETNG/215-374--------------------------------------------------------------------------------
J9Z8G2_LEPFM/5-161--------------------------------------------------------------------------------
M4DJ10_BRARP/17-179--------------------------------------------------------------------------------
MET3_CRYNJ/4-171--------------------------------------------------------------------------------
SAT_GEOKA/5-154--------------------------------------------------------------------------------
Q73WR2_MYCPA/6-159--------------------------------------------------------------------------------
S2JG29_MUCC1/4-165--------------------------------------------------------------------------------

PF04146

U5DHQ3_AMBTC/203-345-----------------------------------DEA------------------------------------------
G9NWF6_HYPAI/319-521-----------------------------------TNA------------------------------------------
D8TNU7_VOLCA/3-131-----------------------------------DEA------------------------------------------
B0CZ01_LACBS/621-947-----------------------------------DQA------------------------------------------
K1VD20_TRIAC/114-250-----------------------------------DAA------------------------------------------
Q6BPA7_DEBHA/127-264-----------------------------------NRA------------------------------------------
C5L6K6_PERM5/34-174-----------------------------------WEI------------------------------------------
D8PXT6_SCHCM/597-878-----------------------------------DQA------------------------------------------
A0DYX2_PARTE/54-188-----------------------------------NAK------------------------------------------
A6QW31_AJECN/628-764-----------------------------------TNA------------------------------------------
G3B5F4_CANTC/46-183-----------------------------------SSA------------------------------------------
G8BTN3_TETPH/177-314-----------------------------------SEA------------------------------------------
K1XSV2_MARBU/377-579-----------------------------------NEA------------------------------------------
M1WAB0_CLAP2/245-382-----------------------------------AQA------------------------------------------
M9LMP9_PSEA3/630-1025-----------------------------------DQA------------------------------------------
T1IEI7_RHOPR/176-317-----------------------------------NHA------------------------------------------
C5E1V0_ZYGRC/178-314-----------------------------------SEA------------------------------------------
T1EJA3_HELRO/16-152-----------------------------------DKA------------------------------------------
B9PUV6_TOXGO/446-580-----------------------------------SNA------------------------------------------
B9GKR9_POPTR/68-204-----------------------------------EEA------------------------------------------
K9G8Z6_PEND2/207-404-----------------------------------NQA------------------------------------------
G2QRC4_THITE/578-713-----------------------------------SEA------------------------------------------
Q179P3_AEDAE/474-610-----------------------------------DQA------------------------------------------
K1PII4_CRAGI/293-431-----------------------------------NNA------------------------------------------
U1HHT6_ENDPU/832-968-----------------------------------VEA------------------------------------------
B6K0R3_SCHJY/340-468-----------------------------------SEA------------------------------------------
A7S845_NEMVE/5-139-----------------------------------NEA------------------------------------------
J9FJT3_WUCBA/174-306-----------------------------------AEA------------------------------------------
A7S9W8_NEMVE/1-137-----------------------------------NAA------------------------------------------
Q2HAM8_CHAGB/185-397-----------------------------------NSA------------------------------------------
A7S7H4_NEMVE/1272-1403-----------------------------------NRA------------------------------------------
H2ZM81_CIOSA/317-452-----------------------------------DSA------------------------------------------
U5H657_USTV1/931-1067-----------------------------------DRA------------------------------------------
D7TI61_VITVI/437-575-----------------------------------DAA------------------------------------------
T5ACT8_OPHSC/215-351-----------------------------------TEA------------------------------------------
I1MJV8_SOYBN/128-270-----------------------------------NAA------------------------------------------
K3Y698_SETIT/311-449-----------------------------------NAA------------------------------------------
K3Y7A4_SETIT/80-223-----------------------------------DTA------------------------------------------
B7Q1P2_IXOSC/1192-1325-----------------------------------QWA------------------------------------------
D7TAY9_VITVI/331-469-----------------------------------NSA------------------------------------------
G7EB12_MIXOS/559-886-----------------------------------DRA------------------------------------------
J7S680_KAZNA/150-287-----------------------------------SEH------------------------------------------
U7Q061_SPOS1/487-740-----------------------------------NDA------------------------------------------
G9MG20_HYPVG/322-524-----------------------------------NGA------------------------------------------
G8XZL1_PICSO/128-265-----------------------------------NKA------------------------------------------
G2XF66_VERDV/192-394-----------------------------------NNA------------------------------------------
K1QXM6_CRAGI/5-167-----------------------------------TRA------------------------------------------
D0NFE9_PHYIT/251-393-----------------------------------KMA------------------------------------------
K3XF31_SETIT/338-480-----------------------------------DSA------------------------------------------
F6Q7U6_ORNAN/151-282-----------------------------------NQA------------------------------------------
E9EVG6_METRA/418-621-----------------------------------NDA------------------------------------------
I7M1Y9_TETTS/89-224-----------------------------------NAA------------------------------------------
J3P7Z2_GAGT3/427-625-----------------------------------NNA------------------------------------------
A0BIE6_PARTE/204-344-----------------------------------SQL------------------------------------------
T5AGE9_OPHSC/374-574-----------------------------------NTA------------------------------------------
F6QHV0_MONDO/340-475-----------------------------------DSA------------------------------------------
E9E0K3_METAQ/180-317-----------------------------------TQA------------------------------------------
G3JL26_CORMM/398-599-----------------------------------NNA------------------------------------------
F9XGG0_ZYMTI/186-391-----------------------------------NRA------------------------------------------
C4JRH9_UNCRE/337-473-----------------------------------TDA------------------------------------------
G9P5M8_HYPAI/35-170-----------------------------------SFA------------------------------------------
E5SQQ4_TRISP/509-644-----------------------------------NII------------------------------------------
Q23DI1_TETTS/133-269-----------------------------------DQA------------------------------------------
M4F5R7_BRARP/228-363-----------------------------------NAA------------------------------------------
R7YYG2_CONA1/426-624-----------------------------------NQA------------------------------------------
A0BNI8_PARTE/17-156-----------------------------------RNA------------------------------------------
K0KIR7_WICCF/195-342-----------------------------------AKA------------------------------------------
E9GRU8_DAPPU/153-289-----------------------------------DAA------------------------------------------
B2AM24_PODAN/407-619-----------------------------------NNA------------------------------------------
Q6FY47_CANGA/158-294-----------------------------------SQA------------------------------------------
K7K6W6_SOYBN/472-610-----------------------------------DAA------------------------------------------
M3BUB4_SPHMS/369-565-----------------------------------NRA------------------------------------------
F6HE16_VITVI/375-517-----------------------------------ENA------------------------------------------
C4Y9B7_CLAL4/138-272-----------------------------------AKA------------------------------------------
R9AVA4_WALI9/217-354-----------------------------------DKA------------------------------------------
B9SK12_RICCO/287-425-----------------------------------DAA------------------------------------------
H6C1G6_EXODN/112-376-----------------------------------NHA------------------------------------------
U9TJV4_RHIID/1-136-----------------------------------DKA------------------------------------------
G3AP02_SPAPN/37-179-----------------------------------DKA------------------------------------------
R7Z4V4_CONA1/260-394-----------------------------------VEA------------------------------------------
G0R5U6_ICHMG/90-225-----------------------------------NEI------------------------------------------
A8Q7N5_MALGO/580-845-----------------------------------DQA------------------------------------------
K2RJ90_MACPH/420-620-----------------------------------NRA------------------------------------------
B0WKC0_CULQU/163-301-----------------------------------NQA------------------------------------------
G0SA06_CHATD/570-705-----------------------------------SDA------------------------------------------
C5GU86_AJEDR/670-806-----------------------------------AEA------------------------------------------
W1NMN5_AMBTC/178-314-----------------------------------EEA------------------------------------------
V2WZC4_MONRO/526-864-----------------------------------DQA------------------------------------------
T1ETR1_HELRO/308-446-----------------------------------NQA------------------------------------------
T1FX57_HELRO/6-141-----------------------------------DAA------------------------------------------
N1PF88_DOTSN/177-372-----------------------------------DDA------------------------------------------
A8NEN2_COPC7/474-610-----------------------------------DKA------------------------------------------
A1CD65_ASPCL/281-513-----------------------------------NRA------------------------------------------
A8QC89_MALGO/15-152-----------------------------------DKA------------------------------------------
J5K4M9_BEAB2/397-598-----------------------------------NNA------------------------------------------
G4U9D0_NEUT9/214-431-----------------------------------NNA------------------------------------------
G9MVK2_HYPVG/4-139-----------------------------------AHA------------------------------------------
K7K544_SOYBN/67-203-----------------------------------EEA------------------------------------------
K4CIR0_SOLLC/70-206-----------------------------------DEA------------------------------------------
Q500V8_ARATH/330-468-----------------------------------DAA------------------------------------------
D0MU40_PHYIT/31-168-----------------------------------DQV------------------------------------------
A0A0D2X8M3_FUSO4/186-387-----------------------------------NNA------------------------------------------
E0VFT2_PEDHC/270-407-----------------------------------DQA------------------------------------------
A0A0C4ELE8_PUCT1/377-584-----------------------------------DQA------------------------------------------
A0A023B4A3_GRENI/252-386-----------------------------------RQA------------------------------------------
Q2GU55_CHAGB/195-329-----------------------------------DKA------------------------------------------
W5KNU3_ASTMX/1266-1402-----------------------------------NRA------------------------------------------
A8JHY3_CHLRE/19-147-----------------------------------DAA------------------------------------------
M2YKU0_DOTSN/375-566-----------------------------------NQA------------------------------------------
A0BI26_PARTE/40-178-----------------------------------NEA------------------------------------------
K4B806_SOLLC/250-386-----------------------------------NEA------------------------------------------
A8NRM6_COPC7/377-678-----------------------------------DQA------------------------------------------
Q5K6Y0_CRYNJ/435-735-----------------------------------DQA------------------------------------------
C5YY10_SORBI/414-556-----------------------------------DAA------------------------------------------
M0SQV1_MUSAM/439-577-----------------------------------DAA------------------------------------------
F2UD73_SALR5/651-791-----------------------------------SRA------------------------------------------
M1WE61_CLAP2/348-546-----------------------------------NEA------------------------------------------
G7DU39_MIXOS/711-847-----------------------------------DRA------------------------------------------
U4LEH5_PYROM/784-918-----------------------------------EEA------------------------------------------
A0A068XD19_HYMMI/150-287-----------------------------------NKA------------------------------------------
F0VF22_NEOCL/53-196-----------------------------------GAA------------------------------------------
K7VKN2_MAIZE/372-514-----------------------------------DNA------------------------------------------
A0EIT2_PARTE/53-193-----------------------------------DEA------------------------------------------
G4VB52_SCHMA/567-702-----------------------------------DTA------------------------------------------
G2R1Z8_THITE/334-546-----------------------------------NSA------------------------------------------
T1KJU9_TETUR/1-134-----------------------------------NRA------------------------------------------
D7KJU6_ARALL/231-373-----------------------------------DAA------------------------------------------
Q6CPT1_KLULA/113-254-----------------------------------ERE------------------------------------------
G4MRQ6_MAGO7/382-591-----------------------------------NKA------------------------------------------
H6BKA5_EXODN/395-603-----------------------------------NKA------------------------------------------
M3ZSP2_XIPMA/204-342-----------------------------------NAA------------------------------------------
D7EHP9_TRICA/107-245-----------------------------------NKA------------------------------------------
D7TGT4_VITVI/456-598-----------------------------------DAA------------------------------------------
M2MNT8_BAUCO/2-142-----------------------------------SDA------------------------------------------
B4JYU7_DROGR/406-542-----------------------------------DDA------------------------------------------
M2R5C6_CERS8/312-622-----------------------------------DQA------------------------------------------
I2G755_USTH4/614-1021-----------------------------------DQA------------------------------------------
G2YI69_BOTF4/640-774-----------------------------------KEA------------------------------------------
M2LBF0_BAUCO/297-486-----------------------------------NRA------------------------------------------
W5FHC2_WHEAT/473-609-----------------------------------DSA------------------------------------------
B8M0U8_TALSN/418-647-----------------------------------NRA------------------------------------------
I7ME02_TETTS/181-321-----------------------------------CEA------------------------------------------
B8NFL9_ASPFN/369-570-----------------------------------NHA------------------------------------------
F7ADG8_MONDO/97-235-----------------------------------NAA------------------------------------------
S9VPX4_SCHCR/340-468-----------------------------------SDA------------------------------------------
B7GER0_PHATC/265-395-----------------------------------NAA------------------------------------------
A0E4N3_PARTE/17-156-----------------------------------DRA------------------------------------------
I3K0G5_ORENI/1247-1379-----------------------------------TKA------------------------------------------
A0A0C4E4W3_MAGP6/566-701-----------------------------------TKA------------------------------------------
Q4WG49_ASPFU/286-529-----------------------------------NRA------------------------------------------
J3NGE7_GAGT3/571-706-----------------------------------SEA------------------------------------------
Q23VX3_TETTS/28-165-----------------------------------FDA------------------------------------------
S3C8R4_OPHP1/452-730-----------------------------------NSA------------------------------------------
A0D256_PARTE/42-168-----------------------------------NDA------------------------------------------
A7ANQ1_BABBO/246-380-----------------------------------INA------------------------------------------
K1WQI3_MARBU/640-774-----------------------------------KRA------------------------------------------
N1RAN2_FUSC4/749-897-----------------------------------NSA------------------------------------------
M0SL27_MUSAM/525-663-----------------------------------DSA------------------------------------------
I1KSN3_SOYBN/457-595-----------------------------------DAA------------------------------------------
A5DC36_PICGU/83-220-----------------------------------DKA------------------------------------------
E9HGQ0_DAPPU/1-135-----------------------------------NQA------------------------------------------
V5F1H8_PSEBG/297-702-----------------------------------DQA------------------------------------------
E0VS89_PEDHC/1201-1325-----------------------------------NRA------------------------------------------
U1NTW9_ASCSU/150-282-----------------------------------GDS------------------------------------------
E7KM29_YEASL/155-291-----------------------------------SEA------------------------------------------
M2ZLJ7_PSEFD/365-555-----------------------------------NKA------------------------------------------
O77335_PLAF7/24-160-----------------------------------VSA------------------------------------------
F0XUX5_GROCL/280-497-----------------------------------NSA------------------------------------------
C3Y1F9_BRAFL/1604-1735-----------------------------------NKA------------------------------------------
K1QIA1_CRAGI/1268-1399-----------------------------------NKA------------------------------------------
Q0CTW5_ASPTN/425-627-----------------------------------NEA------------------------------------------
W5MRF3_LEPOC/1280-1411-----------------------------------NRA------------------------------------------
N1QE16_SPHMS/327-465-----------------------------------QEV------------------------------------------
C1GVY0_PARBA/671-807-----------------------------------TNA------------------------------------------
D5GAI5_TUBMM/941-1075-----------------------------------EEA------------------------------------------
U4LG29_PYROM/546-681-----------------------------------DKA------------------------------------------
A7TK77_VANPO/213-350-----------------------------------SEA------------------------------------------
T1JES8_STRMM/1256-1387-----------------------------------QKT------------------------------------------
F1NS70_CHICK/1295-1426-----------------------------------NRA------------------------------------------
F8QD12_SERL3/161-493-----------------------------------DQA------------------------------------------
I2GVC1_TETBL/450-593-----------------------------------SEA------------------------------------------
B4J3H0_DROGR/281-419-----------------------------------TQA------------------------------------------
F4R3K9_MELLP/487-752-----------------------------------DQA------------------------------------------
G2Q1Z5_THIHA/160-391-----------------------------------NTA------------------------------------------
T1JB38_STRMM/305-440-----------------------------------DAA------------------------------------------
G0W470_NAUDC/181-318-----------------------------------SQA------------------------------------------
D5GNV8_TUBMM/529-729-----------------------------------NQA------------------------------------------
F0X9L9_GROCL/466-601-----------------------------------VTA------------------------------------------
I1FS50_AMPQE/319-455-----------------------------------DTA------------------------------------------
A0C791_PARTE/169-302-----------------------------------MDQ------------------------------------------
U1GGT6_ENDPU/374-579-----------------------------------NAA------------------------------------------
F2U4B6_SALR5/26-157-----------------------------------KAD------------------------------------------
Q0UXB1_PHANO/123-324-----------------------------------NKA------------------------------------------
M3D6T2_SPHMS/5-146-----------------------------------THA------------------------------------------
J4IAX7_FIBRA/582-930-----------------------------------DQA------------------------------------------
R9PLK4_PSEHS/830-1245-----------------------------------DQA------------------------------------------
K3WL53_PYTUL/60-197-----------------------------------DQI------------------------------------------
MMI1_SCHPO/350-477-----------------------------------SDA------------------------------------------
F4RX17_MELLP/35-171-----------------------------------DKA------------------------------------------
G0T2B8_RHOG2/670-1019-----------------------------------QQA------------------------------------------
K5VXL5_PHACS/571-840-----------------------------------DQA------------------------------------------
S8AI65_DACHA/477-669-----------------------------------NDA------------------------------------------
J9JSF7_ACYPI/99-234-----------------------------------NQA------------------------------------------
A0A0D1E4L6_USTMA/726-863-----------------------------------DKA------------------------------------------
U5HCN5_USTV1/575-723-----------------------------------DQA------------------------------------------
M7X3Z8_RHOT1/666-1012-----------------------------------QQA------------------------------------------
S7ZRN7_PENO1/422-658-----------------------------------NHA------------------------------------------
A0A068YDE4_ECHMU/401-537-----------------------------------NAA------------------------------------------
M3AKS3_PSEFD/271-466-----------------------------------DSA------------------------------------------
S8EIQ3_FOMPI/603-928-----------------------------------DQA------------------------------------------
H3GWX4_PHYRM/253-395-----------------------------------KMA------------------------------------------
A7E4D0_SCLS1/650-784-----------------------------------KET------------------------------------------
G0RBB9_HYPJQ/259-394-----------------------------------ASA------------------------------------------
B2ARG7_PODAN/13-148-----------------------------------TEA------------------------------------------
M1CBM7_SOLTU/322-464-----------------------------------DTA------------------------------------------
C5DJE4_LACTC/115-250-----------------------------------SQA------------------------------------------
E9CW19_COCPS/506-642-----------------------------------VDA------------------------------------------
A2R166_ASPNC/418-622-----------------------------------NEA------------------------------------------
A0A023B246_GRENI/12-144-----------------------------------SQS------------------------------------------
K1V256_TRIAC/598-935-----------------------------------DQA------------------------------------------
H2AVY0_KAZAF/114-253-----------------------------------STA------------------------------------------
U9SY90_RHIID/16-149-----------------------------------NKA------------------------------------------
D7FPL2_ECTSI/246-375-----------------------------------NSA------------------------------------------
M3AKK0_PSEFD/1-137-----------------------------------TEA------------------------------------------
G4V1D5_NEUT9/504-639-----------------------------------TKA------------------------------------------
M4BLQ1_HYAAE/253-395-----------------------------------KTA------------------------------------------
E3L1K1_PUCGT/165-453-----------------------------------DQA------------------------------------------
Q8ILQ1_PLAF7/371-505-----------------------------------VNL------------------------------------------
S3CZX6_GLAL2/392-590-----------------------------------NKA------------------------------------------
D7KVZ9_ARALL/316-458-----------------------------------DSA------------------------------------------
K3WDK3_PYTUL/256-398-----------------------------------KFA------------------------------------------
C1G9S2_PARBD/356-556-----------------------------------NRA------------------------------------------
A7ANR0_BABBO/25-162-----------------------------------DKA------------------------------------------
V5I0K1_BYSSN/496-699-----------------------------------NRA------------------------------------------
C8V3R8_EMENI/419-625-----------------------------------NRA------------------------------------------
G8JU51_ERECY/138-279-----------------------------------SKA------------------------------------------
U5H5H6_USTV1/766-1126-----------------------------------HQA------------------------------------------
J9K832_ACYPI/334-468-----------------------------------DQA------------------------------------------
S3CNK2_OPHP1/560-695-----------------------------------RNR------------------------------------------
D8QT35_SELML/2-137-----------------------------------DAA------------------------------------------
A0D629_PARTE/49-182-----------------------------------DEL------------------------------------------
A9USV5_MONBE/253-383-----------------------------------NAS------------------------------------------
F9X648_ZYMTI/3-143-----------------------------------TQA------------------------------------------
G2QHR3_THIHA/207-342-----------------------------------SKA------------------------------------------
Q6C164_YARLI/197-381-----------------------------------NKA------------------------------------------
A0A068Y5Q0_ECHMU/21-159-----------------------------------NRA------------------------------------------
Q4UE68_THEAN/26-159-----------------------------------TKY------------------------------------------
N1PQZ2_DOTSN/317-457-----------------------------------MQV------------------------------------------

PF01878

P74098_SYNY3/2-139-----------------------------------SKE------------------------------------------
Q9WWK9_SYNP2/2-141-----------------------------------KNK------------------------------------------
A6BZ09_9PLAN/29-165-----------------------------------KNK------------------------------------------
A7I926_METB6/3-143-----------------------------------KNK------------------------------------------
A3JN92_9RHOB/3-135-----------------------------------K..------------------------------------------
A8LMB8_DINSH/3-149-----------------------------------R.K------------------------------------------
A1U8X5_MYCSK/2-132-----------------------------------R..------------------------------------------
YOUG_BACLI/5-143-----------------------------------R..------------------------------------------
A6EIT2_9SPHI/6-138-----------------------------------R..------------------------------------------
YDCG_BACSU/4-136-----------------------------------K..------------------------------------------
A5CUD6_CLAM3/3-135-----------------------------------E.R------------------------------------------
Y1062_HELHP/2-131-----------------------------------R..------------------------------------------
Y442_STRMU/3-132-----------------------------------R..------------------------------------------
Y254_STRSV/3-132-----------------------------------R..------------------------------------------
A0A0A8UTV7_LEGHA/3-136-----------------------------------R..------------------------------------------
A1WQL9_VEREI/5-137-----------------------------------R..------------------------------------------
Q2KBY7_RHIEC/3-135-----------------------------------R..------------------------------------------
Y8638_RHILO/3-120-----------------------------------R..------------------------------------------
Y3206_RHILO/3-137-----------------------------------R..------------------------------------------
Q2GIJ6_ANAPZ/5-132-----------------------------------K.A------------------------------------------
Q73H50_WOLPM/2-129-----------------------------------K.I------------------------------------------
Q2GF45_EHRCR/2-130-----------------------------------K.T------------------------------------------
Q5FGQ0_EHRRG/2-130-----------------------------------R.L------------------------------------------
Q024K9_SOLUE/2-130-----------------------------------L.N------------------------------------------
Q5KKF6_CRYNJ/7-162-----------------------------------REK------------------------------------------
B4U7S2_HYDS0/2-128-----------------------------------K.S------------------------------------------
Q1D7F1_MYXXD/5-135-----------------------------------R.A------------------------------------------
Q7S515_NEUCR/88-252-----------------------------------R.S------------------------------------------
Q0U623_PHANO/118-277-----------------------------------Q.A------------------------------------------
Q0CLU5_ASPTN/109-262-----------------------------------R.E------------------------------------------
Q7NK15_GLOVI/2-148-----------------------------------L.A------------------------------------------
Q4E145_TRYCC/13-158-----------------------------------R.A------------------------------------------
Q4Q067_LEIMA/12-157-----------------------------------R.A------------------------------------------
Q1QBK5_PSYCK/2-150-----------------------------------RDD------------------------------------------
THYN1_HUMAN/55-219-----------------------------------R.A------------------------------------------
Q6MNE3_BDEBA/2-149-----------------------------------MKD------------------------------------------
Q4K403_PSEF5/2-148-----------------------------------R.A------------------------------------------
A4B9S6_9GAMM/2-149-----------------------------------R.E------------------------------------------
A0YIC7_LYNSP/2-148-----------------------------------R.R------------------------------------------
Q10WF5_TRIEI/2-148-----------------------------------R.Q------------------------------------------
Q8YY67_NOSS1/2-148-----------------------------------R.Q------------------------------------------
Q5SK57_THET8/2-146-----------------------------------M.Q------------------------------------------
Q2JN10_SYNJB/2-148-----------------------------------K.A------------------------------------------
P74153_SYNY3/2-148-----------------------------------Q.T------------------------------------------
Q31PN6_SYNE7/2-148-----------------------------------R.Q------------------------------------------
A2BYF2_PROM5/5-151-----------------------------------R.R------------------------------------------
A5GV42_SYNR3/7-153-----------------------------------R.S------------------------------------------
Q7V5V1_PROMM/7-153-----------------------------------R.S------------------------------------------
Q7VA84_PROMA/7-153-----------------------------------R.S------------------------------------------
Q46J77_PROMT/7-153-----------------------------------R.S------------------------------------------
A4CF59_9GAMM/2-149-----------------------------------RDG------------------------------------------
Q080Z6_SHEFN/2-151-----------------------------------RDQ------------------------------------------
M6BZG6_LEPBO/2-151-----------------------------------RDS------------------------------------------
Q7UMR5_RHOBA/2-156-----------------------------------RDE------------------------------------------
A6G9B9_9DELT/7-159-----------------------------------RDE------------------------------------------
Q1IWR4_DEIGD/15-161-----------------------------------R.E------------------------------------------
Q21FZ3_SACD2/2-148-----------------------------------RDE------------------------------------------
A3ZLP5_9PLAN/16-165-----------------------------------RDD------------------------------------------
Q3A4Z6_PELCD/6-155-----------------------------------RDE------------------------------------------
B3E7D4_GEOLS/2-150-----------------------------------RDE------------------------------------------
Q74AS6_GEOSL/6-154-----------------------------------RDE------------------------------------------
A1ATY5_PELPD/2-150-----------------------------------RDT------------------------------------------
Q312I8_DESAG/2-150-----------------------------------RDE------------------------------------------
Q1MR11_LAWIP/2-150-----------------------------------RDE------------------------------------------
Q729D5_DESVH/2-149-----------------------------------R.T------------------------------------------
A1U5E7_MARHV/2-150-----------------------------------A.Q------------------------------------------
A6VZD9_MARMS/3-149-----------------------------------K.E------------------------------------------
A0XX89_9GAMM/2-150-----------------------------------RDD------------------------------------------
Q15ZW9_PSEA6/6-155-----------------------------------RDQ------------------------------------------
Q2SNU3_HAHCH/2-150-----------------------------------RDD------------------------------------------
Q2C4F7_9GAMM/2-148-----------------------------------RDE------------------------------------------
A7K5A8_VIBAE/2-149-----------------------------------RDQ------------------------------------------
Q143L8_BURXL/2-150-----------------------------------RDE------------------------------------------
B7WUP3_COMTE/10-158-----------------------------------RDD------------------------------------------
Q7P0R4_CHRVO/4-152-----------------------------------RDD------------------------------------------
Q129F1_POLSJ/2-150-----------------------------------RDA------------------------------------------
A6SVM1_JANMA/2-150-----------------------------------RDA------------------------------------------
A3RRU2_RALSL/81-227-----------------------------------RDR------------------------------------------
B2JES7_BURP8/2-150-----------------------------------RDI------------------------------------------
Q82TJ8_NITEU/2-150-----------------------------------RNQ------------------------------------------
Q478H8_DECAR/2-148-----------------------------------RDA------------------------------------------
Q0HU59_SHESR/2-151-----------------------------------RDA------------------------------------------
B4SI17_STRM5/6-155-----------------------------------RDG------------------------------------------
Q83BN8_COXBU/2-151-----------------------------------RDG------------------------------------------
A1WW93_HALHL/2-151-----------------------------------RDH------------------------------------------
Q60BW0_METCA/2-151-----------------------------------RDE------------------------------------------
Q0A5L0_ALKEH/2-151-----------------------------------RDQ------------------------------------------
A4BS86_9GAMM/2-151-----------------------------------RDQ------------------------------------------
Q1K2S0_DESAC/2-151-----------------------------------RDD------------------------------------------
A0RTQ4_CENSY/6-139-----------------------------------R.N------------------------------------------
A9A4S8_NITMS/3-136-----------------------------------R.E------------------------------------------
Q2IM08_ANADE/10-138-----------------------------------R.A------------------------------------------
A9AWV2_HERA2/2-132-----------------------------------R.A------------------------------------------
B8GCZ0_CHLAD/3-133-----------------------------------R.A------------------------------------------
A0ZBN7_NODSP/2-132-----------------------------------R.N------------------------------------------
A2XKL1_ORYSI/18-161-----------------------------------R.A------------------------------------------
Q1N713_SPHSS/19-149-----------------------------------R.A------------------------------------------
A5V5W6_SPHWW/16-146-----------------------------------K.A------------------------------------------
A3HZ69_9BACT/9-137-----------------------------------K.E------------------------------------------
Q1GUB4_SPHAL/4-135-----------------------------------M.A------------------------------------------
Q2G8P8_NOVAD/13-143-----------------------------------R.S------------------------------------------
Q2NBR4_ERYLH/3-133-----------------------------------A.A------------------------------------------
A3W9K5_9SPHN/3-133-----------------------------------R.A------------------------------------------
Q1V170_PELUQ/2-134-----------------------------------R.A------------------------------------------
A6EJQ3_9SPHI/2-132-----------------------------------K.A------------------------------------------
Q11YZ0_CYTH3/2-132-----------------------------------R.E------------------------------------------
A5G2F8_ACICJ/2-132-----------------------------------K.A------------------------------------------
Q5FQF2_GLUOX/2-132-----------------------------------S.A------------------------------------------
Q2RNC8_RHORT/2-132-----------------------------------K.A------------------------------------------
A4TWZ7_9PROT/2-132-----------------------------------K.A------------------------------------------
A7HSS8_PARL1/2-134-----------------------------------K.A------------------------------------------
Q0C4X5_HYPNA/2-134-----------------------------------R.E------------------------------------------
Q0G4A9_9RHIZ/2-134-----------------------------------R.E------------------------------------------
Q2K3E0_RHIEC/2-135-----------------------------------R.A------------------------------------------
Q98EI4_RHILO/2-134-----------------------------------K.A------------------------------------------
Q8KZ39_9PROT/2-134-----------------------------------R.A------------------------------------------
A3JM70_9RHOB/2-134-----------------------------------R.Q------------------------------------------
A4EH47_9RHOB/9-141-----------------------------------R.A------------------------------------------
B0UCG1_METS4/2-134-----------------------------------Q.A------------------------------------------
E0TE14_PARBH/2-135-----------------------------------Q.E------------------------------------------
A7IEB4_XANP2/28-160-----------------------------------L.A------------------------------------------
Q13DX9_RHOPS/2-134-----------------------------------I.A------------------------------------------
A6EMU5_9BACT/174-313-----------------------------------KDK------------------------------------------
Q8ZZI9_PYRAE/3-147-----------------------------------K.R------------------------------------------
A4WL01_PYRAR/3-147-----------------------------------K.L------------------------------------------
A3CVK7_METMJ/19-161-----------------------------------E.R------------------------------------------
Q2FT29_METHJ/14-155-----------------------------------S.R------------------------------------------
Q2FP01_METHJ/2-143-----------------------------------T.R------------------------------------------
A6UNC0_METVS/2-141-----------------------------------S.K------------------------------------------
A6VFA8_METM7/22-163-----------------------------------A.K------------------------------------------
Y1033_PYRHO/2-143-----------------------------------S.R------------------------------------------
Y875_PYRAB/2-141-----------------------------------K.R------------------------------------------
Y2356_ARCFU/2-145-----------------------------------A.K------------------------------------------
Y3536_METJA/2-144-----------------------------------N.K------------------------------------------
Q4JC14_SULAC/2-142-----------------------------------R.Y------------------------------------------
A4YGW0_METS5/2-141-----------------------------------SKY------------------------------------------
Y2595_SULSO/2-141-----------------------------------EEF------------------------------------------

PF12961

B0T870_CAUSK/4-75--------------------------------RR.NDR-----------EFAV---------------------------
R9TBY5_9EURY/3-77--------------------------------IN.DDR-----------GFQI---------------------------
A2SN47_METPP/13-94--------------------------------RR.RDR-----------DYRV---------------------------
R6E210_9FIRM/7-77--------------------------------RK.DDD-----------DVQV---------------------------
J9RHJ8_9ACTN/3-74--------------------------------RV.HDR-----------DYQA---------------------------
R5Y974_9FIRM/3-77--------------------------------RK.KDR-----------PFEI---------------------------
R7BMW7_9FIRM/17-92--------------------------------RK.NDR-----------GFQR---------------------------
D3UZP9_XENBS/15-94--------------------------------VK.DDR-----------DYKS---------------------------
X2H0U5_9BACI/244-319--------------------------------GF.NNQ-----------SFRV---------------------------
R6TFC5_9FIRM/329-401--------------------------------RK.NDR-----------GYKQ---------------------------
R5F6I4_9CLOT/7-75--------------------------------RV.DED-----------NVQV---------------------------
A7MEP6_CROS8/3-73--------------------------------RK.NDR-----------NYQV---------------------------
M9SC14_9EURY/4-81--------------------------------RREDDR-----------MFHI---------------------------
K8EIC3_CARML/4-76--------------------------------RK.NDR-----------NFQE---------------------------
W8FAL7_9BACT/20-95--------------------------------RE.NDR-----------HFSV---------------------------
R5KJ01_9CLOT/4-86--------------------------------RR.NDR-----------CYQK---------------------------
A6LYH9_CLOB8/3-77--------------------------------VK.YNR-----------DFSV---------------------------
R9VFQ2_9ENTR/5-83--------------------------------RR.ADR-----------DFAV---------------------------
F0LNE9_VIBFN/7-81--------------------------------RF.NDR-----------NYQV---------------------------
R6T3D1_9FIRM/130-204--------------------------------RK.NDR-----------GFQP---------------------------
B2TNZ8_CLOBB/5-89--------------------------------RK.NDR-----------EFEV---------------------------
D4MVL8_9FIRM/411-483--------------------------------QK.NDR-----------NYQI---------------------------
R9TAF8_9EURY/14-88--------------------------------IN.DNG-----------DYQV---------------------------
A8E2L6_BPPHE/105-175--------------------------------RK.NDR-----------NYHV---------------------------
A8FAI2_BACP2/6-76--------------------------------RK.NDR-----------EFQV---------------------------
Q8CWZ2_STRMU/4-76--------------------------------RK.NDR-----------HYQV---------------------------
Q832V0_ENTFA/113-183--------------------------------RK.NDR-----------NYQN---------------------------
W8FCI0_9BACT/21-96--------------------------------RL.NDR-----------NFRV---------------------------
K8E4A8_CARML/4-76--------------------------------RK.NDR-----------DYKV---------------------------

PF04266

Q7PS17_ANOGA/408-520--------------------------------RT-WYS-----------S....--------------------------
Q1Z8F3_PHOPR/9-107--------------------------------RD-ESE-----------RYYV.--------------------------
O59345_PYRHO/1-111--------------------------------RF-GKY-----------EAKP.--------------------------
Q669U5_YERPS/14-127--------------------------------..-DDE-----------GVPL.--------------------------
O28749_ARCFU/4-103--------------------------------RR-GIK-----------SYPV.--------------------------
Q57H41_SALCH/24-141--------------------------------QK-EQP-----------PVTP.--------------------------
Q2P9X4_BPP2/8-81--------------------------------RK-NDR-----------NYER.--------------------------
B9WV89_STRSU/24-154--------------------------------AV-EGE-----------EIPT.--------------------------
B1YID4_EXIS2/5-113--------------------------------RL-NDQ-----------KRQA.--------------------------
Q1ZT49_PHOAS/30-153--------------------------------SE-QGE-----------LMPE.--------------------------
Q82ZD1_ENTFA/26-150--------------------------------KM-EEE-----------QLPK.--------------------------
Q3EQG9_BACTI/8-116--------------------------------RL-YDK-----------KRQL.--------------------------
Q5WBH3_BACSK/27-150--------------------------------EL-EQE-----------SLPK.--------------------------
Q8ZYT1_PYRAE/11-109--------------------------------RY-GIV-----------RPRF.--------------------------
Q666W1_YERPS/141-216--------------------------------RV-NDR-----------DFSV.--------------------------
Q8ZVS1_PYRAE/5-102--------------------------------RP-GVL-----------KVAD.--------------------------
A6TNT9_ALKMQ/35-158--------------------------------AF-EDQ-----------SIPE.--------------------------
Q8A7V1_BACTN/8-125--------------------------------SL-MNQ-----------EEIK.--------------------------
TRIP4_HUMAN/437-549--------------------------------RS-WYT-----------P....--------------------------
B7MCE4_ECO45/27-144--------------------------------CI-EDN-----------AFPM.--------------------------
Q5SM30_THET8/8-102--------------------------------RR-RKT-----------R....--------------------------
Q8G683_BIFLO/18-143--------------------------------EE-EVE-----------PLPC.--------------------------
Q28T99_JANSC/34-145--------------------------------AS-GED-----------AMPQ.--------------------------
Q1Z8W3_PHOPR/30-153--------------------------------ES-GEE-----------PMPT.--------------------------
Q38XJ8_LACSS/28-150--------------------------------E.-PNE-----------HVPQ.--------------------------
Q74J94_LACJO/27-149--------------------------------D.-KNE-----------KLPQ.--------------------------
O59585_PYRHO/4-98--------------------------------RK-TPT-----------K....--------------------------
Y1447_PASMU/6-104--------------------------------RD-KSE-----------SSFQ.--------------------------
Q3M1U7_ANAVT/4-110--------------------------------RV-WPI-----------H....--------------------------
Q8TY14_METKA/239-342--------------------------------RV-KDD-----------KRAR.--------------------------
Q4DDP1_TRYCC/470-580--------------------------------RV-WHT-----------D....--------------------------
Q8TV24_METKA/9-109--------------------------------RV-GRV-----------PGAR.--------------------------
Q4SHG6_TETNG/424-545--------------------------------RT-WYT-----------S....--------------------------
Q5FJH1_LACAC/26-145--------------------------------..-HNE-----------DVPT.--------------------------
Q8LGK4_ARATH/109-212--------------------------------RC-AVG-----------DYMR.--------------------------
O28463_ARCFU/4-98--------------------------------RK-WTN-----------LKEG.--------------------------
Q39AD2_BURL3/6-102--------------------------------RS-WAP-----------PALP.--------------------------
Q49VC6_STAS1/27-147--------------------------------KV-EGE-----------PLPE.--------------------------
O58093_PYRHO/5-109--------------------------------RL-YDE-----------KRRQ.--------------------------
Q8DSX1_STRMU/61-181--------------------------------KV-DNE-----------PLPQ.--------------------------
Q97KB9_CLOAB/33-156--------------------------------EL-END-----------PLPK.--------------------------
Q29GM2_DROPS/388-499--------------------------------RV-WYS-----------E....--------------------------
YO91_BPP2/8-81--------------------------------RK-KDR-----------NYER.--------------------------
Q8ES55_OCEIH/29-152--------------------------------LA-DGD-----------SLPE.--------------------------
Q74MN0_NANEQ/4-103--------------------------------RI-GKL-----------PIKK.--------------------------
A0A0B8RBU5_LISMN/29-152--------------------------------DQ-GGE-----------TMPS.--------------------------
Q5JIS1_THEKO/5-129--------------------------------RK-SRA-----------F....--------------------------
Q57UA7_TRYB2/469-579--------------------------------RV-WST-----------D....--------------------------
Q9KEN6_BACHD/5-112--------------------------------RL-NDA-----------KRRQ.--------------------------
Y1576_VIBCH/7-105--------------------------------RD-KSE-----------SHYV.--------------------------
Q6DAK1_PECAS/16-132--------------------------------AF-KSE-----------PSPQ.--------------------------
Q8DQF2_STRR6/24-144--------------------------------VL-EDE-----------PLPQ.--------------------------
Q7Y1E7_ORYSJ/14-135--------------------------------RS-WPS-----------P....--------------------------
A5VL14_LACRD/4-98--------------------------------RT-WTT-----------K....--------------------------
Q5JEH0_THEKO/6-109--------------------------------RV-AYP-----------QFRN.--------------------------
F8Y0N6_STRAG/6-81--------------------------------RY-NDR-----------DFKV.--------------------------
Q5JHR0_THEKO/9-103--------------------------------RK-SRT-----------K....--------------------------
Q6FET4_ACIAD/8-104--------------------------------RS-WRP-----------DVLP.--------------------------
Y267_MORMI/5-104--------------------------------RD-KSD-----------SHYL.--------------------------
Q9AA41_CAUCR/6-84--------------------------------RR-NDR-----------EFAV.--------------------------
Q6MN09_BDEBA/6-102--------------------------------RR-WLP-----------PADL.--------------------------
Q9CH09_LACLA/21-146--------------------------------G.-EDE-----------PFPS.--------------------------
Q5JEG9_THEKO/4-104--------------------------------RL-GRK-----------PNLK.--------------------------
Q8TYL3_METKA/4-109--------------------------------RP-SDH-----------RSFRY--------------------------
O58177_PYRHO/25-125--------------------------------RL-GRK-----------VNLK.--------------------------
Q6ZM46_DANRE/402-514--------------------------------RT-WYT-----------S....--------------------------
Q6F0Z5_MESFL/5-88--------------------------------RF-KMP-----------ELNI.--------------------------
A9VQI1_BACWK/25-145--------------------------------ES-ENE-----------PLPT.--------------------------
Q5JEL3_THEKO/6-109--------------------------------RL-YDE-----------KRQK.--------------------------
O86782_STRCO/58-183--------------------------------EH-EGE-----------PLPE.--------------------------
Q4QIG2_LEIMA/490-600--------------------------------RV-WGT-----------T....--------------------------
O58178_PYRHO/7-110--------------------------------RV-AYP-----------QLKG.--------------------------
Q1WTR7_LACS1/28-149--------------------------------E.-ENE-----------RIPQ.--------------------------
Q53LS7_ORYSJ/126-229--------------------------------RL-AAG-----------NYNR.--------------------------
Q5JG45_THEKO/12-113--------------------------------RY-GDY-----------EAKP.--------------------------
Y2524_SHEB5/6-104--------------------------------RD-EAE-----------SHVI.--------------------------
Y1394_HAEIN/6-104--------------------------------RD-DSE-----------SHFK.--------------------------
Q1ZQA8_PHOAS/10-108--------------------------------RD-ESE-----------SHYV.--------------------------
H7C704_ENTFA/11-82--------------------------------RK-NDR-----------NFQV.--------------------------
A0A0E1EJ20_STRAG/24-144--------------------------------EL-DEE-----------ELPQ.--------------------------

PF02190

LONM_ASHGO/157-410.KD...........................RSMD-KDS...IDS......IEEV..........................
LONM1_DICDI/158-355.KD............................AYR-NNN...NQIGR...TIDSI..........................
A5DBM7_PICGU/11-325................................SE-KAA.......E...GISEFHQAQANASSTEVAAPETGFDWLVLAI
A5DAP1_PICGU/270-494..K............................DPN-EPD...TDIIR...SKDSV..........................
Q0UIT5_PHANO/192-422................................NR-SSA...SQGNL...GTAPF..........................
A1SL63_NOCSJ/4-197..R...........................EGYE-VGE.......H...GAQSL..........................
LON1_BDEBA/7-200................................TQ-KNP...NASVD...KIEDL..........................
LON_CLOPH/7-201................................SQ-IDA...ETENP...TADDL..........................
LON_AQUAE/16-212................................LQ-KDK...DVEEP...KEEDI..........................
Q9X1W8_THEMA/31-225................................NQ-KDP...SVEIP...EPEDL..........................
A8L4P8_FRASN/6-237..................................-.........PR...VDGDL..........................
LON_NEOSM/32-229................................AQ-KNP...KKEIP...EGKDL..........................
A5CDI0_ORITB/12-207................................TQ-KNA...DDIKP...SINSL..........................
LON_DESVH/17-214................................AQ-REP...ELEKP...GPEDL..........................
A7HIT3_ANADF/21-218..................................-..K...ADAQQ...LRPPL..........................
LONM_CAEEL/88-357.RD...........................DENK-EET...ITS......LSEV..........................
LONM_ORYSJ/101-311EEGTDPNI.................VTSSDSDKS-IDD...LKGKE...LLQRL..........................
LON_FLAJ1/43-237................................SQ-INE...EDEDP...SKDDI..........................
LON_FUSNN/3-196................................LQ-KDA...SQENP..TFDGDI..........................
Q176B8_AEDAE/115-373.KD...........................DENP-NEV...VDN......LTEI..........................
B1YJV9_EXIS2/5-196................................TQ-RDP....EAEP...SVDGL..........................
LON_DESOH/21-214................................TP-KSGERKSDYGP.....GDL..........................
Q4UE63_THEAN/226-447ERPNDVNNS...............NNLPMLRDDA-GSV...SSC.......DEM..........................
LON_KORVE/24-217................................AQ-REA...RVDSP...QPSDL..........................
LON_SYNAS/22-218...............................LTR-KAP...SAEGPL.CQCEDL..........................
A4RYB7_OSTLU/20-244..................................-..A.......P...SNGQI..........................
Q39SL1_GEOMG/12-202................................RP-RD....EAAPG...GIPPF..........................
Q5SJA3_THET8/5-197................................SQ-RDK...EVETP...RPSDL..........................
YOXA_SCHPO/252-470..A............................RSD-GHNEHRELRNA...RGQRLF.........................
A1TLG4_ACIAC/20-217...............................TDG-HEV...RQAGA...APEKF..........................
A9AWT0_HERA2/15-210................................FV-SEAEIEAYKGH...EPQQL..........................
C1DQT6_AZOVD/30-226.DP...........................PPED-AED...FDP.......DKL..........................
Q7MWJ0_PORGI/9-205................................SQ-RDM...DVEEP...DRADL..........................
LONP2_NEUCR/10-256GPEGHLLIENGD.........DKTETADDVDPAK-AT.............KADL..........................
A6L531_BACV8/39-234................................CQ-IQG...DMDDP...GFNDV..........................
Q9S2T2_STRCO/5-222FEVAQTAPGLPD..........PTATLERGPTAG-FGT.......D...PLKAF..........................
LONM_YARLI/202-503..K...........................EFSN-ADV...IQD......ASEV..........................
Q3A8K2_PELCD/13-206................................CQ-KEL...GQETP...TAEDI..........................
LONP2_YARLI/4-302KQIKETGENNEAG........AHDSESVTPVLGT-NST.......E...VNTSV..........................
LONP2_BOVIN/12-220.IPN.........................TPDPA-SDA.......Q...DLPPL..........................
LON2_SYNFM/17-208................................AQ-RNE...EAEEA...SPADI..........................
LONP2_CANAL/21-402VISPEAVEGIKEFFQY..ETGMKTGRGVEKGVKS-TQN.......D...AIKEFDWLTLAIIPNLEKI............
LON1_HERA2/13-209................................AL-KN....EDERPNPVLPEDF..........................
Q4FNU4_PELUB/9-201................................KN-NDD.......S...SIPGL..........................
Q057E4_BUCCC/10-202................................TQ-KEP...TIENP...KKNDL..........................
Q1D5A0_MYXXD/32-225................................TQ-RRA...EEEDP...GAADL..........................
A4FLR4_SACEN/3-200..R...........................QGWE-VGE.......D...NVDSM..........................
Q4X3M7_PLACH/41-324AYDFLTDQELNTNFFLKNDEKANVPILNDKNKII-RKD...IDYIT...SFSDI..........................
LON_DICNV/5-198................................PQ-RDP...AVVEP...TLADL..........................
LON_NITOC/5-198................................PQ-KDP...RTDEP...AADDL..........................
Q67SJ7_SYMTH/11-204................................MQ-KDA...KNEMP...TPDDI..........................
A4YSN7_BRASO/70-260................................LQ-KQQ...AVDEP...SLADL..........................
LONP2_ASPNC/10-255SKDGQRLIDDGS.........LDEDRREEFDMID-AGQ.......S...RKEDL..........................
Q0U2R2_PHANO/14-258SPKDGRLLIEDGA........SMGKTVYESDPMQ-AG.............KKDV..........................
Q4FM92_PELUB/7-199................................TQ-KNS...EIDDP...KKTDV..........................
Q8ILU7_PLAF7/45-357HLETNNTFYNKNCNTYKPPDFLNEKRIKVDKNIL-KKD...IDICT...NINDI..........................
LON_MYCPE/15-212................................SQ-ENP...SIDSP...SKNEI..........................
CRBN_RAT/83-320..................................-..S.......N...VQERE..........................
A5K180_PLAVS/44-319NEKEGGLFNEAH.........FKMDVPIGGKPFL-KKD...IAFIK...DVGEV..........................
LON2_HERA2/18-210................................AQ-RAI...EIEEH...DTSQL..........................
LON_MAGMM/41-240.HA...........................EDGQ-.EV...FDA.......NQL..........................
LON1_DESPS/34-236.TR...........................QDPD-GQV...KAPES....ADDF..........................
LON_MYCMO/2-196................................PQ-KNIKQNEIE.....FEKDL..........................
LONP2_PICST/18-364VAVEGIEQFFKYEAA....FKNSQGLVSEKDIAE-V.........A...PSNEFDWLTLAIKPNLEK.............
B1HVE4_LYSSC/9-197................................TQ-KEM...HDEQP...EEQDL..........................
E4XTK2_OIKDI/43-290.SEI..........................DLKN-IPV...YERNM...TTGKI..........................
G1TBZ8_RABIT/210-407..................................-..........D...TQNSF..........................
I1QQQ1_ORYGL/12-253DSEAAGSLLSPGVGSD.SGEGGSKAPGGSAGEST-KQD...TKNGK...ETIHW..........................
J9Z7L8_LEPFM/44-237................................AE-KER...EEGES...RGDPV..........................
J9ZC05_LEPFM/4-193................................KE-GWE...AQY.D...QSPPI..........................
J9ZD27_LEPFM/11-209.QR...........................PESQ-DAP..EEEGKT...FPDRL..........................
M4B6H0_HYAAE/97-299.SIGD.......................LLKDSG-GDD.....LVR...HLSEL..........................
LON2_BORBU/9-200................................SN-EPNC.DESDRG...VVKNL..........................
P96280_MYCTU/8-204................................SR-GRE...V...G...GGDTR..........................
LON1_BORBU/31-231.DKFL.......................EKNNNN-AQQ...KLIID...YSKDI..........................
Q5E916_ARATH/98-437................................YR-EGA............QFKY..........................
Q5NH45_FRATT/7-203................................TQ-KNG...SSGGD...VVENI..........................
Q63XL2_BURPS/11-205................................KS-GPE...VAQ......EGEVS.........................
Q6FD62_ACIAD/18-212................................AQ-KDS...LTEEI...DHDNL..........................
Q87YR8_PSESM/6-197................................AQ-RNP...ADDDP...DEKAL..........................
R5K463_9CLOT/9-200................................T.-AKE...VKENS...KVPDL..........................
R6MYW8_9CLOT/11-203................................PQ-LDI...KDEDP...GVDNL..........................

PF09157

TRUB_XYLFA/245-300-------------------------.TG---------------.R--VAV-------F....SR----------------
TRUB_ACTSZ/247-304-------------------------.YG---------------.Q--VRL-------F....SA----------------
TRUB_CHRVO/242-300-------------------------.MQ---------------.R--FRV-------Y...QQS----------------
TRUB_AZOSB/241-294-------------------------.QG---------------.S--VRL-------F.....C----------------
Q609C4_METCA/59-115-------------------------.VG---------------EL--VRV-------Y....GG----------------
TRUB_SHIDS/252-309-------------------------.EG---------------.L--VRV-------T...EGE----------------
TRUB_YERPE/252-309-------------------------.EG---------------.M--VRI-------T...EGK----------------
Q140U4_BURXL/245-306-------------------------.AP---------------.R--VRV-------Y....AA----------------
TRUB_PSYIN/251-308-------------------------.NT---------------.V--LRI-------T...VGE----------------
TRUB_MARHV/244-302-------------------------.EG---------------.F--VRL-------Y.....G----------------
TRUB_SHEFN/251-308-------------------------.DE---------------.L--VRI-------T...IGD----------------
TRUB_VIBF1/251-308-------------------------.DG---------------.I--VRM-------T...SGD----------------
Q0VSR9_ALCBS/246-303-------------------------.DG---------------.W--VSV-------Y...QAS----------------
TRUB_NOSS1/234-289-------------------------.IG---------------.K--VRV-------Y...QAE----------------
TRUB_PSEHT/253-308-------------------------.EG---------------.A--IKV-------V.....A----------------
TRUB_ACTP2/246-303-------------------------.YG---------------.Q--VRL-------F....SH----------------
TRUB_COXBU/250-306-------------------------.HG---------------.F--VRL-------R....DQ----------------
TRUB_SACD2/250-310-------------------------.EG---------------DK--VRV-------F....DS----------------
TRUB_NITMU/246-307-------------------------.PG---------------RQ--VRL-------Y....DK----------------
TRUB_ACIAD/262-316-------------------------.VP---------------.E--VLV-------F.....E----------------
TRUB_GLOVI/235-289-------------------------.EG---------------AF--AQI-------W...ECE----------------
TRUB_MANSM/246-303-------------------------.QG---------------.Q--VRL-------F....SP----------------
TRUB_NITEU/231-291-------------------------.NT---------------.Q--LKL-------Y....DD----------------
TRUB_PSEA6/251-311-------------------------.QG---------------TL--VRT-------Y...CTE----------------
A4SY76_POLSQ/241-299-------------------------.A.---------------.L--VRI-------Y...RAT----------------
TRUB_BAUCH/253-312-------------------------.SG---------------.L--VRM-------C...ENK----------------
A0KNE1_AERHH/266-323-------------------------.SG---------------.Q--VRM-------T...VGP----------------
TRUB_SODGM/249-306-------------------------.AG---------------.L--VRL-------T...EGD----------------
A0ZIL4_NODSP/234-288-------------------------.SG---------------.I--LRV-------Y....DQ----------------
TRUB_PECAS/252-309-------------------------.NG---------------.M--VRI-------T...EGD----------------
TRUB_BUCBP/244-301-------------------------.NQ---------------.F--VRI-------T...EGI----------------
Q0K9C1_CUPNH/232-294-------------------------.DA---------------.L--ARV-------Y...AGE----------------
TRUB_SHEAM/251-308-------------------------.DS---------------.L--LRI-------T...LGE----------------
TRUB_HALHL/245-301-------------------------.EG---------------.W--LRL-------Y....DR----------------
TRUB_PHOLL/251-310-------------------------VES---------------.M--VRV-------T...EGD----------------
TRUB_THIDA/239-293-------------------------.RG---------------.L--VRV-------Y....DG----------------
TRUB_IDILO/246-303-------------------------.DA---------------EE--WRV-------A....TE----------------
TRUB_METFK/241-297-------------------------.SG---------------.L--FRL-------Y....SE----------------
TRUB_MARMS/244-301-------------------------.EA---------------.V--VRM-------Y...DQG----------------
A5EWY7_DICNV/237-289-------------------------.NG---------------.L--YQL-------.....SA----------------
Q0A799_ALKEH/244-300-------------------------.AA---------------.W--LRL-------Y....TR----------------
TRUB_HAHCH/247-303-------------------------.EG---------------.K--VRL-------Y....TN----------------
TRUB_CHRSD/242-299-------------------------.QS---------------.T--ARL-------Y.....R----------------
Q2JJL0_SYNJB/239-295-------------------------.GA---------------PT--LRV-------L....DE----------------
TRUB_AQUAE/232-286-------------------------.EG---------------.L--VKI-------Y.....E----------------
TRUB_DECAR/241-295-------------------------.AG---------------.K--ARV-------Y.....A----------------
TRUB_CALS4/230-285-------------------------.EN---------------SL--VKL-------Y....DN----------------
A4G7S5_HERAR/244-306-------------------------.QG---------------.R--MRI-------Y...RES----------------
TRUB_BUCAI/250-307-------------------------.NS---------------.L--VRV-------I...ALE----------------
TRUB_CHESB/253-310-------------------------.RD---------------AP--VQA-------PEAWASL----------------
TRUB_PASMU/246-303-------------------------.TG---------------.Q--VRL-------F....SD----------------
TRUB_SYNE7/234-291-------------------------.DA---------------AP--VRV-------Y....DL----------------
TRUB_NITOC/247-303-------------------------.EG---------------.W--VRL-------I....EC----------------
TRUB_HAEDU/246-303-------------------------.YG---------------.M--VRL-------Y....SE----------------
TRUB_AROAE/245-299-------------------------.AG---------------.L--VRI-------Y.....G----------------
TRUB_HISS2/246-303-------------------------.QG---------------.Q--VRL-------I....SP----------------
B4E7L3_BURCJ/247-306-------------------------.DG---------------ER--VRV-------Y.....D----------------
TRUB_VIBTL/251-308-------------------------.EG---------------.T--VRM-------T...SGE----------------
M1FAI4_9ALTE/245-303-------------------------.QG---------------.Y--VRV-------Y.....G----------------
M9X1B5_MANHA/247-303-------------------------.YG---------------.L--VRL-------Y....SE----------------
TRUB_PSEAE/246-302-------------------------.FG---------------.W--LRV-------Q....DH----------------
TRUB_LEGPH/243-299-------------------------.EG---------------ED--LRL-------Y....GE----------------
TRUB_BURPS/246-307-------------------------.EG---------------GR--VRV-------Y....DA----------------
TRUB_PHOPR/251-308-------------------------.QG---------------TL--VRI-------T...VGE----------------
TRUB_XANCP/245-299-------------------------.EG---------------.Q--VAV-------F....DA----------------
TRUB_RALSO/252-312-------------------------.AE---------------.Q--VRV-------YGARGEA----------------
TRUB_VIBCH/251-308-------------------------.DG---------------.M--VRI-------T...GGE----------------

PF09142

TRUB_LEIXX/238-297--------------------------GE----------------P--VAA-------I----AP----------------
TRUB_THEFY/236-291--------------------------SG----------------P--VGL-------F----AP----------------
TRUB_COREF/238-293--------------------------KG----------------V--HAA-------V----TP----------------
TRUB_RHOJR/245-300--------------------------KG----------------V--YAA-------I----DP----------------
TRUB_PROAC/237-295--------------------------AE----------------V--TAI-------I----AE----------------
TRUB_STRAW/243-301--------------------------RG----------------A--VAV-------V----DP----------------
Q0RDS8_FRAAA/250-305--------------------------PG----------------T--YGV-------F----GP----------------
A5UZQ6_ROSS1/240-296--------------------------AP----------------R--ARA-------H----AP----------------
TRUB_BIFLO/329-385--------------------------SE----------------P--TAA-------I----VP----------------
A1SLK5_NOCSJ/235-289--------------------------PG----------------L--TAV-------F----AP----------------
A1T7J3_MYCVP/243-298--------------------------DG----------------V--YAA-------T----AP----------------
TRUB_CORDI/241-296--------------------------KG----------------I--HAA-------V----DP----------------
Q2IPZ4_ANADE/244-300--------------------------PG----------------M--VRA-------L----AP----------------
A6W7Z8_KINRD/243-298--------------------------PG----------------P--VGA-------F----AP----------------
A4FM27_SACEN/227-282--------------------------KG----------------T--YGV-------F----DP----------------
TRUB_CORJK/248-303--------------------------KG----------------V--RAA-------V----TP----------------
TRUB_MYCLE/247-302--------------------------DG----------------I--YAA-------S----DA----------------
A7H9F6_ANADF/247-302--------------------------PG----------------K--AAA-------R----AP----------------
A8L6F8_FRASN/256-311--------------------------PG----------------P--YGV-------F----GP----------------
TRUB_NOCFA/245-300--------------------------PG----------------V--YAA-------L----TA----------------
A0QVP8_MYCS2/244-299--------------------------DG----------------V--YAA-------T----AP----------------
TRUB_MYCPA/234-289--------------------------DG----------------V--YAA