Sequence alignment for CL0179

PF14305

Q7AJR3_BACHD/224-461--------------------------------------------------------------------------------
Q8CX82_OCEIH/200-437--------------------------------------------------------------------------------
A3Q6N7_MYCSJ/939-1176--------------------------------------------------------------------------------
Q8A829_BACTN/55-295--------------------------------------------------------------------------------
A8UGA4_9FLAO/32-274--------------------------------------------------------------------------------
Q8PYT3_METMA/61-302--------------------------------------------------------------------------------
B5UQ62_BACCE/58-299--------------------------------------------------------------------------------
B1BGT7_CLOPF/58-308--------------------------------------------------------------------------------
C3WFM3_FUSMR/63-297--------------------------------------------------------------------------------
Q2CG16_9RHOB/72-314--------------------------------------------------------------------------------
B9JHB1_AGRRK/64-304--------------------------------------------------------------------------------
Q6AIA9_DESPS/77-317--------------------------------------------------------------------------------
B5L389_ECOLX/57-304--------------------------------------------------------------------------------
B3XSD0_UREUR/50-304--------------------------------------------------------------------------------

PF08443

O59396_PYRHO/80-267--------------------------------------------------------------------------------
RIMK_ECOLI/97-286--------------------------------------------------------------------------------
COFF_METJA/94-282--------------------------------------------------------------------------------
RIMK_HAEIN/105-293--------------------------------------------------------------------------------
Y016_MYCPN/90-287--------------------------------------------------------------------------------

PF05770

Q7XBW0_ORYSJ/9-321--------------------------------------------------------------------------------
ITPK2_ARATH/34-338--------------------------------------------------------------------------------
ITPK1_ARATH/2-311--------------------------------------------------------------------------------
ITPK1_HUMAN/1-318--------------------------------------------------------------------------------
Q9AYJ2_ORYSJ/16-320--------------------------------------------------------------------------------

PF02786

PCCA_HUMAN/176-385--------------------------------------------------------------------------------
CARY_BACSU/128-334--------------------------------------------------------------------------------
PYR1_DICDI/525-729--------------------------------------------------------------------------------
CARB_ECOLI/128-335--------------------------------------------------------------------------------
CARB_TRICU/196-398--------------------------------------------------------------------------------
CPSM_HUMAN/546-750--------------------------------------------------------------------------------
CARB_BACCL/128-334--------------------------------------------------------------------------------
BCCA_MYCLE/122-331--------------------------------------------------------------------------------
PYR1_SCHPO/593-797--------------------------------------------------------------------------------
ACCC_PSEAE/115-324--------------------------------------------------------------------------------
CARB_YEAST/149-353--------------------------------------------------------------------------------
ACCC_ECOLI/115-324--------------------------------------------------------------------------------
BCCA_MYCTU/115-326--------------------------------------------------------------------------------
ACCC_NOSS1/116-325--------------------------------------------------------------------------------
PYC1_YEAST/135-344--------------------------------------------------------------------------------
PYR1_MESAU/514-718--------------------------------------------------------------------------------

PF02222

PURK_BACSU/115-285--------------------------------------------------------------------------------
PURT_METJA/120-294--------------------------------------------------------------------------------
PURT_PYRHO/125-304--------------------------------------------------------------------------------
PURT_ECOLI/121-295--------------------------------------------------------------------------------
PUR6_YEAST/113-285--------------------------------------------------------------------------------
PUR6_CANGA/113-284--------------------------------------------------------------------------------
PUR6_SCHOC/111-283--------------------------------------------------------------------------------
PUR6_PICME/113-284--------------------------------------------------------------------------------
PUR6_SCHPO/111-282--------------------------------------------------------------------------------
O80937_ARATH/197-369--------------------------------------------------------------------------------
PURK_ECOLI/87-254--------------------------------------------------------------------------------
PURK_HAEIN/92-261--------------------------------------------------------------------------------
PURK_PSEAE/105-272--------------------------------------------------------------------------------
PURK_SULSO/109-273--------------------------------------------------------------------------------
PURK_AQUAE/100-266--------------------------------------------------------------------------------
PURK_SYNY3/112-284--------------------------------------------------------------------------------
PURK_SYNE7/116-285--------------------------------------------------------------------------------
PURK_MYCLE/120-300--------------------------------------------------------------------------------
PURK_MYCTU/124-297--------------------------------------------------------------------------------
PURK_CORAM/129-306--------------------------------------------------------------------------------
PURT_BACSU/113-287--------------------------------------------------------------------------------
PURT_PASHA/121-294--------------------------------------------------------------------------------
PURT_SYNY3/117-292--------------------------------------------------------------------------------

PF13535

E8RY18_MICSL/111-299--------------------------------------------------------------------------------
D4GMV9_PANAM/88-261--------------------------------------------------------------------------------
C4FVJ7_9FIRM/127-305--------------------------------------------------------------------------------
Q2Z1L8_ERWST/114-292--------------------------------------------------------------------------------
D1C2W8_SPHTD/155-337--------------------------------------------------------------------------------
Q48NB4_PSE14/107-289--------------------------------------------------------------------------------
Q1MX58_9ACTO/104-292--------------------------------------------------------------------------------
D0Z8Q6_EDWTE/96-265--------------------------------------------------------------------------------
Q12II4_SHEDO/108-288--------------------------------------------------------------------------------
B4DFC6_HUMAN/597-796--------------------------------------------------------------------------------
B0NR58_BACSE/114-290--------------------------------------------------------------------------------
Q83Z60_STRCL/126-311--------------------------------------------------------------------------------
D4I204_ERWAC/99-280--------------------------------------------------------------------------------
C0QL65_DESAH/85-278--------------------------------------------------------------------------------
Q1JXP0_DESAC/85-278--------------------------------------------------------------------------------
B4EQF8_BURCJ/110-298--------------------------------------------------------------------------------
B8J507_ANAD2/110-304--------------------------------------------------------------------------------
C7M0Y2_ACIFD/99-283--------------------------------------------------------------------------------
C6WFN8_ACTMD/117-298--------------------------------------------------------------------------------
D3DDW5_9ACTO/117-307--------------------------------------------------------------------------------
C5NY10_9BACL/132-310--------------------------------------------------------------------------------
B2E5U2_STRPN/105-289--------------------------------------------------------------------------------
B9B6B7_9BURK/48-238--------------------------------------------------------------------------------
C4T7U3_YERIN/81-287--------------------------------------------------------------------------------
C4FU48_9FIRM/109-287--------------------------------------------------------------------------------
D0FMQ8_ERWPE/108-286--------------------------------------------------------------------------------
Q3A2P7_PELCD/85-278--------------------------------------------------------------------------------
E6VR59_DESAO/87-280--------------------------------------------------------------------------------
C5NXU5_9BACL/109-287--------------------------------------------------------------------------------
B1SDM3_9STRE/91-282--------------------------------------------------------------------------------
B8CGT7_SHEPW/109-279--------------------------------------------------------------------------------
Q1VVV2_9FLAO/85-276--------------------------------------------------------------------------------
Q888Y9_PSESM/114-292--------------------------------------------------------------------------------
Q3A6W8_PELCD/114-298--------------------------------------------------------------------------------
C1DMZ3_AZOVD/112-284--------------------------------------------------------------------------------
Q3S8Y0_PSESH/109-293--------------------------------------------------------------------------------
B1HFG7_BURPE/117-293--------------------------------------------------------------------------------
D5WN11_BURSC/115-291--------------------------------------------------------------------------------
D3DDW6_9ACTO/102-274--------------------------------------------------------------------------------
B5SP77_9ACTO/100-278--------------------------------------------------------------------------------
C4FBF5_9ACTN/118-307--------------------------------------------------------------------------------
Q1QB93_PSYCK/115-289--------------------------------------------------------------------------------
D5WN64_BURSC/107-292--------------------------------------------------------------------------------
B9DMB9_STACT/529-710--------------------------------------------------------------------------------
A3UL12_VIBSP/111-283--------------------------------------------------------------------------------
D3D707_9ACTO/131-310--------------------------------------------------------------------------------
D9TNI3_THETC/106-294--------------------------------------------------------------------------------
E8SDA7_MICSL/98-270--------------------------------------------------------------------------------
A5G3Z6_GEOUR/110-292--------------------------------------------------------------------------------
Q7N5R8_PHOLL/91-265--------------------------------------------------------------------------------
C7Q3P0_CATAD/103-280--------------------------------------------------------------------------------
C1F6E3_ACIC5/100-273--------------------------------------------------------------------------------
Q5WS01_LEGPL/99-278--------------------------------------------------------------------------------
CRNS1_CHICK/606-804--------------------------------------------------------------------------------
Q2SKF8_HAHCH/104-284--------------------------------------------------------------------------------
C4L724_EXISA/89-275--------------------------------------------------------------------------------
Q01ZL3_SOLUE/109-290--------------------------------------------------------------------------------
Q0SCF9_RHOSR/101-280--------------------------------------------------------------------------------
C2CRI1_CORST/134-299--------------------------------------------------------------------------------
A3CN29_STRSV/109-286--------------------------------------------------------------------------------
Q842E2_PSESX/109-294--------------------------------------------------------------------------------
C7N331_SLAHD/459-648--------------------------------------------------------------------------------
Q12II2_SHEDO/112-302--------------------------------------------------------------------------------
C0WVD3_LACFE/116-306--------------------------------------------------------------------------------
E7FN57_9LACO/100-280--------------------------------------------------------------------------------
Q0S8A9_RHOSR/103-283--------------------------------------------------------------------------------
A8M0K3_SALAI/103-297--------------------------------------------------------------------------------
B6B6A2_9RHOB/129-318--------------------------------------------------------------------------------
B4VDU1_9ACTO/110-294--------------------------------------------------------------------------------
A3CVX7_METMJ/109-278--------------------------------------------------------------------------------
B5XPP6_KLEP3/106-292--------------------------------------------------------------------------------
Q9AMT9_BRAJP/112-298--------------------------------------------------------------------------------
B0RPV7_XANCB/115-287--------------------------------------------------------------------------------
Q1VG50_VIBAL/111-283--------------------------------------------------------------------------------
D2QAU0_BIFDB/128-311--------------------------------------------------------------------------------
A7NRD0_ROSCS/111-286--------------------------------------------------------------------------------
C6BWA6_DESAD/85-278--------------------------------------------------------------------------------
D0FNI3_ERWPE/106-290--------------------------------------------------------------------------------
D4F6G3_EDWTA/108-277--------------------------------------------------------------------------------
Q121X7_POLSJ/108-282--------------------------------------------------------------------------------
C2CRI1_CORST/498-675--------------------------------------------------------------------------------
D1RZT7_SEROD/113-299--------------------------------------------------------------------------------
Q8TPB8_METAC/85-278--------------------------------------------------------------------------------
B2Q6S1_PROST/113-296--------------------------------------------------------------------------------
D9T106_MICAI/109-294--------------------------------------------------------------------------------
Q1QXJ8_CHRSD/106-286--------------------------------------------------------------------------------
D2B0J8_STRRD/100-269--------------------------------------------------------------------------------
B8GVA8_THISH/116-296--------------------------------------------------------------------------------
D7W254_9FLAO/112-293--------------------------------------------------------------------------------
B9B6B5_9BURK/104-287--------------------------------------------------------------------------------
Q0ACF5_ALHEH/120-296--------------------------------------------------------------------------------
B8J4T0_DESDA/96-289--------------------------------------------------------------------------------
Q5WSD6_LEGPA/104-283--------------------------------------------------------------------------------
A8FIK7_BACP2/134-334--------------------------------------------------------------------------------
Q6FAX4_ACIAD/125-307--------------------------------------------------------------------------------
D3PFD6_CRAVI/610-811--------------------------------------------------------------------------------
D7VTF5_9SPHI/110-291--------------------------------------------------------------------------------
A7N2D3_VIBHB/102-283--------------------------------------------------------------------------------
B7GNZ5_BIFLS/108-299--------------------------------------------------------------------------------
A7N6T3_VIBHB/145-321--------------------------------------------------------------------------------
Q888Z0_PSESM/112-290--------------------------------------------------------------------------------
D4HVL4_ERWAC/112-290--------------------------------------------------------------------------------
D4HVL5_ERWAC/114-292--------------------------------------------------------------------------------
Q0RGQ9_FRAAA/107-286--------------------------------------------------------------------------------
C6W4G0_DYAFD/113-294--------------------------------------------------------------------------------
Q0RYD4_RHOSR/107-296--------------------------------------------------------------------------------
D2UCG0_XANAP/114-286--------------------------------------------------------------------------------
Q02BT0_SOLUE/124-304--------------------------------------------------------------------------------
D9T7Z5_MICAI/109-288--------------------------------------------------------------------------------

PF07478

DDL_BORBU/136-344--------------------------------------------------------------------------------
DDLB_ECOLI/103-303--------------------------------------------------------------------------------
DDL_ENTFA/138-341--------------------------------------------------------------------------------
DDLA_SHIFL/147-348--------------------------------------------------------------------------------
DDL_SYNY3/134-342--------------------------------------------------------------------------------
VANB_ENTFA/138-337--------------------------------------------------------------------------------
DDL_MYCTU/158-363--------------------------------------------------------------------------------
DDL_AQUAE/101-291--------------------------------------------------------------------------------
MUDD_CHLTR/569-778--------------------------------------------------------------------------------
DDL_BUCAP/103-303--------------------------------------------------------------------------------
DDL_BACSU/135-338--------------------------------------------------------------------------------
Q47720_ENTCA/143-343--------------------------------------------------------------------------------
DDL_HAEIN/106-303--------------------------------------------------------------------------------
VANC_ENTGA/136-336--------------------------------------------------------------------------------
O33806_STRTO/139-338--------------------------------------------------------------------------------
DDL_LEUME/142-349--------------------------------------------------------------------------------
VANA_ENTFC/139-338--------------------------------------------------------------------------------
DDL_TREPA/143-347--------------------------------------------------------------------------------

PF06973

Q1ER85_9CREN/193-383--------------------------------------------------------------------------------
PURP_SULSO/152-337--------------------------------------------------------------------------------
PURP_METTP/173-356--------------------------------------------------------------------------------
Q8PZA1_METMA/193-387--------------------------------------------------------------------------------
Q975Y8_SULTO/160-348--------------------------------------------------------------------------------
PURP_METM5/174-361--------------------------------------------------------------------------------
Q4JAU2_SULAC/161-349--------------------------------------------------------------------------------
A8AB21_IGNH4/178-366--------------------------------------------------------------------------------
A1RQP6_PYRIL/168-356--------------------------------------------------------------------------------
PURP_PYRHO/149-333--------------------------------------------------------------------------------
PURP_METS5/151-332--------------------------------------------------------------------------------
PURP_UNCMA/178-365--------------------------------------------------------------------------------
Q8U3N6_PYRFU/189-380--------------------------------------------------------------------------------
PURP_METST/176-363--------------------------------------------------------------------------------
PURP_CALMQ/163-337--------------------------------------------------------------------------------
PURP_PYRCJ/163-333--------------------------------------------------------------------------------
PURP_IGNH4/170-347--------------------------------------------------------------------------------
PURP1_METMA/173-356--------------------------------------------------------------------------------
PURP_METS3/176-363--------------------------------------------------------------------------------
A4GI95_9BACT/191-385--------------------------------------------------------------------------------
A9A5F5_NITMS/177-363--------------------------------------------------------------------------------
O29983_ARCFU/174-373--------------------------------------------------------------------------------
PURP_SULAC/153-333--------------------------------------------------------------------------------
Q64BC8_9ARCH/174-354--------------------------------------------------------------------------------
PURP_METJA/174-361--------------------------------------------------------------------------------
PURP_METKA/174-359--------------------------------------------------------------------------------
Q5JD28_PYRKO/146-310--------------------------------------------------------------------------------
PURP_METBU/172-355--------------------------------------------------------------------------------
PURP_ARCFU/172-359--------------------------------------------------------------------------------
Q12X62_METBU/191-385--------------------------------------------------------------------------------
A8M9J4_CALMQ/161-349--------------------------------------------------------------------------------
PURP_CENSY/156-341--------------------------------------------------------------------------------
A4YCP1_METS5/159-347--------------------------------------------------------------------------------
Q64BC7_9ARCH/185-375--------------------------------------------------------------------------------
PURP_METTH/176-363--------------------------------------------------------------------------------
Q980P6_SULSO/161-349--------------------------------------------------------------------------------
A0B858_METTP/188-379--------------------------------------------------------------------------------
A0RW22_CENSY/177-363--------------------------------------------------------------------------------
PURP_NITMS/156-341--------------------------------------------------------------------------------
Q702E6_9CREN/179-365--------------------------------------------------------------------------------

PF15632

C7NS61_HALUD/17-350VLMTGAGAPGAWGIIRSLRL..T............EE...................RDVRIVGVDMDPDAYGFSLVD-AS
D7DRZ5_METV3/6-346VLITGAGAPGIAGSLYSLRN..N...........YDN...................RKLNIIGTDVKEDTIGKYLCD-KT
B8GGE3_METPE/6-338VLVTGAGAPGIKGTLYSLRE..N...........FDQ...................RTIRTIGTDIKPEVIGTYLCD-RY
C5A2Z7_THEGJ/6-337VLITGAGAPGIRGTLYSLKS..N...........WDN...................RKITTIGVDMKGEVVGKYLCD-RF
F8A3W6_CELGA/3-319VLVTGAGGAAGVAVIRSLLR..R.................................GDVDVLAADMDRWAAGIYLVP-AE
F4H040_CELFA/4-316VLVTGAGGPAGVAVIRSLQR..R.................................GDVEVFAADMDRWASAIYLVP-AE
D5UBS5_CELFN/4-316VLVTGAGGPAGVAVVRSLLR..R.................................GDVDVLAADMDRWASALYLVP-AE
D3FB15_CONWI/9-321VLVTGAGGPSGISVMQAI.E..S.................................GVLTIYAGDIDPYAAGLYLVP-EA
A8KXY8_FRASN/5-354RLWFNQTWRGTYQLIGLLRD..G...........................AGP...GRLTVLGSHQIPSTPFLQACD-AV
E4NDG0_KITSK/6-341RVWLNRTYAENVFFIDLLRS..A...........................P.....RPVHILATHVDPDSPVLAAAD-LG
D1BH78_SANKS/2-342NIWLNRTYATNYWFLQMLRS..N...........................PDG...TPVRLFATHTDETSPVLQAAD-VT
D1BIK1_SANKS/4-316VLVTGTGGPAGVAVVRSLLR..R.................................DDVEVFSADMDGWASGLYLVD-AD
Q82MB0_STRAW/6-340RVWLNRTYAENVFFMDQLRR..N...........................PHD...RAVEIHATHADADSPVLAAAD-TS
O88027_STRCO/6-340RVWLNRTYAENVFFMDQLRR..N...........................PAD...RAVEIHATHGDPDSPVLAAAD-TA
D9XZU1_9ACTO/6-340RVWLNRTYAENVFFMDQLRR..N...........................PAG...RAVEIHATHGDPDSPVLAAAD-TA
D6EGI6_STRLI/6-340RVWLNRTYAENVFFMDQLRR..N...........................PAD...RAVEIHATHGDPDSPVLAAAD-TA
C9ZBJ4_STRSW/6-340RVWLNRTYAENVFFMDQLRH..N...........................PHA...RPVDIHATHGDADSPVLAAAD-TA
B5HSJ5_9ACTO/6-340RVWLNRTYAENVFFMDQLRR..N...........................PSD...RAVEIHATHGDADSPVLAAAD-TA
D9X752_STRVR/6-340RVWLNRTYAENVFFMDQLRR..N...........................PSD...RAVEIHATHGDPDSPVLAAAD-TA
G2GBR6_9ACTO/6-340RVWLNRTYAENVFFMEQLRR..N...........................PSD...RAVEIHATHADPDSPVLAAAD-TA
F9Z982_ODOSD/8-342VIVTGAGAPGIQGTLYSLKQ..N...........YDN...................RSFHVIGTDINDFVVGKYLCD-EF
A6LIK8_PARD8/6-341VLSSACGAFFMPGFFKCLKA..N............KE...................RNIKIVGCDISNDPAMNLLVD-KY
E8U3T8_DEIML/7-345RLYFNKNFAVTTAQIKAVNA..G.................................GRYVTLASHSDPEHPMLHAAH-EA
Q9RSB2_DEIRA/9-338RVLFTKNFSVTSAQIRALE...D.................................SPYEVWASHSDPHHGMLAAAP-HT
Q2BF09_9BACI/6-345KIWFNRWFTTVSHYITMIKN..N...........................PDN...RSFTVYGTHPDKDALYLQVCD-FK
C0Z9Z4_BREBN/4-338RIWFNRTFATAYPIVEMIRN..N...........................PDN...FTFEIYVTHPKRHSVMLQIAD-YA
F5RK20_9FIRM/2-337RVWFNQWFSTAYHLIALMRA..G...........................S.P...DRFTFVGSSANPNMLYRLVCD-AW
F4A6T7_CLOBO/7-346VLLTASSGPGAVGIISALKS..H...........................PTK...KICVITGSVEEFQDVSLKMSE-KH
B2V211_CLOBA/3-315VLLTAIG..KRVQLINHLKK..S.................................ND..VIGADCGDLAPAIQFVD-KF
A7GGU2_CLOBL/9-348VLLTASSGPGAVGIIHALRN..H...........................PNK...HIFIVTGSVEDYEDVSLKIAD-KY
F2JJ82_CELLD/4-343RIWVNQWFSTMYQIIKQLREGAE...........................AEG...LSLHIIGTSTNQNVVYQKVCD-EF
G6G5N9_9FIRM/16-350RIYFNRCFSSTHKIIQRFLA..D...........................NNS...QKYELYISHVSPNIYLEEIAD-YF
F3ZYZ6_MAHA5/15-326VLFSSVG..RRTELIRFFTN..K.................................DGIYVIGVDVSALAPAAYMCH-KF
E0IAJ8_9BACL/7-342RVYFNRWFSVAYHYMNSIRH..N...........................EDG...VAFKLYGTHPDPGHMALQAAD-YA
E0RJG3_PAEP6/5-340KVYFNRWFSVAYHYMNAIRN..N...........................EDG...IPFEIYVTHSDPQHMALQASD-VA
E3EE70_PAEPS/5-340KVYFNRWFSVVYHYMNAIRN..N...........................EDG...IPFEIYATHSDPQHMALQASD-VA
E6UFS3_RUMA7/7-336VIWFNHWFSQAYNFIELLKR................................D...ERNFIIASAKKPDFVFGASAD-ER
E9SAE7_RUMAL/7-336VIWFNHWFSQAYNFIEMLRR................................D...ARNYIIASAKVGDFVFGASAD-ER
C9LVE5_9FIRM/2-338RIWFNQWFSTAYHLIELMRA..G...........................S.P...GKFTFVGSSANPNALYRLVSD-EW
F4QGW0_9CAUL/2-325RIWFNRGFSLASISQSMMAA..Q.................................PELEIYASVAKGMPKHAGPVE-.T
G2TCW6_RHORU/2-335KVWFNRGLSNTYDALTIIRA..A...........................DHA...GAFGLLASHSDETNAVGKAAD-TF
Q5NWT2_AROAE/3-340RVWFNKTFSSVHSALSLIRK..G...........................DAE...ARYRLLCSHPNPQSLALLAAD-DA
Q82TT1_NITEU/3-312VLLLCESGPLGLKVLYCLKG..M.NAFVQ................TAG..PRG...ARILKYSRYTDGHSEVQFWQD-G.
Q0AHL8_NITEC/3-312VLLLCESGPLGLKVLYCLKG..M.NAFVQ................TTG..PRG...ARMLKYSRYANGHSEVQFWQD-G.
A1VWP6_POLNA/3-339RVWFNKTFSSVGSAIRLIRE..A...........................DEA...ADYHLVCSSTNPHAPAFLAAH-ES
Q6FAX4_ACIAD/19-350GIWFTQAHSCQRDLILAAKN..APFN..............................LPIHVVASHADDRPEITSVAD-IA
D3RPB0_ALLVD/3-344RVWFNRTFSNVRAVLDLIRR..G...........................DAA...GEFRLVCTHPEPSFPGFVPAH-EQ
C1MFA0_9ENTR/4-345KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERNEILSVAD-YS
A7MPT7_CROS8/12-353KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRSERNEILSVAD-YS
C8Q020_9GAMM/11-360SIWLAEGQSSQREMLLAMQA..M.KCQYN...........................LPMTIVASHRQSRPEILNCAD-IA
C1IUG1_ENTCL/4-345KIWFMEGLSSQRDIIQGVKS..F.AKKNN...........................FAITVFASHRNERNEILSVAD-YS
D5CKR1_ENTCC/12-353ENLVYGRFILPARYYSGGKI..I.CTKNN...........................FAITVFASHRNERNEILSVAD-YS
Q5CB43_ECOLX/4-334KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERHEILSVAD-YS
G5Q9H1_SALMO/4-345KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERHEILSVAD-YS
E7HA30_ECOLX/1-338....MEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERNEILSVAD-YS
F9CS19_ECOLX/4-345KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERNEILSVAD-YS
F8YR44_ECOLX/4-345KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERNEILSVAD-YS
B2NP55_ECO57/4-345KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERNEILSVAD-YS
E7TZ65_ECO57/4-345KIWFMEGLSSQRDIIQGVKS..F.AQKNN...........................FAITVFASHRNERNEILSVAD-YS
A7KFT2_KLEPN/4-345KIWFMEGLSSQRDIIQGVKS..F.AKKNN...........................FAITVFASHRNERNEILSVAD-YS
B5RKB9_KLEP3/4-345KIWFMEGLSSQRDIVLGVKS..F.AEKEN...........................QNIVVFSSHRNERNEILSVSD-FS
C4XDI7_KLEPN/4-345KIWFMEGLSSQRDIVLGVKS..F.AEKEN...........................QDIEIFSSHRNERKEILSVSD-FS
A3JJ84_9ALTE/2-339RILFNHNISGAADLIDLMRR..A......................R..........PDLHVIATHERRDTPIALAAD-QL
G3ISJ3_9GAMM/2-338RIWFNKTFSTIHAVFRNLRQ..S...........................VPA...GEITLICTHTHAHAAAFLAAD-ES
H8GG73_METAL/2-338RIWFNKTFSTIGAVFRQLKA..G...........................YPD...DGITLVCTHTHRTATAFLAAD-EA
E1PL52_PANVC/6-350SIWFMEGVSSQKDMLALVKM..A.RTECG...........................KNFLIIASHRNERPEILSEAD-IA
D0KLU9_PECWW/4-345RIWLMEGLSSQRDMILAIKS..F.AEIRG...........................AGVTIFASHRNERNEILSLAD-CA
B2Q6S1_PROST/4-344KIWFMEGLSSQRDLIQGARE..F.AQQQL...........................KNITIFASHRHARNEILSQAD-YA
B3G2E4_PSEAI/1-332MIWFLEGQSSQRDIILGARE..A.LP..............................PEVRIFASHRQDRPEITGSAD-VS
D7HVQ0_PSESS/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAH-VA
F3H5H4_PSESX/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAD-MA
F3JPH6_PSESX/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAD-VA
F3I9M2_PSESF/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVKIIASHRQQRSEITGQAD-VA
F3DCN0_9PSED/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAH-LA
F3IYZ7_PSEAP/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................VSVQIIASHRQQRSEITGQAD-VA
E7P0I7_PSESG/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAH-VA
F3FNS0_PSESX/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAD-VA
F3EI09_PSESL/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAH-VA
F3E7Y8_PSESL/1-347MAEAIEAIRQQELLLPEAER....................................VVGRLLITHNNPHFIGFNLAD-HA
F3HNW9_PSEYM/1-332MIWFLEGQASQRDVIIGARD..A.LP..............................ESVRIIASHRQQRSEITGLAD-VA
F3EZH7_9PSED/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAH-VA
F3DP68_9PSED/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVKIIASHRQQRSEITGQAD-VA
F2ZRA0_9PSED/1-332MIWFLEGQASQRDVIIGARD..A.LP..............................ASVRIIASHRQQRSEITGQAD-VA
Q48NB4_PSE14/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAH-VA
Q4ZYB3_PSEU2/1-332MIWFLEGQSSQREVIIGARD..A.LP..............................ASVQIIASHRQQRSEITGQAD-VA
F3K7E1_PSESZ/1-332MIWFLEGQSSQREVIMGARD..A.LP..............................ASVQIIASHRQQRSEITGQAH-LA
F3IPW6_PSESL/1-332MIWFLEGQSSQREVIIGARD..A.LP..............................ASVKIIASHRQQRSEITGQAD-VA
E2MHB3_PSEUB/1-332MIWFLEGQSSQREVIIGARD..A.LP..............................ASVKIIASHRQQRSEITGQAD-VA
Q4FTP6_PSYA2/15-383AVWLAEGQSSQRDMLASLQA..L.KSQSN...........................TPFTIIASHRHNRPEIFEFAD-IV
Q1QCQ8_PSYCK/15-383AAWLAEGQSSQRDMLASLQT..L.KAHSS...........................MPFHIVASHRHNRPEIFEFAD-II
F5SQ56_9GAMM/11-404NVWLAEGQSSQRDMLESLQN..L.RKKVALNLDIYSDLDVVSNPAQDGLVEESVLDAAFRILASHRFHRPEILEMAD-KS
A5WBK0_PSYWF/11-370SVWLAEGQSSQRDMLQSLQQ..L.KRRSI...........................TPFEVIASHRSQRPEIFEFAD-HV
G4DVY4_9GAMM/3-340RVWFNRTFSNVRAVFDLVRQ..G...........................DEA...GEFHLVCSHTQKEFPGFLSAH-EF
H8Z6R5_9GAMM/3-341RIWFNRTFSSVRALFELIRQ..G...........................DTA...SAYRLFCTHPHPSFPGFDLAD-EW
A9QYJ5_YERPG/4-344NIWFMGGLSSQRDIISGVKN..T.SELHG...........................NAIQVFASHHQHRYEILEKAD-VA
A4TRW4_YERPP/4-345NIWFMGGLSSQRDIISGVKN..T.SELHG...........................NAIQVFASHHQHRYEILEKAD-VA
D1U1X0_YERPE/1-338....MGGLSSQRDIISGVKN..T.SELHG...........................NAIQVFASHHQHRYEILEKAD-VA
A7FNB6_YERP3/4-345NIWFMGGLSSQRDIISGVKN..T.SELHG...........................NAIQVFASHHQHRYEILEKAD-VA
B1JNG1_YERPY/4-345NIWFMGGLSSQRDIISGVKN..T.SELHG...........................NAIQVFASHHQHRYEILEKAD-VA

PF14398

Q73CW4_BACC1/180-443--------------------------------------------------------------------------------
YHED_BACSU/178-440--------------------------------------------------------------------------------
D4G719_BACNA/90-350--------------------------------------------------------------------------------
Q5L2A9_GEOKA/175-436--------------------------------------------------------------------------------
A9U6Q3_PHYPA/63-329--------------------------------------------------------------------------------
A6TTN9_ALKMQ/120-382--------------------------------------------------------------------------------
Q0AXS1_SYNWW/103-364--------------------------------------------------------------------------------
A9U6Q2_PHYPA/86-348--------------------------------------------------------------------------------
A9U6A9_PHYPA/218-483--------------------------------------------------------------------------------
C6D8D2_PAESJ/189-456--------------------------------------------------------------------------------
B6YYR2_9RHOB/176-439--------------------------------------------------------------------------------
A3I7C7_9BACI/90-348--------------------------------------------------------------------------------
C6D2S3_PAESJ/1-246--------------------------------------------------------------------------------
C6D2S4_PAESJ/84-344--------------------------------------------------------------------------------

PF14403

A8M4T7_SALAI/1-452-----------------------------------------------------MTDVDYK.WPSAA........QAW.LD
Q02DC9_SOLUE/4-448-----------------------------------------------------LDDAVAR.YNKLL.ETGPFKDLAWAEA
A5UWI9_ROSS1/2-461-----------------------------------------------------LETAIAD.YHAAL.QDEAIARATW.EA
A9WAS2_CHLAA/3-460-----------------------------------------------------LAQAIAD.YHALL..EPTLAVESW.QR
B8GC89_CHLAD/3-460-----------------------------------------------------LVQAIAD.YHALL..DPKLAAASW.QC
A8MKZ9_ALKOO/3-442-----------------------------------------------------TTKELYDVYEDIVRKNEGVFLQDH.RA

PF01071

Q20143_CAEEL/100-292--------------------------------------------------------------------------------
PUR2_BACSU/101-293--------------------------------------------------------------------------------
PUR2_ARATH/198-392--------------------------------------------------------------------------------
PUR2_MYCLE/101-292--------------------------------------------------------------------------------
PUR2_HAEIN/103-296--------------------------------------------------------------------------------
PUR2_METTH/100-298--------------------------------------------------------------------------------
PUR2_SCHPO/109-301--------------------------------------------------------------------------------
PUR2_YEAST/108-308--------------------------------------------------------------------------------
PUR2_HELPY/105-292--------------------------------------------------------------------------------
PUR2_ARCFU/109-334--------------------------------------------------------------------------------
PUR2_METJA/103-304--------------------------------------------------------------------------------
PUR2_CHICK/105-298--------------------------------------------------------------------------------
PUR2_ECOLI/103-296--------------------------------------------------------------------------------
PUR2_HUMAN/105-298--------------------------------------------------------------------------------
PUR2_MYCTU/101-292--------------------------------------------------------------------------------
PUR2_SYNY3/103-291--------------------------------------------------------------------------------
PUR2_YARLI/108-301--------------------------------------------------------------------------------
PUR2_DROME/108-301--------------------------------------------------------------------------------
PUR2_CHITE/109-301--------------------------------------------------------------------------------

PF08442

MTKA_METEA/2-203--------------------------------------------------------------------------------
SUCB1_CAEEL/25-233--------------------------------------------------------------------------------
SUCC2_STRCO/2-191--------------------------------------------------------------------------------
SUCC2_ARCFU/2-195--------------------------------------------------------------------------------
SUCC_HAEIN/2-203--------------------------------------------------------------------------------
SUCC_SHIFL/2-203--------------------------------------------------------------------------------
SUCC_METTH/2-194--------------------------------------------------------------------------------
SUCB2_CAEEL/21-231--------------------------------------------------------------------------------
SUCC_METJA/2-193--------------------------------------------------------------------------------
SUCB2_PIG/40-248--------------------------------------------------------------------------------
SUCC1_ARCFU/2-195--------------------------------------------------------------------------------
SUCB_NEOFR/29-237--------------------------------------------------------------------------------
SUCC_CHLPN/2-203--------------------------------------------------------------------------------
SUCC_AQUAE/2-199--------------------------------------------------------------------------------
SUCB_TRIVA/11-220--------------------------------------------------------------------------------
SUCC_BACSU/2-203--------------------------------------------------------------------------------
SUCB_YEAST/32-240--------------------------------------------------------------------------------
SUCB_SCHPO/24-232--------------------------------------------------------------------------------
SUCC_COXBU/2-204--------------------------------------------------------------------------------
SUCC_THETH/2-194--------------------------------------------------------------------------------
SUCC_MYCTU/2-195--------------------------------------------------------------------------------
SUCC_RICPR/2-203--------------------------------------------------------------------------------

PF02655

Q8PZ07_METMA/105-278--------------------------------------------------------------------------------
O27028_METTH/106-265--------------------------------------------------------------------------------
Q603D9_METCA/124-284--------------------------------------------------------------------------------
Q8PU46_METMA/109-270--------------------------------------------------------------------------------
Y776_METJA/124-282--------------------------------------------------------------------------------
Q7UJD2_RHOBA/127-319--------------------------------------------------------------------------------
Q6LZR0_METMP/123-259--------------------------------------------------------------------------------
O29201_ARCFU/107-251--------------------------------------------------------------------------------
O28027_ARCFU/97-247--------------------------------------------------------------------------------
Q97H24_CLOAB/105-271--------------------------------------------------------------------------------
Q8TQR5_METAC/109-277--------------------------------------------------------------------------------
Q6M182_METMP/105-262--------------------------------------------------------------------------------
Q8TJB8_METAC/125-298--------------------------------------------------------------------------------
Q7BQQ5_XANAU/119-279--------------------------------------------------------------------------------
O26923_METTH/114-270--------------------------------------------------------------------------------
Q8TZ26_METKA/104-247--------------------------------------------------------------------------------
Y815_METJA/136-272--------------------------------------------------------------------------------
Q8TV12_METKA/118-275--------------------------------------------------------------------------------

PF13549

Q30WE4_DESDG/474-696--------------------------------------------------------------------------------
B5EIR8_GEOBB/481-697--------------------------------------------------------------------------------
A7HUK1_PARL1/484-706--------------------------------------------------------------------------------
B5W864_SPIMA/500-721--------------------------------------------------------------------------------
Q1D3M9_MYXXD/505-726--------------------------------------------------------------------------------
A2BJ63_HYPBU/14-235--------------------------------------------------------------------------------
B8GB69_CHLAD/473-695--------------------------------------------------------------------------------
A9EVP6_SORC5/499-721--------------------------------------------------------------------------------
B7K6U2_CYAP7/499-721--------------------------------------------------------------------------------
Q02CN5_SOLUE/497-719--------------------------------------------------------------------------------
A4U1N9_9PROT/483-706--------------------------------------------------------------------------------
Q1YNA3_MOBAS/481-703--------------------------------------------------------------------------------
C8X4E1_DESRD/482-705--------------------------------------------------------------------------------
A6C207_9PLAN/482-704--------------------------------------------------------------------------------
Q2W464_MAGSA/483-705--------------------------------------------------------------------------------
B8CEH1_THAPS/525-748--------------------------------------------------------------------------------
C1DBF7_LARHH/480-702--------------------------------------------------------------------------------
B4D2X3_9BACT/490-711--------------------------------------------------------------------------------
Q2LRG1_SYNAS/43-258--------------------------------------------------------------------------------
A3ZSV0_9PLAN/482-704--------------------------------------------------------------------------------
D2R7V1_PIRSD/482-704--------------------------------------------------------------------------------
A8I025_AZOC5/478-700--------------------------------------------------------------------------------
Q1QYL0_CHRSD/482-704--------------------------------------------------------------------------------
Q0W5Z5_UNCMA/472-693--------------------------------------------------------------------------------
Q12E86_POLSJ/490-712--------------------------------------------------------------------------------
Q8PZJ9_METMA/26-247--------------------------------------------------------------------------------
D5CS41_SIDLE/485-707--------------------------------------------------------------------------------
Q223I3_RHOFD/478-701--------------------------------------------------------------------------------
A2SHI2_METPP/474-697--------------------------------------------------------------------------------
B0CB03_ACAM1/496-716--------------------------------------------------------------------------------
B1XHT3_SYNP2/500-722--------------------------------------------------------------------------------
B9Z1Z5_9NEIS/480-702--------------------------------------------------------------------------------
A9B7A3_HERA2/473-695--------------------------------------------------------------------------------
A5V1W2_ROSS1/474-696--------------------------------------------------------------------------------
B9MJF1_ACIET/473-695--------------------------------------------------------------------------------
Q7NLP6_GLOVI/494-729--------------------------------------------------------------------------------
C9R913_AMMDK/477-698--------------------------------------------------------------------------------
Q1Q1N5_9BACT/475-697--------------------------------------------------------------------------------
D6Z2N4_DESAT/474-696--------------------------------------------------------------------------------
Q0KA53_CUPNH/481-703--------------------------------------------------------------------------------
E3HYZ8_RHOVT/480-705--------------------------------------------------------------------------------
A1K623_AZOSB/482-704--------------------------------------------------------------------------------
B8GPY5_THISH/486-708--------------------------------------------------------------------------------
Q2LUQ3_SYNAS/506-727--------------------------------------------------------------------------------
Q47CI3_DECAR/482-704--------------------------------------------------------------------------------
A1RXS7_THEPD/479-701--------------------------------------------------------------------------------
B5IPC9_9CHRO/514-740--------------------------------------------------------------------------------
Q6MAV5_PARUW/501-722--------------------------------------------------------------------------------
C6C1C2_DESAD/472-693--------------------------------------------------------------------------------
Q8DJG8_THEEB/495-717--------------------------------------------------------------------------------
B0UM89_METS4/27-247--------------------------------------------------------------------------------
A8ZZJ4_DESOH/481-703--------------------------------------------------------------------------------
Q92Z73_RHIME/480-705--------------------------------------------------------------------------------
Q7NRV4_CHRVO/480-702--------------------------------------------------------------------------------
Q2Y8E7_NITMU/478-700--------------------------------------------------------------------------------
Q6AQI6_DESPS/472-694--------------------------------------------------------------------------------
Q3SEU0_THIDA/481-703--------------------------------------------------------------------------------
D0L1W1_HALNC/488-710--------------------------------------------------------------------------------
A1VIA4_POLNA/472-694--------------------------------------------------------------------------------
O29057_ARCFU/463-681--------------------------------------------------------------------------------
B8HP40_CYAP4/501-729--------------------------------------------------------------------------------
C4ZP31_THASP/482-704--------------------------------------------------------------------------------
C7RIF7_ACCPU/482-704--------------------------------------------------------------------------------
B9B8Y3_9BURK/493-714--------------------------------------------------------------------------------
B5HI28_STRPR/17-237--------------------------------------------------------------------------------
C7NV33_HALUD/473-693--------------------------------------------------------------------------------
Q13N88_BURXL/472-694--------------------------------------------------------------------------------
A5D252_PELTS/478-700--------------------------------------------------------------------------------
D2PSA1_KRIFD/14-237--------------------------------------------------------------------------------
Q89QG9_BRAJA/95-315--------------------------------------------------------------------------------
Q2LV27_SYNAS/9-227--------------------------------------------------------------------------------
A7BXB1_9GAMM/467-693--------------------------------------------------------------------------------
B9TF03_RICCO/23-245--------------------------------------------------------------------------------
A5D1F4_PELTS/478-699--------------------------------------------------------------------------------
B8FK52_DESAA/483-704--------------------------------------------------------------------------------
E8YSP4_9BURK/36-256--------------------------------------------------------------------------------
C9ZD67_STRSW/15-235--------------------------------------------------------------------------------
Q2LPY3_SYNAS/483-704--------------------------------------------------------------------------------
C0GKL8_9FIRM/479-700--------------------------------------------------------------------------------
D4GVH7_HALVD/472-692--------------------------------------------------------------------------------
C0QHK1_DESAH/488-708--------------------------------------------------------------------------------
A5FQG4_DEHSB/106-328--------------------------------------------------------------------------------
B4RED1_PHEZH/481-703--------------------------------------------------------------------------------
Q9HQZ0_HALSA/317-537--------------------------------------------------------------------------------
C0QJ02_DESAH/490-712--------------------------------------------------------------------------------
Q7W8F6_BORPA/17-239--------------------------------------------------------------------------------
C0QHB0_DESAH/487-709--------------------------------------------------------------------------------
Q1LF49_RALME/14-234--------------------------------------------------------------------------------
D3STG0_NATMM/473-693--------------------------------------------------------------------------------
E6VV76_DESAO/485-707--------------------------------------------------------------------------------
B1T453_9BURK/492-715--------------------------------------------------------------------------------
A4J695_DESRM/478-699--------------------------------------------------------------------------------
A5D034_PELTS/478-700--------------------------------------------------------------------------------
A3VE72_9RHOB/482-704--------------------------------------------------------------------------------
Q64CH5_9ARCH/12-232--------------------------------------------------------------------------------
A4YYL2_BRASO/483-708--------------------------------------------------------------------------------
A4SW96_POLSQ/471-693--------------------------------------------------------------------------------
A7MH14_CROS8/473-695--------------------------------------------------------------------------------
Q988U3_RHILO/480-705--------------------------------------------------------------------------------
D7AUW7_NOCDD/22-244--------------------------------------------------------------------------------
B1I353_DESAP/478-699--------------------------------------------------------------------------------
Q330N5_9EURY/8-229--------------------------------------------------------------------------------
A0B6M1_METTP/11-226--------------------------------------------------------------------------------
Q20Z65_RHOPB/482-707--------------------------------------------------------------------------------
Q604W6_METCA/481-703--------------------------------------------------------------------------------
Q3IQS4_NATPD/472-692--------------------------------------------------------------------------------
Q2NFU6_METST/479-700--------------------------------------------------------------------------------
C6BU19_DESAD/485-707--------------------------------------------------------------------------------
A0LJP9_SYNFM/480-702--------------------------------------------------------------------------------
Q0A9U7_ALHEH/468-689--------------------------------------------------------------------------------
Q2Y4P6_9ARCH/484-706--------------------------------------------------------------------------------
B7KVR5_METC4/479-704--------------------------------------------------------------------------------
B2Q2E9_PROST/473-695--------------------------------------------------------------------------------
C0QAQ8_DESAH/481-702--------------------------------------------------------------------------------
A5D530_PELTS/478-699--------------------------------------------------------------------------------
D2U861_XANAP/477-702--------------------------------------------------------------------------------
B9AE11_METSM/477-698--------------------------------------------------------------------------------
Q11G56_MESSB/480-705--------------------------------------------------------------------------------
B3Q6R1_RHOPT/482-707--------------------------------------------------------------------------------
A3Y536_9GAMM/503-723--------------------------------------------------------------------------------
B8DM77_DESVM/483-705--------------------------------------------------------------------------------
B4WR45_9SYNE/496-729--------------------------------------------------------------------------------
Q3BMW9_XANC5/481-706--------------------------------------------------------------------------------
B6R8H6_9RHOB/482-707--------------------------------------------------------------------------------
Q7N786_PHOLL/472-694--------------------------------------------------------------------------------
Q1QM20_NITHX/483-708--------------------------------------------------------------------------------
Q2W7Y3_MAGSA/500-722--------------------------------------------------------------------------------
E3I048_RHOVT/473-695--------------------------------------------------------------------------------
D0I5J1_VIBHO/484-706--------------------------------------------------------------------------------
B1LZ43_METRJ/472-697--------------------------------------------------------------------------------
Q07QV1_RHOP5/482-707--------------------------------------------------------------------------------
D3RU01_ALLVD/481-703--------------------------------------------------------------------------------
Q3AFE8_CARHZ/490-711--------------------------------------------------------------------------------
A9DH35_9GAMM/486-708--------------------------------------------------------------------------------
B8FE80_DESAA/10-226--------------------------------------------------------------------------------
C6CLU6_DICZE/473-695--------------------------------------------------------------------------------
C7LTU8_DESBD/481-703--------------------------------------------------------------------------------
B8FIX8_DESAA/9-225--------------------------------------------------------------------------------
Q12WB1_METBU/472-693--------------------------------------------------------------------------------
B2FMM9_STRMK/482-707--------------------------------------------------------------------------------
D3V3Z2_XENBS/472-694--------------------------------------------------------------------------------
B8IED3_METNO/488-713--------------------------------------------------------------------------------
A7C137_9GAMM/159-381--------------------------------------------------------------------------------
D4HZ45_ERWAC/472-694--------------------------------------------------------------------------------
E6WFR2_PANSA/472-694--------------------------------------------------------------------------------
C4ZKF4_THASP/487-709--------------------------------------------------------------------------------
A1S6F9_SHEAM/486-708--------------------------------------------------------------------------------
Q1YVR3_PHOPR/216-438--------------------------------------------------------------------------------
A3QEK7_SHELP/486-708--------------------------------------------------------------------------------
C9PHJ3_VIBFU/483-706--------------------------------------------------------------------------------
Q2YZQ5_9DELT/33-247--------------------------------------------------------------------------------
Q0HVJ0_SHESR/495-717--------------------------------------------------------------------------------
C0QFL6_DESAH/13-229--------------------------------------------------------------------------------
A8FV14_SHESH/486-708--------------------------------------------------------------------------------
Q4XQ92_PLACH/180-403--------------------------------------------------------------------------------
Q1QWA2_CHRSD/486-716--------------------------------------------------------------------------------
B4EUX9_PROMH/472-694--------------------------------------------------------------------------------
A1WTN4_HALHL/467-689--------------------------------------------------------------------------------
O28761_ARCFU/667-877--------------------------------------------------------------------------------
D3PVJ8_STANL/666-881--------------------------------------------------------------------------------
Q082P1_SHEFN/486-708--------------------------------------------------------------------------------
D3FEQ9_CONWI/670-890--------------------------------------------------------------------------------
D0Z2J5_LISDA/490-712--------------------------------------------------------------------------------
A3UW19_VIBSP/483-706--------------------------------------------------------------------------------
A1RWD9_THEPD/9-229--------------------------------------------------------------------------------
B8CM86_SHEPW/486-708--------------------------------------------------------------------------------
A1VGL0_DESVV/20-292--------------------------------------------------------------------------------
B9M8K3_GEOSF/479-695--------------------------------------------------------------------------------
D0X5Z1_VIBHA/468-690--------------------------------------------------------------------------------
B3LBB6_PLAKH/551-775--------------------------------------------------------------------------------
C4XLT1_DESMR/479-701--------------------------------------------------------------------------------
A4FCG4_SACEN/661-877--------------------------------------------------------------------------------
C5B797_EDWI9/472-694--------------------------------------------------------------------------------
Q2BZN6_9GAMM/19-241--------------------------------------------------------------------------------
A0NUW5_9RHOB/488-713--------------------------------------------------------------------------------
B9R2H8_9RHOB/488-713--------------------------------------------------------------------------------
Q12N16_SHEDO/486-708--------------------------------------------------------------------------------
Q3IFA9_PSEHT/480-701--------------------------------------------------------------------------------
C6CAZ3_DICDC/473-695--------------------------------------------------------------------------------
A1VAF7_DESVV/482-698--------------------------------------------------------------------------------
E6VZV8_DESAO/478-699--------------------------------------------------------------------------------
C6C0V7_DESAD/480-701--------------------------------------------------------------------------------
A0KEL7_AERHH/447-666--------------------------------------------------------------------------------
B0KMM7_PSEPG/475-696--------------------------------------------------------------------------------
Q2NRP0_SODGM/472-694--------------------------------------------------------------------------------
Q47QC0_THEFY/653-870--------------------------------------------------------------------------------
D2U4A3_9ENTR/472-694--------------------------------------------------------------------------------
C8X6G7_NAKMY/699-910--------------------------------------------------------------------------------
Q8IL89_PLAF7/540-763--------------------------------------------------------------------------------
B5YGW4_THEYD/482-700--------------------------------------------------------------------------------
B6ERR1_ALISL/484-706--------------------------------------------------------------------------------
A4C9D2_9GAMM/480-701--------------------------------------------------------------------------------
B1VXP6_STRGG/739-955--------------------------------------------------------------------------------
D6STV6_9DELT/482-704--------------------------------------------------------------------------------
A4FAM1_SACEN/663-876--------------------------------------------------------------------------------
D1BG29_SANKS/695-919--------------------------------------------------------------------------------
O50516_STRCO/806-1022--------------------------------------------------------------------------------
C7LRJ9_DESBD/471-692--------------------------------------------------------------------------------
C5C5J4_BEUC1/666-884--------------------------------------------------------------------------------
C5BNQ0_TERTT/484-704--------------------------------------------------------------------------------
C6WAF3_ACTMD/668-881--------------------------------------------------------------------------------
C4ZP63_THASP/474-692--------------------------------------------------------------------------------
A8TIY2_9PROT/479-703--------------------------------------------------------------------------------
A3TZP9_9RHOB/9-212--------------------------------------------------------------------------------
Q2BN19_9GAMM/483-713--------------------------------------------------------------------------------
A8B3P9_GIAIC/94-343--------------------------------------------------------------------------------
Q2SCW5_HAHCH/482-712--------------------------------------------------------------------------------
C3JLK2_RHOER/505-719--------------------------------------------------------------------------------
B8HH21_ARTCA/662-878--------------------------------------------------------------------------------
A8B4I3_GIAIC/26-275--------------------------------------------------------------------------------
A1R5M2_ARTAT/645-861--------------------------------------------------------------------------------
A6W895_KINRD/666-883--------------------------------------------------------------------------------
A6EUH1_9ALTE/482-712--------------------------------------------------------------------------------
A5FUU0_ACICJ/447-667--------------------------------------------------------------------------------
Q7W1M5_BORPA/23-232--------------------------------------------------------------------------------
A3JCC0_9ALTE/482-712--------------------------------------------------------------------------------
E3IU41_FRASU/495-709--------------------------------------------------------------------------------
A2F811_TRIVA/22-271--------------------------------------------------------------------------------
A4BCL0_9GAMM/472-702--------------------------------------------------------------------------------
C7RR50_ACCPU/477-694--------------------------------------------------------------------------------

PF02750

SYN2_HUMAN/214-416--------------------------------------------------------------------------------
SYN3_RAT/192-394--------------------------------------------------------------------------------
SYN1_RAT/214-416--------------------------------------------------------------------------------
O76322_LOLPE/191-393--------------------------------------------------------------------------------

PF04174

Q0RH44_FRAAA/80-411--------------------------------------------------------------------------------
D5YHN9_MYCTU/97-428--------------------------------------------------------------------------------
A3XNZ6_LEEBM/85-416--------------------------------------------------------------------------------
A9H282_GLUDA/91-422--------------------------------------------------------------------------------
B6IMV0_RHOCS/77-408--------------------------------------------------------------------------------
Q138L4_RHOPS/88-420--------------------------------------------------------------------------------
A3RW90_RALSL/94-425--------------------------------------------------------------------------------
B3E3V9_GEOLS/83-414--------------------------------------------------------------------------------
Q05V15_9SYNE/102-432--------------------------------------------------------------------------------
Q0I654_SYNS3/79-409--------------------------------------------------------------------------------
B3EHN4_CHLL2/82-413--------------------------------------------------------------------------------
A4TU14_9PROT/5-295--------------------------------------------------------------------------------
B0SUW6_CAUSK/58-364--------------------------------------------------------------------------------
Q12BE8_POLSJ/50-362--------------------------------------------------------------------------------
Q97YL5_SULSO/75-386--------------------------------------------------------------------------------
Q970N0_SULTO/87-396--------------------------------------------------------------------------------
E1NE18_9BIFI/50-378--------------------------------------------------------------------------------
D0L0C4_HALNC/81-412--------------------------------------------------------------------------------
B5JJZ7_9BACT/77-408--------------------------------------------------------------------------------
A3ZR35_9PLAN/118-447--------------------------------------------------------------------------------
B2HNB5_MYCMM/115-443--------------------------------------------------------------------------------
A2WED1_9BURK/114-449--------------------------------------------------------------------------------
Q1MBT4_RHIL3/98-432--------------------------------------------------------------------------------
B1M6F7_METRJ/100-432--------------------------------------------------------------------------------
B2ICY7_BEII9/94-428--------------------------------------------------------------------------------
Q02F91_PSEAB/81-412--------------------------------------------------------------------------------
A0QWP7_MYCS2/138-466--------------------------------------------------------------------------------
A5JAS0_BURML/116-451--------------------------------------------------------------------------------

PF02955

GSHB_SYNE7/132-305--------------------------------------------------------------------------------
GSHB_SYNY3/132-305--------------------------------------------------------------------------------
GSHB_NEIMA/127-301--------------------------------------------------------------------------------
GSHB_XYLFT/125-299--------------------------------------------------------------------------------
GSHB_SHEON/124-298--------------------------------------------------------------------------------
GSHB_RHOPA/124-297--------------------------------------------------------------------------------
GSHB_BUCAI/129-303--------------------------------------------------------------------------------
GSHB_PROMM/119-292--------------------------------------------------------------------------------
GSHB_CHRVO/123-297--------------------------------------------------------------------------------
Q73I56_WOLPM/115-287--------------------------------------------------------------------------------
GSHB_PROMA/119-292--------------------------------------------------------------------------------
GSHB_BRUSU/124-297--------------------------------------------------------------------------------
Q92UR6_RHIME/135-315--------------------------------------------------------------------------------
GSHB_RALSO/123-297--------------------------------------------------------------------------------
GSHB_CAUCR/125-298--------------------------------------------------------------------------------
GSHB_BUCBP/125-300--------------------------------------------------------------------------------
Q7CU65_AGRT5/135-315--------------------------------------------------------------------------------
GSHB_YERPE/124-298--------------------------------------------------------------------------------
GSHB_THEEB/132-305--------------------------------------------------------------------------------
Q6LMM4_PHOPR/124-298--------------------------------------------------------------------------------
GSHB_BORPA/128-302--------------------------------------------------------------------------------
Q7MGD8_VIBVY/125-307--------------------------------------------------------------------------------
Q6G0M1_BARQU/122-295--------------------------------------------------------------------------------
GSHB_PSESM/125-299--------------------------------------------------------------------------------
GSHB_COXBU/125-299--------------------------------------------------------------------------------
GSHB_ANACE/116-288--------------------------------------------------------------------------------
GSHB_WIGBR/124-297--------------------------------------------------------------------------------
GSHB_NOSS1/132-305--------------------------------------------------------------------------------
Q8RN60_RHITR/126-299--------------------------------------------------------------------------------
GSHB_BUCAP/129-303--------------------------------------------------------------------------------
Q6LH85_PHOPR/128-308--------------------------------------------------------------------------------
Q6F702_ACIAD/123-297--------------------------------------------------------------------------------
GSHB_GLOVI/128-301--------------------------------------------------------------------------------
GSHB_PROMP/119-292--------------------------------------------------------------------------------
GSHB_SYNPX/119-292--------------------------------------------------------------------------------
GSHB_ECOLI/124-298--------------------------------------------------------------------------------
GSHB_NITEU/126-300--------------------------------------------------------------------------------

PF03133

TTL_YEAST/388-732--------------------------------------------------------------------------------
Q9VKL9_DROME/368-666--------------------------------------------------------------------------------
TTL3B_DROME/325-625--------------------------------------------------------------------------------
TTLL3_HUMAN/213-505--------------------------------------------------------------------------------
TTLL4_HUMAN/651-946--------------------------------------------------------------------------------
O17720_CAEEL/115-423--------------------------------------------------------------------------------
TTLL1_HUMAN/48-364--------------------------------------------------------------------------------
TTL12_CAEEL/370-662--------------------------------------------------------------------------------
TTL12_HUMAN/346-642--------------------------------------------------------------------------------
TTL_BOVIN/81-367--------------------------------------------------------------------------------
TTL_SCHPO/119-383--------------------------------------------------------------------------------
TTLL4_CAEEL/185-476--------------------------------------------------------------------------------
Q9VX74_DROME/100-420--------------------------------------------------------------------------------
Q9VGW2_DROME/126-407--------------------------------------------------------------------------------
Q9VQV6_DROME/501-799--------------------------------------------------------------------------------
TTL3A_DROME/342-640--------------------------------------------------------------------------------
Q9U1E3_LEIMA/265-568--------------------------------------------------------------------------------
Q9VBX5_DROME/261-558--------------------------------------------------------------------------------
Q9VB58_DROME/190-486--------------------------------------------------------------------------------
TTL_RAT/81-367--------------------------------------------------------------------------------
Q9VZ97_DROME/119-439--------------------------------------------------------------------------------

PF14397

B6W1R0_9BACE/85-366--------------------------------------------------------------------------------
B5EAA5_GEOBB/103-387--------------------------------------------------------------------------------
B5VY88_SPIMA/78-340--------------------------------------------------------------------------------
A4ALQ8_9ACTN/70-333--------------------------------------------------------------------------------
A7VYN7_9CLOT/74-343--------------------------------------------------------------------------------
B0MM32_9FIRM/70-338--------------------------------------------------------------------------------
A6FLT0_9RHOB/80-384--------------------------------------------------------------------------------
A2PUE2_VIBCL/88-392--------------------------------------------------------------------------------
Q82TT3_NITEU/63-372--------------------------------------------------------------------------------
Q8A3L1_BACTN/280-551--------------------------------------------------------------------------------
B0MX85_9BACT/80-369--------------------------------------------------------------------------------

PF14305

Q7AJR3_BACHD/224-461-------------------------------------------------------------------------------A
Q8CX82_OCEIH/200-437-------------------------------------------------------------------------------A
A3Q6N7_MYCSJ/939-1176-------------------------------------------------------------------------------A
Q8A829_BACTN/55-295-------------------------------------------------------------------------------E
A8UGA4_9FLAO/32-274-------------------------------------------------------------------------------A
Q8PYT3_METMA/61-302-------------------------------------------------------------------------------E
B5UQ62_BACCE/58-299-------------------------------------------------------------------------------E
B1BGT7_CLOPF/58-308-------------------------------------------------------------------------------E
C3WFM3_FUSMR/63-297-------------------------------------------------------------------------------Q
Q2CG16_9RHOB/72-314-------------------------------------------------------------------------------R
B9JHB1_AGRRK/64-304-------------------------------------------------------------------------------D
Q6AIA9_DESPS/77-317-------------------------------------------------------------------------------E
B5L389_ECOLX/57-304-------------------------------------------------------------------------------Q
B3XSD0_UREUR/50-304-------------------------------------------------------------------------------E

PF08443

O59396_PYRHO/80-267-------------------------------------------------------------------------------A
RIMK_ECOLI/97-286-------------------------------------------------------------------------------A
COFF_METJA/94-282-------------------------------------------------------------------------------T
RIMK_HAEIN/105-293-------------------------------------------------------------------------------A
Y016_MYCPN/90-287-------------------------------------------------------------------------------A

PF05770

Q7XBW0_ORYSJ/9-321--------------------------------------------GDGQRRRYLIGYALAPKKQQSFIQPSLVSRAAGRGM
ITPK2_ARATH/34-338--------------------------------------------AFPVKKSIIVGYALTSKKIKSFLQPKLEGLARNKGI
ITPK1_ARATH/2-311--------------------------------------------SDSIQERYLVGYALAAKKQHSFIQPSLIEHSRQRGI
ITPK1_HUMAN/1-318--------------------------------------------MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGM
Q9AYJ2_ORYSJ/16-320--------------------------------------------VAVAGQRLVVGYALTKKKVKSFLQPKLLSLARKKSI

PF02786

PCCA_HUMAN/176-385-------------------------------------------------------------------------------D
CARY_BACSU/128-334-------------------------------------------------------------------------------D
PYR1_DICDI/525-729-------------------------------------------------------------------------------D
CARB_ECOLI/128-335-------------------------------------------------------------------------------D
CARB_TRICU/196-398-------------------------------------------------------------------------------D
CPSM_HUMAN/546-750-------------------------------------------------------------------------------D
CARB_BACCL/128-334-------------------------------------------------------------------------------D
BCCA_MYCLE/122-331-------------------------------------------------------------------------------D
PYR1_SCHPO/593-797-------------------------------------------------------------------------------D
ACCC_PSEAE/115-324-------------------------------------------------------------------------------D
CARB_YEAST/149-353-------------------------------------------------------------------------------D
ACCC_ECOLI/115-324-------------------------------------------------------------------------------D
BCCA_MYCTU/115-326-------------------------------------------------------------------------------D
ACCC_NOSS1/116-325-------------------------------------------------------------------------------D
PYC1_YEAST/135-344-------------------------------------------------------------------------------D
PYR1_MESAU/514-718-------------------------------------------------------------------------------D

PF02222

PURK_BACSU/115-285--------------------------------------------------------------------------------
PURT_METJA/120-294--------------------------------------------------------------------------------
PURT_PYRHO/125-304--------------------------------------------------------------------------------
PURT_ECOLI/121-295--------------------------------------------------------------------------------
PUR6_YEAST/113-285--------------------------------------------------------------------------------
PUR6_CANGA/113-284--------------------------------------------------------------------------------
PUR6_SCHOC/111-283--------------------------------------------------------------------------------
PUR6_PICME/113-284--------------------------------------------------------------------------------
PUR6_SCHPO/111-282--------------------------------------------------------------------------------
O80937_ARATH/197-369--------------------------------------------------------------------------------
PURK_ECOLI/87-254--------------------------------------------------------------------------------
PURK_HAEIN/92-261--------------------------------------------------------------------------------
PURK_PSEAE/105-272--------------------------------------------------------------------------------
PURK_SULSO/109-273--------------------------------------------------------------------------------
PURK_AQUAE/100-266--------------------------------------------------------------------------------
PURK_SYNY3/112-284--------------------------------------------------------------------------------
PURK_SYNE7/116-285--------------------------------------------------------------------------------
PURK_MYCLE/120-300--------------------------------------------------------------------------------
PURK_MYCTU/124-297--------------------------------------------------------------------------------
PURK_CORAM/129-306--------------------------------------------------------------------------------
PURT_BACSU/113-287--------------------------------------------------------------------------------
PURT_PASHA/121-294--------------------------------------------------------------------------------
PURT_SYNY3/117-292--------------------------------------------------------------------------------

PF13535

E8RY18_MICSL/111-299--------------------------------------------------------------------------------
D4GMV9_PANAM/88-261--------------------------------------------------------------------------------
C4FVJ7_9FIRM/127-305--------------------------------------------------------------------------------
Q2Z1L8_ERWST/114-292--------------------------------------------------------------------------------
D1C2W8_SPHTD/155-337--------------------------------------------------------------------------------
Q48NB4_PSE14/107-289--------------------------------------------------------------------------------
Q1MX58_9ACTO/104-292--------------------------------------------------------------------------------
D0Z8Q6_EDWTE/96-265--------------------------------------------------------------------------------
Q12II4_SHEDO/108-288--------------------------------------------------------------------------------
B4DFC6_HUMAN/597-796--------------------------------------------------------------------------------
B0NR58_BACSE/114-290--------------------------------------------------------------------------------
Q83Z60_STRCL/126-311--------------------------------------------------------------------------------
D4I204_ERWAC/99-280--------------------------------------------------------------------------------
C0QL65_DESAH/85-278--------------------------------------------------------------------------------
Q1JXP0_DESAC/85-278--------------------------------------------------------------------------------
B4EQF8_BURCJ/110-298--------------------------------------------------------------------------------
B8J507_ANAD2/110-304--------------------------------------------------------------------------------
C7M0Y2_ACIFD/99-283--------------------------------------------------------------------------------
C6WFN8_ACTMD/117-298--------------------------------------------------------------------------------
D3DDW5_9ACTO/117-307--------------------------------------------------------------------------------
C5NY10_9BACL/132-310--------------------------------------------------------------------------------
B2E5U2_STRPN/105-289--------------------------------------------------------------------------------
B9B6B7_9BURK/48-238--------------------------------------------------------------------------------
C4T7U3_YERIN/81-287--------------------------------------------------------------------------------
C4FU48_9FIRM/109-287--------------------------------------------------------------------------------
D0FMQ8_ERWPE/108-286--------------------------------------------------------------------------------
Q3A2P7_PELCD/85-278--------------------------------------------------------------------------------
E6VR59_DESAO/87-280--------------------------------------------------------------------------------
C5NXU5_9BACL/109-287--------------------------------------------------------------------------------
B1SDM3_9STRE/91-282--------------------------------------------------------------------------------
B8CGT7_SHEPW/109-279--------------------------------------------------------------------------------
Q1VVV2_9FLAO/85-276--------------------------------------------------------------------------------
Q888Y9_PSESM/114-292--------------------------------------------------------------------------------
Q3A6W8_PELCD/114-298--------------------------------------------------------------------------------
C1DMZ3_AZOVD/112-284--------------------------------------------------------------------------------
Q3S8Y0_PSESH/109-293--------------------------------------------------------------------------------
B1HFG7_BURPE/117-293--------------------------------------------------------------------------------
D5WN11_BURSC/115-291--------------------------------------------------------------------------------
D3DDW6_9ACTO/102-274--------------------------------------------------------------------------------
B5SP77_9ACTO/100-278--------------------------------------------------------------------------------
C4FBF5_9ACTN/118-307--------------------------------------------------------------------------------
Q1QB93_PSYCK/115-289--------------------------------------------------------------------------------
D5WN64_BURSC/107-292--------------------------------------------------------------------------------
B9DMB9_STACT/529-710--------------------------------------------------------------------------------
A3UL12_VIBSP/111-283--------------------------------------------------------------------------------
D3D707_9ACTO/131-310--------------------------------------------------------------------------------
D9TNI3_THETC/106-294--------------------------------------------------------------------------------
E8SDA7_MICSL/98-270--------------------------------------------------------------------------------
A5G3Z6_GEOUR/110-292--------------------------------------------------------------------------------
Q7N5R8_PHOLL/91-265--------------------------------------------------------------------------------
C7Q3P0_CATAD/103-280--------------------------------------------------------------------------------
C1F6E3_ACIC5/100-273--------------------------------------------------------------------------------
Q5WS01_LEGPL/99-278--------------------------------------------------------------------------------
CRNS1_CHICK/606-804--------------------------------------------------------------------------------
Q2SKF8_HAHCH/104-284--------------------------------------------------------------------------------
C4L724_EXISA/89-275--------------------------------------------------------------------------------
Q01ZL3_SOLUE/109-290--------------------------------------------------------------------------------
Q0SCF9_RHOSR/101-280--------------------------------------------------------------------------------
C2CRI1_CORST/134-299--------------------------------------------------------------------------------
A3CN29_STRSV/109-286--------------------------------------------------------------------------------
Q842E2_PSESX/109-294--------------------------------------------------------------------------------
C7N331_SLAHD/459-648--------------------------------------------------------------------------------
Q12II2_SHEDO/112-302--------------------------------------------------------------------------------
C0WVD3_LACFE/116-306--------------------------------------------------------------------------------
E7FN57_9LACO/100-280--------------------------------------------------------------------------------
Q0S8A9_RHOSR/103-283--------------------------------------------------------------------------------
A8M0K3_SALAI/103-297--------------------------------------------------------------------------------
B6B6A2_9RHOB/129-318--------------------------------------------------------------------------------
B4VDU1_9ACTO/110-294--------------------------------------------------------------------------------
A3CVX7_METMJ/109-278--------------------------------------------------------------------------------
B5XPP6_KLEP3/106-292--------------------------------------------------------------------------------
Q9AMT9_BRAJP/112-298--------------------------------------------------------------------------------
B0RPV7_XANCB/115-287--------------------------------------------------------------------------------
Q1VG50_VIBAL/111-283--------------------------------------------------------------------------------
D2QAU0_BIFDB/128-311--------------------------------------------------------------------------------
A7NRD0_ROSCS/111-286--------------------------------------------------------------------------------
C6BWA6_DESAD/85-278--------------------------------------------------------------------------------
D0FNI3_ERWPE/106-290--------------------------------------------------------------------------------
D4F6G3_EDWTA/108-277--------------------------------------------------------------------------------
Q121X7_POLSJ/108-282--------------------------------------------------------------------------------
C2CRI1_CORST/498-675--------------------------------------------------------------------------------
D1RZT7_SEROD/113-299--------------------------------------------------------------------------------
Q8TPB8_METAC/85-278--------------------------------------------------------------------------------
B2Q6S1_PROST/113-296--------------------------------------------------------------------------------
D9T106_MICAI/109-294--------------------------------------------------------------------------------
Q1QXJ8_CHRSD/106-286--------------------------------------------------------------------------------
D2B0J8_STRRD/100-269--------------------------------------------------------------------------------
B8GVA8_THISH/116-296--------------------------------------------------------------------------------
D7W254_9FLAO/112-293--------------------------------------------------------------------------------
B9B6B5_9BURK/104-287--------------------------------------------------------------------------------
Q0ACF5_ALHEH/120-296--------------------------------------------------------------------------------
B8J4T0_DESDA/96-289--------------------------------------------------------------------------------
Q5WSD6_LEGPA/104-283--------------------------------------------------------------------------------
A8FIK7_BACP2/134-334--------------------------------------------------------------------------------
Q6FAX4_ACIAD/125-307--------------------------------------------------------------------------------
D3PFD6_CRAVI/610-811--------------------------------------------------------------------------------
D7VTF5_9SPHI/110-291--------------------------------------------------------------------------------
A7N2D3_VIBHB/102-283--------------------------------------------------------------------------------
B7GNZ5_BIFLS/108-299--------------------------------------------------------------------------------
A7N6T3_VIBHB/145-321--------------------------------------------------------------------------------
Q888Z0_PSESM/112-290--------------------------------------------------------------------------------
D4HVL4_ERWAC/112-290--------------------------------------------------------------------------------
D4HVL5_ERWAC/114-292--------------------------------------------------------------------------------
Q0RGQ9_FRAAA/107-286--------------------------------------------------------------------------------
C6W4G0_DYAFD/113-294--------------------------------------------------------------------------------
Q0RYD4_RHOSR/107-296--------------------------------------------------------------------------------
D2UCG0_XANAP/114-286--------------------------------------------------------------------------------
Q02BT0_SOLUE/124-304--------------------------------------------------------------------------------
D9T7Z5_MICAI/109-288--------------------------------------------------------------------------------

PF07478

DDL_BORBU/136-344--------------------------------------------------------------------------------
DDLB_ECOLI/103-303--------------------------------------------------------------------------------
DDL_ENTFA/138-341--------------------------------------------------------------------------------
DDLA_SHIFL/147-348--------------------------------------------------------------------------------
DDL_SYNY3/134-342--------------------------------------------------------------------------------
VANB_ENTFA/138-337--------------------------------------------------------------------------------
DDL_MYCTU/158-363--------------------------------------------------------------------------------
DDL_AQUAE/101-291--------------------------------------------------------------------------------
MUDD_CHLTR/569-778--------------------------------------------------------------------------------
DDL_BUCAP/103-303--------------------------------------------------------------------------------
DDL_BACSU/135-338--------------------------------------------------------------------------------
Q47720_ENTCA/143-343--------------------------------------------------------------------------------
DDL_HAEIN/106-303--------------------------------------------------------------------------------
VANC_ENTGA/136-336--------------------------------------------------------------------------------
O33806_STRTO/139-338--------------------------------------------------------------------------------
DDL_LEUME/142-349--------------------------------------------------------------------------------
VANA_ENTFC/139-338--------------------------------------------------------------------------------
DDL_TREPA/143-347--------------------------------------------------------------------------------

PF06973

Q1ER85_9CREN/193-383--------------------------------------------------------------------------------
PURP_SULSO/152-337--------------------------------------------------------------------------------
PURP_METTP/173-356--------------------------------------------------------------------------------
Q8PZA1_METMA/193-387--------------------------------------------------------------------------------
Q975Y8_SULTO/160-348--------------------------------------------------------------------------------
PURP_METM5/174-361--------------------------------------------------------------------------------
Q4JAU2_SULAC/161-349--------------------------------------------------------------------------------
A8AB21_IGNH4/178-366--------------------------------------------------------------------------------
A1RQP6_PYRIL/168-356--------------------------------------------------------------------------------
PURP_PYRHO/149-333--------------------------------------------------------------------------------
PURP_METS5/151-332--------------------------------------------------------------------------------
PURP_UNCMA/178-365--------------------------------------------------------------------------------
Q8U3N6_PYRFU/189-380--------------------------------------------------------------------------------
PURP_METST/176-363--------------------------------------------------------------------------------
PURP_CALMQ/163-337--------------------------------------------------------------------------------
PURP_PYRCJ/163-333--------------------------------------------------------------------------------
PURP_IGNH4/170-347--------------------------------------------------------------------------------
PURP1_METMA/173-356--------------------------------------------------------------------------------
PURP_METS3/176-363--------------------------------------------------------------------------------
A4GI95_9BACT/191-385--------------------------------------------------------------------------------
A9A5F5_NITMS/177-363--------------------------------------------------------------------------------
O29983_ARCFU/174-373--------------------------------------------------------------------------------
PURP_SULAC/153-333--------------------------------------------------------------------------------
Q64BC8_9ARCH/174-354--------------------------------------------------------------------------------
PURP_METJA/174-361--------------------------------------------------------------------------------
PURP_METKA/174-359--------------------------------------------------------------------------------
Q5JD28_PYRKO/146-310--------------------------------------------------------------------------------
PURP_METBU/172-355--------------------------------------------------------------------------------
PURP_ARCFU/172-359--------------------------------------------------------------------------------
Q12X62_METBU/191-385--------------------------------------------------------------------------------
A8M9J4_CALMQ/161-349--------------------------------------------------------------------------------
PURP_CENSY/156-341--------------------------------------------------------------------------------
A4YCP1_METS5/159-347--------------------------------------------------------------------------------
Q64BC7_9ARCH/185-375--------------------------------------------------------------------------------
PURP_METTH/176-363--------------------------------------------------------------------------------
Q980P6_SULSO/161-349--------------------------------------------------------------------------------
A0B858_METTP/188-379--------------------------------------------------------------------------------
A0RW22_CENSY/177-363--------------------------------------------------------------------------------
PURP_NITMS/156-341--------------------------------------------------------------------------------
Q702E6_9CREN/179-365--------------------------------------------------------------------------------

PF15632

C7NS61_HALUD/17-350YR..VPA....GTDD.........G.....YVTRIADIVTKEDVDVVLPLTTDELQPLATHRED...V.....PASVMV.
D7DRZ5_METV3/6-346LK..VPYP...QDET.........E.....FINELIDICKKEEIDVILPQVTNELLPLSKNKKLFNELEDNKNGTKIAI.
B8GGE3_METPE/6-338YR..ISR....PSQA.........D.....YLDQLLSICEDEEVDVVLPQNTLELSVLAENRSSFSSI.....GTSIAV.
C5A2Z7_THEGJ/6-337YQ..VPP....ASSE.........E.....FIPTLLDICEREEVDVVLPQVTAELYPLARYKEDFEKI.....GTKVAV.
F8A3W6_CELGA/3-319HRRLVPP.G..KAEH...............FMDSVVQMCADDEIDVVFPTVDVELPRLAAARDRLTDV.....GTRLAS.
F4H040_CELFA/4-316RRRLVPA.G..RAPE...............FVDVVAQMCREDRIDVLFPTVDVELPRLAAERDRLAAD.....GTLLAS.
D5UBS5_CELFN/4-316NRRLVPA.G..RAPE...............FVDVVRRMCERDRIDVLVPTVDVELPRLAAARDALAAA.....GTRLAS.
D3FB15_CONWI/9-321QRAILPR.G..DDPA...............FADHLFELCEREAVDVVVPTVDSELLPLAIERERFAAT.....GVALVL.
A8KXY8_FRASN/5-354ID..EPP.G..EGDE...............FVEQALAACRRHGIDVFVPGRNMLD..VAARVGEFEAA.....GVRVMC.
E4NDG0_KITSK/6-341AL..EPD.GL.SAEA...............YVEFALAFCARHDVDVFLPRLHQLA..ISLRHRDFEAL.....GTALVC.
D1BH78_SANKS/2-342EI..EP..AL.TGDA...............YVDWALAFCQAHAIDVLLPGKEMLA..IATRAVEFAAL.....GVHVLA.
D1BIK1_SANKS/4-316HRRIVPR.G..AAPE...............FVDTVLDMCRDDGVTVLVPTVDVELEGLVARRTEFAAH.....GIQIAA.
Q82MB0_STRAW/6-340AM..EPE.GL.SPAG...............YVEYALDQCARRGIDVFVPRLHQDA..VVAHRADFAAA.....GTALLA.
O88027_STRCO/6-340EL..EPE.GL.SPAG...............YVEYALAQCARRGIDVFVPRLHQSA..IVAHRAEFEAL.....GTALLA.
D9XZU1_9ACTO/6-340EP..EPE.GL.SPAA...............YVEYALAQCERRGIDVFVPRLHQPA..IVARRADFEAV.....GTALLA.
D6EGI6_STRLI/6-340EP..EPE.GL.SPAG...............YVEYALAQCARRGIDVFVPRLHQSA..IVAHRAEFEAL.....GTALLA.
C9ZBJ4_STRSW/6-340DL..EPE.GL.SPAA...............YVEYALDQCAKRGIDVFVPRLHQAA..LAAHREEFAAA.....GTALLA.
B5HSJ5_9ACTO/6-340EL..EPE.GL.SPAA...............YVEFALDQCQKRGIDVFVPRLHQAA..IVAHRADFAAL.....GTALLA.
D9X752_STRVR/6-340EL..EPE.GL.SPAG...............YVEYALDQCARRGIDVFVPRLHQSA..VVAHRAEFEAA.....GTAVLA.
G2GBR6_9ACTO/6-340EP..EPE.GL.SPAA...............YVEYALAQCRRRGIDVFVPRLHQAA..IVAHRAEFEAV.....GTALLA.
F9Z982_ODOSD/8-342CV..ISP.A..KKEE.........E.....YLSDLMSICKDRNVKAILPQNTAELLLLAKHKKMFSDI.....GVGIVV.
A6LIK8_PARD8/6-341YQ..VPK....YTDS.........N.....FVDVLLNICKNEKVDVFFPHISMELPSILKRMDDFKKL.....DVKVAI.
E8U3T8_DEIML/7-345LT..EPR.GL.LGDA...............YVDWLLDTCARLRVDAFLVGKEPKS..VARRAAEFEAR.....GVHLIV.
Q9RSB2_DEIRA/9-338LT..EPR.GL.LGDD...............YVAWLLGTCAEHGFDLVLPGKERER..LAAYRDTFAAQ.....GTQLVV.
Q2BF09_9BACI/6-345GT..EPD..I.SGEE...............YILFCLDFCARNEIDIFIPRKENVL..ISRNLPRFEAI.....GVKVLV.
C0Z9Z4_BREBN/4-338EL..EPT..L.DVPE...............YIDYCLSFCKKHRIDVFLPNYRLVE..ISRHIKEFERQ.....GTQVMI.
F5RK20_9FIRM/2-337ET..EPV..LPVGTA...............YVEYALRFCRAQGIDVFFPRRALTL..LAQHQDAFRVQ.....GTILAA.
F4A6T7_CLOBO/7-346IK..IP...F.ASDK.........Q.....FVEKMITICKENDIQLIVPAYCEEIVKLAEYEKNFLKE.....GINILC.
B2V211_CLOBA/3-315YK..IHK.Y..NEEE...............YIDHLIKICKNEKVDLLIPLYEKEFSILCENRDKFKKN.....GTILLL.
A7GGU2_CLOBL/9-348VK..IP...F.SSDE.........D.....FVSKMIRICKENNIDLIVPAYSQEILELAKNEEVFLRE.....GIHILC.
F2JJ82_CELLD/4-343WE..EPKKGI.SPED...............YVEWCLTFCREHQVDVFIPKRHMIA..IAKRKEAFTEL.....GIKVLV.
G6G5N9_9FIRM/16-350EV..EPA..I.DGKD...............YADYCLDFCQKHNINIFIPRYNVST..LIKFKDLFENL.....GVKVMF.
F3ZYZ6_MAHA5/15-326FK..VPN.F..NDAG...............YVDVLLDICRNEGVSLLIPLHEGEFNVLLQNRRRFEDA.....GCRLLL.
E0IAJ8_9BACL/7-342TV..EPV..L.HGLD...............YAQFCVDFCREHEIDVFIPRLHMLD..IARHIALFDEI.....GTQVTV.
E0RJG3_PAEP6/5-340EV..EPR..T.SGVE...............YAQFCADFCKRHGIDVFIPRWNMLD..ISKHLYLFDDI.....GTKVMV.
E3EE70_PAEPS/5-340EV..EPR..T.SGVE...............YAQFCADFCRRHEIDVFIPRWNMLD..ISKHLYLFDDI.....GTEVMV.
E6UFS3_RUMA7/7-336YV..EPN.GV.NGEE...............YAAWALGFCREHSVDVFFPKRWRAA..VISHISEFEAI.....GTHVTA.
E9SAE7_RUMAL/7-336YT..EPR.GV.DGVQ...............YTAWALDFCKAHEVDVFFPKRWRAE..IMKHLDEFAAI.....GTKVTA.
C9LVE5_9FIRM/2-338YT..EPA..LPVSDE...............YVEYCLEFCKAHHIDIFFPRRALTL..LSRYREEFLAA.....GTKLAV.
F4QGW0_9CAUL/2-325WV..EPD..V.DAAD...............YVAWARGQVEAYRIDLMIPTHYRTA..LREAQLPCRVE..F.........
G2TCW6_RHORU/2-335FV..EPA..GLEDDA...............YGAWCLEQCRARGVDLFVPQRRRQV..IGRQRAAFEAA.....GVRLSI.
Q5NWT2_AROAE/3-340AT..EPS.GL.TGEA...............YVGWCLAFCKEQRVDIFVPGKEATL..IGRHAKRFLDQ.....GVRVLS.
Q82TT1_NITEU/3-312....LPS......VK...............TQQLLRERVQGENFDIILPSDMGSAAFLAATKKAYP.......DLPCFP.
Q0AHL8_NITEC/3-312....VPS......TT...............TQQLLRERVEAENFDVILPSDMASAAFLAATKKVYP.......DLPCFP.
A1VWP6_POLNA/3-339AV..EPS.GL.KGQA...............YLDWCLEFCHEHGIGIFIPGKEASL..LSAERQQFEAQ.....GTRLLC.
Q6FAX4_ACIAD/19-350LQ..EP.....PFSE...............RVEWVLQQAQRLNVKLIIAGHHAAI..YLAEKHRFEQL.....GIRLMAG
D3RPB0_ALLVD/3-344AL..EPA.GL.SGAD...............YVDFCLDFCRERHVDALWPGKEARL..LTEQRPRFSAI.....GVRLLS.
C1MFA0_9ENTR/4-345LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEST.....GATLTTG
A7MPT7_CROS8/12-353LT..EPE....DPQR...............RLQFIQETIQNHGIHHIHTGRNSQW..FEEHRTAIESA.....GATLTTG
C8Q020_9GAMM/11-360YQ..EPS....EPSE...............RVEFVLDRAKHHHVKVVLTGRNSQD..YEARRQDFKAA.....GIRLLTG
C1IUG1_ENTCL/4-345LT..EPE....DPQK...............RLQFIQETIQSYGIHHIHTGRNSQW..FEEHRSAIEST.....GATLTTG
D5CKR1_ENTCC/12-353LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSDIEST.....GATLTTG
Q5CB43_ECOLX/4-334LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEST.....GATLTTG
G5Q9H1_SALMO/4-345LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEST.....GATLTTG
E7HA30_ECOLX/1-338LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEPT.....GATLTTG
F9CS19_ECOLX/4-345LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEPT.....GATLTTG
F8YR44_ECOLX/4-345LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEST.....GATLTTG
B2NP55_ECO57/4-345LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEPT.....GATLTTG
E7TZ65_ECO57/4-345LT..EPE....DPQK...............RLQFIQETIQTYGIHHIHTGRNSQW..FEEHRSAIEPT.....GATLTTG
A7KFT2_KLEPN/4-345LT..EPE....DPQK...............RLQFIQETIQSYGIHHIHTGRNSQW..FEEHRSAIEST.....GATLTTG
B5RKB9_KLEP3/4-345ML..EPK....SEEE...............RLSFIHSITSAHGINAIHTGRNCKW..FESHRENIQRS.....GIHLTTG
C4XDI7_KLEPN/4-345MI..EPN....NEEE...............RLSFIHSITDAHGINAIHTGRNCKW..FESHRENIQRS.....GVHLTTG
A3JJ84_9ALTE/2-339LP..EPA....ETRLMSPDA..........YADWLLQVALTERAELVLPYRRREE..LAGFRDWFSAR.....GIRLLTA
G3ISJ3_9GAMM/2-338YL..EPT.EL.TGQE...............YLEWCVGFCRQHNIRLFWPGKEAAF..ISKHHEFFQAI.....GVQVLS.
H8GG73_METAL/2-338YL..EPS.EL.HGQE...............YIDWCLDFCREHRIELFWPGKEAAL..ACKNRAPFESE.....GVRLMA.
E1PL52_PANVC/6-350YL..EPD....ETQD...............LLPFIAGICTKHNVVAIHAGKRGHL..LERYRDAIDEM.....GVKLTTG
D0KLU9_PECWW/4-345FL..EPK....DETE...............RLSFILTTVKTQGIHAIHAGRHGRW..CENYRHEIESL.....GVKLTTG
B2Q6S1_PROST/4-344RL..EPE....DSAE...............RLAFITRLVEKEKISAIQAGRNSEW..FESHRQQIESL.....GVKLTTG
B3G2E4_PSEAI/1-332FL..EPK....DNQE...............RIDWVIETALRHGIKVILAGRVGSV..FEAQRHRFEVA.....GLVLVTG
D7HVQ0_PSESS/1-332LQ..EPV....DNEE...............RIDWVLETARSLGVRTIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3H5H4_PSESX/1-332LQ..EPV....DNDE...............RIDWVLQTARSLGVKIIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3JPH6_PSESX/1-332LQ..EPV....DNDE...............RIDWVLHTARSLGVKIIVAGRIGSF..YEAQRDRFVAE.....GLDLVTG
F3I9M2_PSESF/1-332LQ..EPV....DNEE...............RIDWVLETARSLGVKTIVAGRIGGV..YEAQRARFVAE.....GLDLVTG
F3DCN0_9PSED/1-332LQ..EPV....DNEE...............RIDWVLETARSLGVRTIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3IYZ7_PSEAP/1-332LQ..EPV....DNEE...............RIDWVLQTARSLGVKIIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
E7P0I7_PSESG/1-332LQ..EPV....DNEE...............RIDWVLQTARSLGVRTIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3FNS0_PSESX/1-332LQ..EPV....DNDE...............RVDWVLHTARSLGVKIIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3EI09_PSESL/1-332LQ..EPV....DNEE...............RIDWVLETARSLGVRTIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3E7Y8_PSESL/1-347EL..EPT.FK.DAEA...............YAAWALEFVKTHGVECIVASRNLEA..LALNEAAFEAM.....GVKVLR.
F3HNW9_PSEYM/1-332LQ..EPL....DNQE...............RIDWVLEHARSLGAKVIVAGRVGGL..YEAQRARFIAE.....GLDLVTG
F3EZH7_9PSED/1-332LQ..EPV....DNEE...............RIDWVLETARSLGVRTIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3DP68_9PSED/1-332LQ..EPL....DNEE...............RIDWVLETALSLGVKTIVAGRVGGV..YEAQRARFVAE.....GLDLVTG
F2ZRA0_9PSED/1-332LQ..EPL....DNEE...............RIDWVLENARAMGVSVIIAGRVGGV..YEAQRSRFVAE.....GLDLVTG
Q48NB4_PSE14/1-332LQ..EPV....DNEE...............RIDWVLETARSLGVRTIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
Q4ZYB3_PSEU2/1-332LQ..EPV....DNDE...............RIDWVLHTARSLGVKIIVAGRIGSF..YEAQRDRFVAE.....GLDLVTG
F3K7E1_PSESZ/1-332LQ..EPV....DNEE...............RIDWVLETARSLGVRTIVAGRIGSF..YEAQRARFVAE.....GLDLVTG
F3IPW6_PSESL/1-332LQ..EPI....DNEE...............RIDWVLETARSLGVKTIVAGRVGGI..YEAQRARFVAE.....GLDLVTG
E2MHB3_PSEUB/1-332LQ..EPI....DNEE...............RIDWVLETARSLGVKTIVAGRVGGI..YEAQRARFVAE.....GLDLVTG
Q4FTP6_PSYA2/15-383YR..EPSVTATDSDEQAIIESVETLIP...RWEFVLEQAKNNNVKVLLTGRNGID..YEAQREKFTAA.....GIRLLTG
Q1QCQ8_PSYCK/15-383YR..EPSISTADSDEQAVLESVEPLMP...RWQFVLEQAQKNNVKVLLTGRNGID..YEAHREKFAAA.....GIRLLTG
F5SQ56_9GAMM/11-404FT..EPHITKGATSAQPSLVADTDGTQIMPRWQFVLEQAIEHQTKVLLTGRNSID..YELHRTQFEQA.....GIRLLTG
A5WBK0_PSYWF/11-370FI..EPS....VKQEQQSG.........LARWQFVLQHAIKANTKVLLTGRNSIT..YEAQRAQFEQA.....GIRLLTG
G4DVY4_9GAMM/3-340AL..EPT.GT.VGEA...............YLDFCLGFCRKRRIDFLWPGKGVQW..LAAHQERFAEQ.....GVRVLT.
H8Z6R5_9GAMM/3-341AL..EPA.DL.SDED...............YLEYCLGVCREQRVDAFWPGKAAEL..IARHQARFAAL.....GVPVLA.
A9QYJ5_YERPG/4-344FI..EPS....DLDT...............KMAFIRHIVKAFDIEAIHTGRSCLW..FEQHRAAIEGL.....GVKLTTG
A4TRW4_YERPP/4-345FI..EPS....DLDT...............KMAFIRHIVKAFDIEAIHTGRSCLW..FEQHRAAIEGL.....GVKLTTG
D1U1X0_YERPE/1-338FI..EPS....DLDT...............KMAFIRHIVKAFDIEAIHTGRSCLW..FEQHRAAIEGL.....GVKLTTG
A7FNB6_YERP3/4-345FI..EPS....DLDT...............KMAFIRHIVKAFDIEAIHTGRSCLW..FEQHRAAIEGL.....GVKLTTG
B1JNG1_YERPY/4-345FI..EPS....DLDT...............KMAFIRHIVKAFDIEAIHTGRSCLW..FEQHRAAIEGL.....GVKLTTG

PF14398

Q73CW4_BACC1/180-443---------------------------------------------------------------------------RKLEH
YHED_BACSU/178-440---------------------------------------------------------------------------KRLID
D4G719_BACNA/90-350---------------------------------------------------------------------------EWLKK
Q5L2A9_GEOKA/175-436---------------------------------------------------------------------------KTLQT
A9U6Q3_PHYPA/63-329---------------------------------------------------------------------------VSANG
A6TTN9_ALKMQ/120-382---------------------------------------------------------------------------NRIKE
Q0AXS1_SYNWW/103-364---------------------------------------------------------------------------RKFSE
A9U6Q2_PHYPA/86-348---------------------------------------------------------------------------IDECM
A9U6A9_PHYPA/218-483---------------------------------------------------------------------------KEAKS
C6D8D2_PAESJ/189-456---------------------------------------------------------------------------KEIKN
B6YYR2_9RHOB/176-439---------------------------------------------------------------------------KNRMR
A3I7C7_9BACI/90-348---------------------------------------------------------------------------IIERL
C6D2S3_PAESJ/1-246---------------------------------------------------------------------------.....
C6D2S4_PAESJ/84-344---------------------------------------------------------------------------TLVKK

PF14403

A8M4T7_SALAI/1-452LPADLRADMVSAGVESWREIFDGRASYNQQWRLARPPVMDRTSLRVLNSVCDRLAQLVFEACRRRARTA..G.ELRQLLG
Q02DC9_SOLUE/4-448LHERMESGKLSAGGRLVCPFL.............RPNFISRRQYESLVKTGESLISAIDRMEQMVLTTP....SLLARLE
A5UWI9_ROSS1/2-461LTVGQRECNLFFGDRPLATVM.............RPRFLTRPQYDLLRRGVGLVVAALQRLGDALLADP....ALRARIA
A9WAS2_CHLAA/3-460LTAEMRARRLYFGERPLATVL.............RPRLITASQYELLRRGTQQVAEAARAIVAAALDSSEAGQAVREVLM
B8GC89_CHLAD/3-460LTEEMRARRLYFGERPLATVL.............RPRLMTMTQYELLRHGTKQVAEAARLIVAAALADDEVGRAVREVLM
A8MKZ9_ALKOO/3-442ILKKVEESPAKYKGSPVEFLY.............QPMLLSDEDFKRFQDLTDMLLVILNKVIQQYLEEP....TFRSYFG

PF01071

Q20143_CAEEL/100-292--------------------------------------------------------------------------------
PUR2_BACSU/101-293--------------------------------------------------------------------------------
PUR2_ARATH/198-392--------------------------------------------------------------------------------
PUR2_MYCLE/101-292--------------------------------------------------------------------------------
PUR2_HAEIN/103-296--------------------------------------------------------------------------------
PUR2_METTH/100-298--------------------------------------------------------------------------------
PUR2_SCHPO/109-301--------------------------------------------------------------------------------
PUR2_YEAST/108-308--------------------------------------------------------------------------------
PUR2_HELPY/105-292--------------------------------------------------------------------------------
PUR2_ARCFU/109-334--------------------------------------------------------------------------------
PUR2_METJA/103-304--------------------------------------------------------------------------------
PUR2_CHICK/105-298--------------------------------------------------------------------------------
PUR2_ECOLI/103-296--------------------------------------------------------------------------------
PUR2_HUMAN/105-298--------------------------------------------------------------------------------
PUR2_MYCTU/101-292--------------------------------------------------------------------------------
PUR2_SYNY3/103-291--------------------------------------------------------------------------------
PUR2_YARLI/108-301--------------------------------------------------------------------------------
PUR2_DROME/108-301--------------------------------------------------------------------------------
PUR2_CHITE/109-301--------------------------------------------------------------------------------

PF08442

MTKA_METEA/2-203--------------------------------------------------------------------------------
SUCB1_CAEEL/25-233--------------------------------------------------------------------------------
SUCC2_STRCO/2-191--------------------------------------------------------------------------------
SUCC2_ARCFU/2-195--------------------------------------------------------------------------------
SUCC_HAEIN/2-203--------------------------------------------------------------------------------
SUCC_SHIFL/2-203--------------------------------------------------------------------------------
SUCC_METTH/2-194--------------------------------------------------------------------------------
SUCB2_CAEEL/21-231--------------------------------------------------------------------------------
SUCC_METJA/2-193--------------------------------------------------------------------------------
SUCB2_PIG/40-248--------------------------------------------------------------------------------
SUCC1_ARCFU/2-195--------------------------------------------------------------------------------
SUCB_NEOFR/29-237--------------------------------------------------------------------------------
SUCC_CHLPN/2-203--------------------------------------------------------------------------------
SUCC_AQUAE/2-199--------------------------------------------------------------------------------
SUCB_TRIVA/11-220--------------------------------------------------------------------------------
SUCC_BACSU/2-203--------------------------------------------------------------------------------
SUCB_YEAST/32-240--------------------------------------------------------------------------------
SUCB_SCHPO/24-232--------------------------------------------------------------------------------
SUCC_COXBU/2-204--------------------------------------------------------------------------------
SUCC_THETH/2-194--------------------------------------------------------------------------------
SUCC_MYCTU/2-195--------------------------------------------------------------------------------
SUCC_RICPR/2-203--------------------------------------------------------------------------------

PF02655

Q8PZ07_METMA/105-278--------------------------------------------------------------------------------
O27028_METTH/106-265--------------------------------------------------------------------------------
Q603D9_METCA/124-284--------------------------------------------------------------------------------
Q8PU46_METMA/109-270--------------------------------------------------------------------------------
Y776_METJA/124-282--------------------------------------------------------------------------------
Q7UJD2_RHOBA/127-319--------------------------------------------------------------------------------
Q6LZR0_METMP/123-259--------------------------------------------------------------------------------
O29201_ARCFU/107-251--------------------------------------------------------------------------------
O28027_ARCFU/97-247--------------------------------------------------------------------------------
Q97H24_CLOAB/105-271--------------------------------------------------------------------------------
Q8TQR5_METAC/109-277--------------------------------------------------------------------------------
Q6M182_METMP/105-262--------------------------------------------------------------------------------
Q8TJB8_METAC/125-298--------------------------------------------------------------------------------
Q7BQQ5_XANAU/119-279--------------------------------------------------------------------------------
O26923_METTH/114-270--------------------------------------------------------------------------------
Q8TZ26_METKA/104-247--------------------------------------------------------------------------------
Y815_METJA/136-272--------------------------------------------------------------------------------
Q8TV12_METKA/118-275--------------------------------------------------------------------------------

PF13549

Q30WE4_DESDG/474-696-----------------------------------------------------------------------------EAL
B5EIR8_GEOBB/481-697-----------------------------------------------------------------------------QAR
A7HUK1_PARL1/484-706-----------------------------------------------------------------------------TAL
B5W864_SPIMA/500-721-----------------------------------------------------------------------------KVL
Q1D3M9_MYXXD/505-726-----------------------------------------------------------------------------SAR
A2BJ63_HYPBU/14-235-----------------------------------------------------------------------------QAL
B8GB69_CHLAD/473-695-----------------------------------------------------------------------------DVR
A9EVP6_SORC5/499-721-----------------------------------------------------------------------------GVR
B7K6U2_CYAP7/499-721-----------------------------------------------------------------------------SVQ
Q02CN5_SOLUE/497-719-----------------------------------------------------------------------------KAR
A4U1N9_9PROT/483-706-----------------------------------------------------------------------------EVM
Q1YNA3_MOBAS/481-703-----------------------------------------------------------------------------TVR
C8X4E1_DESRD/482-705-----------------------------------------------------------------------------KAL
A6C207_9PLAN/482-704-----------------------------------------------------------------------------AAL
Q2W464_MAGSA/483-705-----------------------------------------------------------------------------EAL
B8CEH1_THAPS/525-748-----------------------------------------------------------------------------EAQ
C1DBF7_LARHH/480-702-----------------------------------------------------------------------------TAL
B4D2X3_9BACT/490-711-----------------------------------------------------------------------------HAR
Q2LRG1_SYNAS/43-258-----------------------------------------------------------------------------QAI
A3ZSV0_9PLAN/482-704-----------------------------------------------------------------------------TIL
D2R7V1_PIRSD/482-704-----------------------------------------------------------------------------QIL
A8I025_AZOC5/478-700-----------------------------------------------------------------------------AVI
Q1QYL0_CHRSD/482-704-----------------------------------------------------------------------------GVI
Q0W5Z5_UNCMA/472-693-----------------------------------------------------------------------------DAR
Q12E86_POLSJ/490-712-----------------------------------------------------------------------------QAL
Q8PZJ9_METMA/26-247-----------------------------------------------------------------------------AAL
D5CS41_SIDLE/485-707-----------------------------------------------------------------------------GAM
Q223I3_RHOFD/478-701-----------------------------------------------------------------------------DAL
A2SHI2_METPP/474-697-----------------------------------------------------------------------------RAL
B0CB03_ACAM1/496-716-----------------------------------------------------------------------------DAT
B1XHT3_SYNP2/500-722-----------------------------------------------------------------------------SIR
B9Z1Z5_9NEIS/480-702-----------------------------------------------------------------------------AAL
A9B7A3_HERA2/473-695-----------------------------------------------------------------------------QVR
A5V1W2_ROSS1/474-696-----------------------------------------------------------------------------RVR
B9MJF1_ACIET/473-695-----------------------------------------------------------------------------SVL
Q7NLP6_GLOVI/494-729-----------------------------------------------------------------------------AAR
C9R913_AMMDK/477-698-----------------------------------------------------------------------------RAR
Q1Q1N5_9BACT/475-697-----------------------------------------------------------------------------QMK
D6Z2N4_DESAT/474-696-----------------------------------------------------------------------------RRR
Q0KA53_CUPNH/481-703-----------------------------------------------------------------------------NAL
E3HYZ8_RHOVT/480-705-----------------------------------------------------------------------------SVL
A1K623_AZOSB/482-704-----------------------------------------------------------------------------TAL
B8GPY5_THISH/486-708-----------------------------------------------------------------------------GVL
Q2LUQ3_SYNAS/506-727-----------------------------------------------------------------------------KAL
Q47CI3_DECAR/482-704-----------------------------------------------------------------------------ALL
A1RXS7_THEPD/479-701-----------------------------------------------------------------------------SAL
B5IPC9_9CHRO/514-740-----------------------------------------------------------------------------QAQ
Q6MAV5_PARUW/501-722-----------------------------------------------------------------------------KAQ
C6C1C2_DESAD/472-693-----------------------------------------------------------------------------NAL
Q8DJG8_THEEB/495-717-----------------------------------------------------------------------------QVR
B0UM89_METS4/27-247-----------------------------------------------------------------------------RVK
A8ZZJ4_DESOH/481-703-----------------------------------------------------------------------------TCR
Q92Z73_RHIME/480-705-----------------------------------------------------------------------------RVA
Q7NRV4_CHRVO/480-702-----------------------------------------------------------------------------AAL
Q2Y8E7_NITMU/478-700-----------------------------------------------------------------------------GAM
Q6AQI6_DESPS/472-694-----------------------------------------------------------------------------RSQ
Q3SEU0_THIDA/481-703-----------------------------------------------------------------------------SAL
D0L1W1_HALNC/488-710-----------------------------------------------------------------------------AAR
A1VIA4_POLNA/472-694-----------------------------------------------------------------------------HVL
O29057_ARCFU/463-681-----------------------------------------------------------------------------KLL
B8HP40_CYAP4/501-729-----------------------------------------------------------------------------TVR
C4ZP31_THASP/482-704-----------------------------------------------------------------------------MAL
C7RIF7_ACCPU/482-704-----------------------------------------------------------------------------AVL
B9B8Y3_9BURK/493-714-----------------------------------------------------------------------------AAA
B5HI28_STRPR/17-237-----------------------------------------------------------------------------GAL
C7NV33_HALUD/473-693-----------------------------------------------------------------------------RTK
Q13N88_BURXL/472-694-----------------------------------------------------------------------------SVL
A5D252_PELTS/478-700-----------------------------------------------------------------------------DVT
D2PSA1_KRIFD/14-237-----------------------------------------------------------------------------QAL
Q89QG9_BRAJA/95-315-----------------------------------------------------------------------------QVK
Q2LV27_SYNAS/9-227-----------------------------------------------------------------------------KGE
A7BXB1_9GAMM/467-693-----------------------------------------------------------------------------SVL
B9TF03_RICCO/23-245-----------------------------------------------------------------------------TAR
A5D1F4_PELTS/478-699-----------------------------------------------------------------------------DVK
B8FK52_DESAA/483-704-----------------------------------------------------------------------------EKL
E8YSP4_9BURK/36-256-----------------------------------------------------------------------------HAK
C9ZD67_STRSW/15-235-----------------------------------------------------------------------------AVR
Q2LPY3_SYNAS/483-704-----------------------------------------------------------------------------KAV
C0GKL8_9FIRM/479-700-----------------------------------------------------------------------------DVL
D4GVH7_HALVD/472-692-----------------------------------------------------------------------------TVK
C0QHK1_DESAH/488-708-----------------------------------------------------------------------------KAK
A5FQG4_DEHSB/106-328-----------------------------------------------------------------------------KVA
B4RED1_PHEZH/481-703-----------------------------------------------------------------------------GVL
Q9HQZ0_HALSA/317-537-----------------------------------------------------------------------------DAA
C0QJ02_DESAH/490-712-----------------------------------------------------------------------------GCL
Q7W8F6_BORPA/17-239-----------------------------------------------------------------------------QAL
C0QHB0_DESAH/487-709-----------------------------------------------------------------------------GAL
Q1LF49_RALME/14-234-----------------------------------------------------------------------------IAK
D3STG0_NATMM/473-693-----------------------------------------------------------------------------RVE
E6VV76_DESAO/485-707-----------------------------------------------------------------------------HAL
B1T453_9BURK/492-715-----------------------------------------------------------------------------RCR
A4J695_DESRM/478-699-----------------------------------------------------------------------------DVI
A5D034_PELTS/478-700-----------------------------------------------------------------------------DVI
A3VE72_9RHOB/482-704-----------------------------------------------------------------------------NAL
Q64CH5_9ARCH/12-232-----------------------------------------------------------------------------NAL
A4YYL2_BRASO/483-708-----------------------------------------------------------------------------SAL
A4SW96_POLSQ/471-693-----------------------------------------------------------------------------NVL
A7MH14_CROS8/473-695-----------------------------------------------------------------------------QAC
Q988U3_RHILO/480-705-----------------------------------------------------------------------------QVA
D7AUW7_NOCDD/22-244-----------------------------------------------------------------------------RAR
B1I353_DESAP/478-699-----------------------------------------------------------------------------AVK
Q330N5_9EURY/8-229-----------------------------------------------------------------------------AAR
A0B6M1_METTP/11-226-----------------------------------------------------------------------------QAL
Q20Z65_RHOPB/482-707-----------------------------------------------------------------------------AAV
Q604W6_METCA/481-703-----------------------------------------------------------------------------GAL
Q3IQS4_NATPD/472-692-----------------------------------------------------------------------------SVE
Q2NFU6_METST/479-700-----------------------------------------------------------------------------EAK
C6BU19_DESAD/485-707-----------------------------------------------------------------------------KAL
A0LJP9_SYNFM/480-702-----------------------------------------------------------------------------TNL
Q0A9U7_ALHEH/468-689-----------------------------------------------------------------------------AAL
Q2Y4P6_9ARCH/484-706-----------------------------------------------------------------------------SVA
B7KVR5_METC4/479-704-----------------------------------------------------------------------------EAL
B2Q2E9_PROST/473-695-----------------------------------------------------------------------------QAL
C0QAQ8_DESAH/481-702-----------------------------------------------------------------------------AAL
A5D530_PELTS/478-699-----------------------------------------------------------------------------DVK
D2U861_XANAP/477-702-----------------------------------------------------------------------------AAL
B9AE11_METSM/477-698-----------------------------------------------------------------------------KVK
Q11G56_MESSB/480-705-----------------------------------------------------------------------------KAA
B3Q6R1_RHOPT/482-707-----------------------------------------------------------------------------KAL
A3Y536_9GAMM/503-723-----------------------------------------------------------------------------NAK
B8DM77_DESVM/483-705-----------------------------------------------------------------------------DAL
B4WR45_9SYNE/496-729-----------------------------------------------------------------------------RVR
Q3BMW9_XANC5/481-706-----------------------------------------------------------------------------EAL
B6R8H6_9RHOB/482-707-----------------------------------------------------------------------------VAL
Q7N786_PHOLL/472-694-----------------------------------------------------------------------------QAL
Q1QM20_NITHX/483-708-----------------------------------------------------------------------------SAV
Q2W7Y3_MAGSA/500-722-----------------------------------------------------------------------------RGL
E3I048_RHOVT/473-695-----------------------------------------------------------------------------NGL
D0I5J1_VIBHO/484-706-----------------------------------------------------------------------------QAL
B1LZ43_METRJ/472-697-----------------------------------------------------------------------------GAL
Q07QV1_RHOP5/482-707-----------------------------------------------------------------------------AAV
D3RU01_ALLVD/481-703-----------------------------------------------------------------------------GVM
Q3AFE8_CARHZ/490-711-----------------------------------------------------------------------------NAL
A9DH35_9GAMM/486-708-----------------------------------------------------------------------------KAK
B8FE80_DESAA/10-226-----------------------------------------------------------------------------CVK
C6CLU6_DICZE/473-695-----------------------------------------------------------------------------QAL
C7LTU8_DESBD/481-703-----------------------------------------------------------------------------TAL
B8FIX8_DESAA/9-225-----------------------------------------------------------------------------RVL
Q12WB1_METBU/472-693-----------------------------------------------------------------------------DAI
B2FMM9_STRMK/482-707-----------------------------------------------------------------------------AAL
D3V3Z2_XENBS/472-694-----------------------------------------------------------------------------QVL
B8IED3_METNO/488-713-----------------------------------------------------------------------------AAV
A7C137_9GAMM/159-381-----------------------------------------------------------------------------RIL
D4HZ45_ERWAC/472-694-----------------------------------------------------------------------------QAL
E6WFR2_PANSA/472-694-----------------------------------------------------------------------------QAL
C4ZKF4_THASP/487-709-----------------------------------------------------------------------------GAL
A1S6F9_SHEAM/486-708-----------------------------------------------------------------------------AAL
Q1YVR3_PHOPR/216-438-----------------------------------------------------------------------------HLL
A3QEK7_SHELP/486-708-----------------------------------------------------------------------------RAI
C9PHJ3_VIBFU/483-706-----------------------------------------------------------------------------EHL
Q2YZQ5_9DELT/33-247-----------------------------------------------------------------------------NAK
Q0HVJ0_SHESR/495-717-----------------------------------------------------------------------------AAQ
C0QFL6_DESAH/13-229-----------------------------------------------------------------------------AAL
A8FV14_SHESH/486-708-----------------------------------------------------------------------------KAL
Q4XQ92_PLACH/180-403-----------------------------------------------------------------------------KAF
Q1QWA2_CHRSD/486-716-----------------------------------------------------------------------------SAK
B4EUX9_PROMH/472-694-----------------------------------------------------------------------------DAL
A1WTN4_HALHL/467-689-----------------------------------------------------------------------------AAL
O28761_ARCFU/667-877-----------------------------------------------------------------------------EAI
D3PVJ8_STANL/666-881-----------------------------------------------------------------------------EAL
Q082P1_SHEFN/486-708-----------------------------------------------------------------------------RAL
D3FEQ9_CONWI/670-890-----------------------------------------------------------------------------RAL
D0Z2J5_LISDA/490-712-----------------------------------------------------------------------------ELL
A3UW19_VIBSP/483-706-----------------------------------------------------------------------------RQL
A1RWD9_THEPD/9-229-----------------------------------------------------------------------------KAL
B8CM86_SHEPW/486-708-----------------------------------------------------------------------------MAL
A1VGL0_DESVV/20-292-----------------------------------------------------------------------------SAR
B9M8K3_GEOSF/479-695-----------------------------------------------------------------------------EAR
D0X5Z1_VIBHA/468-690-----------------------------------------------------------------------------QLL
B3LBB6_PLAKH/551-775-----------------------------------------------------------------------------NAL
C4XLT1_DESMR/479-701-----------------------------------------------------------------------------RAF
A4FCG4_SACEN/661-877-----------------------------------------------------------------------------SAI
C5B797_EDWI9/472-694-----------------------------------------------------------------------------QAQ
Q2BZN6_9GAMM/19-241-----------------------------------------------------------------------------MML
A0NUW5_9RHOB/488-713-----------------------------------------------------------------------------AAL
B9R2H8_9RHOB/488-713-----------------------------------------------------------------------------AAL
Q12N16_SHEDO/486-708-----------------------------------------------------------------------------LAR
Q3IFA9_PSEHT/480-701-----------------------------------------------------------------------------EFL
C6CAZ3_DICDC/473-695-----------------------------------------------------------------------------QAL
A1VAF7_DESVV/482-698-----------------------------------------------------------------------------DAL
E6VZV8_DESAO/478-699-----------------------------------------------------------------------------KAR
C6C0V7_DESAD/480-701-----------------------------------------------------------------------------NCR
A0KEL7_AERHH/447-666-----------------------------------------------------------------------------QAL
B0KMM7_PSEPG/475-696-----------------------------------------------------------------------------QAL
Q2NRP0_SODGM/472-694-----------------------------------------------------------------------------EAL
Q47QC0_THEFY/653-870-----------------------------------------------------------------------------EFL
D2U4A3_9ENTR/472-694-----------------------------------------------------------------------------KAL
C8X6G7_NAKMY/699-910-----------------------------------------------------------------------------GAL
Q8IL89_PLAF7/540-763-----------------------------------------------------------------------------KAI
B5YGW4_THEYD/482-700-----------------------------------------------------------------------------RAI
B6ERR1_ALISL/484-706-----------------------------------------------------------------------------NCV
A4C9D2_9GAMM/480-701-----------------------------------------------------------------------------QHL
B1VXP6_STRGG/739-955-----------------------------------------------------------------------------TAP
D6STV6_9DELT/482-704-----------------------------------------------------------------------------NAL
A4FAM1_SACEN/663-876-----------------------------------------------------------------------------AWL
D1BG29_SANKS/695-919-----------------------------------------------------------------------------RHT
O50516_STRCO/806-1022-----------------------------------------------------------------------------HLA
C7LRJ9_DESBD/471-692-----------------------------------------------------------------------------DCL
C5C5J4_BEUC1/666-884-----------------------------------------------------------------------------RVA
C5BNQ0_TERTT/484-704-----------------------------------------------------------------------------TAL
C6WAF3_ACTMD/668-881-----------------------------------------------------------------------------SVP
C4ZP63_THASP/474-692-----------------------------------------------------------------------------TLL
A8TIY2_9PROT/479-703-----------------------------------------------------------------------------DGL
A3TZP9_9RHOB/9-212-----------------------------------------------------------------------------NWQ
Q2BN19_9GAMM/483-713-----------------------------------------------------------------------------TAL
A8B3P9_GIAIC/94-343-----------------------------------------------------------------------------SAS
Q2SCW5_HAHCH/482-712-----------------------------------------------------------------------------KIY
C3JLK2_RHOER/505-719-----------------------------------------------------------------------------DWL
B8HH21_ARTCA/662-878-----------------------------------------------------------------------------DVK
A8B4I3_GIAIC/26-275-----------------------------------------------------------------------------QAS
A1R5M2_ARTAT/645-861-----------------------------------------------------------------------------GVT
A6W895_KINRD/666-883-----------------------------------------------------------------------------RAL
A6EUH1_9ALTE/482-712-----------------------------------------------------------------------------NAI
A5FUU0_ACICJ/447-667-----------------------------------------------------------------------------LAR
Q7W1M5_BORPA/23-232-----------------------------------------------------------------------------QWI
A3JCC0_9ALTE/482-712-----------------------------------------------------------------------------NAL
E3IU41_FRASU/495-709-----------------------------------------------------------------------------GAP
A2F811_TRIVA/22-271-----------------------------------------------------------------------------KVI
A4BCL0_9GAMM/472-702-----------------------------------------------------------------------------QAR
C7RR50_ACCPU/477-694-----------------------------------------------------------------------------EAV

PF02750

SYN2_HUMAN/214-416-----------------------------------------------------------------------------NSL
SYN3_RAT/192-394-----------------------------------------------------------------------------NSL
SYN1_RAT/214-416-----------------------------------------------------------------------------NSL
O76322_LOLPE/191-393-----------------------------------------------------------------------------NSF

PF04174

Q0RH44_FRAAA/80-411------------------------------------------------------------------PRL--------LDG
D5YHN9_MYCTU/97-428------------------------------------------------------------------PRV--------ISA
A3XNZ6_LEEBM/85-416------------------------------------------------------------------PRI--------IDP
A9H282_GLUDA/91-422------------------------------------------------------------------PRV--------LTA
B6IMV0_RHOCS/77-408------------------------------------------------------------------PRI--------ISA
Q138L4_RHOPS/88-420------------------------------------------------------------------PRI--------LSA
A3RW90_RALSL/94-425------------------------------------------------------------------PRI--------FPA
B3E3V9_GEOLS/83-414------------------------------------------------------------------PRI--------ITA
Q05V15_9SYNE/102-432------------------------------------------------------------------PRL--------IGG
Q0I654_SYNS3/79-409------------------------------------------------------------------PRL--------IHK
B3EHN4_CHLL2/82-413------------------------------------------------------------------PRI--------IPS
A4TU14_9PROT/5-295------------------------------------------------------------------AAI--------LMN
B0SUW6_CAUSK/58-364------------------------------------------------------------------PVF--------IAK
Q12BE8_POLSJ/50-362------------------------------------------------------------------AVF--------LDP
Q97YL5_SULSO/75-386------------------------------------------------------------------PRI--------ITS
Q970N0_SULTO/87-396------------------------------------------------------------------PRL--------VSK
E1NE18_9BIFI/50-378------------------------------------------------------------------PRI--------IES
D0L0C4_HALNC/81-412------------------------------------------------------------------PRV--------FGA
B5JJZ7_9BACT/77-408------------------------------------------------------------------PLA--------ISQ
A3ZR35_9PLAN/118-447------------------------------------------------------------------PLL--------IAS
B2HNB5_MYCMM/115-443------------------------------------------------------------------PLV--------VSA
A2WED1_9BURK/114-449------------------------------------------------------------------PMI--------VTP
Q1MBT4_RHIL3/98-432------------------------------------------------------------------PVL--------IDE
B1M6F7_METRJ/100-432------------------------------------------------------------------PLV--------IEG
B2ICY7_BEII9/94-428------------------------------------------------------------------PLL--------IEA
Q02F91_PSEAB/81-412------------------------------------------------------------------PNL--------LSA
A0QWP7_MYCS2/138-466------------------------------------------------------------------PMV--------ISA
A5JAS0_BURML/116-451------------------------------------------------------------------PLI--------IAP

PF02955

GSHB_SYNE7/132-305------------------------------------------------------------------EKM--------Y.A
GSHB_SYNY3/132-305------------------------------------------------------------------EKM--------Y.T
GSHB_NEIMA/127-301------------------------------------------------------------------EKL--------A.I
GSHB_XYLFT/125-299------------------------------------------------------------------EKI--------A.A
GSHB_SHEON/124-298------------------------------------------------------------------EKL--------F.T
GSHB_RHOPA/124-297------------------------------------------------------------------EKL--------F.V
GSHB_BUCAI/129-303------------------------------------------------------------------EKI--------F.T
GSHB_PROMM/119-292------------------------------------------------------------------EKL--------G.A
GSHB_CHRVO/123-297------------------------------------------------------------------EKL--------A.I
Q73I56_WOLPM/115-287------------------------------------------------------------------EKL--------I.T
GSHB_PROMA/119-292------------------------------------------------------------------EKL--------G.A
GSHB_BRUSU/124-297------------------------------------------------------------------EKI--------F.V
Q92UR6_RHIME/135-315------------------------------------------------------------------NKL--------Y.F
GSHB_RALSO/123-297------------------------------------------------------------------EKL--------A.I
GSHB_CAUCR/125-298------------------------------------------------------------------EKL--------F.V
GSHB_BUCBP/125-300------------------------------------------------------------------EKL--------FTT
Q7CU65_AGRT5/135-315------------------------------------------------------------------NKL--------Y.F
GSHB_YERPE/124-298------------------------------------------------------------------EKL--------F.T
GSHB_THEEB/132-305------------------------------------------------------------------EKM--------Y.A
Q6LMM4_PHOPR/124-298------------------------------------------------------------------EKL--------F.T
GSHB_BORPA/128-302------------------------------------------------------------------EKL--------A.I
Q7MGD8_VIBVY/125-307------------------------------------------------------------------NKL--------Y.T
Q6G0M1_BARQU/122-295------------------------------------------------------------------EKI--------F.V
GSHB_PSESM/125-299------------------------------------------------------------------EKL--------F.A
GSHB_COXBU/125-299------------------------------------------------------------------EKL--------F.T
GSHB_ANACE/116-288------------------------------------------------------------------EKL--------L.P
GSHB_WIGBR/124-297------------------------------------------------------------------EKI--------S.T
GSHB_NOSS1/132-305------------------------------------------------------------------EKM--------Y.A
Q8RN60_RHITR/126-299------------------------------------------------------------------EKI--------F.V
GSHB_BUCAP/129-303------------------------------------------------------------------EKI--------F.I
Q6LH85_PHOPR/128-308------------------------------------------------------------------NKL--------Y.T
Q6F702_ACIAD/123-297------------------------------------------------------------------EKL--------F.A
GSHB_GLOVI/128-301------------------------------------------------------------------EKL--------Y.A
GSHB_PROMP/119-292------------------------------------------------------------------EKL--------G.A
GSHB_SYNPX/119-292------------------------------------------------------------------EKL--------G.A
GSHB_ECOLI/124-298------------------------------------------------------------------EKL--------F.T
GSHB_NITEU/126-300------------------------------------------------------------------EKL--------A.I

PF03133

TTL_YEAST/388-732------------------------------------------------------------------EQLDMDK...LMEL
Q9VKL9_DROME/368-666------------------------------------------------------------------KAIRS......YQK
TTL3B_DROME/325-625------------------------------------------------------------------VRHAEHYS..LDDA
TTLL3_HUMAN/213-505------------------------------------------------------------------MDIDKD.....LEA
TTLL4_HUMAN/651-946------------------------------------------------------------------RSIRE......HQK
O17720_CAEEL/115-423------------------------------------------------------------------MRELMP.....WQR
TTLL1_HUMAN/48-364------------------------------------------------------------------FSVEAGYRLSDDQI
TTL12_CAEEL/370-662------------------------------------------------------------------QLSEENP....CGM
TTL12_HUMAN/346-642------------------------------------------------------------------KLSQERP....GVL
TTL_BOVIN/81-367------------------------------------------------------------------IKTSPEL....AES
TTL_SCHPO/119-383------------------------------------------------------------------SLMEA......YEL
TTLL4_CAEEL/185-476------------------------------------------------------------------RALQP......HQK
Q9VX74_DROME/100-420------------------------------------------------------------------FGIDHPYRMRSDQV
Q9VGW2_DROME/126-407------------------------------------------------------------------ANLKNLG...QHQV
Q9VQV6_DROME/501-799------------------------------------------------------------------RTIRS......HQK
TTL3A_DROME/342-640------------------------------------------------------------------IDSCQHN....DID
Q9U1E3_LEIMA/265-568------------------------------------------------------------------ITLKSS....MVTA
Q9VBX5_DROME/261-558------------------------------------------------------------------VRNLAP.....YQR
Q9VB58_DROME/190-486------------------------------------------------------------------FKNMKR.....FQQ
TTL_RAT/81-367------------------------------------------------------------------VKTSPEL....SES
Q9VZ97_DROME/119-439------------------------------------------------------------------FSVDSGYRMHDNQM

PF14397

B6W1R0_9BACE/85-366------------------------------------------------------------------YMS--------HQT
B5EAA5_GEOBB/103-387------------------------------------------------------------------DAY--------QRR
B5VY88_SPIMA/78-340------------------------------------------------------------------TAS--------LRH
A4ALQ8_9ACTN/70-333------------------------------------------------------------------TWI--------TSG
A7VYN7_9CLOT/74-343------------------------------------------------------------------TMQ--------DNL
B0MM32_9FIRM/70-338------------------------------------------------------------------TFM--------TMN
A6FLT0_9RHOB/80-384------------------------------------------------------------------EKG--------SAR
A2PUE2_VIBCL/88-392------------------------------------------------------------------YYF--------YKI
Q82TT3_NITEU/63-372------------------------------------------------------------------RQY--------VSK
Q8A3L1_BACTN/280-551------------------------------------------------------------------RQY--------LTS
B0MX85_9BACT/80-369------------------------------------------------------------------KDY--------FPE

PF14305

Q7AJR3_BACHD/224-461NLSIRLRKKQFGTILPEWLLDQ------KKVA------------YRFMDSLH..---------..IDRP-------WV--
Q8CX82_OCEIH/200-437SLTNRMRQYQITGELPEMVLDD------KKIA------------YRFMESQQ..---------..VRIP-------WL--
A3Q6N7_MYCSJ/939-1176RMIQQSEARLLGVPQPTWLLDR------KDVG------------YRFIDRLK..---------..VRRP-------LS--
Q8A829_BACTN/55-295KLQWLKLY...DRHPEYTQMVD------KATV------------KEYVASIIGE---------K.YIIP-------TL--
A8UGA4_9FLAO/32-274KIEWYKVF...YRPKILNLMVD------KYAV------------RAYVEEKIGS---------E.YLNE-------IY--
Q8PYT3_METMA/61-302KLQWLKLY...DRDPVYSQMVD------KYEV------------YQYVSKKIGK---------K.YLIP-------LL--
B5UQ62_BACCE/58-299KLQWLKLY...DRNPLYTQLVD------KYEV------------RKYISNIIGE---------R.YLIP-------LL--
B1BGT7_CLOPF/58-308KLQWLKIN...DRKQKYIKMVD------KYEV------------KKYVSEVIGE---------K.YIIP-------TL--
C3WFM3_FUSMR/63-297KIQFRKLY...DNNPLYSICAD------KYKV------------REYVKEKIGE---------E.YLIP-------LY--
Q2CG16_9RHOB/72-314SAQWRAAPAD.TPAGRLSALRT------KAHI------------HRWLQDE..G---------V.PVPP-------RL--
B9JHB1_AGRRK/64-304KIQARKLY...DRNPLFTGFVD------KAGA------------KTLIAERVGS---------Q.YVIP-------TQ--
Q6AIA9_DESPS/77-317KIQWLKLN...IRNQDLSKYVD------KYDV------------KKIISEKTGK---------D.KIIP-------TI--
B5L389_ECOLX/57-304KLQWLKLN...DRTLLHTICAD------KIRV------------REYVENRLGT---------RDNIID-------LL--
B3XSD0_UREUR/50-304KLLYMYLK...ADQSKILEIVD------KISF------------KKWLIKHRLY---------Q.YQVP-------TL--

PF08443

O59396_PYRHO/80-267GDKVFSTL-----------KLS------KK..------------.......V-------------PVPR-------WG--
RIMK_ECOLI/97-286RDKLRSMQ-----------LLA------RQG.------------.......I-------------DLPV-------TG--
COFF_METJA/94-282SDKFKCIK-----------LLA------KNK.------------.......I-------------KTPK-------TA--
RIMK_HAEIN/105-293RDKWKSLQ-----------LLL------KAG.------------.......I-------------PVPN-------SL--
Y016_MYCPN/90-287DNKALSHA-----------VLA------QHPT------------IKQIPTLI-------------GPQN-------FR--

PF05770

Q7XBW0_ORYSJ/9-321DLVPVDPSRPLPEQGPFHLLIH------KLYG............EEWRGQLDAF---------SAAHPA-------VP--
ITPK2_ARATH/34-338LFVAIDQNKPLSEQGPFDIVLH------KQIG............KEWRRILEEF---------RLAHPD-------VT--
ITPK1_ARATH/2-311DLVKLDPTKSLLEQGKLDCIIH------KLYD............VYWKENLHEF---------REKCPG-------VP--
ITPK1_HUMAN/1-318EVVQLNLSRPIEEQGPLDVIIH------KLTDVILEADQNDSQSLELVHRFQEY---------IDAHPE-------TI--
Q9AYJ2_ORYSJ/16-320HFVSIDETRPLSEQGPFDIILH------KLTD............KEWQQVLEDY---------REEHPE-------VT--

PF02786

PCCA_HUMAN/176-385KIESKL-------------LAK------KAEV---------------------------------NTIP-------GF--
CARY_BACSU/128-334REKFRS-------------LMN------ELKQ---------------------------------PVPE-------SE--
PYR1_DICDI/525-729RGIFAE-------------KLS------EINE---------------------------------RIAP-------SM--
CARB_ECOLI/128-335RRRFDV-------------AMK------KIGL---------------------------------ETAR-------SG--
CARB_TRICU/196-398RDLFVQ-------------ALN------EIDI---------------------------------PAAQ-------ST--
CPSM_HUMAN/546-750RQLFSD-------------KLN------EINE---------------------------------KIAP-------SF--
CARB_BACCL/128-334REQFRA-------------LMN------ELGE---------------------------------PVPE-------SA--
BCCA_MYCLE/122-331KVTARH-------------IAA------RAQA---------------------------------PLVP-------GT--
PYR1_SCHPO/593-797RELFAR-------------AMD------EINE---------------------------------KCAK-------SA--
ACCC_PSEAE/115-324KVSAKD-------------AMK------RAGV---------------------------------PTVP-------GS--
CARB_YEAST/149-353RDLFAS-------------ALK------DINI---------------------------------PIAE-------SF--
ACCC_ECOLI/115-324KVSAIA-------------AMK------KAGV---------------------------------PCVP-------GS--
BCCA_MYCTU/115-326KIAAKN-------------AVA------AFDV---------------------------------PVVP-------GV--
ACCC_NOSS1/116-325KSTAKE-------------TMQ------KAGV---------------------------------PTVP-------GS--
PYC1_YEAST/135-344KVSARN-------------LAA------KANV---------------------------------PTVP-------GT--
PYR1_MESAU/514-718RRAFAA-------------RMA------EIGE---------------------------------HVAP-------SE--

PF02222

PURK_BACSU/115-285-------------------I.Q------SAGC---------------------------------EVAP-------YS--
PURT_METJA/120-294-------------------AAE------KLGL---------------------------------KTAK-------YE--
PURT_PYRHO/125-304-------------------LVK------EAKV---------------------------------PTSR-------YM--
PURT_ECOLI/121-295-------------------AAE------ELQL---------------------------------PTST-------YR--
PUR6_YEAST/113-285-------------------L.I------KNGI---------------------------------AVTQ-------SV--
PUR6_CANGA/113-284-------------------L.V------KNRI---------------------------------PVVP-------SI--
PUR6_SCHOC/111-283-------------------L.I------QHGI---------------------------------SVTE-------SV--
PUR6_PICME/113-284-------------------L.I------KNGI---------------------------------AVAE-------SC--
PUR6_SCHPO/111-282-------------------L.Q------VFKI---------------------------------ALPE-------FC--
O80937_ARATH/197-369-------------------F.S------QHGI---------------------------------PLPE-------FM--
PURK_ECOLI/87-254-------------------F.D------KLHL---------------------------------PTAP-------WQ--
PURK_HAEIN/92-261-------------------L.D------ELNL---------------------------------STSP-------WC--
PURK_PSEAE/105-272-------------------F.K------DLGI---------------------------------PTPD-------FA--
PURK_SULSO/109-273-------------------Y.R------QHNL---------------------------------PTPR-------FY--
PURK_AQUAE/100-266-------------------L.K------KHGF---------------------------------PVPE-------FL--
PURK_SYNY3/112-284-------------------L.Q------NLGL---------------------------------PVPD-------FW--
PURK_SYNE7/116-285-------------------L.T------RLGL---------------------------------PTPR-------FL--
PURK_MYCLE/120-300-------------------L.A------ALGA---------------------------------AMPR-------FM--
PURK_MYCTU/124-297-------------------L.A------AAGV---------------------------------AVPR-------YA--
PURK_CORAM/129-306-------------------L.A------ELGA---------------------------------PVPR-------FA--
PURT_BACSU/113-287-------------------AAE------TLGL---------------------------------ATAG-------YE--
PURT_PASHA/121-294-------------------AAE------ELGL---------------------------------KTSP-------YR--
PURT_SYNY3/117-292-------------------AAQ------QLGV---------------------------------RTAR-------YN--

PF13535

E8RY18_MICSL/111-299--------PFV.DKMASKAALA.-----GSGL-------------------------------R.L-PRHLRFDRDRH--
D4GMV9_PANAM/88-261--------IAT.NKFLMRNFCS.-----.GFL-------------------------------S.C-PK.......FW--
C4FVJ7_9FIRM/127-305--------KTK.YKSVMKEYFR.-----KAGV-------------------------------P.V-VD.......GR--
Q2Z1L8_ERWST/114-292--------RFR.DKKKMKEIAC.-----RAGI-------------------------------L.T-AR.......EI--
D1C2W8_SPHTD/155-337--------WIW.DKRRTYDMAG.-----QLGI-------------------------------P.A-PR.......TW--
Q48NB4_PSE14/107-289--------DVD.DKSRFTAAAE.-----AAGL-------------------------------A.C-IP.......GI--
Q1MX58_9ACTO/104-292--------RLV.DKLQQRRAFA.-----EAGL-------------------------------D.D-LP.......FA--
D0Z8Q6_EDWTE/96-265--------AAK.EKWRMRQRLA.-----QLGL-------------------------------P.S-LW.......SQ--
Q12II4_SHEDO/108-288--------RVR.DKLVMKHQVQ.-----AAGL-------------------------------H.V-PR.......FF--
B4DFC6_HUMAN/597-796--------LAKQKSLTQLHLLH.-----HHGP-------------------------------P.W-PAPSLHAVPCC--
B0NR58_BACSE/114-290--------LLM.DKEKMRLLAE.-----KYNL-------------------------------K.T-PQ.......TW--
Q83Z60_STRCL/126-311--------TAN.EKDRLRLALG.-----DVPY-------------------------------N.I-P........HA--
D4I204_ERWAC/99-280--------FFR.DKFLQKLKLS.-----.DVV-------------------------------P.H-AN.......CK--
C0QL65_DESAH/85-278--------LFK.NKLKFRELTK.-----....-------------------------------...-.........SL--
Q1JXP0_DESAC/85-278--------LFK.DKCAFRDLLK.-----....-------------------------------...-.........DA--
B4EQF8_BURCJ/110-298--------NVR.DKAATRRVLD.-----AVPN-------------------------------A.N-PR.......YA--
B8J507_ANAD2/110-304--------RAA.DKHAMRATLR.-----DAGV-------------------------------P.V-PG.......FR--
C7M0Y2_ACIFD/99-283--------RAT.HKDQLRSTLD.-----RAEL-------------------------------P.Q-PS.......WH--
C6WFN8_ACTMD/117-298--------SMR.DKYVQKDLVR.-----GVGI-------------------------------P.V-TR.......CR--
D3DDW5_9ACTO/117-307--------GLR.DKLTMREQLR.-----EHGL-------------------------------SQV-AAWPFDDERYA--
C5NY10_9BACL/132-310--------FTK.YKSKMKERFI.-----KAKV-------------------------------P.V-AK.......GR--
B2E5U2_STRPN/105-289--------LFK.DKYFMRSFLV.-----..GV-------------------------------VNQ-PY.......FR--
B9B6B7_9BURK/48-238--------QLR.NKLFVRQTLR.-----QAGL-------------------------------SNV-.........DA--
C4T7U3_YERIN/81-287--------RSR.NKFLMRESFS.-----EAGV-------------------------------P.N-PK.......YL--
C4FU48_9FIRM/109-287--------KTK.YKSKMKKLFE.-----KAGV-------------------------------P.V-VP.......GY--
D0FMQ8_ERWPE/108-286--------KYR.DKQQMKKVAS.-----FHGI-------------------------------P.T-PE.......QF--
Q3A2P7_PELCD/85-278--------LFK.NKVKFREMTR.-----....-------------------------------...-.........PI--
E6VR59_DESAO/87-280--------VCK.DKARFREVTA.-----....-------------------------------...-.........CL--
C5NXU5_9BACL/109-287--------KTK.HKSEMKKYFE.-----KAGV-------------------------------P.V-VP.......GF--
B1SDM3_9STRE/91-282--------NAR.NKFLMRKAIS.-----EENP-------------------------------ELC-PK.......FL--
B8CGT7_SHEPW/109-279--------QAK.NKAAMRTKLL.-----LAEL-------------------------------P.N-TW.......SL--
Q1VVV2_9FLAO/85-276--------LFK.DKLKFRELTQ.-----....-------------------------------...-.........DL--
Q888Y9_PSESM/114-292--------RFR.DKRRMKKIAQ.-----KFNI-------------------------------P.T-AK.......EL--
Q3A6W8_PELCD/114-298--------MLM.DKLQFYAFAR.-----EAGF-------------------------------R.V-PD.......TW--
C1DMZ3_AZOVD/112-284--------AAK.NKAEMRERLQ.-----RLGL-------------------------------P.G-PW.......FR--
Q3S8Y0_PSESH/109-293--------RLG.GKEYVSSLIP.-----....-------------------------------EYS-PI.......SM--
B1HFG7_BURPE/117-293--------RFR.DKTEMKRLLR.-----AAGL-------------------------------R.V-PA.......WF--
D5WN11_BURSC/115-291--------RFR.NTAVTKNTIA.-----AAGL-------------------------------R.V-PR.......FA--
D3DDW6_9ACTO/102-274--------PLR.DKWLMRTRAA.-----AAGI-------------------------------A.Q-PA.......FW--
B5SP77_9ACTO/100-278--------AFR.DKHVMKTAAA.-----AAGV-------------------------------R.T-AE.......MA--
C4FBF5_9ACTN/118-307--------AVC.DKDTFAELCA.-----AHGL-------------------------------E.T-PR.......TE--
Q1QB93_PSYCK/115-289--------VFK.DKYLMRTQLH.-----SAHL-------------------------------Y.Q-AG.......YQ--
D5WN64_BURSC/107-292--------ARR.NKFHMIEALR.-----KTAV-------------------------------P.S-MR.......QF--
B9DMB9_STACT/529-710--------ALN.NKARIPEWTA.-----GKYL-------------------------------P..-.........KR--
A3UL12_VIBSP/111-283--------KAK.NKYLTRQVLN.-----EKSL-------------------------------P.N-TQ.......SV--
D3D707_9ACTO/131-310--------LGL.DKHRFRAVESA-----SADH-------------------------------PAG-YTPLR....SL--
D9TNI3_THETC/106-294--------AFR.DKFYQKKLLR.-----.GVV-------------------------------P.V-TD.......SW--
E8SDA7_MICSL/98-270--------RCK.DKATMRRALA.-----AAGL-------------------------------D.P-VR.......AV--
A5G3Z6_GEOUR/110-292--------AVS.NKYTLFQSAC.-----RLGI-------------------------------A.M-PE.......TV--
Q7N5R8_PHOLL/91-265--------CVT.NKWRMRKCLE.-----.DEL-------------------------------P.A-PR.......CW--
C7Q3P0_CATAD/103-280--------ALA.SKTLVRERMR.-----SLGL-------------------------------S..-.........DI--
C1F6E3_ACIC5/100-273--------RLM.EKSEQVQLAR.-----EAGF-------------------------------QVL-P........SW--
Q5WS01_LEGPL/99-278--------LLS.HKDLMYQKLD.-----.GSF-------------------------------P.F-PK.......TT--
CRNS1_CHICK/606-804--------LAKQKSRTHQHLQRC-----RRGR-------------------------------P.P-PAA..FSVPCR--
Q2SKF8_HAHCH/104-284--------LFSIDKSLMRDTLV.-----EKGL-------------------------------SSV-.........QS--
C4L724_EXISA/89-275--------TLT.NKAKFRTFLQ.-----RHDF-------------------------------A.V-PK.......TF--
Q01ZL3_SOLUE/109-290--------HFR.DKLAMRMKAR.-----ECGL-------------------------------A.V-PE.......FV--
Q0SCF9_RHOSR/101-280--------AYR.DKILMKELAQ.-----AAGL-------------------------------L.V-PA.......FA--
C2CRI1_CORST/134-299--------PLR.DKIAFRRCVG.-----..GV-------------------------------Q..-.........WT--
A3CN29_STRSV/109-286--------KTK.FKSEMKKLFK.-----KAGV-------------------------------P.V-VP.......GQ--
Q842E2_PSESX/109-294--------ARR.DKYTMHESLK.-----AVGL-------------------------------R.S-MD.......HF--
C7N331_SLAHD/459-648--------QVS.DKVTFHTLCQ.-----NVGI-------------------------------D.V-PK.......TE--
Q12II2_SHEDO/112-302--------LLR.DKHLLRKVLY.-----DAGL-------------------------------SQV-.........NS--
C0WVD3_LACFE/116-306--------DLT.DKETFYEACE.-----KYGL-------------------------------P.Y-PK.......TS--
E7FN57_9LACO/100-280--------LFK.DKYYMRSVLQ.-----.GKI-------------------------------E.Q-PD.......FV--
Q0S8A9_RHOSR/103-283--------IVN.DKVAMKAAVA.-----GCGL-------------------------------R.V-PR.......FV--
A8M0K3_SALAI/103-297--------RSR.NKYLMRRAYE.-----EGGV-------------------------------P.V-PR.......YR--
B6B6A2_9RHOB/129-318--------SMD.NKIETVRIGN.-----KAGV-------------------------------PSV-PNV......LA--
B4VDU1_9ACTO/110-294--------VYR.DKWEMKRAAV.-----RAGI-------------------------------P.V-AD.......HV--
A3CVX7_METMJ/109-278--------LAG.NKDKTMQLAE.-----SIGI-------------------------------A.I-PK.......TF--
B5XPP6_KLEP3/106-292--------ELA.SKYAVGKIVP.-----....-------------------------------EHV-PA.......EV--
Q9AMT9_BRAJP/112-298--------ARR.DKARLSCALT.-----YAGV-------------------------------R.S-IR.......QV--
B0RPV7_XANCB/115-287--------AAK.NKAAMRQRLQ.-----ARGM-------------------------------P.S-PW.......FC--
Q1VG50_VIBAL/111-283--------KAK.NKHLTRQVLN.-----EKAL-------------------------------P.N-TQ.......SC--
D2QAU0_BIFDB/128-311--------SCR.DKVTMKQSAL.-----NAGL-------------------------------KII-P........YT--
A7NRD0_ROSCS/111-286--------GIK.RKSEMKRLFT.-----RAQV-------------------------------D.V-AR.......GI--
C6BWA6_DESAD/85-278--------SFK.DKSAFRDMVR.-----....-------------------------------...-.........DM--
D0FNI3_ERWPE/106-290--------LSR.NKLMMKAAVA.-----SSGL-------------------------------A.T-PT.......CY--
D4F6G3_EDWTA/108-277--------AAK.EKWRMRQRLA.-----HLGL-------------------------------P.S-VW.......SL--
Q121X7_POLSJ/108-282--------RAK.NKAQMRVHLQ.-----ALGI-------------------------------D.T-LW.......HA--
C2CRI1_CORST/498-675--------KAR.NKFEMRKAVQS-----IAPH-------------------------------M.V-PS.......FS--
D1RZT7_SEROD/113-299--------PFI.NKLRMKAVIA.-----AGDI-------------------------------D.I-PLVVPFSPQAY--
Q8TPB8_METAC/85-278--------LFK.NKIKFRKLLE.-----....-------------------------------...-.........RI--
B2Q6S1_PROST/113-296--------LAD.DKYAFAQSME.-----KHGL-------------------------------P.V-VP.......SI--
D9T106_MICAI/109-294--------RLT.RKSLQREALA.-----SAGV-------------------------------D.G-LA.......FR--
Q1QXJ8_CHRSD/106-286--------LLR.DKALMKRRAQ.-----LGGI-------------------------------R.V-GI.......FE--
D2B0J8_STRRD/100-269--------ATK.NKALTRRRLA.-----AAGV-------------------------------E.T-VR.......SV--
B8GVA8_THISH/116-296--------AAA.DKRTTLELAM.-----QLGV-------------------------------P.V-PR.......SI--
D7W254_9FLAO/112-293--------YFR.DKLAMRQKAK.-----DSGI-------------------------------S.V-PE.......FT--
B9B6B5_9BURK/104-287--------LVR.NKVLMKRAVR.-----DSGL-------------------------------R.V-PR.......FA--
Q0ACF5_ALHEH/120-296--------AVL.DKAETLRLAK.-----NLSI-------------------------------P.A-PE.......TF--
B8J4T0_DESDA/96-289--------KLK.NKALTRELLR.-----....-------------------------------...-.........PL--
Q5WSD6_LEGPA/104-283--------LLS.HKDLMYQKLD.-----..GL-------------------------------FSY-PK.......TT--
A8FIK7_BACP2/134-334--------LAR.DKSQMRAAFN.-----EAGV-------------------------------K.A-VK.......TK--
Q6FAX4_ACIAD/125-307--------QLN.DKSLFTQICL.-----NHSL-------------------------------A.V-AP.......AT--
D3PFD6_CRAVI/610-811--------IAKKKSATQNTLCDR-----TADI-------------------------------PHF-PRTHLYAERCH--
D7VTF5_9SPHI/110-291--------YFR.DKLAMRQMAK.-----DNGI-------------------------------H.I-PS.......FV--
A7N2D3_VIBHB/102-283--------IIR.DKTRTRELANR-----CSDV-------------------------------D.A-P........YD--
B7GNZ5_BIFLS/108-299--------NAR.NKYLMRSAIA.-----LKHP-------------------------------ELC-PR.......FK--
A7N6T3_VIBHB/145-321--------FFR.DKIYMKSQVN.-----KMGF-------------------------------R.V-PK.......YF--
Q888Z0_PSESM/112-290--------SFR.DKKAMKEIAQ.-----HAGI-------------------------------R.T-AR.......EI--
D4HVL4_ERWAC/112-290--------KFR.DKKRMKEIAQ.-----QAGI-------------------------------K.T-AR.......EI--
D4HVL5_ERWAC/114-292--------RFR.DKKRMKQIAQ.-----RAGI-------------------------------A.T-AR.......EI--
Q0RGQ9_FRAAA/107-286--------RFR.DKLVMNQVAE.-----AAGI-------------------------------P.A-PA.......FA--
C6W4G0_DYAFD/113-294--------YFR.DKLAMRTKAL.-----ESGI-------------------------------L.V-PG.......FS--
Q0RYD4_RHOSR/107-296--------RAR.NKHSMRSAMA.-----DQPQ-------------------------------F.I-PR.......FR--
D2UCG0_XANAP/114-286--------AAK.NKAAMRQRLR.-----AQGL-------------------------------P.T-PW.......FF--
Q02BT0_SOLUE/124-304--------ACL.DKNLARQLFQ.-----AAGL-------------------------------R.V-PA.......FF--
D9T7Z5_MICAI/109-288--------AFR.DKNVMHRRAV.-----ELGV-------------------------------P.V-AR.......SC--

PF07478

DDL_BORBU/136-344--------LLK-----------------SFDI-------------------------------P-L-VP-------FI--
DDLB_ECOLI/103-303--------LWQ-----------------GAGL-------------------------------P-V-AP-------WV--
DDL_ENTFA/138-341--------LLQ-----------------TVGI-------------------------------P-Q-VP-------FV--
DDLA_SHIFL/147-348--------LLR-----------------DAGL-------------------------------N-I-AP-------FI--
DDL_SYNY3/134-342--------VFE-----------------RAGL-------------------------------P-Q-VN-------YM--
VANB_ENTFA/138-337--------LTK-----------------NAGI-------------------------------A-V-PE-------FQ--
DDL_MYCTU/158-363--------LLA-----------------ADGL-------------------------------P-V-GA-------YA--
DDL_AQUAE/101-291--------IVK-----------------SLGI-------------------------------N-T-PD-------WE--
MUDD_CHLTR/569-778--------FMS-----------------DLGI-------------------------------P-V-VP-------YL--
DDL_BUCAP/103-303--------LWK-----------------SLSL-------------------------------R-V-LP-------DI--
DDL_BACSU/135-338--------LFA-----------------QVGL-------------------------------A-Q-AK-------YA--
Q47720_ENTCA/143-343--------AAA-----------------AIGV-------------------------------Q-S-AP-------TI--
DDL_HAEIN/106-303--------LWK-----------------AFGL-------------------------------P-V-AD-------MK--
VANC_ENTGA/136-336--------LAD-----------------TMGI-------------------------------A-S-AP-------TL--
O33806_STRTO/139-338--------VVR-----------------NAGI-------------------------------A-T-PN-------FW--
DDL_LEUME/142-349--------LLT-----------------VNGI-------------------------------R-N-TK-------YI--
VANA_ENTFC/139-338--------VAK-----------------NAGI-------------------------------A-T-PA-------FW--
DDL_TREPA/143-347--------LWQ-----------------AAGL-------------------------------P-V-LP-------FV--

PF06973

Q1ER85_9CREN/193-383-------DYVRKAEARIEKGMIS-----REDL-------------------------------A------------DA--
PURP_SULSO/152-337-------EVKEGIQKLIESKMI.-----.RDE-------------------------------N------------EV--
PURP_METTP/173-356-------EFQSKIQQG.......-----....-------------------------------Q------------KY--
Q8PZA1_METMA/193-387-------EYQEKSEALIKQGVIT-----RDAL-------------------------------E------------NA--
Q975Y8_SULTO/160-348-------DFDEKLDSLMKAGIID-----EKSV-------------------------------N------------EM--
PURP_METM5/174-361-------EFWRKIAEFKAKGILT-----EDDV-------------------------------K------------KA--
Q4JAU2_SULAC/161-349-------DFEEKLNTLLKVGIID-----DEAI-------------------------------K------------NM--
A8AB21_IGNH4/178-366-------DYWKRVKELKEAGVID-----DEGL-------------------------------K------------NA--
A1RQP6_PYRIL/168-356-------DLYRKAKRLADAGVIK-----LEDL-------------------------------E------------RS--
PURP_PYRHO/149-333-------DFWEKAEKFL..GIRS-----KEDL-------------------------------K------------NV--
PURP_METS5/151-332-------EVKEGIRRLQEKGLI.-----.NNV-------------------------------E------------EL--
PURP_UNCMA/178-365-------GFDEKMKLMINKGWLT-----EEDR-------------------------------A------------KA--
Q8U3N6_PYRFU/189-380-------EFKEKSEKLIRLGVIT-----REDL-------------------------------E------------KA--
PURP_METST/176-363-------EFQNKIQEMKERNWIT-----DSDV-------------------------------K------------DA--
PURP_CALMQ/163-337-------DAGELAGKL......S-----SINT-------------------------------D------------DY--
PURP_PYRCJ/163-333-------ELAKRIKAV.......-----...E-------------------------------G------------DY--
PURP_IGNH4/170-347-------EVRRGLEAL.......-----.GNP-------------------------------S------------NY--
PURP1_METMA/173-356-------EFDELVDRT.......-----....-------------------------------Q------------KY--
PURP_METS3/176-363-------EFNKKIDAMKARGWLE-----DSDV-------------------------------A------------NA--
A4GI95_9BACT/191-385-------EYKEKSEVLLKDGIID-----QASL-------------------------------D------------GA--
A9A5F5_NITMS/177-363-------DYVKTSEEKIKQGVIA-----RKDL-------------------------------E------------KA--
O29983_ARCFU/174-373-------DYYEQAERLLKEGVID-----EEGL-------------------------------K------------KA--
PURP_SULAC/153-333-------EVKEGLNRLISSKLI.-----.KDV-------------------------------N------------DV--
Q64BC8_9ARCH/174-354-------EFERKLKKS......G-----LRDK-------------------------------D------------RF--
PURP_METJA/174-361-------EFYKKAEDLKKRGILT-----DEDI-------------------------------A------------NA--
PURP_METKA/174-359-------EFEEKAERLIEDGVID-----EEDL-------------------------------E------------QA--
Q5JD28_PYRKO/146-310-------ELEERLSTL.......-----...E-------------------------------E------------PY--
PURP_METBU/172-355-------EFKQYIDPN.......-----....-------------------------------E------------KH--
PURP_ARCFU/172-359-------EFYEISDEMVKKGLIG-----EEDI-------------------------------K------------NA--
Q12X62_METBU/191-385-------EYVEKSESLIKQGVIT-----REAL-------------------------------A------------EA--
A8M9J4_CALMQ/161-349-------DALRKVKELADKGIIR-----LSDL-------------------------------D------------NA--
PURP_CENSY/156-341-------EYESKRLSLIESGVIS-----TD..-------------------------------E------------DL--
A4YCP1_METS5/159-347-------DFQEKLRKLEKDGIID-----QQGI-------------------------------S------------QM--
Q64BC7_9ARCH/185-375-------EFYNNSEQMLRDGKIT-----EEGL-------------------------------K------------KA--
PURP_METTH/176-363-------EFNEKIDSMLERGWIT-----EDDV-------------------------------K------------DA--
Q980P6_SULSO/161-349-------DFEAKLNELLRNNVID-----NEGL-------------------------------K------------NM--
A0B858_METTP/188-379-------EYYEKSELLLRQGVID-----SDGL-------------------------------E------------LA--
A0RW22_CENSY/177-363-------DYKEQSKSKIERGLIS-----EKAL-------------------------------E------------SA--
PURP_NITMS/156-341-------DYNTKRNQLISEGVIS-----ED..-------------------------------E------------TL--
Q702E6_9CREN/179-365-------DYYEKSKIKINRHIIE-----EKDL-------------------------------R------------SA--

PF15632

C7NS61_HALUD/17-350.SAAEILSIAN-DKAALYAFLDK.....H.GF..D----------------------------S-A-PR-------FC--
D7DRZ5_METV3/6-346.SSEKSIKFAN-DKFELIKTCKK.....L.DI...----------------------------P-Y-PE-------CY--
B8GGE3_METPE/6-338.SDASAISIAN-DKFKLMKLAER.....I.GI...----------------------------P-A-PK-------CS--
C5A2Z7_THEGJ/6-337.SGYEAIELAN-SKKELMKIAKK.....V.GV...----------------------------P-Y-PE-------FY--
F8A3W6_CELGA/3-319.PALRTLEAAL-DKLALARVCERACGP...AV...----------------------------H-V-PR-------TE--
F4H040_CELFA/4-316.PALGTLETCL-DKLALARACTR.......TV...----------------------------R-V-PR-------TE--
D5UBS5_CELFN/4-316.PSSRTLDTCL-DKLALAHACAG.......TV...----------------------------R-V-PR-------TE--
D3FB15_CONWI/9-321.ASERTLAVCL-DKWALDARCRG.......HV...----------------------------R-T-PA-------CW--
A8KXY8_FRASN/5-354SP.AASARIFT-TKSGQYAAMAA.....R.GL...----------------------------P-V-PH-------TR--
E4NDG0_KITSK/6-341PP.ASAISLFA-SKSDGYRALDA.....A.GL...----------------------------P-T-PL-------WR--
D1BH78_SANKS/2-342SP.APSIALLD-DKDATYASASA.....L.GV...----------------------------P-V-PP-------WR--
D1BIK1_SANKS/4-316.PSAETLASTL-DKHALALACAG.......AL...----------------------------R-V-PA-------TE--
Q82MB0_STRAW/6-340PP.AEAVAVFQ-DKATAYEAVQA.....I.GI...----------------------------P-V-PP-------WR--
O88027_STRCO/6-340PP.PEAVAVFR-DKVIAYEAVRA.....I.GV...----------------------------P-V-PP-------WW--
D9XZU1_9ACTO/6-340PP.PEAVAVFH-DKVIAYEAVQA.....I.GV...----------------------------P-V-PP-------WW--
D6EGI6_STRLI/6-340PP.PEAVAVFR-DKVIAYEAVRA.....I.GV...----------------------------P-V-PP-------WW--
C9ZBJ4_STRSW/6-340PT.AEAIELFE-DKVTAYEAVQA.....H.GV...----------------------------P-V-PP-------WF--
B5HSJ5_9ACTO/6-340PP.PEAVAVFH-DKVIAYEAVKA.....V.GV...----------------------------P-V-PP-------WW--
D9X752_STRVR/6-340PP.PEAVAVFH-DKVIAYEAVQA.....I.GV...----------------------------P-V-PP-------WY--
G2GBR6_9ACTO/6-340PP.PQAVAVFQ-DKVIAYEAVQA.....I.GV...----------------------------P-V-PP-------WR--
F9Z982_ODOSD/8-342.SNYDAIEKAN-NKYKLFQIAES.....L.NI...----------------------------P-V-AK-------YS--
A6LIK8_PARD8/6-341.SNNETLEIAN-SKYQLYEFMKD.....K.GL...----------------------------V-V-PK-------YF--
E8U3T8_DEIML/7-345PADADTLTLLD-HKDQFLAGWDA.....D.LL...----------------------------P-I-PA-------WT--
Q9RSB2_DEIRA/9-338PADEATQRHLE-RKDEFLRGWDT.....D.IL...----------------------------P-I-PR-------WT--
Q2BF09_9BACI/6-345CPDPMLMSFMD-NKAAIYRSIEEKNSAGK.QLV..----------------------------S-I-PD-------YE--
C0Z9Z4_BREBN/4-338AQEHQLLEDIS-DKGKLFQLFQD.....V.PEV..----------------------------P-I-PA-------YA--
F5RK20_9FIRM/2-337GAA.DTMALLD-DKAATYAFFAE.....H.LPE..----------------------------I-V-PA-------YR--
F4A6T7_CLOBO/7-346.PSNENICIAH-NKDLLYENMKK.....D.GV...----------------------------K-Y-YP-------RF--
B2V211_CLOBA/3-315.SNKAVIELCN-DKWETYEFFLE..N....EI...----------------------------N-T-PI-------SY--
A7GGU2_CLOBL/9-348.PSFENIFTAH-NKDIMYEQLQR.....L.NC...----------------------------N-C-YP-------NF--
F2JJ82_CELLD/4-343EDDIELLENFN-NKVKTAELFKS..L..P.EIC..----------------------------N-V-PP-------FE--
G6G5N9_9FIRM/16-350VGNSETYQLLD-NKLKTYEALKN.....K.DIL..----------------------------G-I-PK-------SF--
F3ZYZ6_MAHA5/15-326.SSEEVISICQ-DKYNTFLFFQQ..N....GV...----------------------------N-T-PA-------TI--
E0IAJ8_9BACL/7-342CRDVELLEKLT-IKDKFYEAVRA.....T.GIM..----------------------------E-V-PA-------YE--
E0RJG3_PAEP6/5-340CQDTELLEQLM-EKDLFYESIRQ.....K.EIV..----------------------------T-I-PD-------YA--
E3EE70_PAEPS/5-340CRDTELLEQLM-EKDLFYESIRQ.....K.DIV..----------------------------T-I-PD-------YA--
E6UFS3_RUMA7/7-336DHDTEQNDMLD-SKMKSCIFMRE.....N.GLC..----------------------------P-T-PY-------ME--
E9SAE7_RUMAL/7-336DGNFEQNDMLD-SKFRSCNFMRE.....N.SLC..----------------------------A-T-PL-------ME--
C9LVE5_9FIRM/2-338GSDYKIMRLLD-DKAATYAFFEA.....R.DAS..----------------------------L-V-PA-------HL--
F4QGW0_9CAUL/2-325PAGQRVLKLLD-DKYRFAEALED.....T.EF...----------------------------H-L-ET-------AL--
G2TCW6_RHORU/2-335MAEPAVMDLVD-QK...HAFYDD.....L.IGSGV----------------------------A-V-PP-------YR--
Q5NWT2_AROAE/3-340AAAPDTLERLH-DKARFYAEA.C.....APSA...----------------------------P-S-PE-------LE--
Q82TT1_NITEU/3-312CSDQVILDTLH-NKWSFAQTCAK.....Y.RL...----------------------------P-I-PP-------TI--
Q0AHL8_NITEC/3-312CGDQVTLDTLH-NKWSFAQTCTK.....Y.GL...----------------------------P-I-PP-------TV--
A1VWP6_POLNA/3-339AASQDMLHLLH-DKAQFYQSVNC.....L..T...----------------------------P-P-AA-------FR--
Q6FAX4_ACIAD/19-350CDTLDQIEQLN-DKSLFTQICLN.....H.SL...----------------------------A-V-AP-------AT--
D3RPB0_ALLVD/3-344VAAPESLERLH-DKARFALEASQ.....F.HL...----------------------------P-T-PE-------TI--
C1MFA0_9ENTR/4-345ATGVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
A7MPT7_CROS8/12-353ATGVDWLILAD-EKVTFAQFMEQ.....N.GL...----------------------------P-V-VP-------SW--
C8Q020_9GAMM/11-360ATDTATLELMD-DKAAFTAFCQQ.....H.DI...----------------------------P-V-AS-------GW--
C1IUG1_ENTCL/4-345ATGVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
D5CKR1_ENTCC/12-353ATSVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
Q5CB43_ECOLX/4-334ATGVDWLTLAD-EKVTFAQFMEQ.....N.GL...----------------------------P-V-VP-------SW--
G5Q9H1_SALMO/4-345ATGVDWLTLAD-EKVTFAQFMEQ.....N.GL...----------------------------P-V-VP-------SW--
E7HA30_ECOLX/1-338ATGVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
F9CS19_ECOLX/4-345ATGVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
F8YR44_ECOLX/4-345ATGVDWLTLAD-EKVTFAQFMEQ.....N.GL...----------------------------P-V-VP-------SW--
B2NP55_ECO57/4-345ATGVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
E7TZ65_ECO57/4-345ATDVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
A7KFT2_KLEPN/4-345ATGVDWLTLAD-EKVTFAQFMEQ.....K.GL...----------------------------P-V-VP-------SW--
B5RKB9_KLEP3/4-345STGTHWLELAD-EKVTFSEFMEK.....N.GL...----------------------------P-V-VP-------SV--
C4XDI7_KLEPN/4-345STGTHWFELAD-EKVTFSEFMEK.....N.GL...----------------------------P-V-VP-------SV--
A3JJ84_9ALTE/2-339SDS.NTMGFLE-EKPAFLARMET.....A.GV...----------------------------P-V-TP-------FR--
G3ISJ3_9GAMM/2-338VADVDTLTLLH-NKADFYSELSA.....E.VA...----------------------------Q-T-MD-------FI--
H8GG73_METAL/2-338AADYPTLTLLH-NKADFYADLPR.....E.VA...----------------------------L-V-MD-------FV--
E1PL52_PANVC/6-350ATSLETFELAD-NKAEFSVRMMT.....Y.GL...----------------------------P-S-VV-------SI--
D0KLU9_PECWW/4-345TVNVESLLIAD-DKVSFAHEMEK.....L.GL...----------------------------A-V-VP-------SI--
B2Q6S1_PROST/4-344AMSVSALQLAD-DKYAFAQSMEK.....H.GL...----------------------------P-V-VP-------SI--
B3G2E4_PSEAI/1-332GSSMGTFELVD-DKSKFTAEAER.....A.GL...----------------------------A-C-VP-------AI--
D7HVQ0_PSESS/1-332GTSQQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3H5H4_PSESX/1-332GTSLQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3JPH6_PSESX/1-332GTSLQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3I9M2_PSESF/1-332GTSLQTFLDFD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------AI--
F3DCN0_9PSED/1-332GTSQQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3IYZ7_PSEAP/1-332GTSLQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
E7P0I7_PSESG/1-332GTSQQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3FNS0_PSESX/1-332GTSLQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3EI09_PSESL/1-332GTSQQTFMDVD-DKGRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3E7Y8_PSESL/1-347ACDLSAWNEID-DKIAFYNKLQN.AGA.G.EM.L.----------------------------P-R-WT-------TW--
F3HNW9_PSEYM/1-332GTSLQTFMDVD-NKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------AI--
F3EZH7_9PSED/1-332GTSQQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IS-------GI--
F3DP68_9PSED/1-332GTSLQTFLDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------AI--
F2ZRA0_9PSED/1-332GTSLQTFMNVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------AL--
Q48NB4_PSE14/1-332GTSQQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
Q4ZYB3_PSEU2/1-332GTSLQTFMDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3K7E1_PSESZ/1-332GTSQQTFMNVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------GI--
F3IPW6_PSESL/1-332GTSLQTFLDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------AI--
E2MHB3_PSEUB/1-332GTSLQTFLDVD-DKSRFTAAAEA.....A.GL...----------------------------A-C-IP-------AI--
Q4FTP6_PSYA2/15-383ATSVAALESID-DKFAFMQQCHE.....H.DI...----------------------------P-V-AD-------AW--
Q1QCQ8_PSYCK/15-383ATSVSALESID-DKFAFMQQCHE.....H.DI...----------------------------P-V-AD-------AW--
F5SQ56_9GAMM/11-404STSTDMLNKID-DKFAFIKHCEV.....S.NI...----------------------------P-V-AK-------GW--
A5WBK0_PSYWF/11-370ATSTEMLQKID-DKFAFMSHCQA.....H.NI...----------------------------A-A-AE-------GW--
G4DVY4_9GAMM/3-340PASADHLTTLM-DKARFYAEARR.....F.SI...----------------------------P-P-PD-------YL--
H8Z6R5_9GAMM/3-341VADADTLALLR-DKARFYDRAQA.....F.SV...----------------------------P-P-PA-------HR--
A9QYJ5_YERPG/4-344AQCPATFTLAD-NKVEYAAYMAQ.....K.GL...----------------------------P-V-VP-------SI--
A4TRW4_YERPP/4-345AQCPATFTLAD-NKVEYAAYMAQ.....K.GL...----------------------------P-V-VP-------SI--
D1U1X0_YERPE/1-338AQCPATFTLAD-NKVEYAAYMAQ.....K.GL...----------------------------P-V-VP-------SI--
A7FNB6_YERP3/4-345AQCPATFALAD-NKVEYAAYMAQ.....K.GL...----------------------------P-V-VP-------SI--
B1JNG1_YERPY/4-345AQCPATFTLAD-NKVEYAAYMAQ.....K.GL...----------------------------P-V-VP-------SI--

PF14398

Q73CW4_BACC1/180-443DYAIPWFNPGFFNKWEVHQLLMK-----DESIM------------------------------PLL.PN-------TE--
YHED_BACSU/178-440EYQIPWFNKTFFNKWNVHQLLEK-----DPRTA------------------------------PFL.PR-------SE--
D4G719_BACNA/90-350YPKTEFIGRGLPDKWTVLHDLQQ-----HSVIN------------------------------PYI.PE-------TI--
Q5L2A9_GEOKA/175-436TYGIPIFNGCFFNKWDIYRRLAA-----HPKAQ------------------------------PYL.PA-------TS--
A9U6Q3_PHYPA/63-329AYKHRYWSASLPGKWEVHRVLSR-----NAELR------------------------------ARLAPT-------TR--
A6TTN9_ALKMQ/120-382FDIKLINYLYCFNKWEIYEHLSD-----YQNIS------------------------------PHL.PL-------SV--
Q0AXS1_SYNWW/103-364HEGLYLFNSRYLDKWEVYQTLSS-----HPLGA------------------------------ELV.PE-------T.--
A9U6Q2_PHYPA/86-348QSGIELYNPFFFNKWNLFEWLKK-----SKSTQ------------------------------QLI.PY-------TR--
A9U6A9_PHYPA/218-483RYGTQVFNEKFLDKNEVFGALGH-----ESSLA------------------------------KYL.PD-------SR--
C6D8D2_PAESJ/189-456THHVSVFNEKFLDKMEVFDALKK-----DESVR------------------------------RYL.PE-------SH--
B6YYR2_9RHOB/176-439ALGSHIYNPGFFDKWEVHEHLMH-----GQKLR------------------------------KYL.PE-------TH--
A3I7C7_9BACI/90-348KEEIPFTTYSIGNKWNVMKRLKE-----AKEFE------------------------------QYL.IP-------SE--
C6D2S3_PAESJ/1-246MKGYMIKYPGR..KWLKHVALSG-----EEELR------------------------------DYL.PD-------TE--
C6D2S4_PAESJ/84-344APSFPFTGYGIGNKIRIQKHLLT-----SPVLK------------------------------PYL.LP-------TE--

PF14403

A8M4T7_SALAI/1-452MPAGQNRLLDE-DEPLTDALLAAFRPDVLLSD-------------------------------GV..PR-------VV--
Q02DC9_SOLUE/4-448LLPAEKMLASI-DPGYQALE.VAARLDSHLVN-------------------------------GH..LH-------FV--
A5UWI9_ROSS1/2-461LTPQEEALLVR-DPGYPYHS.AHSRMDTFLTL-------------------------------DGASLR-------FV--
A9WAS2_CHLAA/3-460LTPLEERLIEM-HPGYLEPS.AHSRMDTFLTV-------------------------------DGSSLQ-------FV--
B8GC89_CHLAD/3-460LTPLEERLIAM-HPGYLEPS.AHSRMDTFLTV-------------------------------DGSSLQ-------FV--
A8MKZ9_ALKOO/3-442FSPLLEKLILK-DPGYKINI.PMGRFDIFYHL-------------------------------DGT.FQ-------FC--

PF01071

Q20143_CAEEL/100-292-----------TSKSFSKHFMK------EYGL-------------------------------PTA-.D-------FV--
PUR2_BACSU/101-293-----------GSKQFAKDLMK------KYDI-------------------------------PTA-.E-------YE--
PUR2_ARATH/198-392-----------GSKNFMKNLCH------KYNI-------------------------------PTA-.K-------YK--
PUR2_MYCLE/101-292-----------GSKAFAKEVMA------AAGV-------------------------------RTS-.R-------SE--
PUR2_HAEIN/103-296-----------GSKAFTKDFLA------RHKI-------------------------------PTA-.E-------YQ--
PUR2_METTH/100-298-----------TDKSFMRKLFE------DYRI-------------------------------PGS-IT-------YR--
PUR2_SCHPO/109-301-----------GSKVFSKDFMH------RNNI-------------------------------PTA-.V-------YK--
PUR2_YEAST/108-308-----------ASKAFSKRFMS------KHNI-------------------------------PTA-.S-------YD--
PUR2_HELPY/105-292-----------ASKSYMKAFVK------ECGI-------------------------------KSA-.S-------YF--
PUR2_ARCFU/109-334-----------ASKCWAKDFLK------RIGV-------------------------------PIP-.E-------YA--
PUR2_METJA/103-304-----------TNKEFMRNLFK------KYNI-------------------------------KGS-LM-------YK--
PUR2_CHICK/105-298-----------SSKSFTKSFLD------RHGI-------------------------------PTA-.R-------WK--
PUR2_ECOLI/103-296-----------GSKAFTKDFLA------RHKI-------------------------------PTA-.E-------YQ--
PUR2_HUMAN/105-298-----------SSKRFAKEFMD------RHGI-------------------------------PTA-.Q-------WK--
PUR2_MYCTU/101-292-----------GSKAFAKDVMA------AAGV-------------------------------RTA-.N-------SE--
PUR2_SYNY3/103-291-----------ASKSWTKQLLI------EAGV-------------------------------PTA-.F-------GE--
PUR2_YARLI/108-301-----------GSKTFSKDFMK------KHNI-------------------------------PTA-.A-------FE--
PUR2_DROME/108-301-----------ADKKWAKDFML------RHGI-------------------------------PTA-.R-------YE--
PUR2_CHITE/109-301-----------SDKSWSKDFMI------RHHI-------------------------------PTA-.Q-------YG--

PF08442

MTKA_METEA/2-203----------DVHEYQAKELLA------SFGV-------------------------------A-V-PK-------GA--
SUCB1_CAEEL/25-233----------MLHEHHGMKILQ------NYEI-------------------------------K-V-PP-------FG--
SUCC2_STRCO/2-191----------DLYEHQARELFK------EHGI-------------------------------V-V-PR-------AE--
SUCC2_ARCFU/2-195----------RLHEYQAKQIFS------KHGI-------------------------------R-V-AR-------GE--
SUCC_HAEIN/2-203----------NLHEYQAKQLFE------HYGL-------------------------------P-V-KN-------GA--
SUCC_SHIFL/2-203----------NLHEYQAKQLFA------RYGL-------------------------------P-A-PV-------GY--
SUCC_METTH/2-194----------KFYEYSAKEIFR------AEGI-------------------------------S-T-PR-------GG--
SUCB2_CAEEL/21-231----------NLQEFQSKEILE------KHGC-------------------------------S-V-QN-------FV--
SUCC_METJA/2-193----------KLHEYEAKNIFK------KYGI-------------------------------P-V-PE-------SF--
SUCB2_PIG/40-248----------NLQEYQSKKLMS------DNGV-------------------------------K-V-QR-------FF--
SUCC1_ARCFU/2-195----------RLHEHQAKQIFA------KHGI-------------------------------R-V-PR-------GE--
SUCB_NEOFR/29-237----------SVHEYCSMNLLH------EYNV-------------------------------N-A-PK-------GI--
SUCC_CHLPN/2-203----------HLHEYQAKDLLA------SYDV-------------------------------P-I-PP-------YW--
SUCC_AQUAE/2-199----------KLHEHQAKEIFA------KYGI-------------------------------P-V-PE-------GK--
SUCB_TRIVA/11-220----------NILEWQSKEICA------KYNV-------------------------------A-A-GI-------NL--
SUCC_BACSU/2-203----------NIHEYQGKEVLR------KYGV-------------------------------S-V-PE-------GK--
SUCB_YEAST/32-240----------SIHEYRSAQLLR------EYGI-------------------------------G-T-PE-------GF--
SUCB_SCHPO/24-232----------ALHEYISHDILR------KFGV-------------------------------D-V-PR-------GA--
SUCC_COXBU/2-204----------NLHEYQSKHLLK------KYNI-------------------------------P-V-PA-------SE--
SUCC_THETH/2-194----------NLHEYQAKEILA------RYGV-------------------------------P-V-PP-------GK--
SUCC_MYCTU/2-195----------DLFEYQAKELFA------KHNV-------------------------------P-S-TP-------GR--
SUCC_RICPR/2-203----------NIHEYQAKEILR------KYGV-------------------------------P-T-ST-------GL--

PF02655

Q8PZ07_METMA/105-278----------ASNKLHLAKRLEA-----M.GM-------------------------------P-H-P.-------..--
O27028_METTH/106-265----------VEDKYRLYRRIRN-----S..Y-------------------------------P-T-PE-------TH--
Q603D9_METCA/124-284----------AASKLATTQALER-----HHLA-------------------------------V-V-P.-------..--
Q8PU46_METMA/109-270----------CADKLRCTEILKT-----A.GI-------------------------------N-A-P.-------..--
Y776_METJA/124-282----------ISNKYKTYKKLKN-----L.GF-------------------------------N-I-PE-------TK--
Q7UJD2_RHOBA/127-319----------ASDKWFTAKWLME-----H.AI-------------------------------P-T-PQ-------TW--
Q6LZR0_METMP/123-259----------AGDKFLTYEAIKN-----A..V-------------------------------N-T-P.-------..--
O29201_ARCFU/107-251----------TSDKWELYKKLRG-----E..V-------------------------------Q-V-P.-------..--
O28027_ARCFU/97-247----------VANKLKFYRELEK-----A.GL-------------------------------P-F-P.-------..--
Q97H24_CLOAB/105-271----------CNDKWKSYEFFKE-----N.QV-------------------------------K-C-P.-------..--
Q8TQR5_METAC/109-277----------CADKVLCTKVLKK-----A.GV-------------------------------K-A-P.-------..--
Q6M182_METMP/105-262----------ISDKYKTVKKLEN-----L.GF-------------------------------N-V-PV-------TY--
Q8TJB8_METAC/125-298----------ASNKLHLAKKLEA-----L.GM-------------------------------P-N-P.-------..--
Q7BQQ5_XANAU/119-279----------ATSKLETARRLAA-----AGVP-------------------------------H-I-P.-------..--
O26923_METTH/114-270----------CSDKRLTYRALDG-----R...-------------------------------.-V-P.-------..--
Q8TZ26_METKA/104-247----------AADKRKTEDALRD-----ARSF-------------------------------Q-L-P.-------..--
Y815_METJA/136-272----------AGNKYLTYLAIKD-----A..V-------------------------------K-T-P.-------..--
Q8TV12_METKA/118-275----------AADKLELFNRLSD-----V..L-------------------------------P-M-P.-------..--

PF13549

Q30WE4_DESDG/474-696DQ..Q..RQV.LTVAETTGILK------AYG---I----------------------------NIP.ET-------RT..
B5EIR8_GEOBB/481-697KE..G..RQV.LSATDVYSIFE------AYG---I----------------------------PVA.PW-------RM..
A7HUK1_PARL1/484-706AE..K..REW.LSEAEAKHLLA------AYG---V----------------------------PVV.DT-------RI..
B5W864_SPIMA/500-721SQ..G..RSL.LTEFESKELLA------LYG---I----------------------------PVV.DT-------RM..
Q1D3M9_MYXXD/505-726AE..G..RTL.LTEYESKKLLA------AYG---I----------------------------PTV.ET-------RL..
A2BJ63_HYPBU/14-235RE..G..RSK.LLEHEALAVAE------LYG---V----------------------------PVA.GY-------GL..
B8GB69_CHLAD/473-695AS..G..RVE.LGEVEARQVME------AYG---M----------------------------RLP.KS-------RL..
A9EVP6_SORC5/499-721AS..G..RTL.LDEVESKQLMA------AYG---I----------------------------PTV.PT-------AV..
B7K6U2_CYAP7/499-721QS..G..RTI.LTEAESKQILA------AYG---I----------------------------PIV.RT-------AT..
Q02CN5_SOLUE/497-719QE..G..RSI.LTEFESKQVLA------AYG---I----------------------------PVA.KT-------II..
A4U1N9_9PROT/483-706ER..G..DNI.LTEAEAKTVLS------AYG---I----------------------------PTV.PT-------HI..
Q1YNA3_MOBAS/481-703RD..G..RTI.LSEYEAKRLLA------TFG---I----------------------------PTV.TT-------RM..
C8X4E1_DESRD/482-705EE..G..RAT.LSEPEAKEVLG------AYG---I----------------------------PIV.PT-------RI..
A6C207_9PLAN/482-704LE..G..RDI.LSECTSKTLLE------AYG---I----------------------------PVN.RT-------VV..
Q2W464_MAGSA/483-705AK..G..GGT.LNEPEAKAVLE------AYG---I----------------------------PTV.ET-------HV..
B8CEH1_THAPS/525-748SS..G..RTI.LTELESKQLLS------AYG---I----------------------------PTV.TT-------IL..
C1DBF7_LARHH/480-702DE..G..RSV.LSELESKALLA------AFN---L----------------------------PVN.QV-------RL..
B4D2X3_9BACT/490-711KE..G..RNL.LTEVESKHLLS------AYG---I----------------------------PTV.ET-------FI..
Q2LRG1_SYNAS/43-258RE..N..RTY.LMEHECKEILE------NMG---I----------------------------ATT.GF-------LV..
A3ZSV0_9PLAN/482-704SE..G..REV.LSESTSKALLE------AYE---I----------------------------PVT.KP-------HV..
D2R7V1_PIRSD/482-704KS..S..DGV.LTENASKDLLE------TYG---I----------------------------PVT.KP-------IA..
A8I025_AZOC5/478-700GA..G..RSV.LTEVEAKAVLA------AYD---I----------------------------PVV.ET-------RT..
Q1QYL0_CHRSD/482-704AA..G..RSV.LTEPEAVAVLA------AYD---I----------------------------PTV.PA-------IV..
Q0W5Z5_UNCMA/472-693KA..G..ISV.L.GLEALPVLE------AYG---I----------------------------PTL.KY-------RI..
Q12E86_POLSJ/490-712HE..G..REW.LDGAPAQALLR------AYG---I----------------------------PGV.EA-------VQ..
Q8PZJ9_METMA/26-247DV..Q..RR..TPGLESLGILE------AYG---I----------------------------PVV.KT-------VF..
D5CS41_SIDLE/485-707QE..H..RKV.LTEMESKALLA------AFN---I----------------------------PVA.RT-------MV..
Q223I3_RHOFD/478-701AS..G..REM.LTEPEAKAVLD------ACH---I----------------------------PVV.PT-------RR..
A2SHI2_METPP/474-697DA..G..REM.LDESEAKAVLV------AYG---I----------------------------PVV.KT-------LA..
B0CB03_ACAM1/496-716AC..D..RTL.LSEWESKQFLQ------SYG---I----------------------------PTV.LS-------HL..
B1XHT3_SYNP2/500-722AE..G..RTL.LTESESKKVLA------AYG---I----------------------------PIV.PT-------GN..
B9Z1Z5_9NEIS/480-702AE..G..RVI.LSERESKEVLS------AFN---I----------------------------PVN.PT-------RL..
A9B7A3_HERA2/473-695EA..G..RVE.LGEIEAREVMA------AYG---M----------------------------RLP.DS-------RL..
A5V1W2_ROSS1/474-696SE..G..RVE.LGELEARQVIE------AYG---M----------------------------RLP.RS-------LL..
B9MJF1_ACIET/473-695AE..R..RNV.LTEMESKTLLA------AFH---I----------------------------PVT.KT-------LL..
Q7NLP6_GLOVI/494-729QA..G..RTL.LTEFEAKALLA------AYG---I----------------------------PTV.ET-------RV..
C9R913_AMMDK/477-698QE..R..RRS.LLSSEAAAVAS------AYG---I----------------------------PVA.PI-------QL..
Q1Q1N5_9BACT/475-697QK..E..AAY.LSEEDAKQVIS------TYG---F----------------------------TIP.KS-------II..
D6Z2N4_DESAT/474-696RS..G..HRQ.LGEVRAKSILG------AYG---F----------------------------QIP.EG-------YL..
Q0KA53_CUPNH/481-703RA..G..RAL.LTEPEAKAALA------AYG---V----------------------------PVV.AT-------RT..
E3HYZ8_RHOVT/480-705AE..K..RDL.MTEPEAKAVLA------AYG---I----------------------------PTV.PT-------LV..
A1K623_AZOSB/482-704AE..R..RKV.LNEMESKALLA------AFR---I----------------------------PIA.QT-------VI..
B8GPY5_THISH/486-708AE..G..RKV.LGSLEAKAVLS------AFR---I----------------------------PVT.QT-------LL..
Q2LUQ3_SYNAS/506-727GE..G..RTL.LNEDESKEFLA------AYG---I----------------------------PTT.VP-------SL..
Q47CI3_DECAR/482-704AE..R..RKV.LSEMESKAILR------AFR---V----------------------------PVA.QT-------MV..
A1RXS7_THEPD/479-701KE..G..RTT.LTPSEAAALVG------YYG---I----------------------------PVL.AK-------KI..
B5IPC9_9CHRO/514-740EE..G..REL.LSEAEAKQVLA------AAG---I----------------------------PVL.ET-------RL..
Q6MAV5_PARUW/501-722EE..K..RTI.LTEFESKQVLS------LYG---I----------------------------PII.QT-------EV..
C6C1C2_DESAD/472-693RS..G..RSE.LVEFQARDIVT------AYG---L----------------------------PTP.ES-------DL..
Q8DJG8_THEEB/495-717SE..G..RTL.LTEWEAKTVLA------AYG---L----------------------------PVV.ET-------CI..
B0UM89_METS4/27-247AD..G..RDA.LTAPEGRIVCD------AYG---I----------------------------PVP.KE-------AV..
A8ZZJ4_DESOH/481-703QE..G..QTY.LGELEGNEVLS------CYG---F----------------------------SVL.PT-------KL..
Q92Z73_RHIME/480-705AE..G..RRM.LNEPEAKAVLA------AYG---I----------------------------PVP.QT-------II..
Q7NRV4_CHRVO/480-702AE..G..RTV.LSERESKQVLA------AFH---I----------------------------PVN.PT-------TL..
Q2Y8E7_NITMU/478-700QE..Q..RTI.LTAMESKAVLA------AFH---I----------------------------PVA.PT-------ML..
Q6AQI6_DESPS/472-694AS..G..VRR.LGEVRAKKILD------AYG---F----------------------------NVP.EG-------YL..
Q3SEU0_THIDA/481-703AH..G..RHL.LNEVESKALLS------AFR---I----------------------------PIA.QT-------LI..
D0L1W1_HALNC/488-710SA..G..RKV.LTTRESKAILN------AFH---I----------------------------PTT.QT-------IL..
A1VIA4_POLNA/472-694AE..R..RKV.LTEMESKTLLS------AFH---I----------------------------PVT.QT-------IL..
O29057_ARCFU/463-681ES..G..GRV.V.GAEGLPVLE------AYG---I----------------------------EVA.PY-------GI..
B8HP40_CYAP4/501-729GE..G..RTL.LTEAEAKQVLE------AYG---I----------------------------PTV.KV-------CV..
C4ZP31_THASP/482-704SE..R..RKK.LNEMESKALLA------AFR---I----------------------------PIA.QT-------VV..
C7RIF7_ACCPU/482-704QE..R..RKL.LSEMESKAILR------AFR---I----------------------------PVA.QT-------MV..
B9B8Y3_9BURK/493-714KA..R..GNV.LGEQDSKRVLA------AYG---I----------------------------RVP.RE-------TV..
B5HI28_STRPR/17-237AE..G..RTA.LTAPEGKAVTD------AYG---I----------------------------PTP.AE-------GL..
C7NV33_HALUD/473-693.E..R..DTN.KLGVEAMELLE------AYG---I----------------------------PTP.QG-------AI..
Q13N88_BURXL/472-694AE..R..RKV.LTEMESKALLA------AFH---I----------------------------PIT.QT-------IL..
A5D252_PELTS/478-700RD..R..RLT.LLGSEAAEVAI------AYG---I----------------------------PAA.PA-------VL..
D2PSA1_KRIFD/14-237AE..G..RSS.LSAPEAKQVAD------AYG---I----------------------------PTP.GE-------GL..
Q89QG9_BRAJA/95-315AD..N..RTS.LTAPEGKLVCD------AYG---I----------------------------PVP.KE-------GV..
Q2LV27_SYNAS/9-227VK..M..ERL.LLGVEAFDFLE------KEG---I----------------------------PIL.KT-------VL..
A7BXB1_9GAMM/467-693AE..R..RKV.LTEMESKALLG------AFR---I----------------------------PIV.NT-------AI..
B9TF03_RICCO/23-245AE..G..RTL.LNEIEAKALLT------AYG---V----------------------------ATV.PT-------RL..
A5D1F4_PELTS/478-699KD..N..RLV.LLGSEAAEVVA------AYG---V----------------------------PVA.PT-------VL..
B8FK52_DESAA/483-704KD..V.DRVT.LPQSEANEILK------IYG---F----------------------------PVL.QN-------RV..
E8YSP4_9BURK/36-256AE..G..RNS.LTAPEGKLICD------VYG---I----------------------------SVP.KE-------AL..
C9ZD67_STRSW/15-235AE..G..RSA.LTAPEGKVIAD------AYG---I----------------------------AVP.GE-------EL..
Q2LPY3_SYNAS/483-704SE..E..RTL.LSDRESKAFLA------GYG---I----------------------------PSV.DS-------HL..
C0GKL8_9FIRM/479-700KE..R..RLV.LLGNEATSVAE------AYG---I----------------------------PVA.PV-------RL..
D4GVH7_HALVD/472-692DR..D...ET.RLGVEAMELLD------AYG---I----------------------------ETP.AG-------DI..
C0QHK1_DESAH/488-708SQ..G..RKV.LLEHEAKQLLK------LHG---A----------------------------STS.AD-------KV..
A5FQG4_DEHSB/106-328SE..G..RTL.LSETESKKFLQ------AYG---I----------------------------DAT.VP-------FL..
B4RED1_PHEZH/481-703AE..G..RSS.LAPLEIQAVLR------AYG---V----------------------------PIL.ET-------RI..
Q9HQZ0_HALSA/317-537DR..G..ATR.L.GVEAMDLLD------AYG---I----------------------------PTP.TG-------DV..
C0QJ02_DESAH/490-712DA..G..KTR.LGELDGIELLK------CYG---M----------------------------SVL.PT-------KL..
Q7W8F6_BORPA/17-239EA..G..RGA.LDEPTGKRILA------GHG---I----------------------------AVP.KS-------VV..
C0QHB0_DESAH/487-709AE..N..RSW.LTVSEAMAVLA------AYA---I----------------------------PVV.AT-------HE..
Q1LF49_RALME/14-234KE..G..RNA.LTAPEGKLVCD------AYG---I----------------------------SVP.GE-------GV..
D3STG0_NATMM/473-693RR.....DDN.RLGIESMALLD------AYG---I----------------------------PTP.PG-------EI..
E6VV76_DESAO/485-707DK..G..RTS.LTEPEAKDTLA------AYG---I----------------------------PVV.ET-------RI..
B1T453_9BURK/492-715EE..M..RVV.VLEHEARQALV------EAG---V----------------------------PASAPA-------IL..
A4J695_DESRM/478-699RD..R..RSV.LLGSEAAVVAE------AYG---I----------------------------STA.PI-------KL..
A5D034_PELTS/478-700KD..K..RLT.LLGSEAAEVAM------AYG---I----------------------------PAA.PI-------VL..
A3VE72_9RHOB/482-704SE..D..REM.LSDLESKALLK------AFR---I----------------------------PIN.LT-------VE..
Q64CH5_9ARCH/12-232TA..G..RQA.LFEPEAKALVS------AWG---I----------------------------QVP.KS-------VL..
A4YYL2_BRASO/483-708AD..G..RTW.LDPVEISRLLE------AYD---I----------------------------AMV.PT-------FA..
A4SW96_POLSQ/471-693AS..R..RTV.LTEMESKALLS------AFH---I----------------------------PIT.QT-------IL..
A7MH14_CROS8/473-695AE..G..VTQ.LDTHEVRPILE------AYG---L----------------------------HTL.PT-------WI..
Q988U3_RHILO/480-705RE..G..RRM.LTEPEAKAAIC------AYG---I----------------------------PVP.ET-------II..
D7AUW7_NOCDD/22-244AE..G..RTA.LTAPEGRVLAD------AYG---I----------------------------PVP.GE-------DL..
B1I353_DESAP/478-699ED..N..RLV.LLGSEGAAVVE------AYG---I----------------------------PVS.PT-------RL..
Q330N5_9EURY/8-229AD..G..RRT.LTEAEGKRLLA------DAG---I----------------------------ETP.PF-------AL..
A0B6M1_METTP/11-226EE..G..RTY.LMEHESKRILM------DVG---L----------------------------ETT.GA-------HL..
Q20Z65_RHOPB/482-707DD..G..RIW.LDPVEVKALFD------AYR---I----------------------------PTV.PV-------LA..
Q604W6_METCA/481-703GD..K..RSL.LSPLETRAILG------AFR---I----------------------------PML.PA-------LP..
Q3IQS4_NATPD/472-692DR..P...DN.RLGIEAMGLLD------AYG---I----------------------------PTL.DS-------EI..
Q2NFU6_METST/479-700QK..G..RDA.LLGSEAYQVAK------AYG---I----------------------------SAA.PI-------IL..
C6BU19_DESAD/485-707SE..G..RQE.LNEPEARRVLA------AYG---L----------------------------PVV.ET-------KV..
A0LJP9_SYNFM/480-702SR..G..RTY.LADADGNEILR------CYG---F----------------------------PTL.PT-------FT..
Q0A9U7_ALHEH/468-689TA..G..RDQ.LNEYQAQQLLT------AYE---I----------------------------PCV.PS-------RR..
Q2Y4P6_9ARCH/484-706GE..K..RTI.LTETEAKAVLD------AYQ---I----------------------------PVA.RM-------LV..
B7KVR5_METC4/479-704AE..G..RTW.LDPYAVTELLT------AYR---I----------------------------VSV.PV-------TL..
B2Q2E9_PROST/473-695QN..N..NLH.LDTHEVQPILQ------AYG---L----------------------------NSL.PT-------WI..
C0QAQ8_DESAH/481-702AE..N..NME.FTEVEAKDLLR------AYG---I----------------------------PVN.AC-------LL..
A5D530_PELTS/478-699KD..N..RLA.LLGSEAAEVIA------AYG---V----------------------------AAV.AT-------EL..
D2U861_XANAP/477-702AA..G..QAW.LDPLATTQLLA------AYG---I----------------------------PTA.PV-------VQ..
B9AE11_METSM/477-698AD..G..RDT.LLGSEAYAVAE------AYG---I----------------------------EAA.PI-------KL..
Q11G56_MESSB/480-705SE..G..RRM.LTEPEAKAAIE------AYG---I----------------------------SVP.ET-------IV..
B3Q6R1_RHOPT/482-707RE..G..RTW.LDPLEISGLFA------AYQ---I----------------------------PMI.PT-------LA..
A3Y536_9GAMM/503-723AQ..G..RD..LFEFEAKNLLS------SYR---L----------------------------DVA.KE-------II..
B8DM77_DESVM/483-705EA..K..RML.LTPAEAHAVLT------AYG---I----------------------------PVA.ET-------RH..
B4WR45_9SYNE/496-729LD..N..RTI.MTEMESQMVLN------AYG---I----------------------------PTV.TS-------QT..
Q3BMW9_XANC5/481-706AA..G..RRW.LDPVATNRLLA------AYG---I----------------------------PVV.PL-------QV..
B6R8H6_9RHOB/482-707EN..G..QKW.LTPLQTRELLR------AYS---V----------------------------NQV.EL-------HL..
Q7N786_PHOLL/472-694EQ..G..NSR.LDTHEVQPILE------AYG---L----------------------------NTL.PT-------WI..
Q1QM20_NITHX/483-708AE..G..RGW.LDPIEVMGVLD------AYG---I----------------------------ASV.PT-------RA..
Q2W7Y3_MAGSA/500-722AE..A..GGN.LTEPDAKALLS------AYG---I----------------------------KTQ.DT-------RL..
E3I048_RHOVT/473-695SR..P..DGV.LSEPDSRRLLA------SYG---I----------------------------PTL.ES-------IL..
D0I5J1_VIBHO/484-706DE..S..LTI.LTTHEARPFLS------KYG---I----------------------------NVM.AT-------WL..
B1LZ43_METRJ/472-697RQ..G..AAW.LDPVAVNGLLQ------AYG---I----------------------------PTV.PI-------TL..
Q07QV1_RHOP5/482-707AE..G..RRW.LDPLEIQQLFE------AYQ---I----------------------------PLL.PV-------LA..
D3RU01_ALLVD/481-703SE..G..RKV.LGTIEAKAILS------AFR---I----------------------------PTM.QA-------IL..
Q3AFE8_CARHZ/490-711VE..G..RRN.LTGYETAEVLK------AFG---F----------------------------PVL.PV-------KL..
A9DH35_9GAMM/486-708ER..G..RKT.LETHESQEILS------AYG---L----------------------------KTI.DT-------YV..
B8FE80_DESAA/10-226KE..E..RAS.LTEAESKILLS------AYG---I----------------------------PVV.EE-------AI..
C6CLU6_DICZE/473-695QE..G..TTR.LDTHEVQPILQ------AYG---L----------------------------NTL.PT-------WI..
C7LTU8_DESBD/481-703DE..D..RNH.LTEDESRQVLA------AYG---V----------------------------PVV.ET-------RI..
B8FIX8_DESAA/9-225SA..G..RKA.LTESESKALLA------EYG---V----------------------------PVV.EE-------KI..
Q12WB1_METBU/472-693SN..G..RRT.L.GLESFDILR------AYG---I----------------------------PVV.ET-------LN..
B2FMM9_STRMK/482-707AN..G..QQW.LDPLATHELLK------AYG---I----------------------------PSA.PV-------MH..
D3V3Z2_XENBS/472-694DS..G..NTL.LDTHEVQPILE------AYG---L----------------------------NTL.PT-------WI..
B8IED3_METNO/488-713RE..G..RTW.LDPREVAGLFA------AYA---I----------------------------PML.PV-------HF..
A7C137_9GAMM/159-381SE..G..RQI.LTTQESKAILA------AFN---I----------------------------PVT.QT-------IK..
D4HZ45_ERWAC/472-694SN..G..ITS.LDTHQVQPILQ------AYG---L----------------------------NTL.PT-------WI..
E6WFR2_PANSA/472-694DQ..G..ITT.LDTHEVQPVLQ------AYG---L----------------------------ATL.PT-------WI..
C4ZKF4_THASP/487-709AQ..S..RAS.LTESESKDVLA------AYG---V----------------------------PVI.QT-------HL..
A1S6F9_SHEAM/486-708AK..G..KTV.LETYDASAILG------AYG---L----------------------------NTI.DT-------WF..
Q1YVR3_PHOPR/216-438AQ..E..ITH.LETHEVRPVLE------SYG---F----------------------------KTL.PT-------WI..
A3QEK7_SHELP/486-708AD..N..KQV.IETHEASAILK------AYG---L----------------------------NTI.ET-------HF..
C9PHJ3_VIBFU/483-706EQ..A.NLAH.LDTHQIGTLLK------CFN---F----------------------------NVL.PT-------WI..
Q2YZQ5_9DELT/33-247SS..G..RKA.LNEYEAKSFLA------AFG---V----------------------------PIC.RE-------VL..
Q0HVJ0_SHESR/495-717AK..G..KSV.LETHEASPILR------AYG---L----------------------------NTI.DT-------WF..
C0QFL6_DESAH/13-229AS..G..RNA.LLEDDAKKLIA------GFG---I----------------------------PVV.DE-------HR..
A8FV14_SHESH/486-708GL..G..KRI.LETHESQEILS------AYG---L----------------------------NTI.DT-------YV..
Q4XQ92_PLACH/180-403EN..K..NYI.LNEYDSKQILE------AYD---I----------------------------PVV.NT-------KI..
Q1QWA2_CHRSD/486-716QR..G..RDR.LTHQETAEVLA------AYG---I----------------------------PAA.PS-------QY..
B4EUX9_PROMH/472-694DK..K..QYR.LDTHQVQPIME------AYG---F----------------------------NTL.PT-------WI..
A1WTN4_HALHL/467-689TA..G..RDH.LNEYQTGRLLS------AYG---I----------------------------PCV.DS-------RR..
O28761_ARCFU/667-877G...R..REW.LSPPEAFELLR------CFG---I----------------------------SFP.EY-------EY..
D3PVJ8_STANL/666-881RT..G..GGW.QNAEWSRGLLA------SYG---I----------------------------PHV.ET-------RF..
Q082P1_SHEFN/486-708DN..G..QTV.VETHQAVDILR------AYG---L----------------------------NTI.ET-------RF..
D3FEQ9_CONWI/670-890AE..QPGGGW.LDALATHDLLA------CHG---L----------------------------PLP.SQ-------RV..
D0Z2J5_LISDA/490-712NH..N..ITQ.LETHEVQPILK------GYG---F----------------------------KTL.PT-------WL..
A3UW19_VIBSP/483-706LD..K.DTVS.LDTHQNSQFFK------HFN---L----------------------------DVL.PT-------WI..
A1RWD9_THEPD/9-229SE..N..RKN.LSLGEAFAVCE------YYG---L----------------------------PLL.GY-------RF..
B8CM86_SHEPW/486-708SQ..G..KTI.LETHESSSILG------AYG---L----------------------------NTI.ET-------WF..
A1VGL0_DESVV/20-292DE..G..RDY.LLEYEVYNLLG------SSG---A----------------------------ETP.PK-------CILI
B9M8K3_GEOSF/479-695QA..G..RSV.LSATDVYTIFE------AYG---I----------------------------PVA.GW-------GV..
D0X5Z1_VIBHA/468-690DK..N..TVT.LDTHQTSPLFE------QFG---F----------------------------DIL.PT-------WI..
B3LBB6_PLAKH/551-775KN..K..NYI.LNEFDSKKILQ------SYG---I----------------------------PTV.ST-------EV..
C4XLT1_DESMR/479-701AE..G..RLT.LTDPEAKEVLG------YYG---V----------------------------RAV.AS-------QL..
A4FCG4_SACEN/661-877AE..D.TDGW.LGPDQVQRVLT------AFG---L----------------------------PAV.PT-------TV..
C5B797_EDWI9/472-694TD..G..VTR.LDTHEVRDILA------CYG---L----------------------------DTL.PG-------WI..
Q2BZN6_9GAMM/19-241TN..N..IHH.LETHEARPILE------CYG---F----------------------------NTL.PT-------WI..
A0NUW5_9RHOB/488-713QE..D..RTW.LNPPEVVAILE------AYD---L----------------------------PIM.AT-------AM..
B9R2H8_9RHOB/488-713AD..D..RIW.LTPKEVCDILA------AYD---I----------------------------PIM.AT-------DM..
Q12N16_SHEDO/486-708AR..G..QYQ.LATHETGEILA------AYG---L----------------------------NTI.DT-------DF..
Q3IFA9_PSEHT/480-701EE..G..QSY.LPTHQASQILS------HYG---I----------------------------ECI.QT-------EV..
C6CAZ3_DICDC/473-695HA..G..ATR.LDIHEAAPILN------AYG---L----------------------------HTQ.PT-------RI..
A1VAF7_DESVV/482-698EA..K..RQI.LDPAEARAVLE------AYG---I----------------------------PVA.EA-------LH..
E6VZV8_DESAO/478-699RI..G..LQE.LPFADAMSVAA------AYE---L----------------------------PVP.ET-------RL..
C6C0V7_DESAD/480-701KT..G..LTE.LVELDAQQLAS------AYE---L----------------------------PVP.ET-------VL..
A0KEL7_AERHH/447-666ER..K..QLT.LDTHLAHPILQ------AAG---L----------------------------STL.PT-------WI..
B0KMM7_PSEPG/475-696AG..E..SRL.LDEWQSKQALR------AFG---L----------------------------PVP.AG-------.V..
Q2NRP0_SODGM/472-694DQ..G..ITR.LETHEVRPIVK------AYG---I----------------------------KTL.PT-------WI..
Q47QC0_THEFY/653-870KR..HPEGGW.LPLDQTMEVLG------CYG---V----------------------------TVA.PW-------QW..
D2U4A3_9ENTR/472-694KK..G..ITQ.LDTHEVEPILR------AYG---L----------------------------KIL.PT-------WI..
C8X6G7_NAKMY/699-910AA..G..AGW.LTAAEVERLLA------AYG---L----------------------------PTC.PQ-------RP..
Q8IL89_PLAF7/540-763QN..K..SYI.LNEFDSKVILQ------NYD---I----------------------------PIV.QT-------RI..
B5YGW4_THEYD/482-700SE..G..RSI.PTFFEASEILS------AYG---I----------------------------PVI.LT-------KR..
B6ERR1_ALISL/484-706TK..N..IVS.LDTHEVQTLYE------CYG---F----------------------------KTL.DT-------WI..
A4C9D2_9GAMM/480-701AD..K..QTY.LSTYQTRPILD------FYG---I----------------------------DVI.QT-------EV..
B1VXP6_STRGG/739-955DP..R..GRP.LTHDEARELLG------RYG---I----------------------------DVR.PT-------LP..
D6STV6_9DELT/482-704DE..N..RSF.LSAPETNEVLS------IYT---I----------------------------PVV.PT-------RQ..
A4FAM1_SACEN/663-876TD..D..LQR.LTDDRTVELLR------CYG---I----------------------------ELV.AF-------RR..
D1BG29_SANKS/695-919RE..G..ERVDLAPAEVRALLA------CYG---I----------------------------DVW.ES-------VP..
O50516_STRCO/806-1022RG..Q..GLT.LGSQETCDLLG------RYG---V----------------------------HVH.RA-------LP..
C7LRJ9_DESBD/471-692DA..R..KTE.LFGFEVQPLLM------AYE---L----------------------------GFP.RT-------EL..
C5C5J4_BEUC1/666-884PA..E..RRR.LDAPRATELLG------AYG---I----------------------------RLW.PA-------IG..
C5BNQ0_TERTT/484-704RS..E..QFQ.LSETESKTILA------AFG---I----------------------------PIA.PT-------IL..
C6WAF3_ACTMD/668-881HA..E..LVK.LDDGTTMRLLA------CYG---I----------------------------DVV.PF-------RV..
C4ZP63_THASP/474-692NQ..R..RHI.LSAMESKALLR------SFG---I----------------------------PVT.HT-------TV..
A8TIY2_9PROT/479-703KS..G..RSQ.LAPDACMEILA------AYG---I----------------------------PTP.PS-------LV..
A3TZP9_9RHOB/9-212RA..G..RKV.VHEADAKSLLQ------RIG---V----------------------------PVP.RR-------DP..
Q2BN19_9GAMM/483-713SE..K..RDY.LSHAEACSLLD------LYD---I----------------------------PVS.NT-------YY..
A8B3P9_GIAIC/94-343SR..P..DGL.LYEYEAYELFE------LIG---I----------------------------KVP.EF-------RYFP
Q2SCW5_HAHCH/482-712AS..G..RRV.LTNAESRQILT------DYG---I----------------------------NML.DT-------RY..
C3JLK2_RHOER/505-719EN..S.PGRW.LSDVEAAALLE------CYG---V----------------------------AVV.EF-------RS..
B8HH21_ARTCA/662-878GE..Q..LKQ.LDPAAAASLLG------HYG---I----------------------------SVL.PS-------AA..
A8B4I3_GIAIC/26-275SR..P..DGL.LYEYEAYELFE------LIG---I----------------------------KVP.EF-------RYFP
A1R5M2_ARTAT/645-861GE..K..IRK.LDAGAAAALLS------GYG---I----------------------------KVV.PS-------LG..
A6W895_KINRD/666-883AAHPG..GTA.LGGRERTELLE------AVG---V----------------------------RLL.PR-------AE..
A6EUH1_9ALTE/482-712RS..G..RAH.LSNQEARDVIR------NYG---I----------------------------NAV.ET-------MY..
A5FUU0_ACICJ/447-667NG..G..RTA.LPQDAGFAILR------AYG---I----------------------------ETA.AT-------RI..
Q7W1M5_BORPA/23-232DA..G..RQV.VHEADSKRILA------MAG---F----------------------------PVP.GE-------....
A3JCC0_9ALTE/482-712HA..G..RHY.LTNEEARGVLS------DYN---I----------------------------RAI.DT-------IF..
E3IU41_FRASU/495-709RG..A..DGL.LDEPTSQAVLA------AVG---V----------------------------EGP.RQ-------IV..
A2F811_TRIVA/22-271AE..R.PDGL.LAEHEVLSIIG------DLG---F----------------------------SIA.PH-------CY..
A4BCL0_9GAMM/472-702RN..R..RDY.LTWPESRYLLR------AYG---F----------------------------TLV.DS-------TF..
C7RR50_ACCPU/477-694DA..G..SDV.PSAEQARRVLR------AYG---I----------------------------AVA.DH-------SL..

PF02750

SYN2_HUMAN/214-416ESIYNFCDKP-WVFAQLVAIYK------TLGGEKF----------------------------PLI-EQ-------TY--
SYN3_RAT/192-394YSVYNFCSKP-WVFSQLIKIFH------SLGPEKF----------------------------PLV-EQ-------TF--
SYN1_RAT/214-416HSVYNFCDKP-WVFAQMVRLHK------KLGTEEF----------------------------PLI-DQ-------TF--
O76322_LOLPE/191-393HSIYNFQDKP-WTMAHLIQIQK------KVGAENF----------------------------PLI-EQ-------AY--

PF04174

Q0RH44_FRAAA/80-411DEWDVIERGVTQRVQALEAFLA------DVYGPAE--VL------------------AD....GIV-PR-------RL--
D5YHN9_MYCTU/97-428PEWTRLERGITQRVKALECYLD------DIYGDQE--IL------------------RD....GVI-PR-------RL--
A3XNZ6_LEEBM/85-416EEWETIEKGVLQRSKALNHFIW------DIYHDKK--II------------------KQ....GII-PL-------DL--
A9H282_GLUDA/91-422AEWDHVNRGVQQRVTALNHFLW------DIYHERR--IL------------------RD....GII-PA-------DL--
B6IMV0_RHOCS/77-408AEWARLEAGVQQRVKALNLFLH------DIYHDQK--IL------------------KD....GIV-PA-------DL--
Q138L4_RHOPS/88-420REWALMELGLKQRVRALNMFLR------DIYHGRD--IL------------------RA....GII-PQ-------DL--
A3RW90_RALSL/94-425GEWATLERGLRQRVDALNRFLC------DIYHAQD--II------------------RA....GLI-PP-------DQ--
B3E3V9_GEOLS/83-414PEWSRIESGLKQRVKALNLFLE------DLYGEQK--II------------------KD....GVI-PP-------EL--
Q05V15_9SYNE/102-432HEWQRLEQGLIQRLEAIDCFLA------DIYGPQQ--II------------------ND....GVI-PR-------ED--
Q0I654_SYNS3/79-409REWVILEEGLLQRLDAIDHFLA------DIYGPQN--IL------------------ND....NVI-PR-------ED--
B3EHN4_CHLL2/82-413DEWQRIERGLIQRITALNEFLA------DIYSNQK--IL------------------RD....KVV-PA-------EL--
A4TU14_9PROT/5-295SRVRALPCG.DGVAPFLGLWRP------GLLASSA--IL------------------VDEGQGAEM-KR-------AV--
B0SUW6_CAUSK/58-364SDLAAMLDIVGAIEAAVQD...------.......--..------------------......PAY-QA-------AV--
Q12BE8_POLSJ/50-362AIRTTLGQAIAAIERVIAL...------.......--..------------------......PAY-QQ-------LA--
Q97YL5_SULSO/75-386ELFFKISNYLVARSYVLNKFIR------EVYQEG.--..------------------.S....NPI-PD-------WI--
Q970N0_SULTO/87-396DFFNKVSRYLIARSYVLNRLIK------EVYEEK.--..------------------.S....SPI-PD-------WI--
E1NE18_9BIFI/50-378DEFDEMEAGLKQRVNALNAYLR------DIYSDKH--AI------------------KD....GVV-PE-------EY--
D0L0C4_HALNC/81-412NEWRRLELGLKQRVRALNMFLH------DIYHDQE--II------------------KA....GVI-PA-------SQ--
B5JJZ7_9BACT/77-408KEMTSLEASLSQRAHLLNLILG------DVYGRQT--ML------------------QS....SKM-HP-------YL--
A3ZR35_9PLAN/118-447EDWDIAVKGLQQRARLLEAILT------DIYGHQE--LM------------------KS....GVL-PP-------EV--
B2HNB5_MYCMM/115-443QDWEVLEAGLVQRSRLLDAVLA------DLYGPRR--LL------------------TE....GLL-PS-------EL--
A2WED1_9BURK/114-449EDWVAIERGVLQRVRLLNATMA------DLYGPQT--IL------------------AR....GLL-PP-------AL--
Q1MBT4_RHIL3/98-432REWKTLSAGLVQRADLLEAIVA------DIYGDNR--LV------------------EE....GVL-PP-------AL--
B1M6F7_METRJ/100-432PEWAALSAGIVQRAELMEAILA------DAYGEGR--LV------------------AE....GLL-PA-------AI--
B2ICY7_BEII9/94-428NEWREIAAGICQRVQLMEAILA------DVYGEGR--LV------------------RS....GAL-PA-------TA--
Q02F91_PSEAB/81-412AEWQPIAAGVAQRARLLNALLA------DLYGEQR--LL------------------AE....GLL-PS-------EL--
A0QWP7_MYCS2/138-466EEWDVLEAGLVQRSRLLDAVLA------DLYGERR--SI------------------TS....GVL-PA-------QL--
A5JAS0_BURML/116-451DDWAAIERGVLQRVRLSNAILA------DLYGEQT--IL------------------RR....GLL-PP-------AL--

PF02955

GSHB_SYNE7/132-305LQFQ....-------------------------------------------------------SVV.PR-------TL--
GSHB_SYNY3/132-305LQFA....-------------------------------------------------------AVM.PP-------TV--
GSHB_NEIMA/127-301LNFS....-------------------------------------------------------RFT.AP-------TL--
GSHB_XYLFT/125-299QLFP....-------------------------------------------------------QCC.PP-------TL--
GSHB_SHEON/124-298AWFS....-------------------------------------------------------EFT.PE-------TI--
GSHB_RHOPA/124-297MDFT....-------------------------------------------------------ELM.PP-------TL--
GSHB_BUCAI/129-303SWFP....-------------------------------------------------------DLI.TD-------TL--
GSHB_PROMM/119-292LRFN....-------------------------------------------------------NLM.AP-------TL--
GSHB_CHRVO/123-297LHFP....-------------------------------------------------------ELI.SP-------TL--
Q73I56_WOLPM/115-287SLFP....-------------------------------------------------------ELI.PP-------TL--
GSHB_PROMA/119-292LRFS....-------------------------------------------------------KLM.AP-------TL--
GSHB_BRUSU/124-297TEFP....-------------------------------------------------------DLM.PE-------TL--
Q92UR6_RHIME/135-315QEFP....-------------------------------------------------------EIIRPT-------SL--
GSHB_RALSO/123-297AQFR....-------------------------------------------------------EFT.AP-------TI--
GSHB_CAUCR/125-298TDFP....-------------------------------------------------------GVQ.PP-------TL--
GSHB_BUCBP/125-300THFP....-------------------------------------------------------QYI.PK-------TL--
Q7CU65_AGRT5/135-315QSFP....-------------------------------------------------------EIVRPT-------TL--
GSHB_YERPE/124-298AWFP....-------------------------------------------------------ELT.PD-------TL--
GSHB_THEEB/132-305LQFT....-------------------------------------------------------SVI.PK-------TI--
Q6LMM4_PHOPR/124-298AWFP....-------------------------------------------------------ELT.PT-------TL--
GSHB_BORPA/128-302TEFP....-------------------------------------------------------DLT.TP-------TL--
Q7MGD8_VIBVY/125-307ASMGGTAS-------------------------------------------------------EFL.PS-------TH--
Q6G0M1_BARQU/122-295TEFS....-------------------------------------------------------DLM.PE-------TL--
GSHB_PSESM/125-299TLFP....-------------------------------------------------------QCT.PP-------TL--
GSHB_COXBU/125-299GWFP....-------------------------------------------------------HCT.PK-------TL--
GSHB_ANACE/116-288LSFP....-------------------------------------------------------KFI.PP-------TL--
GSHB_WIGBR/124-297LSF.....-------------------------------------------------------KYS.PK-------TL--
GSHB_NOSS1/132-305LQFT....-------------------------------------------------------KAI.PE-------TI--
Q8RN60_RHITR/126-299TEFA....-------------------------------------------------------DLM.PK-------TL--
GSHB_BUCAP/129-303SWFS....-------------------------------------------------------RFT.TD-------TL--
Q6LH85_PHOPR/128-308ASLPDPNN-------------------------------------------------------EFI.PV-------TH--
Q6F702_ACIAD/123-297TQFP....-------------------------------------------------------ELQ.VP-------TL--
GSHB_GLOVI/128-301LHFP....-------------------------------------------------------DLV.PE-------TR--
GSHB_PROMP/119-292LRYS....-------------------------------------------------------HLM.AP-------TI--
GSHB_SYNPX/119-292LRFS....-------------------------------------------------------RWM.AP-------TL--
GSHB_ECOLI/124-298AWFS....-------------------------------------------------------DLT.PE-------TL--
GSHB_NITEU/126-300TEFP....-------------------------------------------------------RFT.PP-------SL--

PF03133

TTL_YEAST/388-732PNNYFTNSYIYRKALIRKHFLS------HTIQTYT--AKNPE.................SILKKAYLES-------FT--
Q9VKL9_DROME/368-666INHLPGSFRIGRKD.SCWKNLQ------RQMGKHS--NK......................EFGFMPRT-------YI--
TTL3B_DROME/325-625RIKPPTPAEIVENQTFMVQSTD------VLKSNAK--FKV....................SEKVMAEYA-------RL--
TTLL3_HUMAN/213-505PLYLTPEGWSLFLQ.RYYQVVH------EGAELRH--LD.......................TQVQRCE-------DI--
TTLL4_HUMAN/651-946LNHFPGSFQIGRKD.RLWRNLS------RMQSRFG--KK......................EFSFFPQS-------FI--
O17720_CAEEL/115-423LNQFPRSTELTKKD.RLYENIE------RSKSIFG--ES.......................FDFIPEF-------YV--
TTLL1_HUMAN/48-364VNHFPNHYELTRKD.LMVKNIK------RYRKELE--KEGSPLAEK........DENGKYLYLDFVPVT-------YM--
TTL12_CAEEL/370-662INQFPFESCITVKD.LLAACAM------RDPAKND--WY...........................QLT-------YN--
TTL12_HUMAN/346-642LNQFPCENLLTVKD.CLASIAR------RAGGPEG--PP.........................WLPRT-------FN--
TTL_BOVIN/81-367CTWFPESYVIYPTN.LKTPVAP------AQDGIHP--PL.........................HSSRT-------DE--
TTL_SCHPO/119-383RQELEENATKNISE.KQWYILK------PSMCDRA--QG...........................IRL-------FS--
TTLL4_CAEEL/185-476VNHFPGAFHIGRKD.RLWMHIR------KQQERFE--GE.......................FDIMPFT-------YI--
Q9VX74_DROME/100-420INHFPNSIELSRKD.LLIKNIK------RYRKDLE--RRGDPLAQSHPPDTKLGIGGTRYKHLDIIPMT-------FV--
Q9VGW2_DROME/126-407VNHYPGCGYLTNKV...D....------..LCTTQ--LP.........................FLPRA-------FR--
Q9VQV6_DROME/501-799YNHIPGSFRIGRKD.TMWRSIY------NNMKKFG--KK......................EFGFMQKS-------YI--
TTL3A_DROME/342-640FEDPPKIWEHDWDA.FLFQHQQ------LVNEDGR--IQHD...................GGQRLEPMV-------KS--
Q9U1E3_LEIMA/265-568LLKHHNYNWNTLGD.YLPMSFK------LTPCQSS--RD...........................ERQ-------QL--
Q9VBX5_DROME/261-558VNHFPRSYEMTRKD.RLYKNIE------RMQHLRG--MK......................HFDIVPQT-------FV--
Q9VB58_DROME/190-486INHFPGMIEICRKD.LLSRNLN------RMLKIFP--QD.......................YKIFPKT-------WM--
TTL_RAT/81-367CSWFPESYVIHPTN.LKTPVAP------AQNGIQL--PV.........................SNSRT-------DE--
Q9VZ97_DROME/119-439INHFPNHYELSRKD.LLVKNIK------RYRKDLE--RDGNPLAEKTES...NNSSGTRYLYLDFVPTT-------FV--

PF14397

B6W1R0_9BACE/85-366YLPLVARTL..NNYRYTKLFEH------KSLLGYL..VNGS..LKFPRCIIR......CVDQEYYNEQ.-------.M--
B5EAA5_GEOBB/103-387QFKKFI.....YSRENFVLFAN------KQICYQL..CHDAGF...............PLPAQFATLY.-------..--
B5VY88_SPIMA/78-340ELTRQV.....NENDEVHILKN------KAHFANK..FHDL..................LGRKIYFY..-------..--
A4ALQ8_9ACTN/70-333NANSIVVKY..NQREYRERFYD------KPTFNKT..FDEW..................LGRDWLDLR.-------..--
A7VYN7_9CLOT/74-343RVCRLA.....NDKAYLPLFED------KLQFNEK..FREF..................VHRDFLDLR.-------..--
B0MM32_9FIRM/70-338DNITISKRC..NDRTYFHIFDN------KSEFDEA..FREY..................IGRDFLNLE.-------..--
A6FLT0_9RHOB/80-384LNRRLSPY...QITGLRAFVRD------KVMYGTL..MATLGFPVPTVQAVF......SKDRSYGKLR.-------..--
A2PUE2_VIBCL/88-392VYPYYD.....DIKKTTSMLEN------KIYMKRL..FEEGGIPTPI..TLF......TKLNDVFLLND-------NV--
Q82TT3_NITEU/63-372EMADRFYRKY.NPGAAVPNIED------KFIFTTL..CLQHHLPIPATYGIF.....KQGIVKTFDER.-------..--
Q8A3L1_BACTN/280-551SLRHELTRQV.NDPCEALVLKD------KVRFSE...VFEDIL...............GRRVMTFDEIK-------RQ--
B0MX85_9BACT/80-369ILFSTRLEPKLNPYREAEILGD------KSFLPLLFSGIEG.LHIPQTYLSCVKGIYRNGNNALLSPAE-------..--

PF14305

Q7AJR3_BACHD/224-461-SDDTY..-...TISTI-----------------P--KK----.E----------------R-I-----VI---KPQD--
Q8CX82_OCEIH/200-437-SVESY..-...TYKQI-----------------P--QK----.A----------------N-I-----VI---KPVN--
A3Q6N7_MYCSJ/939-1176-TEPGP..-....IHRL-----------------R--PT----.Y----------------P-C-----CV---KPVN--
Q8A829_BACTN/55-295-GVWENF.-..DDIDFE-----------------N--IP----.S----------------S-F-----VL---KCTH--
A8UGA4_9FLAO/32-274-GVYEHA.-..EDIPID-----------------K--FP----.N----------------K-F-----VV---KATH--
Q8PYT3_METMA/61-302-GIWDSA.-..DDIEFD-----------------K--LP----.D----------------Q-F-----VL---KPTH--
B5UQ62_BACCE/58-299-GVYEKF.-..SDIDFD-----------------K--LP----.R----------------Q-F-----VL---KCTH--
B1BGT7_CLOPF/58-308-GVWDNV.-..EEIDWE-----------------K--LP----.Q----------------K-F-----VL---KCTH--
C3WFM3_FUSMR/63-297-LVTDKL.-..TEEQWD-----------------K--LP----.N----------------S-F-----VA---KANH--
Q2CG16_9RHOB/72-314-ATAPNI.-..GALDFA-----------------A--LP----.A----------------R-Y-----II---KPVD--
B9JHB1_AGRRK/64-304-WVGTDL.-..STIDWS-----------------V--IT----.L----------------P-A-----VV---KPTH--
Q6AIA9_DESPS/77-317-GVWDDV.-..EDIDFD-----------------M--LP----.K----------------Q-F-----VI---KCTH--
B5L389_ECOLX/57-304-KVYDTP.-..FDITFE-----------------S--LP----QG----------------K-F-----VI---KSNH--
B3XSD0_UREUR/50-304-AVFNRQN-QITLLDLN-----------------K--FA----.K----------------P-Y-----II---KLNN--

PF08443

O59396_PYRHO/80-267-VSFSENS-AKKIAEEL-----------------....G-----Y----------------P-I-----VS---KPVF--
RIMK_ECOLI/97-286-IAHSPDD-TSDLIDMV-----------------G...G-----A----------------P-L-----VV---KLVE--
COFF_METJA/94-282-LIRDYED-AVKFIEKY-----------------N..LR-----F----------------P-V-----VI---KNSF--
RIMK_HAEIN/105-293-LSGGEVQ-AQATIPHI-----------------....S-----S----------------P-T-----IL---KTLN--
Y016_MYCPN/90-287-LAWYPEK-LEQFIEQI-----------------KRCFQ-----F----------------P-V-----IV---KSIY--

PF05770

Q7XBW0_ORYSJ/9-321-VVDPPHA-IDRLHNRI-----------------SMLQV----VS----------------E-L-----DVPLHAHHH--
ITPK2_ARATH/34-338-VLDPPDA-ILHLRNRQ-----------------SMLQC----VA----------------D-M-----NL...SDSN--
ITPK1_ARATH/2-311-VIDLPEA-IERLHNRV-----------------SMLEV----IT----------------Q-L-----RF..PVSDS--
ITPK1_HUMAN/1-318-VLDPLPA-IRTLLDRS-----------------KSYEL----IR----------------K-I-----EA...YMED--
Q9AYJ2_ORYSJ/16-320-VLDPPNA-IQHLHNRQ-----------------SMLQE----VA----------------D-L-----NL...SNAY--

PF02786

PCCA_HUMAN/176-385-DGV.VKD-AEEAVRIA-----------------R--EI----GY----------------P-V-----MI---KASA--
CARY_BACSU/128-334-IV...DN-EADALHFA-----------------E--SI----GF----------------P-V-----II---RPAY--
PYR1_DICDI/525-729-AC...NS-LEESLIEA-----------------E--KI----GY----------------P-V-----IV---RAAY--
CARB_ECOLI/128-335-IA...HT-MEEALAVA-----------------A--DV----GF----------------P-C-----II---RPSF--
CARB_TRICU/196-398-AV...ST-IQDALDAA-----------------K--TI----GY----------------P-I-----IL---RSAF--
CPSM_HUMAN/546-750-AV...ES-IEDALKAA-----------------D--TI----GY----------------P-V-----MI---RSAY--
CARB_BACCL/128-334-II...HS-LEEAYAFV-----------------E--QI----GY----------------P-V-----IV---RPAF--
BCCA_MYCLE/122-331-PDP.VKN-ADEVVAFA-----------------K--EH----GV----------------P-I-----AI---KAAF--
PYR1_SCHPO/593-797-SA...SS-IEEAIKVS-----------------K--DI----SF----------------P-V-----IV---RAAY--
ACCC_PSEAE/115-324-DGPLPED-EETALAIA-----------------R--EV----GY----------------P-V-----II---KAAG--
CARB_YEAST/149-353-AC...ET-VDEALEAA-----------------E--RV----KY----------------P-V-----IV---RSAY--
ACCC_ECOLI/115-324-DGPLGDD-MDKNRAIA-----------------K--RI----GY----------------P-V-----II---KASG--
BCCA_MYCTU/115-326-ARA.GLT-DDALVTAA-----------------A--EV----GY----------------P-V-----LI---KPSA--
ACCC_NOSS1/116-325-EGL.VET-EQEGLELA-----------------K--DI----GY----------------P-V-----MI---KATA--
PYC1_YEAST/135-344-PGP.IET-VEEALDFV-----------------N--EY----GY----------------P-V-----II---KAAF--
PYR1_MESAU/514-718-AA...NS-LEQAQAAA-----------------E--RL----GY----------------P-V-----LV---RAAF--

PF02222

PURK_BACSU/115-285-IVKTKN.-..ELKQAV-----------------Q--EL....RL----------------P-A-----VL--KTCRG--
PURT_METJA/120-294-FADSLE.-..ELRDAV-----------------E--KL....GL----------------P-C-----VV--K.PIM--
PURT_PYRHO/125-304-YATTLD.-..ELYEAC-----------------E--KI....GY----------------P-C-----HT--K.AIM--
PURT_ECOLI/121-295-FADSES.-..LFREAV-----------------A--DI....GY----------------P-C-----IV--K.PVM--
PUR6_YEAST/113-285-PVEQASE-.TSLLNVG-----------------R--DL....GF----------------P-F-----VL--KSRTL--
PUR6_CANGA/113-284-TVENSK.-.ESLIKTG-----------------S--SL....GY----------------P-F-----VL--KSRTL--
PUR6_SCHOC/111-283-AVPSNDE-.QSLIEIG-----------------N--KF....NY----------------P-F-----ML--KSRTL--
PUR6_PICME/113-284-SVESSA.-.ASLEEVG-----------------A--KY....GF----------------P-Y-----ML--KSRTM--
PUR6_SCHPO/111-282-DAPDQE.-..SVEKAG-----------------Q--EF....GY----------------P-F-----VL--KSKTL--
O80937_ARATH/197-369-EISDIE.-..GARKAG-----------------E--LF....GY----------------P-L-----MI--KSKRL--
PURK_ECOLI/87-254-LLAERS.-..EWPAVF-----------------D--RL....GE----------------L-A-----IV--KRRTG--
PURK_HAEIN/92-261-LLKDKN.-..QWNDLF-----------------Q--TV....GE----------------K-V-----VV--KRRTG--
PURK_PSEAE/105-272-DVQSQA.-..DLDAAA-----------------A--AI....GL----------------P-A-----VL--KTRTL--
PURK_SULSO/109-273-VAEDGE.-.EALKILR-----------------E--EF....NN----------------V-G-----VI--KESKG--
PURK_AQUAE/100-266-VIKRD..-..EIIDAL-----------------K--SF....KL----------------P-V-----VI--KAEKL--
PURK_SYNY3/112-284-ALESL..-..PAQLP.-----------------.--......DF----------------P-W-----VL--KARRH--
PURK_SYNE7/116-285-AIAAAT.-..ATESEL-----------------T--AL....GF----------------P-V-----VL--KQRRH--
PURK_MYCLE/120-300-ALDSVDD-LAEIDAFA-----------------Q--RLTGSKDA----------------P-M-----VV--KAVRG--
PURK_MYCTU/124-297-GIKDPD.-..EIDVFA-----------------A--RV....DA----------------P-I-----VV--KAVRG--
PURK_CORAM/129-306-PIESAQ.-..DAYDFW-----------------T--LT....SG----------------Q-V-----CL--KARRG--
PURT_BACSU/113-287-FANTYD.-..EFIQAA-----------------A--QI....GF----------------P-C-----VV--K.PLM--
PURT_PASHA/121-294-FVDNFE.-..QFQQAI-----------------Q--EI....GI----------------P-C-----VV--K.PIM--
PURT_SYNY3/117-292-YATSLA.-..ELEEVS-----------------Q--AI....GF----------------P-N-----VV--K.PVM--

PF13535

E8RY18_MICSL/111-299-A-AD--P-RGYC-ERI-----------------A-------AEI---G.......F....P-M-----VV---KPVD--
D4GMV9_PANAM/88-261-L-SG--E-IINS-ENL-----------------L-------LSS---Q.......K....D-Y-----IV---KPLT--
C4FVJ7_9FIRM/127-305-V-VS--Q-TSEI-DAA-----------------V-------QDL---G.......L....P-L-----IA---KPDN--
Q2Z1L8_ERWST/114-292-S-PQ--A-IKRG-DVS-----------------.-------...---........F....P-L-----VM---KPRS--
D1C2W8_SPHTD/155-337-C-PR--D-VGEL-DEL-----------------D-------LE.---........F....P-V-----AI---KPAI--
Q48NB4_PSE14/107-289-A-AS--S-AEEL-QA.-----------------A-------YDS---LSVS....G....E-V-----CI---KPVV--
Q1MX58_9ACTO/104-292-P-VA--D-AADL-DAA-----------------L-------DAV---G.......L....P-A-----VL---KPRR--
D0Z8Q6_EDWTE/96-265-R-LL--P-ETPI-DPD-----------------W-------P..---........W....P-L-----VL---KPSQ--
Q12II4_SHEDO/108-288-E-LA--E-VMTQ-ELT-----------------G-------LQ.---.............Q-L-----IL---KPKD--
B4DFC6_HUMAN/597-796-P-LE--S-EADV-ERA-----------------V-------HQV---P.......L....P-G-----VM---KLEF--
B0NR58_BACSE/114-290-I-IS--K-RNPI-PNN-----------------L-------H..---........Y....P-C-----II---KPLL--
Q83Z60_STRCL/126-311-R-VS--S-REQL-DEA-----------------V-------RKL---G.......F....P-M-----IA---KPPA--
D4I204_ERWAC/99-280-Y-VT--R-DSDY-LKL-----------------I-------DEL---G.......S....P-F-----II---KPSN--
C0QL65_DESAH/85-278-F-PD--F-YFKG-VGV-----------------E-------HLE---RIEFHQLPL....P-F-----II---KPIV--
Q1JXP0_DESAC/85-278-F-PD--F-FYAE-IPA-----------------E-------QLA---QTDTSTWSW....P-I-----IV---KPAV--
B4EQF8_BURCJ/110-298-V-VS--S-EAEF-TAA-----------------L-------KRI---G.......A....P-A-----LL---KPAG--
B8J507_ANAD2/110-304-L-HA--L-DEDP-EAA-----------------A-------RAA---P.......Y....P-C-----VL---KPLI--
C7M0Y2_ACIFD/99-283-V-AD--S-VAAI-DVD-----------------W-------LER---ALGP....G....P-W-----VL---KPLD--
C6WFN8_ACTMD/117-298-A-VD--H-LDDL-TAA-----------------P-------PE.---........F....P-V-----VI---KPPA--
D3DDW5_9ACTO/117-307-A-LA--D-PS..-...-----------------.-------...---.............R-Y-----FV---KPRT--
C5NY10_9BACL/132-310-A-VK--N-IREL-EKA-----------------I-------KDI---K.......L....P-V-----IA---KPNN--
B2E5U2_STRPN/105-289-L-LE--S-ENDL-RVF-----------------W-------NNC---KSS..........A-A-----IL---KPRN--
B9B6B7_9BURK/48-238-R-AL--T-AIVL-DDV-----------------K-------RDG---R............S-Y-----FV---KPVH--
C4T7U3_YERIN/81-287-K-LT--A-ATDT-SNL-----------------L-------KTL---N.......T....P-F-----II---KVTE--
C4FU48_9FIRM/109-287-L-IK--N-ESQL-NKA-----------------L-------KET---G.......L....P-A-----VA---KPDR--
D0FMQ8_ERWPE/108-286-S-QE--D-VRRG-DVP-----------------.-------...---........F....P-L-----VL---KPRS--
Q3A2P7_PELCD/85-278-F-PE--F-YFRE-IPM-----------------D-------DLE---KIRFEDLVV....P-F-----II---KPAV--
E6VR59_DESAO/87-280-Y-PD--Y-RFAR-VTA-----------------E-------GLG---AFDPAGFPK....P-F-----VI---KPSR--
C5NXU5_9BACL/109-287-L-VK--K-EGDI-EKG-----------------V-------KKL---K.......L....P-L-----IA---KPDN--
B1SDM3_9STRE/91-282-R-VT--N-LSEF-KEA-----------------V-------DVI---G.......T....P-G-----VL---KPVG--
B8CGT7_SHEPW/109-279-S-WA--M-CDEL-PDN-----------------I-------P..---........F....P-I-----VV---KPRS--
Q1VVV2_9FLAO/85-276-F-PD--F-LFRK-IKI-----------------D-------EIQ---TLAIDDLQL....P-F-----VI---KPSL--
Q888Y9_PSESM/114-292-S-LD--D-INRG-GAT-----------------.-------...---........F....P-V-----IL---KPRS--
Q3A6W8_PELCD/114-298-F-IH--N-RQEL-DSA-----------------A-------RKV---V.......F....P-C-----VL---KPHY--
C1DMZ3_AZOVD/112-284-V-LT--P-GAAL-PAD-----------------A-------P..---........F....P-L-----VA---KPRE--
Q3S8Y0_PSESH/109-293-E-VG--E-FSNF-SML-----------------V-------RGP---........FAHCKK-V-----IV---KPVR--
B1HFG7_BURPE/117-293-A-CD--G-AGDI-HAR-----------------A-------LEL---G.......F....P-L-----IL---KPVR--
D5WN11_BURSC/115-291-A-LE--D-LAVA-KAA-----------------T-------TTV---MR......F....P-I-----IV---KPRS--
D3DDW6_9ACTO/102-274-S-VA--D-FRRN-PPT-----------------T-------...---........G....T-Y-----LI---KPRL--
B5SP77_9ACTO/100-278-L-VD--G-PAGL-LEF-----------------A-------ERV---G.......C....P-V-----VV---KPVD--
C4FBF5_9ACTN/118-307-V-AR--L-AGDE-PIA-----------------P-------CAI---P.......F....P-V-----VA---KPSV--
Q1QB93_PSYCK/115-289-L-LT--A-KDLH-LEN-----------------L-------SIS---........F....P-L-----VA---KPKQ--
D5WN64_BURSC/107-292-A-SR--S-LSEL-LTW-----------------Y-------SES---EL......G....T-V-----IF---KPTM--
B9DMB9_STACT/529-710-Q-IV--E-IEEF-EAA-----------------V-------RDW---D.......F....P-L-----VL---KPGD--
A3UL12_VIBSP/111-283-L-LS--R-ESAP-VFD-----------------F-------D..---........F....P-V-----VA---KPKE--
D3D707_9ACTO/131-310-V-VH--S-LAEF-EAA-----------------V-------ARF---G.......G....T-A-----FV---KPTS--
D9TNI3_THETC/106-294-M-ID--D-IENF-VIV-----------------E-------KYP---........Y....P-V-----VL---KPVA--
E8SDA7_MICSL/98-270-T-VD--P-GATP-TVP-----------------A-------DL.---........F....P-A-----VL---KPRD--
A5G3Z6_GEOUR/110-292-Y-VA--G-MEDF-FRQ-----------------R-------QRI---AD......F....P-V-----VV---KPAF--
Q7N5R8_PHOLL/91-265-L-SG--H-FYNN-FAQ-----------------C-------TQG---AA......T....H-F-----II---KPLS--
C7Q3P0_CATAD/103-280-R-FS--G-DPRS-VDF-----------------.-------...---........F....P-A-----IV---KPAR--
C1F6E3_ACIC5/100-273-L-LH--T-RADA-DSV-----------------P-------ASS---........F....P-L-----CL---RPTH--
Q5WS01_LEGPL/99-278-T-LI--E-SPNL-KSI-----------------Q-------EKI---GV......Q....E-I-----FV---KPIN--
CRNS1_CHICK/606-804-R-LR--S-HGDV-ERA-----------------A-------GAV---P.......F....P-A-----VA---KLEF--
Q2SKF8_HAHCH/104-284-F-RT--T-VAEL-AEA-----------------L-------LSV---D.......F....P-V-----VV---KPVR--
C4L724_EXISA/89-275-A-FT--E-LETA-VDT-----------------L-------WER---A.......G....E-Y-----II---KPAD--
Q01ZL3_SOLUE/109-290-H-VL--N-YDAV-RQF-----------------M-------ESV---P.......A....P-W-----VL---KPRS--
Q0SCF9_RHOSR/101-280-P-VL--H-PADI-VDF-----------------M-------ADN---P.......G....R-V-----VV---KPRS--
C2CRI1_CORST/134-299-E-VK--S-ESDI-FE.-----------------.-------...---........P....P-C-----VI---KPAN--
A3CN29_STRSV/109-286-I-VN--T-EAGA-DLA-----------------V-------KKL---G.......L....P-L-----IA---KPDN--
Q842E2_PSESX/109-294-L-AV--D-RDAL-SAW-----------------A-------ERG---S.......W....P-V-----VI---KPQA--
C7N331_SLAHD/459-648-V-VK--L-AGTD-AIP-----------------A-------SEI---P.......F....P-S-----VA---KPAA--
Q12II2_SHEDO/112-302-R-IL--T-QEVF-IQI-----------------Q-------KNR---E............L-A-----FV---KPRQ--
C0WVD3_LACFE/116-306-I-LK--P-DTDW-QNY-----------------Q-------SPF---G.......F....P-I-----AL---KAAD--
E7FN57_9LACO/100-280-A-MT--P-EISV-EKV-----------------P-------EKG---..............-.-----VI---KPRR--
Q0S8A9_RHOSR/103-283-R-CD--E-ALTA-SSA-----------------D-------VTP---WAG..........K-T-----VL---KPLD--
A8M0K3_SALAI/103-297-L-VE--S-VGEA-LAG-----------------G-------AEF---G.......Y....P-L-----II---KPTM--
B6B6A2_9RHOB/129-318-E-VK--D-YEDL-KKT-----------------C-------EKA---GIG.....H....D-V-----VL---QSAF--
B4VDU1_9ACTO/110-294-L-LR--T-GADL-DAF-----------------A-------ERH---G.......L....P-V-----VV---KPRR--
A3CVX7_METMJ/109-278-Y-PQ--S-LEDA-ERI-----------------A-------ESL---S.......Y....P-V-----VV---KGAR--
B5XPP6_KLEP3/106-292-Q-IS--F-SEDK-FVL-----------------P-------WLK---........VRENNT-I-----IL---KPAI--
Q9AMT9_BRAJP/112-298-V-SD--N-AVEI-ASW-----------------K-------REA---NF......D....E-I-----VI---KPLN--
B0RPV7_XANCB/115-287-T-LA--P-GAAL-PAQ-----------------I-------P..---........W....P-V-----VA---KPRE--
Q1VG50_VIBAL/111-283-L-LH--R-HSNA-ALG-----------------M-------A..---........F....P-V-----VA---KPKE--
D2QAU0_BIFDB/128-311-S-CK--C-FGDI-IAA-----------------F-------DRW---E............T-V-----VL---KPRW--
A7NRD0_ROSCS/111-286-L-AH--S-PAQV-RAF-----------------A-------VEV---G.......Y....P-L-----VA---KPDV--
C6BWA6_DESAD/85-278-Y-PE--F-FYRT-VKF-----------------E-------DLD---SVKPEELPI....P-C-----VI---KPSV--
D0FNI3_ERWPE/106-290-S-LN--D-TLQN-PRI-----------------L-------EAI---SSA..........K-L-----VL---KPLD--
D4F6G3_EDWTA/108-277-P-LL--P-DTPI-DPD-----------------W-------P..---........W....P-L-----VL---KPSQ--
Q121X7_POLSJ/108-282-T-VC--D-PAML-SAL-----------------P-------EVP---........F....P-A-----VV---KPRE--
C2CRI1_CORST/498-675-F-IE--P-GDNA-QSV-----------------M-------EGA---GIT.....V....P-C-----VV---KPVD--
D1RZT7_SEROD/113-299-Q-AA--P-ERYL-QQV-----------------E-------QPL---S.......Y....P-I-----FA---KQID--
Q8TPB8_METAC/85-278-Y-PD--F-YFQG-IEF-----------------E-------KLD---EIRVEEIKK....P-F-----II---KPAV--
B2Q6S1_PROST/113-296-Q-ID--S-IDEL-KAF-----------------I-------VNN---PFKN....V....P-L-----CV---KPIK--
D9T106_MICAI/109-294-L-VR--S-VEEA-TAA-----------------L-------DEI---G.......F....P-A-----VL---KPST--
Q1QXJ8_CHRSD/106-286-E-AH--D-KEDV-IRF-----------------L-------KRV---NQTLLKLDGDPNDP-I-----HL---KAFD--
D2B0J8_STRRD/100-269-R-LA--P-GDPI-PPD-----------------P-------P..---........F....P-A-----VV---KPCE--
B8GVA8_THISH/116-296-V-LE--Q-HRDA-ERD-----------------L-------DLP---........Y....P-L-----VI---KPAR--
D7W254_9FLAO/112-293-A-VF--N-DHEV-DEF-----------------T-------DRV---P.......A....P-W-----VL---KPRS--
B9B6B5_9BURK/104-287-T-LS--D-LVQR-TNA-----------------S-------EWH---G............P-T-----VL---KPHS--
Q0ACF5_ALHEH/120-296-Y-VS--G-EDDL-DVV-----------------C-------ENA---S.......F....P-V-----VV---KPSD--
B8J4T0_DESDA/96-289-D-QD--Y-YYRR-LDF-----------------A-------QMQ---ALPFDELRT....P-C-----IL---KPAV--
Q5WSD6_LEGPA/104-283-T-LI--E-SSNL-KSI-----------------K-------EKI---GV......Q....E-I-----FI---KPIN--
A8FIK7_BACP2/134-334-P-VT--T-LADF-QQA-----------------I-------EHI---G.......T....P-L-----IL---KPTY--
Q6FAX4_ACIAD/125-307-I-VE--N-AEQL-QDA-----------------Y-------HDW---RQK.....G....E-V-----CV---KPAK--
D3PFD6_CRAVI/610-811-H-IE--N-ECDL-ETA-----------------E-------KTV---D.......F....P-A-----IM---KLEY--
D7VTF5_9SPHI/110-291-P-VF--N-DAVI-AKF-----------------I-------EEN---P.......A....P-W-----VL---KPRS--
A7N2D3_VIBHB/102-283-I-VV--N-KEQV-LEF-----------------I-------SEF---........G....S-S-----VI---KPSA--
B7GNZ5_BIFLS/108-299-S-VR--S-LEEL-QTA-----------------V-------DEI---G.......V....P-G-----VL---KPVG--
A7N6T3_VIBHB/145-321-S-LS--S-ETCY-DDV-----------------V-------SHL---HT......N....C-F-----VI---KPID--
Q888Z0_PSESM/112-290-T-LS--D-IEGG-HVE-----------------.-------...---........F....P-V-----VV---KPRS--
D4HVL4_ERWAC/112-290-T-LD--D-IENG-RVQ-----------------.-------...---........Y....P-V-----VV---KPRS--
D4HVL5_ERWAC/114-292-S-MD--E-IHQG-KAT-----------------.-------...---........F....P-L-----IL---KPRS--
Q0RGQ9_FRAAA/107-286-D-AP--D-ETAV-REF-----------------A-------DTH---G.......W....P-V-----IV---KPRR--
C6W4G0_DYAFD/113-294-A-LF--N-DDQI-NRF-----------------I-------EKH---P.......G....P-W-----MI---KPRS--
Q0RYD4_RHOSR/107-296-H-VR--S-LSDL-QSA-----------------Y-------EEI---G.......T....P-A-----VL---KPAG--
D2UCG0_XANAP/114-286-C-LP--P-GAAP-PTQ-----------------A-------P..---........W....P-L-----IA---KPRE--
Q02BT0_SOLUE/124-304-R-AS--L-ADNP-EEL-----------------A-------ARA---P.......Y....P-C-----VL---KPLG--
D9T7Z5_MICAI/109-288-R-PD--T-IGAV-AEF-----------------A-------AEV---G.......W....P-V-----VV---KPYA--

PF07478

DDL_BORBU/136-344-G-FR--Q-HDYF-LDK-----------------E...----EIK---RNVKEVLGY----P-V-----IV---KPAV--
DDLB_ECOLI/103-303-A-LT--R-AEFE-KGL-----------------S...----DKQ---LAEISALGL----P-V-----IV---KPSR--
DDL_ENTFA/138-341-P-VL--R-SDWK-GNP-----------------K...----EVF---EKCEGSLIY----P-V-----FV---KPAN--
DDLA_SHIFL/147-348-T-LT--R-ANRH-NIS-----------------....----..F---AEVESKLGL----P-L-----FV---KPAN--
DDL_SYNY3/134-342-G-VE--R-GEIW-SNP-----------------CVFP----ALC---EKIEAQVGY----P-C-----FV---KPAN--
VANB_ENTFA/138-337-M-IE--K-GDKP-EAR-----------------....----...---.....TLTY----P-V-----FV---KPAR--
DDL_MYCTU/158-363-V-LR--P-PRST-LHR-----------------....----...---.QECERLGL----P-V-----FV---KPAR--
DDL_AQUAE/101-291-T-FI--S-EGDV-LNT-----------------....----...---....EWNKF----P-A-----VV---KPVR--
MUDD_CHLTR/569-778-P-LT--L-AGWK-QEQ-----------------D...----KWL---AHIVEAFSF----P-I-----FV---KSSH--
DDL_BUCAP/103-303-Y-LQ--K-KDIS-KYT-----------------Y...----SYI---LKKILKLKF----P-V-----VI---KPNN--
DDL_BACSU/135-338-A-FL--K-KDWT-RSP-----------------K...----ESC---EEVEQELGY----P-C-----FV---KPAN--
Q47720_ENTCA/143-343-L-LT--N-QANQ-QEQ-----------------....----..I---EAFIQTHGF----P-V-----FF---KPNE--
DDL_HAEIN/106-303-V-VT--R-ETFS-ELD-----------------....----..P---QAVVAKLGL----P-L-----MV---KPSL--
VANC_ENTGA/136-336-L-LS--R-YEND-PAT-----------------....----..I---DRFIQDHGF----P-I-----FI---KPNE--
O33806_STRTO/139-338-T-VA--A-DETV-DAA-----------------....----...---.....RFTY----P-V-----FV---KPAR--
DDL_LEUME/142-349-V-VD--P-ESAN-NWS-----------------....----..W---DKIVAELGN----I-V-----FV---KAAN--
VANA_ENTFC/139-338-V-IN--K-DDRP-VAA-----------------....----...---.....TFTY----P-V-----FV---KPAR--
DDL_TREPA/143-347-F-FR--K-DAWR-MHM-----------------Q...----EFV---AQLETRLGY----P-L-----FV---KPAQ--

PF06973

Q1ER85_9CREN/193-383-T-IE--E-FIIG-TYF-----------------N---------------------F----N-Y-----FY---SPIS--
PURP_SULSO/152-337-I-IQ--E-YVVG-VPM-----------------Y---------------------F----Q-F-----FY---SDII--
PURP_METTP/173-356-T-IQ--E-FILG-TRY-----------------Y---------------------I----H-F-----FY---SPIR--
Q8PZA1_METMA/193-387-R-IE--R-YIIG-PVF-----------------N---------------------L----D-M-----FY---SPIE--
Q975Y8_SULTO/160-348-V-IE--E-YILG-AHF-----------------N---------------------I----N-Y-----FY---SPIF--
PURP_METM5/174-361-H-IE--E-YVVG-ANY-----------------C---------------------I----H-Y-----FY---SPLK--
Q4JAU2_SULAC/161-349-I-IE--E-YILG-AHF-----------------N---------------------L----N-Y-----FY---SPLH--
A8AB21_IGNH4/178-366-S-IE--E-LVLG-AHF-----------------N---------------------I----N-Y-----FY---SPLL--
A1RQP6_PYRIL/168-356-S-IE--E-LVLG-AHF-----------------N---------------------A----N-Y-----FY---SVMR--
PURP_PYRHO/149-333-Q-IQ--E-YVVG-VPI-----------------Y---------------------P----H-Y-----FY---SKIT--
PURP_METS5/151-332-I-IQ--E-YVIG-IPM-----------------Y---------------------F----Q-F-----FY---SPML--
PURP_UNCMA/178-365-H-IE--E-YVAG-DIY-----------------C---------------------M----H-Y-----FY---SPLT--
Q8U3N6_PYRFU/189-380-R-IE--R-YIIG-PVF-----------------N---------------------F----D-F-----FY---SPID--
PURP_METST/176-363-H-IE--E-YVCG-TNF-----------------C---------------------I----H-Y-----FY---SALK--
PURP_CALMQ/163-337-I-IQ--E-YVIG-VPA-----------------Y---------------------Y----H-Y-----FD---SKVY--
PURP_PYRCJ/163-333-I-IQ--E-YVFG-VPA-----------------Y---------------------Y----H-Y-----FA---SPVY--
PURP_IGNH4/170-347-I-IQ--E-YVIG-VPA-----------------Y---------------------Y----H-F-----FY---SPIY--
PURP1_METMA/173-356-T-IQ--E-FITG-TRY-----------------Y---------------------L----H-Y-----FY---SPIR--
PURP_METS3/176-363-H-IE--E-YVSG-CNY-----------------C---------------------I----H-Y-----FY---SALE--
A4GI95_9BACT/191-385-R-IE--R-YVIG-PVF-----------------N---------------------L----N-F-----FY---SPLA--
A9A5F5_NITMS/177-363-S-IE--E-LAIG-TYM-----------------N---------------------F----N-F-----FH---TPIS--
O29983_ARCFU/174-373-R-IE--E-YVLG-ARF-----------------N---------------------A----N-F-----HS---YALK--
PURP_SULAC/153-333-I-IQ--E-YVIG-VPM-----------------Y---------------------F----Q-F-----FY---SPIL--
Q64BC8_9ARCH/174-354-T-IQ--E-FVIG-TRF-----------------Y---------------------P----H-Y-----FY---SPLK--
PURP_METJA/174-361-H-IE--E-YVVG-TNF-----------------C---------------------I----H-Y-----FY---SPLK--
PURP_METKA/174-359-H-IE--E-YVVG-TNF-----------------C---------------------V----H-Y-----FR---SVVE--
Q5JD28_PYRKO/146-310-R-VE--R-FIPG-VYL-----------------Y---------------------V----H-F-----FY---SPIL--
PURP_METBU/172-355-T-VQ--E-FIVG-TRY-----------------Y---------------------L----H-F-----FY---SPIR--
PURP_ARCFU/172-359-E-IQ--E-YILG-ANI-----------------Y---------------------F----S-F-----FY---SPVY--
Q12X62_METBU/191-385-R-IE--R-YIIG-PVF-----------------N---------------------F----D-M-----FH---SPIE--
A8M9J4_CALMQ/161-349-S-IE--E-LVIG-AHF-----------------N---------------------A----N-Y-----FH---SKVR--
PURP_CENSY/156-341-Y-IQ--E-YVPG-VLA-----------------Y---------------------L----Q-F-----FY---SPLK--
A4YCP1_METS5/159-347-V-IE--E-FIFG-AYF-----------------N---------------------I----N-Y-----FY---SPIF--
Q64BC7_9ARCH/185-375-V-IE--E-FVMG-AQS-----------------N---------------------F----N-Y-----FY---SILD--
PURP_METTH/176-363-H-IE--E-YIAG-TNF-----------------C---------------------I----H-Y-----FY---SIMN--
Q980P6_SULSO/161-349-V-IE--E-FVFG-AHF-----------------N---------------------L----N-Y-----FY---SPIF--
A0B858_METTP/188-379-R-IE--R-YIIG-PVF-----------------N---------------------L----D-F-----FY---SPLR--
A0RW22_CENSY/177-363-S-IE--E-LAVG-TYL-----------------N---------------------F----N-Y-----FY---TPVS--
PURP_NITMS/156-341-Y-IQ--E-YAAG-VLA-----------------Y---------------------L----T-F-----FY---SPLK--
Q702E6_9CREN/179-365-V-VE--E-YVVG-AYF-----------------N---------------------F----N-F-----FY---SPLS--

PF15632

C7NS61_HALUD/17-350-R.VE--D-EASF.VDA-----------------V.QA....LEY...P......DN----P-V-----CF---KPVV--
D7DRZ5_METV3/6-346-L.VK--T-WDEL.EKA-----------------A.EK....LEF...P........----.-F-----IV---KPPV--
B8GGE3_METPE/6-338-L.VD--T-FDSL.KRS-----------------A.EA....LGW...P......EK----L-V-----VV---KPPL--
C5A2Z7_THEGJ/6-337-V.VR--T-WDEL.ESS-----------------A.EK....LGF...P........----.-F-----VV---KPPV--
F8A3W6_CELGA/3-319-L.VG--T-PQAV....-----------------..SG....WDF...P........----.-V-----IV---KPRR--
F4H040_CELFA/4-316-L.VG--T-PQAT....-----------------..SG....WEF...P........----.-V-----IV---KPRR--
D5UBS5_CELFN/4-316-L.FG--T-PQAL....-----------------..SG....WDF...P........----.-V-----IV---KPRR--
D3FB15_CONWI/9-321-L.VD--E-AFDA....-----------------..SA....PEL...P........----.-A-----IV---KPRS--
A8KXY8_FRASN/5-354-T.VT--T-FAEF.EAA-----------------C.DE....LSA...A......GC----T-V-----CV---KPDV--
E4NDG0_KITSK/6-341-H.AD--T-AAEL.LAA-----------------V.EE....IEA...T......GV----P-A-----CL---KPAS--
D1BH78_SANKS/2-342-T.AQ--G-ADAF.VDA-----------------V.AS....LRSELEA......DE----V-V-----CF---KPLQ--
D1BIK1_SANKS/4-316-L.LD--A-DGVA....-----------------..AP....WDF...P........----.-V-----IV---KPRR--
Q82MB0_STRAW/6-340-R.VR--T-EDEL.LSA-----------------V.EE....LEA...G......GY----K-A-----CF---KPAA--
O88027_STRCO/6-340-R.VR--T-ADEL.VLA-----------------V.EE....LEA...G......GH----R-A-----CF---KPAS--
D9XZU1_9ACTO/6-340-R.VR--C-ADEL.VAA-----------------V.DE....LEG...R......GY----R-A-----CF---KPAS--
D6EGI6_STRLI/6-340-R.VR--T-ADEL.VLA-----------------V.EE....LEA...G......GH----R-A-----CF---KPAS--
C9ZBJ4_STRSW/6-340-R.VT--N-ADEL.VAA-----------------V.DE....LEE...A......GH----R-A-----CF---KPAA--
B5HSJ5_9ACTO/6-340-R.VR--T-ADEL.VAA-----------------V.EE....LEA...D......GH----K-A-----CF---KPAS--
D9X752_STRVR/6-340-R.VR--S-GEEL.VAA-----------------V.EE....LEA...D......GH----R-A-----CF---KPAS--
G2GBR6_9ACTO/6-340-R.VR--D-ADEL.IAA-----------------V.EE....LEA...G......GH----R-A-----CF---KPAS--
F9Z982_ODOSD/8-342-L.VS--T-FTDL.KNE-----------------A.IK....LGW...P......RN----K-F-----VV---KPPL--
A6LIK8_PARD8/6-341-L.VD--S-AKTL.RNR-----------------I.GE....LGY...P......QK----P-V-----CV---KMTQ--
E8U3T8_DEIML/7-345-T.FR--D-AAAF.EGA-----------------L.AA....LRA...DPAFVPGRT----R-L-----CV---KPAR--
Q9RSB2_DEIRA/9-338-T.FQ--S-VAEF.DAA-----------------C.AQ....LRQ...D......GV----R-L-----CM---KPAR--
Q2BF09_9BACI/6-345-V.VN--T-AAGF.KEA-----------------Y.HK....LRA...A......GH----K-V-----CF---KPVI--
C0Z9Z4_BREBN/4-338-I.VN--T-AEQF.QIA-----------------Y.EQ....LKQ...D......GN----K-V-----CF---KPAR--
F5RK20_9FIRM/2-337-V.AR--S-YEAF.VAA-----------------Y.EE....LRP...C......CA----R-V-----CY---KLTE--
F4A6T7_CLOBO/7-346-EIVS--S-VDEL.KKA-----------------C.LS....MGY...P......EQ----K-I-----CV---KPAV--
B2V211_CLOBA/3-315-C.KK--D-IEQILKRE-----------------NKEN....IQF...P........----.-L-----II---KPRD--
A7GGU2_CLOBL/9-348-KFVN--S-VDEL.KSV-----------------C.LS....MGY...P......QK----K-L-----CV---KPAV--
F2JJ82_CELLD/4-343-V.VT--N-VEAF.KLS-----------------Y.EK....LKQ...Q..LGK.SA----V-L-----CV---KYAV--
G6G5N9_9FIRM/16-350-S.VR--N-YPDF.QMA-----------------E.DQ....ISK...N.......G----K-T-----CL---KPIS--
F3ZYZ6_MAHA5/15-326-L.PE--E-IEY.....-----------------..RK....TEF...P........----.-L-----FI---KPRN--
E0IAJ8_9BACL/7-342-V.VR--D-AEGF.KQA-----------------Y.AR....LRE...A......GH----R-V-----CF---KPTD--
E0RJG3_PAEP6/5-340-I.AS--N-AEQF.KQA-----------------Y.ES....LIA...L......GH----K-V-----CF---KPCN--
E3EE70_PAEPS/5-340-I.AS--N-AEQF.RQA-----------------Y.ES....LIA...L......GH----K-V-----CF---KPCN--
E6UFS3_RUMA7/7-336-R.IT--T-VEGF.EQA-----------------Y.AA....VKE...R..YGK.DH----K-V-----CI---KADR--
E9SAE7_RUMAL/7-336-R.IT--T-VEGF.ESA-----------------Y.AA....IKE...K..YGR.QH----K-V-----CV---KADR--
C9LVE5_9FIRM/2-338-I.AG--T-YEEF.CAA-----------------Y.ES....LRP...H......CA----R-V-----CY---KLTK--
F4QGW0_9CAUL/2-325-..IR--S-ADEL.EAA-----------------L.AV....FRA.R.A...D..GG----A-P-----CV---KPRN--
G2TCW6_RHORU/2-335-L.FR--G-LEEF.DLA-----------------C.AE....LGG...E......AA----Q-L-----CV---KPSV--
Q5NWT2_AROAE/3-340-V.FE--D-AETF.AAA-----------------Y.AR....MRE...R......HE----V-L-----CM---KPSV--
Q82TT1_NITEU/3-312-L.LT--S-SDQL.DTS-----------------T.......LDP...V......GF----P-L-----IV---KPLE--
Q0AHL8_NITEC/3-312-L.LE--S-IDQL.DTS-----------------I.......LDP...V......GF----P-L-----II---KPLE--
A1VWP6_POLNA/3-339-V.VE--T-AQQF.EAA-----------------Y.RA....LRK...E......HA----K-L-----CI---KPSV--
Q6FAX4_ACIAD/19-350-I.VE--N-AEQL.QDA-----------------Y.HD....WRQ...K......GE----.-V-----CV---KPAK--
D3RPB0_ALLVD/3-344-P.FR--T-VAEF.ESA-----------------Y.ER....LRF...T......HD----V-L-----CI---KPAK--
C1MFA0_9ENTR/4-345-R.VN--T-LAEL.KTH-----------------L.AA....PPF...T......DS----P-V-----CV---KPVT--
A7MPT7_CROS8/12-353-R.VN--T-LAEL.KTH-----------------L.AA....PPF...S......DS----Q-V-----CV---KPVT--
C8Q020_9GAMM/11-360-R.FA--N-TDEL.MAL-----------------L.AL......H...G......GQ----P-L-----CV---KPVK--
C1IUG1_ENTCL/4-345-R.VN--T-LAEL.KTH-----------------L.AA....PPF...T......DS----P-V-----CV---KPVT--
D5CKR1_ENTCC/12-353-R.VN--T-LAEL.KTH-----------------L.AS....PPF...T......DS----P-V-----CV---KPVT--
Q5CB43_ECOLX/4-334-R.VN--T-LAEL.KTH-----------------L.AA....PPF...S......DS----P-V-----CV---KPVT--
G5Q9H1_SALMO/4-345-R.VN--T-LAEL.KTH-----------------L.AA....PPF...S......DS----P-V-----CV---KPVT--
E7HA30_ECOLX/1-338-R.VN--T-LAEL.KTH-----------------L.AA....PPF...T......DS----P-V-----CV---KPVT--
F9CS19_ECOLX/4-345-R.VN--T-LAEL.KTH-----------------L.AA....PPF...T......DS----P-V-----CV---KPVT--
F8YR44_ECOLX/4-345-R.VN--T-LAEL.KTH-----------------L.AA....PPF...S......DS----P-V-----CV---KPVT--
B2NP55_ECO57/4-345-R.VN--T-LAEL.KTH-----------------L.AA....PPF...T......DS----P-V-----CV---KPVT--
E7TZ65_ECO57/4-345-R.VN--T-LAEL.KTH-----------------L.AA....PPF...T......DS----P-V-----CV---KPVT--
A7KFT2_KLEPN/4-345-R.VN--T-LTEL.KTH-----------------L.AA....PPF...T......DS----P-V-----CV---KPVT--
B5RKB9_KLEP3/4-345-R.VK--N-VDEL.RAL-----------------L.SD....PPF...P......SD----C-L-----CI---KPVT--
C4XDI7_KLEPN/4-345-R.VK--N-VDEL.RTL-----------------L.NH....PPF...P......SD----C-L-----CI---KPVT--
A3JJ84_9ALTE/2-339-R.FE--G-AEEY.ERL-----------------R.GEGEIFPDH...P......GQ----.-L-----CV---KPAS--
G3ISJ3_9GAMM/2-338-A.VN--D-RDAF.DSA-----------------V.AE....LST...R......HQ----R-L-----CV---KPAV--
H8GG73_METAL/2-338-A.VN--D-AEAF.DRA-----------------V.EM....LAS...K......HK----R-L-----CV---KPAV--
E1PL52_PANVC/6-350-K.VQ--S-PDEL.ASA-----------------I.ED....FES...R......GV----L-P-----CI---KPVK--
D0KLU9_PECWW/4-345-R.VS--S-VDEL.RQQ-----------------I.AA....APF...S......GA----P-L-----CV---KPVT--
B2Q6S1_PROST/4-344-Q.ID--S-IDEL.KAF-----------------I.VN....NPF...K......NV----P-L-----CV---KPIK--
B3G2E4_PSEAI/1-332-T.AR--N-AKEL.IDA-----------------Y.ES....LRV...H......GD----.-V-----CV---KPAV--
D7HVQ0_PSESS/1-332-A.AS--S-AEEL.QAA-----------------Y.DS....LSV...S......GE----.-V-----CI---KPVV--
F3H5H4_PSESX/1-332-A.VS--N-AEEL.QTA-----------------Y.DA....LAV...S......GE----.-V-----CI---KPVV--
F3JPH6_PSESX/1-332-A.VS--N-AEEL.QAA-----------------Y.DA....LAV...S......GE----.-V-----CI---KPVV--
F3I9M2_PSESF/1-332-T.AC--N-TEEL.QAA-----------------Y.DT....LSV...S......GE----.-V-----CI---KPVV--
F3DCN0_9PSED/1-332-A.AS--S-AEEL.QAA-----------------Y.DS....LSV...S......GE----.-V-----CI---KPVV--
F3IYZ7_PSEAP/1-332-A.VS--N-AEEL.QAA-----------------Y.DA....LAV...S......GE----.-V-----CI---KPVV--
E7P0I7_PSESG/1-332-A.AS--S-AEEL.QAA-----------------Y.DS....LSV...S......GE----.-V-----CI---KPVV--
F3FNS0_PSESX/1-332-A.VS--N-AEEL.QAA-----------------Y.DA....LAV...S......GE----.-V-----CI---KPVV--
F3EI09_PSESL/1-332-A.AS--S-AEEL.QAA-----------------Y.DS....LSV...S......GE----.-V-----CI---KPVV--
F3E7Y8_PSESL/1-347-R.SD--L-STSL.NDA-----------------I.SR....ITA.V.G.LGEP.KR----E-A-----CI---KPAR--
F3HNW9_PSEYM/1-332-T.AC--N-AEEL.QAA-----------------Y.AT....LSV...S......GE----.-V-----CI---KPVV--
F3EZH7_9PSED/1-332-A.AS--S-AEEL.QAA-----------------Y.DS....LSV...S......GE----.-V-----CI---KPVV--
F3DP68_9PSED/1-332-T.AC--N-TEEL.QAA-----------------Y.DT....LSV...S......GE----.-V-----CI---KPVV--
F2ZRA0_9PSED/1-332-T.AR--N-ADEL.QAA-----------------Y.EA....LSI...A......GE----.-V-----CV---KPVV--
Q48NB4_PSE14/1-332-A.AS--S-AEEL.QAA-----------------Y.DS....LSV...S......GE----.-V-----CI---KPVV--
Q4ZYB3_PSEU2/1-332-A.VS--N-AEEL.QAA-----------------Y.DA....LAV...S......GE----.-V-----CI---KPVV--
F3K7E1_PSESZ/1-332-A.AS--S-AEEL.QAA-----------------Y.DS....LSV...S......GE----.-V-----CI---KPVV--
F3IPW6_PSESL/1-332-T.AC--N-TEEL.QAA-----------------Y.DA....LSV...S......GE----.-V-----CI---KPVV--
E2MHB3_PSEUB/1-332-T.AC--N-TEEL.QAA-----------------Y.DA....LSV...S......GE----.-V-----CI---KPVV--
Q4FTP6_PSYA2/15-383-R.FD--S-VAEL.EAL-----------------L.AK......H...G......HQ----P-L-----CV---KPVT--
Q1QCQ8_PSYCK/15-383-R.FD--T-VAEL.EAL-----------------L.AT......H...G......HQ----P-L-----CV---KPVT--
F5SQ56_9GAMM/11-404-R.FD--S-LYEL.KAL-----------------L.EE......H...G......HQ----P-L-----CV---KPVT--
A5WBK0_PSYWF/11-370-R.FD--T-VDEL.KQL-----------------I.ET......H...G......HQ----P-L-----CV---KPIS--
G4DVY4_9GAMM/3-340-E.FR--T-ADEF.ETA-----------------Y.AR....LRA...S......HE----V-L-----CV---KPAE--
H8Z6R5_9GAMM/3-341-C.LT--V-ATEF.EPA-----------------Y.AA....LRT...L......HS----R-L-----CV---KPAE--
A9QYJ5_YERPG/4-344-Q.IA--S-PDEL.REW-----------------L.AN....PPF...D......TE----K-L-----CI---KPVT--
A4TRW4_YERPP/4-345-Q.IA--S-PDEL.REW-----------------L.AN....PPF...D......TE----K-L-----CI---KPVT--
D1U1X0_YERPE/1-338-Q.IA--S-PDEL.REW-----------------L.AN....PPF...D......TE----K-L-----CI---KPVT--
A7FNB6_YERP3/4-345-Q.IA--S-PDEL.REW-----------------L.AN....PPF...D......TE----K-L-----CI---KPVT--
B1JNG1_YERPY/4-345-Q.IA--S-PDEL.REW-----------------L.AN....PPF...D......TE----K-L-----CI---KPVT--

PF14398

Q73CW4_BACC1/180-443-T-FQ--H-FEQV-ERF-----------------L-------GTY-----------K----S-I-----YM---KPVH--
YHED_BACSU/178-440-L-TP--S-VELI-DEL-----------------C-------GAY-----------K----K-V-----YI---KPAN--
D4G719_BACNA/90-350-K-VS--R-YEQI-HSF-----------------L-------SKE-----------K----A-C-----IL---KPAF--
Q5L2A9_GEOKA/175-436-A-HV--T-QHTI-EQF-----------------L-------ARY-----------R----E-A-----YI---KPAD--
A9U6Q3_PHYPA/63-329-I-GL--H-IPWE-TWL-----------------E-------HWP-----------M----G-L-----FF---KPLS--
A6TTN9_ALKMQ/120-382-L-YD--S-PDSL-KKM-----------------L-------AIS-----------H----K-V-----YL---KACQ--
Q0AXS1_SYNWW/103-364-C-LF--S-FSNL-EEL-----------------L-------NRY-----------S----E-V-----YL---KPIN--
A9U6Q2_PHYPA/86-348-R-MR--S-ASSL-GAV-----------------L-------RTY-----------P----Y-L-----YL---KPES--
A9U6A9_PHYPA/218-483-L-LR--S-YADL-KSM-----------------A-------PRH-----------P----V-L-----FL---KPER--
C6D8D2_PAESJ/189-456-F-LR--N-YTTL-KSM-----------------C-------SRY-----------G----N-V-----FL---KPSK--
B6YYR2_9RHOB/176-439-R-AP--T-PALL-KKI-----------------L-------GRH-----------H----S-A-----YL---KPVD--
A3I7C7_9BACI/90-348-I-VK--D-ADVF-HKF-----------------I-------NYY-----------K----R-V-----VF---KPID--
C6D2S3_PAESJ/1-246-Q-FT--P-.KGF-ISM-----------------I-------DRY-----------P----V-L-----FV---KPDL--
C6D2S4_PAESJ/84-344-P-VK--D-PSSF-LAF-----------------V-------KKH-----------N----S-V-----ML---KPIN--

PF14403

A8M4T7_SALAI/1-452-E-YN--I-DSSLGGAL-----------------D-------ADTTVRRFVEVYRRRGLTDG-V-----RM---EPAP--
Q02DC9_SOLUE/4-448-Q-YN--A-DSPTGA.A-----------------Y-------ADALADLFWDIPPVKEFRKK-Y-----TL---ARLG--
A5UWI9_ROSS1/2-461-E-YN--G-ESPAAI.A-----------------Y-------EDVLAELFLSLPAMQQFTRT-Y-----AV---TPLP--
A9WAS2_CHLAA/3-460-E-YN--A-ESPAAI.A-----------------Y-------EDLLAQAFLAMPVMQEFAKR-Y-----PI---LPLP--
B8GC89_CHLAD/3-460-E-YN--A-ESPAAI.A-----------------Y-------EDLLAQAFLAMPVMQEFIKR-Y-----PL---LPLP--
A8MKZ9_ALKOO/3-442-E-LN--A-DGSSGM.V-----------------E-------ARELQKIIGESFAVTELKKK-Y-----SL---KDFE--

PF01071

Q20143_CAEEL/100-292-T-VSIEN.VKSL-DCV-----------------F-------ERL----------PW----K-N....SVV---KADG--
PUR2_BACSU/101-293-T-FT..S.FDEA-KAY-----------------V-------QEK----------GA----P-I.....VI---KADG--
PUR2_ARATH/198-392-T-FS..D.ASAA-KEY-----------------I-------QEQ----------GA----P-I.....VI---KADG--
PUR2_MYCLE/101-292-I-VN..S.PARL-DAA-----------------L-------DRF----------GP----P-VGDLSWVV---KDDR--
PUR2_HAEIN/103-296-N-FT..E.VEPA-LTY-----------------L-------REK----------GT----P-I.....VV---KADG--
PUR2_METTH/100-298-V-FS..D.PEEL-REF-----------------M-------EDF----------DS----E-A.....VV---KPVG--
PUR2_SCHPO/109-301-S-FS..N.YDHA-KSF-----------------L-------DTC----------TF----D-V.....VI---KADG--
PUR2_YEAST/108-308-V-FT..N.PEEA-ISF-----------------L-------QAH----------TD----K-A....FVI---KADG--
PUR2_HELPY/105-292-E-TN..D.LKEA-LSY-----------------I-------QNA----------SF----P-L.....VI---K...--
PUR2_ARCFU/109-334-N-FD..N.PEEA-KEY-----------------I-------REK----------FN----N-G....IVV---KADG--
PUR2_METJA/103-304-A-FE..EYGEEL-ESF-----------------I-------DEL----------TE----K-GI..KAVV---KPVG--
PUR2_CHICK/105-298-S-FT..D.PKAA-CSF-----------------I-------NSA----------NF----P-A....LVV---KASG--
PUR2_ECOLI/103-296-N-FT..E.VEPA-LAY-----------------L-------REK----------GA----P-I.....VI---KADG--
PUR2_HUMAN/105-298-A-FT..K.PEEA-CSF-----------------I-------LSA----------DF----P-A....LVV---KASG--
PUR2_MYCTU/101-292-I-VD..S.PAHL-DAA-----------------L-------DRF----------GP----P-AGDPAWVV---KDDR--
PUR2_SYNY3/103-291-T-FT..E.PAPA-QAY-----------------A-------TKM----------GA----P-I.....VV---KADG--
PUR2_YARLI/108-301-N-FT..D.YNKA-VDY-----------------V-------KKV----------GH----R-V.....VI---KASG--
PUR2_DROME/108-301-S-FT..D.TEKA-KAF-----------------I-------RSA----------PY----P-A....LVV---KAAG--
PUR2_CHITE/109-301-S-FI..D.ALKA-KDF-----------------I-------RNT----------PN----A-L.....VV---KASG--

PF08442

MTKA_METEA/2-203-V-AF--S-PDQAVYAA-----------------T--------------------------E-LGGSFWAV---KAQI--
SUCB1_CAEEL/25-233-V-AQ--D-AETAFSEA-----------------K--------------------------R-IGGKDYVV---KAQV--
SUCC2_STRCO/2-191-V-TD--S-PERAREIA-----------------R--------------------------A-LGGRA.VV---KAQV--
SUCC2_ARCFU/2-195-L-AT--S-VEDVRGIA-----------------E--------------------------E-LGGKV.VL---KSQV--
SUCC_HAEIN/2-203-V-CQ--S-VEDVDLVL-----------------A--------------------------Q-LSGGKWAA---KCQV--
SUCC_SHIFL/2-203-A-CT--T-PREAEEAA-----------------S--------------------------K-IGAGPWVV---KCQV--
SUCC_METTH/2-194-V-AE--T-PEEAERIA-----------------A--------------------------E-LGCDV.AV---KSQV--
SUCB2_CAEEL/21-231-V-AS--N-RKEAEEKW-----------------M--------------------------S-FGDHEYVV---KAQI--
SUCC_METJA/2-193-L-VS--K-EDDLNSIN-----------------V--------------------------D-...KEVVL---KAQV--
SUCB2_PIG/40-248-V-AD--T-ANEALEAA-----------------K--------------------------R-LNAKEIVL---KAQI--
SUCC1_ARCFU/2-195-V-AT--S-PEEAEKIA-----------------E--------------------------K-LGGRV.VV---KAQI--
SUCB_NEOFR/29-237-V-AK--T-PEEAYQAA-----------------K--------------------------K-LNTEDLVI---KAQV--
SUCC_CHLPN/2-203-V-VS--S-EEEGELLI-----------------T--------------------------K-SGLDSAVV---KVQV--
SUCC_AQUAE/2-199-V-AF--S-LKEAKEVA-----------------E--------------------------E-LGEFPLVV---KAQI--
SUCB_TRIVA/11-220-V-AR--S-PEEAAEAF-----------------R--------------------------K-MNLPAAVI---KAQV--
SUCC_BACSU/2-203-V-AF--T-AEEAVESA-----------------K--------------------------S-LSSSVYVV---KAQI--
SUCB_YEAST/32-240-P-AF--T-PEEAFEAA-----------------K--------------------------K-LNTNKLVI---KAQA--
SUCB_SCHPO/24-232-P-AR--S-GEEAEKVA-----------------R--------------------------D-LKVTDLVV---KAQV--
SUCC_COXBU/2-204-V-VF--N-PDAAVDAA-----------------A--------------------------K-IGGDRWVV---KAQV--
SUCC_THETH/2-194-V-AY--T-PEEAKRIA-----------------E--------------------------E-FGKRV.VI---KAQV--
SUCC_MYCTU/2-195-V-TD--T-AEGAKAIA-----------------T--------------------------E-IGRPV.MV---KAQV--
SUCC_RICPR/2-203-V-VT--K-TEKINETI-----------------D--------------------------K-LNTKVYVI---KAQI--

PF02655

Q8PZ07_METMA/105-278-...RCYS-SNEP-EAI-----------------.........EY----------------P-V-----IL---KPAT--
O27028_METTH/106-265-LISDPAE-AMEI-VAA-----------------G........EK----------------K-Y-----IA---KPVS--
Q603D9_METCA/124-284-...TRLC-MARP-EPA-----------------.........PD----------------A-M-----VI---KPDD--
Q8PU46_METMA/109-270-......E-IVRE-AEE-----------------.........GK----------------K-Y-----VI---KPRF--
Y776_METJA/124-282-KINNKTQ-LYKF-LEE-----------------.........FK----------------T-C-----IL---KPIY--
Q7UJD2_RHOBA/127-319-AMESNLT-ASEA-RRS-----------------NGIGPIGLDAK----------------R-W-----VR---KPRD--
Q6LZR0_METMP/123-259-.......-...K-TFP-----------------.........VK----------------K-Y-----VV---KNRL--
O29201_ARCFU/107-251-.......-QTSL-RPL-----------------.........DC----------------K-F-----II---KPRT--
O28027_ARCFU/97-247-.......-..EL-LGE-----------------.........GE----------------R-G-----II---KPVV--
Q97H24_CLOAB/105-271-..ITYLR-DEIP-SVI-----------------.........EY----------------P-L-----IV---KPFD--
Q8TQR5_METAC/109-277-......E-IAEW-AEK-----------------.........GK----------------K-Y-----VI---KPRF--
Q6M182_METMP/105-262-LVNNKYQ-FEKC-LSE-----------------.........LK----------------S-V-----VV---KPIS--
Q8TJB8_METAC/125-298-...QCYS-SEEL-DIV-----------------.........EY----------------P-V-----IL---KPSS--
Q7BQQ5_XANAU/119-279-....TFT-LAQA-PDL-----------------.........PG----------------P-R-----IT---KPDD--
O26923_METTH/114-270-.LIGTYE-PEEI-VDV-----------------.........PS----------------R-L-----IV---KPAD--
Q8TZ26_METKA/104-247-.......-....-TRE-----------------.........AD----------------V-M-----VS---KPAD--
Y815_METJA/136-272-.......-...K-TFP-----------------.........PK----------------K-Y-----VV---KKID--
Q8TV12_METKA/118-275-....ETS-EDPS-ELG-----------------.........VE----------------T-L-----VE---KPVR--

PF13549

Q30WE4_DESDG/474-696.VP.DVHA-AVRAAEEM...G.------------Y--------------------------P.V-----AL---KVES..
B5EIR8_GEOBB/481-697.AG.SAAE-AVAAAEVV...G.------------Y--------------------------P.V-----VV---KVDC..
A7HUK1_PARL1/484-706.VS.SASE-AARTADEI...G.------------Y--------------------------P.V-----AL---KILS..
B5W864_SPIMA/500-721.AS.RVEE-ALAAAEAI...G.------------Y--------------------------P.V-----AL---KLLS..
Q1D3M9_MYXXD/505-726.AV.TEDA-AVAEAAAL...G.------------F--------------------------P.V-----VV---KLHS..
A2BJ63_HYPBU/14-235.AR.NEDE-AVEAAERI...G.------------Y--------------------------P.V-----VL---KIVS..
B8GB69_CHLAD/473-695.AH.TPEE-AVAIANEF...G.------------Y--------------------------P.V-----VM---KISS..
A9EVP6_SORC5/499-721.AR.SADE-AVATAGEM...G.------------Y--------------------------P.A-----VL---KLYS..
B7K6U2_CYAP7/499-721.AT.SEEE-AIAIAESM...G.------------Y--------------------------P.V-----VV---KLYS..
Q02CN5_SOLUE/497-719.AV.NAPD-AVKAANEI...G.------------Y--------------------------P.I-----VL---KLYS..
A4U1N9_9PROT/483-706.AG.TPAE-ASRIAKTI...D.------------G--------------------------P.V-----AL---KILS..
Q1YNA3_MOBAS/481-703.AG.DVDG-AVACFEAI...G.------------A--------------------------P.A-----VL---KIVS..
C8X4E1_DESRD/482-705.AL.DDEE-AQLLAWDL...G.------------Y--------------------------P.V-----AL---KAYS..
A6C207_9PLAN/482-704.AR.SAEE-AVQLSQQM...G.------------R--------------------------P.V-----VL---KVYS..
Q2W464_MAGSA/483-705.AR.SPAL-AGKIAMAM...K.------------V--------------------------P.V-----AL---KILS..
B8CEH1_THAPS/525-748.AC.TAEE-AALAADGV...G.------------Y--------------------------P.V-----VV---KINS..
C1DBF7_LARHH/480-702.AR.TSAE-AVAYAEEF...G.------------Y--------------------------P.V-----VL---KIDS..
B4D2X3_9BACT/490-711.AH.TENA-AVNRAQRL...G.------------Y--------------------------P.V-----VV---KVYS..
Q2LRG1_SYNAS/43-258.AG.SEDE-AVEMSNKL...G.------------Y--------------------------P.V-----VL---KIVS..
A3ZSV0_9PLAN/482-704.AW.SKND-AVILAERL...G.------------Y--------------------------P.V-----VM---KIFS..
D2R7V1_PIRSD/482-704.AS.TAAQ-AVEVARQL...G.------------Y--------------------------P.V-----VL---KVLS..
A8I025_AZOC5/478-700.AA.SPAE-AADLAAAF...G.------------G--------------------------P.V-----AL---KILS..
Q1QYL0_CHRSD/482-704.AR.TPEE-ASQAAQRL...G.------------F--------------------------P.V-----VL---KILS..
Q0W5Z5_UNCMA/472-693.VD.SADK-AVATAKEF...G.------------Y--------------------------P.V-----VM---KIVS..
Q12E86_POLSJ/490-712.AR.DVEE-AVAAASRI...G.------------Y--------------------------P.V-----VL---KIVS..
Q8PZJ9_METMA/26-247.AK.TEEE-AVKAAEEM...G.------------Y--------------------------P.L-----VM---KVVS..
D5CS41_SIDLE/485-707.AH.SPGE-ALLIAQQL...G.------------F--------------------------P.V-----AM---KVNS..
Q223I3_RHOFD/478-701.IRATAAA-AVKAALTI...G.------------F--------------------------P.V-----VL---KILS..
A2SHI2_METPP/474-697.VDASADA-AEDAARTL...G.------------Y--------------------------P.V-----AL---KIRS..
B0CB03_ACAM1/496-716.AQ.TPEQ-AVAFAETL...G.------------Y--------------------------P.V-----VL---KLHS..
B1XHT3_SYNP2/500-722.AS.TPEM-AIALADEI...G.------------Y--------------------------P.V-----VL---KLLS..
B9Z1Z5_9NEIS/480-702.AR.DSDE-AVRLAEET...G.------------Y--------------------------P.V-----VL---KIDS..
A9B7A3_HERA2/473-695.SR.SPEE-AAEIAKEI...G.------------F--------------------------P.V-----VM---KISS..
A5V1W2_ROSS1/474-696.AQ.SPEE-AAEIAAHL...G.------------F--------------------------P.V-----VM---KISS..
B9MJF1_ACIET/473-695.AR.SSHE-AMMIATQL...G.------------F--------------------------P.V-----AL---KIDS..
Q7NLP6_GLOVI/494-729.AA.DEEA-AVAAAGAI...G.------------Y--------------------------P.V-----VV---KLHS..
C9R913_AMMDK/477-698.AQ.RAAE-AVAIAAEY...G.------------Y--------------------------P.V-----VL---KVAS..
Q1Q1N5_9BACT/475-697.AT.SETG-AVKAAEEM...G.------------Y--------------------------P.V-----VM---KISS..
D6Z2N4_DESAT/474-696.AT.TADE-AVEAAQRV...G.------------F--------------------------P.V-----AM---KVVS..
Q0KA53_CUPNH/481-703.AA.SVDE-AVGQATRI...G.------------Y--------------------------P.V-----AL---KILS..
E3HYZ8_RHOVT/480-705.AR.TPEE-AGEAAAELL.RK.------------S--------------------------PSV-----VV---KILS..
A1K623_AZOSB/482-704.AR.SATE-AMVLAEEI...G.------------L--------------------------P.V-----VM---KIDS..
B8GPY5_THISH/486-708.AR.TPAE-ALVAASTL...G.------------Y--------------------------P.L-----AM---KIAS..
Q2LUQ3_SYNAS/506-727.TS.SVEE-AVTVAGQI...G.------------Y--------------------------P.V-----VI---KIVS..
Q47CI3_DECAR/482-704.AR.TATE-ALLLAEQI...G.------------F--------------------------P.I-----AM---KVDS..
A1RXS7_THEPD/479-701.AK.SPEE-AVRIAREI...G.------------Y--------------------------P.V-----VL---EVES..
B5IPC9_9CHRO/514-740.AA.TAAE-ACAAAEAI...G.------------Y--------------------------P.V-----VL---KLNS..
Q6MAV5_PARUW/501-722.AK.NAAE-AVKLADQF...G.------------Y--------------------------P.V-----VL---KLFS..
C6C1C2_DESAD/472-693.AR.SGDE-AVAIAEQL...G.------------Y--------------------------P.V-----VL---KIAS..
Q8DJG8_THEEB/495-717.AR.SEAE-AVAAADRL...G.------------Y--------------------------P.V-----VL---KLYS..
B0UM89_METS4/27-247.AT.SAQD-AVRAAESM...G.------------F--------------------------P.V-----VL---KIVS..
A8ZZJ4_DESOH/481-703.AE.TPEQ-AVAIAKEM...G.------------Y--------------------------P.V-----VM---KIVS..
Q92Z73_RHIME/480-705.AT.SPKE-AEAIAGLLL.AG.------------A--------------------------PKL-----VV---KLIS..
Q7NRV4_CHRVO/480-702.AR.TADQ-AVKQAAKI...G.------------Y--------------------------P.V-----VL---KIDS..
Q2Y8E7_NITMU/478-700.AR.SPAE-ALLIAQQL...G.------------F--------------------------P.V-----VM---KINS..
Q6AQI6_DESPS/472-694.VD.SADE-AVEYARRI...G.------------F--------------------------P.V-----AL---KVVS..
Q3SEU0_THIDA/481-703.AR.DPME-AMLTAQQI...G.------------F--------------------------P.V-----AM---KINS..
D0L1W1_HALNC/488-710.AR.DADE-AMLAAESL...G.------------F--------------------------P.V-----AL---KISA..
A1VIA4_POLNA/472-694.AR.SATE-AMMIATQL...G.------------F--------------------------P.V-----AL---KIDS..
O29057_ARCFU/463-681.AR.NVDE-ARDIAESI...G.------------Y--------------------------P.V-----VL---KVVS..
B8HP40_CYAP4/501-729.AT.SVGA-AVAQAEQL...G.------------Y--------------------------P.V-----VL---KLLS..
C4ZP31_THASP/482-704.AR.SAAE-AMVLSAEI...G.------------L--------------------------P.V-----VM---KIDS..
C7RIF7_ACCPU/482-704.AH.TPTE-SLLLAEQI...G.------------F--------------------------P.I-----GM---KIDS..
B9B8Y3_9BURK/493-714.AA.TPDE-AAQAASAM...R.------------F--------------------------P.L-----VV---KIAS..
B5HI28_STRPR/17-237.AE.TADE-AVALADRI...G.------------F--------------------------P.V-----AM---KIVS..
C7NV33_HALUD/473-693.VS.DKNA-AVEAAKDI...P.------------G--------------------------N.V-----VM---KIVS..
Q13N88_BURXL/472-694.AH.NANE-AMLIASQI...G.------------Y--------------------------P.V-----AL---KIDS..
A5D252_PELTS/478-700.TT.TPEE-AVAVAEKM...G.------------Y--------------------------P.V-----VL---KVAS..
D2PSA1_KRIFD/14-237.AT.TAEE-AASLAAGI...G.------------F--------------------------P.V-----VL---KIVS..
Q89QG9_BRAJA/95-315.AR.SAGE-AGKMAASM...G.------------F--------------------------P.V-----VM---KIVS..
Q2LV27_SYNAS/9-227.AK.DENE-AVMTASQI...G.------------F--------------------------P.V-----AL---KVSS..
A7BXB1_9GAMM/467-693.AH.TANE-ALVLAEAM...G.------------F--------------------------P.I-----AM---KVNS..
B9TF03_RICCO/23-245.AA.TAQD-VARICADL...A.------------P--------------------------P.Y-----AV---KIVS..
A5D1F4_PELTS/478-699.SS.SPEE-AAGQADKI...G.------------Y--------------------------P.V-----VL---KIAS..
B8FK52_DESAA/483-704.AT.SPEE-VKPIMDEL...G.------------T--------------------------P.V-----VM---KIIS..
E8YSP4_9BURK/36-256.AT.TAAE-AAQFATEI...G.------------F--------------------------P.V-----VL---KIVS..
C9ZD67_STRSW/15-235.AR.DVDE-AVSFAARF...G.------------G--------------------------P.V-----VM---KIVS..
Q2LPY3_SYNAS/483-704.AG.TLEE-ALSLAKEI...G.------------Y--------------------------P.V-----VI---KIAS..
C0GKL8_9FIRM/479-700.AT.SPEE-AAELADKL...G.------------Y--------------------------P.A-----VL---KVAS..
D4GVH7_HALVD/472-692.VD.DPAD-ALEVAEDI...D.------------G--------------------------N.V-----VM---KIVS..
C0QHK1_DESAH/488-708.AL.SEDQ-AVEMANQM...N.------------G--------------------------A.V-----VL---KIVS..
A5FQG4_DEHSB/106-328.AR.DAKD-AAQIASAL...R.------------F--------------------------P.V-----VM---KIAS..
B4RED1_PHEZH/481-703.VR.DPTQ-AGEAAEAL...G.------------G--------------------------P.V-----AL---KILS..
Q9HQZ0_HALSA/317-537.VD.SPDA-ARRVARDI...E.------------G--------------------------D.V-----VM---KIVS..
C0QJ02_DESAH/490-712.AK.TAKE-AIALASEM...K.------------Y--------------------------P.V-----VM---KIAS..
Q7W8F6_BORPA/17-239.LP.ADAS-FAQVEGQL...A.------------Q--------------------------P.Y-----VL---KLVS..
C0QHB0_DESAH/487-709.AS.SPEA-AAGLAETI...G.------------G--------------------------P.T-----AL---KIVS..
Q1LF49_RALME/14-234.AR.SPTG-AVELASKM...G.------------Y--------------------------P.V-----VL---KIVS..
D3STG0_NATMM/473-693.VD.DPAR-AREVAEAI...E.------------G--------------------------D.V-----VM---KIVS..
E6VV76_DESAO/485-707.AR.SAKE-AVIAADEL...G.------------Y--------------------------P.V-----AI---KLRS..
B1T453_9BURK/492-715.AR.TPQE-ALGAFREL...GA------------V--------------------------P.V-----AM---KVVS..
A4J695_DESRM/478-699.AI.TPEE-AISLADTM...G.------------Y--------------------------P.V-----VL---KIAS..
A5D034_PELTS/478-700.AT.SPRE-AAEVAEKM...G.------------F--------------------------P.V-----VL---KVAS..
A3VE72_9RHOB/482-704.AE.TAAE-ALVAASSV...G.------------F--------------------------P.V-----AM---KISS..
Q64CH5_9ARCH/12-232.ID.ELAD-VALKSKEI...T.------------P--------------------------P.L-----VL---KVVS..
A4YYL2_BRASO/483-708.AS.SVDE-AVAYANQLFAQG.------------A--------------------------T.V-----VL---KILS..