Sequence alignment for CL0179

PF08442

MTKA_METEA/2-203--------------------------------------------------------------------------------
SUCB1_CAEEL/25-233--------------------------------------------------------------------------------
SUCC2_STRCO/2-191--------------------------------------------------------------------------------
SUCC2_ARCFU/2-195--------------------------------------------------------------------------------
SUCC_HAEIN/2-203--------------------------------------------------------------------------------
SUCC_METTH/2-194--------------------------------------------------------------------------------
SUCB2_CAEEL/21-231--------------------------------------------------------------------------------
SUCC_METJA/2-193--------------------------------------------------------------------------------
SUCB2_PIG/40-248--------------------------------------------------------------------------------
SUCC1_ARCFU/2-195--------------------------------------------------------------------------------
SUCC_AQUAE/2-199--------------------------------------------------------------------------------
SUCC_BACSU/2-203--------------------------------------------------------------------------------
SUCB_YEAST/32-240--------------------------------------------------------------------------------
SUCB_SCHPO/24-232--------------------------------------------------------------------------------
SUCC_COXBU/2-204--------------------------------------------------------------------------------
SUCC_RICPR/2-203--------------------------------------------------------------------------------
A2EBX0_TRIVA/11-220--------------------------------------------------------------------------------
SUCC_ECOLI/2-203--------------------------------------------------------------------------------
SUCC_MYCTU/2-194--------------------------------------------------------------------------------
Q5SKV5_THET8/15-207--------------------------------------------------------------------------------

PF13549

Q30WE4_DESAG/474-696--------------------------------------------------------------------------------
B5EIR8_GEOBB/481-697--------------------------------------------------------------------------------
A7HUK1_PARL1/484-706--------------------------------------------------------------------------------
Q1D3M9_MYXXD/505-726--------------------------------------------------------------------------------
A2BJ63_HYPBU/14-235--------------------------------------------------------------------------------
A9EVP6_SORC5/499-721--------------------------------------------------------------------------------
B7K6U2_CYAP7/499-721--------------------------------------------------------------------------------
Q02CN5_SOLUE/497-719--------------------------------------------------------------------------------
C8X4E1_DESRD/482-705--------------------------------------------------------------------------------
Q2W464_MAGSA/483-705--------------------------------------------------------------------------------
B8CEH1_THAPS/525-748--------------------------------------------------------------------------------
C1DBF7_LARHH/480-702--------------------------------------------------------------------------------
Q2LRG1_SYNAS/43-258--------------------------------------------------------------------------------
D2R7V1_PIRSD/482-704--------------------------------------------------------------------------------
A8I025_AZOC5/478-700--------------------------------------------------------------------------------
Q1QYL0_CHRSD/482-704--------------------------------------------------------------------------------
Q0W5Z5_UNCMA/472-693--------------------------------------------------------------------------------
Q12E86_POLSJ/490-712--------------------------------------------------------------------------------
D5CS41_SIDLE/485-707--------------------------------------------------------------------------------
Q223I3_ALBFT/478-701--------------------------------------------------------------------------------
A2SHI2_METPP/474-697--------------------------------------------------------------------------------
B0CB03_ACAM1/496-716--------------------------------------------------------------------------------
B1XHT3_SYNP2/500-722--------------------------------------------------------------------------------
A9B7A3_HERA2/473-695--------------------------------------------------------------------------------
A5V1W2_ROSS1/474-696--------------------------------------------------------------------------------
Q7NLP6_GLOVI/494-729--------------------------------------------------------------------------------
C9R913_AMMDK/477-698--------------------------------------------------------------------------------
D6Z2N4_DESAT/474-696--------------------------------------------------------------------------------
Q0KA53_CUPNH/481-703--------------------------------------------------------------------------------
E3HYZ8_RHOVT/480-705--------------------------------------------------------------------------------
A1K623_AZOSB/482-704--------------------------------------------------------------------------------
B8GPY5_THISH/486-708--------------------------------------------------------------------------------
Q2LUQ3_SYNAS/506-727--------------------------------------------------------------------------------
Q47CI3_DECAR/482-704--------------------------------------------------------------------------------
A1RXS7_THEPD/479-701--------------------------------------------------------------------------------
Q6MAV5_PARUW/501-722--------------------------------------------------------------------------------
C6C1C2_DESAD/472-693--------------------------------------------------------------------------------
Q8DJG8_THEEB/495-717--------------------------------------------------------------------------------
B0UM89_METS4/27-247--------------------------------------------------------------------------------
A8ZZJ4_DESOH/481-703--------------------------------------------------------------------------------
Q92Z73_RHIME/480-705--------------------------------------------------------------------------------
Q7NRV4_CHRVO/480-702--------------------------------------------------------------------------------
Q2Y8E7_NITMU/478-700--------------------------------------------------------------------------------
Q6AQI6_DESPS/472-694--------------------------------------------------------------------------------
Q3SEU0_THIDA/481-703--------------------------------------------------------------------------------
D0L1W1_HALNC/488-710--------------------------------------------------------------------------------
A1VIA4_POLNA/472-694--------------------------------------------------------------------------------
O29057_ARCFU/463-681--------------------------------------------------------------------------------
B8HP40_CYAP4/501-729--------------------------------------------------------------------------------
C4ZP31_THASP/482-704--------------------------------------------------------------------------------
C7RIF7_ACCPU/482-704--------------------------------------------------------------------------------
B5HI28_STRPR/17-237--------------------------------------------------------------------------------
Q13N88_BURXL/472-694--------------------------------------------------------------------------------
A5D252_PELTS/478-700--------------------------------------------------------------------------------
D2PSA1_KRIFD/14-237--------------------------------------------------------------------------------
Q89QG9_BRADU/95-315--------------------------------------------------------------------------------
Q2LV27_SYNAS/9-227--------------------------------------------------------------------------------
B9TF03_RICCO/23-245--------------------------------------------------------------------------------
A5D1F4_PELTS/478-699--------------------------------------------------------------------------------
B8FK52_DESAA/483-704--------------------------------------------------------------------------------
C9ZD67_STRSW/15-235--------------------------------------------------------------------------------
Q2LPY3_SYNAS/483-704--------------------------------------------------------------------------------
D4GVH7_HALVD/472-692--------------------------------------------------------------------------------
C0QHK1_DESAH/488-708--------------------------------------------------------------------------------
B4RED1_PHEZH/481-703--------------------------------------------------------------------------------
Q9HQZ0_HALSA/317-537--------------------------------------------------------------------------------
C0QJ02_DESAH/490-712--------------------------------------------------------------------------------
C0QHB0_DESAH/487-709--------------------------------------------------------------------------------
Q1LF49_RALME/14-234--------------------------------------------------------------------------------
D3STG0_NATMM/473-693--------------------------------------------------------------------------------
E6VV76_DESAO/485-707--------------------------------------------------------------------------------
A4J695_DESRM/478-699--------------------------------------------------------------------------------
A5D034_PELTS/478-700--------------------------------------------------------------------------------
A4YYL2_BRASO/483-708--------------------------------------------------------------------------------
A4SW96_POLSQ/471-693--------------------------------------------------------------------------------
A7MH14_CROS8/473-695--------------------------------------------------------------------------------
Q988U3_RHILO/480-705--------------------------------------------------------------------------------
D7AUW7_NOCDD/22-244--------------------------------------------------------------------------------
B1I353_DESAP/478-699--------------------------------------------------------------------------------
A0B6M1_METTP/11-226--------------------------------------------------------------------------------
Q20Z65_RHOPB/482-707--------------------------------------------------------------------------------
Q604W6_METCA/481-703--------------------------------------------------------------------------------
Q3IQS4_NATPD/472-692--------------------------------------------------------------------------------
Q2NFU6_METST/479-700--------------------------------------------------------------------------------
C6BU19_DESAD/485-707--------------------------------------------------------------------------------
A0LJP9_SYNFM/480-702--------------------------------------------------------------------------------
Q0A9U7_ALKEH/468-689--------------------------------------------------------------------------------
C0QAQ8_DESAH/481-702--------------------------------------------------------------------------------
A5D530_PELTS/478-699--------------------------------------------------------------------------------
D2U861_XANAP/477-702--------------------------------------------------------------------------------
Q11G56_CHESB/480-705--------------------------------------------------------------------------------
B8DM77_DESVM/483-705--------------------------------------------------------------------------------
Q7N786_PHOLL/472-694--------------------------------------------------------------------------------
Q1QM20_NITHX/483-708--------------------------------------------------------------------------------
Q2W7Y3_MAGSA/500-722--------------------------------------------------------------------------------
E3I048_RHOVT/473-695--------------------------------------------------------------------------------
B1LZ43_METRJ/472-697--------------------------------------------------------------------------------
D3RU01_ALLVD/481-703--------------------------------------------------------------------------------
Q3AFE8_CARHZ/490-711--------------------------------------------------------------------------------
B8FE80_DESAA/10-226--------------------------------------------------------------------------------
C7LTU8_DESBD/481-703--------------------------------------------------------------------------------
B8FIX8_DESAA/9-225--------------------------------------------------------------------------------
Q12WB1_METBU/472-693--------------------------------------------------------------------------------
B2FMM9_STRMK/482-707--------------------------------------------------------------------------------
D3V3Z2_XENBS/472-694--------------------------------------------------------------------------------
B8IED3_METNO/488-713--------------------------------------------------------------------------------
E6WFR2_PANSA/472-694--------------------------------------------------------------------------------
C4ZKF4_THASP/487-709--------------------------------------------------------------------------------
A1S6F9_SHEAM/486-708--------------------------------------------------------------------------------
A3QEK7_SHELP/486-708--------------------------------------------------------------------------------
C0QFL6_DESAH/13-229--------------------------------------------------------------------------------
Q4XQ92_PLACH/180-403--------------------------------------------------------------------------------
Q1QWA2_CHRSD/486-716--------------------------------------------------------------------------------
B4EUX9_PROMH/472-694--------------------------------------------------------------------------------
A1WTN4_HALHL/467-689--------------------------------------------------------------------------------
O28761_ARCFU/667-877--------------------------------------------------------------------------------
D3PVJ8_STANL/666-881--------------------------------------------------------------------------------
Q082P1_SHEFN/486-708--------------------------------------------------------------------------------
D3FEQ9_CONWI/670-890--------------------------------------------------------------------------------
A1RWD9_THEPD/9-229--------------------------------------------------------------------------------
B8CM86_SHEPW/486-708--------------------------------------------------------------------------------
B9M8K3_GEODF/479-695--------------------------------------------------------------------------------
B3LBB6_PLAKH/551-775--------------------------------------------------------------------------------
C4XLT1_DESMR/479-701--------------------------------------------------------------------------------
A4FCG4_SACEN/661-877--------------------------------------------------------------------------------
C5B797_EDWI9/472-694--------------------------------------------------------------------------------
Q12N16_SHEDO/486-708--------------------------------------------------------------------------------
Q3IFA9_PSEHT/480-701--------------------------------------------------------------------------------
E6VZV8_DESAO/478-699--------------------------------------------------------------------------------
C6C0V7_DESAD/480-701--------------------------------------------------------------------------------
A0KEL7_AERHH/447-666--------------------------------------------------------------------------------
Q2NRP0_SODGM/472-694--------------------------------------------------------------------------------
Q47QC0_THEFY/653-870--------------------------------------------------------------------------------
C8X6G7_NAKMY/699-910--------------------------------------------------------------------------------
Q8IL89_PLAF7/540-763--------------------------------------------------------------------------------
B5YGW4_THEYD/482-700--------------------------------------------------------------------------------
B1VXP6_STRGG/739-955--------------------------------------------------------------------------------
A4FAM1_SACEN/663-876--------------------------------------------------------------------------------
D1BG29_SANKS/695-919--------------------------------------------------------------------------------
O50516_STRCO/806-1022--------------------------------------------------------------------------------
C7LRJ9_DESBD/471-692--------------------------------------------------------------------------------
C5C5J4_BEUC1/666-884--------------------------------------------------------------------------------
C5BNQ0_TERTT/484-704--------------------------------------------------------------------------------
C6WAF3_ACTMD/668-881--------------------------------------------------------------------------------
C4ZP63_THASP/474-692--------------------------------------------------------------------------------
A8B3P9_GIAIC/94-343--------------------------------------------------------------------------------
Q2SCW5_HAHCH/482-712--------------------------------------------------------------------------------
A8B4I3_GIAIC/26-275--------------------------------------------------------------------------------
A1R5M2_ARTAT/645-861--------------------------------------------------------------------------------
A6W895_KINRD/666-883--------------------------------------------------------------------------------
A5FUU0_ACICJ/447-667--------------------------------------------------------------------------------
E3IU41_FRASU/495-709--------------------------------------------------------------------------------
A2F811_TRIVA/22-271--------------------------------------------------------------------------------
C7RR50_ACCPU/477-694--------------------------------------------------------------------------------
A1W7H4_ACISJ/481-702--------------------------------------------------------------------------------
A5UN98_METS3/478-698--------------------------------------------------------------------------------
A9WDH8_CHLAA/474-695--------------------------------------------------------------------------------
B7VRZ9_VIBSL/486-706--------------------------------------------------------------------------------
C0ZYS6_RHOE4/678-886--------------------------------------------------------------------------------
C5AV44_METEA/480-704--------------------------------------------------------------------------------
D4ZKT1_SHEVD/490-708--------------------------------------------------------------------------------
D5A1V4_ARTPN/500-721--------------------------------------------------------------------------------
E0SDH6_DICD3/473-694--------------------------------------------------------------------------------
F7PKW5_9EURY/446-663--------------------------------------------------------------------------------
G2IXU4_PSEUL/481-702--------------------------------------------------------------------------------
G8PQP7_PSEUV/483-707--------------------------------------------------------------------------------
I0DX01_PROSM/473-695--------------------------------------------------------------------------------
M1FE38_9ALTE/482-712--------------------------------------------------------------------------------
Q6LIT6_PHOPR/492-712--------------------------------------------------------------------------------
Q6N212_RHOPA/482-707--------------------------------------------------------------------------------
Q726Y6_DESVH/483-698--------------------------------------------------------------------------------
Q88GJ8_PSEPK/476-696--------------------------------------------------------------------------------
Q8P3T1_XANCP/482-706--------------------------------------------------------------------------------
V6F1Q9_9PROT/484-706--------------------------------------------------------------------------------

PF15632

A5WBK0_PSYWF/12-367.VWLAEGQSSQRDMLQSLQQLKRRSITPFEVIASHRS..QRPEIFEFADHVFIEPSVKQEQQSGLA..........RWQF
A7MPT7_CROS8/12-350KIWFMEGLSSQRDIIQGVKSFAQKNNFAITVFASHRS..ERNEILSVADYSLTEPE...DPQR.............RLQF
C0Z9Z4_BREBN/4-333RIWFNRTFATAYPIVEMIR..NNPDNFTFEIYVTHPK..RHSVMLQIADYAELEPT..LDVPE.............YIDY
F9Z982_ODOSD/8-339VIVTGAGAPGIQGTLYSLK..QNYDNRSFHVIGTDIN..DFVVGKYLCDEFCVISP.AKKEEE.............YLSD
I3YAU9_THIV6/3-337RVWFNRTFSNVRAVFDLVR..QGDEAGEFHLVCSHTQ..KEFPGFLSAHEFALEPT.GTVGEA.............YLDF
A8KXY8_FRASN/5-351RLWFNQTWRGTYQLIGLLR..DGAGPGRLTVLGSHQI..PSTPFLQACDAVIDEPP..GEGDE.............FVEQ
W0LEM0_SERFO/4-342KIWLLEGLSSQRDIIQGIVSFAKNQQAAVTVIASHRH..ERNEILSQADKALSEPK...EDEH.............RLPF
F2JJ82_CELLD/4-341RIWVNQWFSTMYQIIKQLREGAEAEGLSLHIIGTSTN..QNVVYQKVCDEFWEEPKKGISPED.............YVEW
F8A3W6_CELGA/3-315VLVTGAGGAAGVAVIRSLL.....RRGDVDVLAADMDRWAAGIYLVPAEHRRLVPP..GKAEH.............FMDS
U5N6U2_9BURK/2-337RVWFNKTFSLVHTALRLLR..TADPDQTFTLLASHPN..PDAIVRLAADEFSPEPP.GQGGAE.............YVDW
E8U3T8_DEIML/7-342RLYFNKNFAVTTAQIKAVN.....AGGRYVTLASHSD..PEHPMLHAAHEALTEPR.GLLGDA.............YVDW
C9LVE5_SELS3/2-335RIWFNQWFSTAYHLIELMR..AGSPG.KFTFVGSSAN..PNALYRLVSDEWYTEPA.LPVSDE.............YVEY
Q7CKQ4_YERPE/4-342NIWFMGGLSSQRDIISGVKNTSELHGNAIQVFASHHQ..HRYEILEKADVAFIEPS...DLDT.............KMAF
R6L1S2_9BACE/13-342.LVTGAGAPGIQGTVYSLK..TNYDSRELYIIGTDIK..DFVVGKYLCDEFYTISP.AKNVQN.............YISD
E3EE70_PAEPS/5-337KVYFNRWFSVVYHYMNAIR..NNEDGIPFEIYATHSD..PQHMALQASDVAEVEPR..TSGVE.............YAQF
B5HSJ5_9ACTO/6-337RVWLNRTYAENVFFMDQLR..RNPSDRAVEIHATHGD..ADSPVLAAADTAELEPE.GLSPAA.............YVEF
H8GG73_METAL/2-335RIWFNKTFSTIGAVFRQLK..AGYPDDGITLVCTHTH..RTATAFLAADEAYLEPS.ELHGQE.............YIDW
Q6FAX4_ACIAD/20-348.IWFTQAHSCQRDLILAAK..NAPFNLPIHVVASHAD..DRPEITSVADIALQEPP....FSE.............RVEW
Q2RVZ8_RHORT/2-333KVWFNRGLSNTYDALTIIR..AADHAGAFGLLASHSD..ETNAVGKAADTFFVEPA.GLEDDA.............YGAW
I0DSI2_PROSM/4-341KIWFMEGLSSQRDLIQGAREFAQQQLKNITIFASHRH..ARNEILSQADYARLEPE...DSTE.............RLAF
J7IZM6_DESMD/16-343RIYFNRCFSSTHKIIQRFL..ADNNSQKYELYISHVS..PNIYLEEIADYFEVEPA..IDGKD.............YADY
C9ZBJ4_STRSW/6-337RVWLNRTYAENVFFMDQLR..HNPHARPVDIHATHGD..ADSPVLAAADTADLEPE.GLSPAA.............YVEY
D1BH78_SANKS/2-339NIWLNRTYATNYWFLQMLR..SNPDGTPVRLFATHTD..ETSPVLQAADVTEIEPA..LTGDA.............YVDW
J7U1Y0_MORMO/5-342.IWLTEGLSSQRDLIRNIRLFAQTLQVDLTIFASHRQ..PRHEILSEADFSLTEPA...DENE.............RLAF
Q4FTP6_PSYA2/16-380.VWLAEGQSSQRDMLASLQALKSQSNTPFTIIASHRH..NRPEIFEFADIVYREPSVTATDSDEQAIIESVETLIPRWEF
Q888T3_PSESM/1-329MIWFLEGQSSQREVIIGAR...DALPASVKIIASHRQ..QRSEITGQADVALQEPI...DNEE.............RIDW
B8GGE3_METPE/6-335VLVTGAGAPGIKGTLYSLR..ENFDQRTIRTIGTDIK..PEVIGTYLCDRYYRISR..PSQAD.............YLDQ
D1BIK1_SANKS/4-313VLVTGTGGPAGVAVVRSLL.....RRDDVEVFSADMDGWASGLYLVDADHRRIVPR..GAAPE.............FVDT
U5LE31_9BACI/6-343KIWFNRWFTTVSHYITMIK..NNPDNRSFTVYGTHPD..KDALYLQVCDFKGTEPD..ISGEE.............YILF
D7DRZ5_METV3/6-343VLITGAGAPGIAGSLYSLR..NNYDNRKLNIIGTDVK..EDTIGKYLCDKTLKVPY.PQDETE.............FINE
Q5NWT2_AROAE/3-338RVWFNKTFSSVHSALSLIR..KGDAEARYRLLCSHPN..PQSLALLAADDAATEPS.GLTGEA.............YVGW
Q9RSB2_DEIRA/9-335RVLFTKNFSVTSAQIRALE......DSPYEVWASHSD..PHHGMLAAAPHTLTEPR.GLLGDD.............YVAW

PF13535

B6B6A2_9RHOB/129-318--------------------------------------------------------------------------------
B0NR58_BACSE/114-290--------------------------------------------------------------------------------
B9DMB9_STACT/529-710--------------------------------------------------------------------------------
C0WVD3_LACFE/116-306--------------------------------------------------------------------------------
C1F6E3_ACIC5/100-273--------------------------------------------------------------------------------
C4FBF5_9ACTN/118-307--------------------------------------------------------------------------------
C7N331_SLAHD/459-648--------------------------------------------------------------------------------
Q3A6W8_PELCD/114-298--------------------------------------------------------------------------------
D1C2W8_SPHTD/155-337--------------------------------------------------------------------------------
Q0ACF5_ALKEH/120-296--------------------------------------------------------------------------------
A3CVX7_METMJ/109-278--------------------------------------------------------------------------------
B8GVA8_THISH/116-296--------------------------------------------------------------------------------
A5G3Z6_GEOUR/110-292--------------------------------------------------------------------------------
Q3S8Y0_PSESH/109-293--------------------------------------------------------------------------------
B5XPP6_KLEP3/106-292--------------------------------------------------------------------------------
Q5WS01_LEGPL/99-278--------------------------------------------------------------------------------
Q5WSD6_LEGPA/104-283--------------------------------------------------------------------------------
Q7N5R8_PHOLL/91-265--------------------------------------------------------------------------------
D4GMV9_PANAM/88-261--------------------------------------------------------------------------------
N8ZXH9_ACIBI/125-307--------------------------------------------------------------------------------
B2Q6S1_PROST/113-295--------------------------------------------------------------------------------
Q48NB4_PSE14/107-288--------------------------------------------------------------------------------
E7FN57_9LACO/100-280--------------------------------------------------------------------------------
B2E5U2_STREE/105-289--------------------------------------------------------------------------------
Q1QXJ8_CHRSD/106-286--------------------------------------------------------------------------------
A7N2D3_VIBCB/102-283--------------------------------------------------------------------------------
D2QAU0_BIFDB/128-311--------------------------------------------------------------------------------
A7NRD0_ROSCS/111-286--------------------------------------------------------------------------------
C5NY10_9BACL/132-310--------------------------------------------------------------------------------
C5NXU5_9BACL/109-287--------------------------------------------------------------------------------
A3CN29_STRSV/109-286--------------------------------------------------------------------------------
A0A034V0G1_ERWAM/99-280--------------------------------------------------------------------------------
C6WFN8_ACTMD/117-298--------------------------------------------------------------------------------
D9TNI3_THETC/106-294--------------------------------------------------------------------------------
A7N6T3_VIBCB/145-320--------------------------------------------------------------------------------
S0AIU0_SERPL/113-299--------------------------------------------------------------------------------
D3DDW6_9ACTO/102-274--------------------------------------------------------------------------------
Q01ZL3_SOLUE/109-290--------------------------------------------------------------------------------
C6W4G0_DYAFD/113-294--------------------------------------------------------------------------------
D7W254_9FLAO/112-293--------------------------------------------------------------------------------
D7VTF5_9SPHI/110-291--------------------------------------------------------------------------------
D9T7Z5_MICAI/109-288--------------------------------------------------------------------------------
E8RY18_MICSL/111-299--------------------------------------------------------------------------------
D0FMQ8_ERWPE/108-286--------------------------------------------------------------------------------
F3IMV4_PSESL/114-292--------------------------------------------------------------------------------
H3RK27_PANSE/114-292--------------------------------------------------------------------------------
A0A034UUS3_ERWAM/114-292--------------------------------------------------------------------------------
F3IMV3_PSESL/112-290--------------------------------------------------------------------------------
A0A034US15_ERWAM/112-290--------------------------------------------------------------------------------
Q0RGQ9_FRAAA/107-286--------------------------------------------------------------------------------
B5SP77_9ACTO/100-278--------------------------------------------------------------------------------
B4VDU1_9ACTO/110-294--------------------------------------------------------------------------------
Q0SCF9_RHOSR/101-280--------------------------------------------------------------------------------
D5WN11_BURSC/115-291--------------------------------------------------------------------------------
B1HFG7_BURPE/117-293--------------------------------------------------------------------------------
D0FNI3_ERWPE/106-290--------------------------------------------------------------------------------
Q0S8A9_RHOSR/103-283--------------------------------------------------------------------------------
Q12II4_SHEDO/108-288--------------------------------------------------------------------------------
B9B6B5_9BURK/104-287--------------------------------------------------------------------------------
Q1JXP0_DESAC/85-278--------------------------------------------------------------------------------
C6BWA6_DESAD/85-278--------------------------------------------------------------------------------
Q8TPB8_METAC/85-278--------------------------------------------------------------------------------
C0QL65_DESAH/85-278--------------------------------------------------------------------------------
Q3A2P7_PELCD/85-278--------------------------------------------------------------------------------
B8J4T0_DESDA/96-289--------------------------------------------------------------------------------
E6VR59_DESAO/87-280--------------------------------------------------------------------------------
D5WN64_BURSC/107-292--------------------------------------------------------------------------------
F3K8S3_PSESZ/109-294--------------------------------------------------------------------------------
A0A023X9K0_BRAJP/112-298--------------------------------------------------------------------------------
C4L724_EXISA/89-275--------------------------------------------------------------------------------
D3DDW5_9ACTO/117-307--------------------------------------------------------------------------------
B9B6B7_9BURK/48-238--------------------------------------------------------------------------------
Q12II2_SHEDO/112-302--------------------------------------------------------------------------------
Q2SKF8_HAHCH/104-284--------------------------------------------------------------------------------
D3D707_9ACTO/131-310--------------------------------------------------------------------------------
Q83Z60_STRCL/126-311--------------------------------------------------------------------------------
C7Q3P0_CATAD/103-280--------------------------------------------------------------------------------
A8FIK7_BACP2/134-334--------------------------------------------------------------------------------
C4T7U3_YERIN/81-287--------------------------------------------------------------------------------
C7M0Y2_ACIFD/99-282--------------------------------------------------------------------------------
B8J507_ANAD2/110-303--------------------------------------------------------------------------------
Q02BT0_SOLUE/124-303--------------------------------------------------------------------------------
C2CRI1_CORST/134-299--------------------------------------------------------------------------------
D3PFD6_CRAVI/610-811--------------------------------------------------------------------------------
CRNS1_HUMAN/500-699--------------------------------------------------------------------------------
CRNS1_CHICK/606-804--------------------------------------------------------------------------------
C2CRI1_CORST/498-675--------------------------------------------------------------------------------
B4EQF8_BURCJ/110-298--------------------------------------------------------------------------------
Q0RYD4_RHOSR/107-296--------------------------------------------------------------------------------
B1SDM3_9STRE/91-282--------------------------------------------------------------------------------
B7GNZ5_BIFLS/108-299--------------------------------------------------------------------------------
A8M0K3_SALAI/103-297--------------------------------------------------------------------------------
E8SDA7_MICSL/98-270--------------------------------------------------------------------------------
D2B0J8_STRRD/100-269--------------------------------------------------------------------------------
Q121X7_POLSJ/108-282--------------------------------------------------------------------------------
Q1QB93_PSYCK/115-289--------------------------------------------------------------------------------
A0A034SRJ0_9ENTR/96-265--------------------------------------------------------------------------------
D4F6G3_EDWTA/108-277--------------------------------------------------------------------------------
A3UL12_VIBSP/111-283--------------------------------------------------------------------------------
Q1VG50_VIBAL/111-283--------------------------------------------------------------------------------
B8CGT7_SHEPW/109-279--------------------------------------------------------------------------------
C1DMZ3_AZOVD/112-284--------------------------------------------------------------------------------
D2UCG0_XANAP/114-286--------------------------------------------------------------------------------
B0RPV7_XANCB/115-287--------------------------------------------------------------------------------
Q1MX58_9ACTO/104-292--------------------------------------------------------------------------------
D9T106_MICAI/109-294--------------------------------------------------------------------------------

PF02786

PCCA_HUMAN/176-385--------------------------------------------------------------------------------
CARY_BACSU/128-334--------------------------------------------------------------------------------
PYR1_DICDI/525-729--------------------------------------------------------------------------------
CARB_ECOLI/128-335--------------------------------------------------------------------------------
CPSM_HUMAN/546-750--------------------------------------------------------------------------------
BCCA_MYCLE/122-331--------------------------------------------------------------------------------
PYR1_SCHPO/593-797--------------------------------------------------------------------------------
ACCC_PSEAE/115-324--------------------------------------------------------------------------------
CARB_YEAST/149-353--------------------------------------------------------------------------------
ACCC_ECOLI/115-324--------------------------------------------------------------------------------
ACCC_NOSS1/116-325--------------------------------------------------------------------------------
PYC1_YEAST/135-344--------------------------------------------------------------------------------
E9QAT6_MOUSE/514-717--------------------------------------------------------------------------------
K1V2B9_TRIAC/311-514--------------------------------------------------------------------------------
BCCA_MYCTU/115-324--------------------------------------------------------------------------------
Q5L0U3_GEOKA/128-333--------------------------------------------------------------------------------

PF02655

O27028_METTH/106-265--------------------------------------------------------------------------------
Q603D9_METCA/124-284--------------------------------------------------------------------------------
Y776_METJA/124-282--------------------------------------------------------------------------------
Q7UJD2_RHOBA/127-319--------------------------------------------------------------------------------
Q6LZR0_METMP/123-259--------------------------------------------------------------------------------
O29201_ARCFU/107-251--------------------------------------------------------------------------------
O28027_ARCFU/97-247--------------------------------------------------------------------------------
Q97H24_CLOAB/105-271--------------------------------------------------------------------------------
Q8TQR5_METAC/109-277--------------------------------------------------------------------------------
Q6M182_METMP/105-262--------------------------------------------------------------------------------
Q8TJB8_METAC/125-298--------------------------------------------------------------------------------
O26923_METTH/114-270--------------------------------------------------------------------------------
Q8TZ26_METKA/104-247--------------------------------------------------------------------------------
Y815_METJA/136-272--------------------------------------------------------------------------------
Q8TV12_METKA/118-275--------------------------------------------------------------------------------

PF02222

PURK_BACSU/115-285--------------------------------------------------------------------------------
PURT_METJA/120-294--------------------------------------------------------------------------------
PURT_ECOLI/121-295--------------------------------------------------------------------------------
PUR6_YEAST/113-285--------------------------------------------------------------------------------
PUR6_CANGA/113-284--------------------------------------------------------------------------------
PUR6_SCHPO/111-282--------------------------------------------------------------------------------
PURK_ECOLI/87-254--------------------------------------------------------------------------------
PURK_HAEIN/92-261--------------------------------------------------------------------------------
PURK_PSEAE/105-272--------------------------------------------------------------------------------
PURK_SULSO/109-273--------------------------------------------------------------------------------
PURK_AQUAE/100-266--------------------------------------------------------------------------------
PURK_SYNY3/112-284--------------------------------------------------------------------------------
PURK_SYNE7/116-285--------------------------------------------------------------------------------
PURK_MYCLE/120-300--------------------------------------------------------------------------------
PURT_BACSU/113-287--------------------------------------------------------------------------------
PURT_SYNY3/117-292--------------------------------------------------------------------------------
M9WZK1_PASHA/123-295--------------------------------------------------------------------------------
PURK_MYCTU/125-297--------------------------------------------------------------------------------
Q84TI2_ARATH/198-369--------------------------------------------------------------------------------
PURT_PYRFU/127-303--------------------------------------------------------------------------------

PF07478

DDL_BORBU/136-344--------------------------------------------------------------------------------
DDLB_ECOLI/103-303--------------------------------------------------------------------------------
DDL_ENTFA/138-341--------------------------------------------------------------------------------
DDL_SYNY3/134-342--------------------------------------------------------------------------------
VANB_ENTFA/138-337--------------------------------------------------------------------------------
DDL_AQUAE/101-291--------------------------------------------------------------------------------
MUDD_CHLTR/569-778--------------------------------------------------------------------------------
DDL_BACSU/135-338--------------------------------------------------------------------------------
DDL_HAEIN/106-303--------------------------------------------------------------------------------
DDL_TREPA/143-347--------------------------------------------------------------------------------
DDLA_ECOLI/147-348--------------------------------------------------------------------------------
DDL_MYCTU/158-363--------------------------------------------------------------------------------
DDL_LEUMM/142-349--------------------------------------------------------------------------------

PF01071

Q20143_CAEEL/100-292--------------------------------------------------------------------------------
PUR2_BACSU/101-293--------------------------------------------------------------------------------
PUR2_ARATH/198-392--------------------------------------------------------------------------------
PUR2_MYCLE/101-292--------------------------------------------------------------------------------
PUR2_HAEIN/103-296--------------------------------------------------------------------------------
PUR2_METTH/100-298--------------------------------------------------------------------------------
PUR2_SCHPO/109-301--------------------------------------------------------------------------------
PUR2_YEAST/108-308--------------------------------------------------------------------------------
PUR2_HELPY/105-292--------------------------------------------------------------------------------
PUR2_ARCFU/109-334--------------------------------------------------------------------------------
PUR2_METJA/103-304--------------------------------------------------------------------------------
PUR2_CHICK/105-298--------------------------------------------------------------------------------
PUR2_HUMAN/105-298--------------------------------------------------------------------------------
PUR2_SYNY3/103-291--------------------------------------------------------------------------------
PUR2_YARLI/108-301--------------------------------------------------------------------------------
PUR2_DROME/108-301--------------------------------------------------------------------------------

PF14305

Q7AJR3_BACHD/224-461--------------------------------------------------------------------------------
Q8CX82_OCEIH/200-437--------------------------------------------------------------------------------
Q8A829_BACTN/55-295--------------------------------------------------------------------------------
B9JHB1_AGRRK/64-304--------------------------------------------------------------------------------
Q6AIA9_DESPS/77-317--------------------------------------------------------------------------------

PF06973

I0A0Q1_FERFK/170-355--------------------------------------------------------------------------------
E3GY13_METFV/174-361--------------------------------------------------------------------------------
D1Z1I1_METPS/179-365--------------------------------------------------------------------------------
F6D2X5_METSW/176-363--------------------------------------------------------------------------------
A8AB21_IGNH4/178-366--------------------------------------------------------------------------------
A8M9J4_CALMQ/163-349--------------------------------------------------------------------------------
PURP_METS5/151-332--------------------------------------------------------------------------------
PURP_KORCO/176-365--------------------------------------------------------------------------------
B8D424_DESK1/179-369--------------------------------------------------------------------------------
Q8U3N6_PYRFU/189-380--------------------------------------------------------------------------------
PURP_METST/176-363--------------------------------------------------------------------------------
K4MLW3_9EURY/192-385--------------------------------------------------------------------------------
PURP_SULSO/152-336--------------------------------------------------------------------------------
E0SQP6_IGNAA/182-372--------------------------------------------------------------------------------
F2KQP9_ARCVS/170-356--------------------------------------------------------------------------------
A9A5F5_NITMS/177-363--------------------------------------------------------------------------------
PURP_UNCMA/179-365--------------------------------------------------------------------------------
PURP_METS3/176-363--------------------------------------------------------------------------------
PURP_METMP/174-361--------------------------------------------------------------------------------
PURP_PYRFU/150-334--------------------------------------------------------------------------------
E1QNA3_VULDI/179-369--------------------------------------------------------------------------------
O29983_ARCFU/174-373--------------------------------------------------------------------------------
G0EE86_PYRF1/180-370--------------------------------------------------------------------------------
F4B7X4_ACIHW/160-347--------------------------------------------------------------------------------
Q8ZYV4_PYRAE/159-346--------------------------------------------------------------------------------
PURP_METJA/174-361--------------------------------------------------------------------------------
PURP_METKA/174-359--------------------------------------------------------------------------------
D1Z1I2_METPS/172-358--------------------------------------------------------------------------------
F4B7X3_ACIHW/152-334--------------------------------------------------------------------------------
PURP_ARCFU/172-358--------------------------------------------------------------------------------
F7XPS6_METZD/191-385--------------------------------------------------------------------------------
D3RZQ2_FERPA/169-355--------------------------------------------------------------------------------
R9SKL3_9EURY/176-363--------------------------------------------------------------------------------
PURP_NITMS/156-341--------------------------------------------------------------------------------
PURP_CENSY/156-341--------------------------------------------------------------------------------
I0A0P9_FERFK/179-369--------------------------------------------------------------------------------
K0ILQ3_NITGG/143-327--------------------------------------------------------------------------------
G0EEZ5_PYRF1/172-355--------------------------------------------------------------------------------
M9SKX6_9EURY/192-385--------------------------------------------------------------------------------
PURP_METTH/176-363--------------------------------------------------------------------------------
A4YCP1_METS5/159-347--------------------------------------------------------------------------------
D7E8D4_METEZ/189-383--------------------------------------------------------------------------------
B1L3X8_KORCO/189-379--------------------------------------------------------------------------------
R9T5A2_9EURY/191-385--------------------------------------------------------------------------------
N0BIZ6_9EURY/179-365--------------------------------------------------------------------------------
Q980P6_SULSO/161-349--------------------------------------------------------------------------------
PURP_SULTO/152-333--------------------------------------------------------------------------------
H3ZJJ4_THELN/150-333--------------------------------------------------------------------------------
A0B858_METTP/188-379--------------------------------------------------------------------------------
Q4JAU2_SULAC/161-348--------------------------------------------------------------------------------
E1QNA2_VULDI/169-353--------------------------------------------------------------------------------
D2RDT4_ARCPA/168-351--------------------------------------------------------------------------------
B8D426_DESK1/170-355--------------------------------------------------------------------------------
A0RW22_CENSY/177-363--------------------------------------------------------------------------------
U6EAL6_9EURY/176-363--------------------------------------------------------------------------------
D3E1N5_METRM/176-363--------------------------------------------------------------------------------
E0SQP8_IGNAA/175-356--------------------------------------------------------------------------------
N0BIR8_9EURY/179-375--------------------------------------------------------------------------------
PURP_THEKO/148-331--------------------------------------------------------------------------------
K0IE82_NITGG/179-366--------------------------------------------------------------------------------
E6N6E4_9ARCH/154-341--------------------------------------------------------------------------------

PF03738

A9WS88_RENSM/12-384--------------------------------------------------------------------------------
A4YN97_BRASO/12-390--------------------------------------------------------------------------------
B0SZP5_CAUSK/12-383--------------------------------------------------------------------------------
D3UH97_HELM1/10-389--------------------------------------------------------------------------------
Q7NXU8_CHRVO/12-377--------------------------------------------------------------------------------
B1ME79_MYCA9/12-385--------------------------------------------------------------------------------
B3PBJ7_CELJU/12-388--------------------------------------------------------------------------------
C6WDU1_ACTMD/12-385--------------------------------------------------------------------------------
Q7VK77_HELHP/10-389--------------------------------------------------------------------------------
B8HN62_CYAP4/12-376--------------------------------------------------------------------------------
D2NP05_ROTMD/13-409--------------------------------------------------------------------------------
A6WBP0_KINRD/12-396--------------------------------------------------------------------------------
A6Q7W3_SULNB/11-391--------------------------------------------------------------------------------
Q7MSC7_WOLSU/10-389--------------------------------------------------------------------------------
C5B6G4_METEA/12-387--------------------------------------------------------------------------------
D1AYZ0_SULD5/11-391--------------------------------------------------------------------------------
A4F635_SACEN/12-385--------------------------------------------------------------------------------
B1M2K4_METRJ/12-384--------------------------------------------------------------------------------
D1A3Z2_THECD/12-380--------------------------------------------------------------------------------
C6CYE8_PAESJ/19-410--------------------------------------------------------------------------------
Q7MZH8_PHOLL/12-386--------------------------------------------------------------------------------
C1CWU9_DEIDV/12-384--------------------------------------------------------------------------------
A7ZBD7_CAMC1/11-391--------------------------------------------------------------------------------
Q5YS21_NOCFA/12-385--------------------------------------------------------------------------------
Q9A5T6_CAUCR/12-385--------------------------------------------------------------------------------
C6W6C0_DYAFD/11-389--------------------------------------------------------------------------------
Q0KFM7_CUPNH/12-388--------------------------------------------------------------------------------
A8ETQ4_ARCB4/10-391--------------------------------------------------------------------------------
A0RRF5_CAMFF/10-390--------------------------------------------------------------------------------
Q8ZK95_SALTY/12-385--------------------------------------------------------------------------------
Q30QI3_SULDN/11-391--------------------------------------------------------------------------------
Q89T52_BRADU/12-385--------------------------------------------------------------------------------
B6INZ6_RHOCS/12-390--------------------------------------------------------------------------------
Q87QT2_VIBPA/12-386--------------------------------------------------------------------------------
B4EW39_PROMH/12-385--------------------------------------------------------------------------------
C7Q215_CATAD/12-391--------------------------------------------------------------------------------
Q114E2_TRIEI/12-374--------------------------------------------------------------------------------
Q01QL8_SOLUE/12-375--------------------------------------------------------------------------------
Q3IWQ4_RHOS4/12-395--------------------------------------------------------------------------------
E8RVG1_ASTEC/12-399--------------------------------------------------------------------------------
Q2S7Y7_HAHCH/12-386--------------------------------------------------------------------------------
C5BUP2_TERTT/12-387--------------------------------------------------------------------------------
Q2G5S8_NOVAD/12-379--------------------------------------------------------------------------------
C7MS99_SACVD/12-385--------------------------------------------------------------------------------
C4K7Y5_HAMD5/12-384--------------------------------------------------------------------------------
D3FUB3_BACPE/20-413--------------------------------------------------------------------------------
D2SBB5_GEOOG/6-397--------------------------------------------------------------------------------
D1BLL0_VEIPT/15-434--------------------------------------------------------------------------------
Q15WJ3_PSEA6/12-386--------------------------------------------------------------------------------
Q4K4Q9_PSEF5/12-383--------------------------------------------------------------------------------
Q7MJ95_VIBVY/27-401--------------------------------------------------------------------------------
D2QD19_SPILD/11-389--------------------------------------------------------------------------------
Q5FTG8_GLUOX/15-386--------------------------------------------------------------------------------
D2B8Z4_STRRD/12-384--------------------------------------------------------------------------------
A1B1F8_PARDP/12-405--------------------------------------------------------------------------------
B3E4M1_GEOLS/12-372--------------------------------------------------------------------------------
D2PYF3_KRIFD/12-390--------------------------------------------------------------------------------
C5D289_GEOSW/22-423--------------------------------------------------------------------------------
A0JZG2_ARTS2/12-384--------------------------------------------------------------------------------
A6L652_BACV8/13-373--------------------------------------------------------------------------------
B2FMH2_STRMK/12-382--------------------------------------------------------------------------------
C5AU12_METEA/12-384--------------------------------------------------------------------------------
D4ZZ36_ARTPN/26-390--------------------------------------------------------------------------------
E0SI48_DICD3/12-384--------------------------------------------------------------------------------
F3ZL76_9ACTO/12-395--------------------------------------------------------------------------------
I0DVC8_PROSM/16-395--------------------------------------------------------------------------------
O25019_HELPY/12-388--------------------------------------------------------------------------------
Y929_HAEIN/15-391--------------------------------------------------------------------------------
Q0PBD8_CAMJE/11-387--------------------------------------------------------------------------------
Q6LL61_PHOPR/12-386--------------------------------------------------------------------------------
Q7CGH0_YERPE/12-384--------------------------------------------------------------------------------
Q7CPS0_SALTY/12-384--------------------------------------------------------------------------------
Q87YL5_PSESM/12-383--------------------------------------------------------------------------------
Q8P6Y2_XANCP/12-386--------------------------------------------------------------------------------

PF04174

Q0RH44_FRAAA/80-411--------------------------------------------------------------------------------
A9H282_GLUDA/91-422--------------------------------------------------------------------------------
B6IMV0_RHOCS/77-408--------------------------------------------------------------------------------
B3E3V9_GEOLS/83-414--------------------------------------------------------------------------------
Q97YL5_SULSO/75-386--------------------------------------------------------------------------------
Q970N0_SULTO/87-396--------------------------------------------------------------------------------
D0L0C4_HALNC/81-412--------------------------------------------------------------------------------
B2HNB5_MYCMM/115-443--------------------------------------------------------------------------------
B1M6F7_METRJ/100-432--------------------------------------------------------------------------------
B2ICY7_BEII9/94-428--------------------------------------------------------------------------------
A0QWP7_MYCS2/138-466--------------------------------------------------------------------------------
A1A098_BIFAA/50-378--------------------------------------------------------------------------------
B4EHB6_BURCJ/116-451--------------------------------------------------------------------------------
Y2411_MYCTU/100-431--------------------------------------------------------------------------------
Q2K491_RHIEC/98-432--------------------------------------------------------------------------------
Q6N7S9_RHOPA/71-403--------------------------------------------------------------------------------
Q8Y0C3_RALSO/108-439--------------------------------------------------------------------------------
Q9HUN7_PSEAE/81-412--------------------------------------------------------------------------------

PF14403

B0SRE6_LEPBP/78-451--------------------------------------------------------------------------------
B2U9B5_RALPJ/95-470--------------------------------------------------------------------------------
Q7UKP3_RHOBA/129-506--------------------------------------------------------------------------------
A2SIW6_METPP/106-491--------------------------------------------------------------------------------
A8L1J5_FRASN/461-842--------------------------------------------------------------------------------
Q2SNA4_HAHCH/81-457--------------------------------------------------------------------------------
G0A368_METMM/76-451--------------------------------------------------------------------------------
G8TDU5_NIAKG/82-458--------------------------------------------------------------------------------
R7GX10_9FIRM/44-409--------------------------------------------------------------------------------
E4PGP6_MARAH/87-466--------------------------------------------------------------------------------
A6X4S6_OCHA4/70-446--------------------------------------------------------------------------------
C7MDA1_BRAFD/81-458--------------------------------------------------------------------------------
E0TD75_PARBH/78-455--------------------------------------------------------------------------------
M5E9Z3_9GAMM/88-463--------------------------------------------------------------------------------
A5GWV9_SYNR3/98-472--------------------------------------------------------------------------------
G8ANL6_AZOBR/76-451--------------------------------------------------------------------------------
F7QPB4_9BRAD/100-477--------------------------------------------------------------------------------
C8XDV8_NAKMY/113-485--------------------------------------------------------------------------------
C7PAP4_CHIPD/82-458--------------------------------------------------------------------------------
C5BPD7_TERTT/80-455--------------------------------------------------------------------------------
M4S737_9SPHN/75-454--------------------------------------------------------------------------------
Q0BUT6_GRABC/74-457--------------------------------------------------------------------------------
B8EIB3_METSB/73-449--------------------------------------------------------------------------------
R6N2N2_9BACE/41-413--------------------------------------------------------------------------------
Q98HG7_RHILO/95-474--------------------------------------------------------------------------------
I0INR8_LEPFC/82-459--------------------------------------------------------------------------------
R4LWB6_9ACTO/464-838--------------------------------------------------------------------------------
Q28NW9_JANSC/74-451--------------------------------------------------------------------------------
I4B961_TURPD/78-451--------------------------------------------------------------------------------
G8MNB3_9BURK/97-486--------------------------------------------------------------------------------
L0G4F9_ECHVK/78-451--------------------------------------------------------------------------------
C0Q8Z8_DESAH/78-453--------------------------------------------------------------------------------
B0RAK7_CLAMS/92-468--------------------------------------------------------------------------------
B3E3V9_GEOLS/83-458--------------------------------------------------------------------------------
E6U6S7_ETHHY/43-414--------------------------------------------------------------------------------
W6EFT2_SULMU/57-431--------------------------------------------------------------------------------
D6Z885_SEGRD/105-486--------------------------------------------------------------------------------
C6CZ87_PAESJ/86-462--------------------------------------------------------------------------------
A6TAV7_KLEP7/78-451--------------------------------------------------------------------------------
A4SY70_POLSQ/99-486--------------------------------------------------------------------------------
Q2SNA6_HAHCH/93-464--------------------------------------------------------------------------------
D9QNT2_BRESC/66-443--------------------------------------------------------------------------------
K0I269_9BURK/78-457--------------------------------------------------------------------------------
D9SI67_GALCS/71-450--------------------------------------------------------------------------------
A8LRF1_DINSH/95-474--------------------------------------------------------------------------------
Q0AAK8_ALKEH/80-455--------------------------------------------------------------------------------
F0ST83_PLABD/75-454--------------------------------------------------------------------------------
Q21VI9_ALBFT/96-493--------------------------------------------------------------------------------
H6NBM0_9BACL/88-465--------------------------------------------------------------------------------
B1HML8_LYSSC/75-453--------------------------------------------------------------------------------
F7QLS6_9BRAD/69-448--------------------------------------------------------------------------------
H8GJT5_METAL/83-459--------------------------------------------------------------------------------
A0L4M7_MAGSM/83-454--------------------------------------------------------------------------------
C5AZ44_METEA/105-482--------------------------------------------------------------------------------
A0JWU1_ARTS2/82-458--------------------------------------------------------------------------------
I4BBL4_TURPD/78-451--------------------------------------------------------------------------------
G7US46_PSEUP/77-453--------------------------------------------------------------------------------
Y335_SYNY3/78-454--------------------------------------------------------------------------------
J7QJ85_METSZ/88-467--------------------------------------------------------------------------------
J9SHX4_9ACTO/88-468--------------------------------------------------------------------------------
D5BCY0_ZUNPS/86-464--------------------------------------------------------------------------------
G0HBD1_CORVD/76-453--------------------------------------------------------------------------------
I4ESF5_MODMB/82-471--------------------------------------------------------------------------------
A0L4N2_MAGSM/83-457--------------------------------------------------------------------------------
D7A0C0_STAND/71-448--------------------------------------------------------------------------------
Q0ATT5_MARMM/69-446--------------------------------------------------------------------------------
D5UNK9_TSUPD/57-430--------------------------------------------------------------------------------
C5CSR6_VARPS/152-536--------------------------------------------------------------------------------
I3Y9R4_THIV6/92-476--------------------------------------------------------------------------------
X2GX35_9BACI/76-454--------------------------------------------------------------------------------
E8RKL3_ASTEC/78-453--------------------------------------------------------------------------------
K9ULM7_9CHRO/78-453--------------------------------------------------------------------------------
B2JQR2_BURP8/100-483--------------------------------------------------------------------------------
R5QN47_9PROT/73-432--------------------------------------------------------------------------------
F6IN23_9SPHN/75-454--------------------------------------------------------------------------------
B0UGL6_METS4/78-455--------------------------------------------------------------------------------
M5APU0_9ACTN/67-443--------------------------------------------------------------------------------
D5V7Y1_ARCNC/57-430--------------------------------------------------------------------------------
M7T6M7_EUTLA/444-819--------------------------------------------------------------------------------
E4RQ16_LEAB4/78-451--------------------------------------------------------------------------------
Q21G21_SACD2/80-457--------------------------------------------------------------------------------
Q92M17_RHIME/95-473--------------------------------------------------------------------------------
D5V7X8_ARCNC/79-456--------------------------------------------------------------------------------
I0JSH6_HALH3/77-456--------------------------------------------------------------------------------
G8APY9_AZOBR/89-465--------------------------------------------------------------------------------
Q31PF7_SYNE7/78-453--------------------------------------------------------------------------------
U5QND4_9CYAN/83-459--------------------------------------------------------------------------------
I0IHC7_PHYMF/105-493--------------------------------------------------------------------------------
I2EYM9_EMTOG/80-453--------------------------------------------------------------------------------
G2IYZ6_PSEUL/78-452--------------------------------------------------------------------------------
A8EX29_ARCB4/79-455--------------------------------------------------------------------------------
Q13L11_BURXL/97-482--------------------------------------------------------------------------------
A4CLL4_ROBBH/85-463--------------------------------------------------------------------------------
I3TKS7_TISMK/114-492--------------------------------------------------------------------------------
G2IJ61_9SPHN/69-445--------------------------------------------------------------------------------
F0JK82_DESDE/78-453--------------------------------------------------------------------------------
L0DKM2_SINAD/84-459--------------------------------------------------------------------------------
E3I492_RHOVT/91-466--------------------------------------------------------------------------------
D2R7T8_PIRSD/92-467--------------------------------------------------------------------------------
W0DUN0_9GAMM/77-453--------------------------------------------------------------------------------
A9B2Y8_HERA2/82-457--------------------------------------------------------------------------------
Q97YL5_SULSO/75-427--------------------------------------------------------------------------------
F2IUX9_POLGS/74-450--------------------------------------------------------------------------------
R5DYJ0_9BURK/41-413--------------------------------------------------------------------------------
Q0BV94_GRABC/93-468--------------------------------------------------------------------------------
K0CEB2_ALCDB/78-452--------------------------------------------------------------------------------
B3DZH2_METI4/107-482--------------------------------------------------------------------------------
Q21VL2_ALBFT/82-461--------------------------------------------------------------------------------
A3HSI5_9BACT/83-460--------------------------------------------------------------------------------
C6XLI1_HIRBI/77-454--------------------------------------------------------------------------------
C4KD55_THASP/91-485--------------------------------------------------------------------------------
A8IHP2_AZOC5/108-487--------------------------------------------------------------------------------
B1M6F7_METRJ/100-481--------------------------------------------------------------------------------
E8R5T8_ISOPI/108-483--------------------------------------------------------------------------------
I4ERM1_MODMB/76-452--------------------------------------------------------------------------------
D7DK31_METV0/96-471--------------------------------------------------------------------------------
G8SAR1_ACTS5/450-824--------------------------------------------------------------------------------
B4S7R2_PROA2/82-458--------------------------------------------------------------------------------
B0SXI0_CAUSK/100-478--------------------------------------------------------------------------------
D3RNR2_ALLVD/81-457--------------------------------------------------------------------------------
D5ATU8_RHOCB/90-477--------------------------------------------------------------------------------
F8A772_CELGA/73-449--------------------------------------------------------------------------------
C4XHJ1_DESMR/78-453--------------------------------------------------------------------------------
M1FFR1_9ALTE/77-450--------------------------------------------------------------------------------
F4KUW8_HALH1/85-463--------------------------------------------------------------------------------
B2ICY7_BEII9/94-472--------------------------------------------------------------------------------
T2KQP6_9FLAO/86-464--------------------------------------------------------------------------------
A4XVI7_PSEMY/72-445--------------------------------------------------------------------------------
Q9HUN7_PSEAE/81-462--------------------------------------------------------------------------------
T2G776_DESGI/78-453--------------------------------------------------------------------------------
D3F1T9_CONWI/90-466--------------------------------------------------------------------------------
Q024T8_SOLUE/78-453--------------------------------------------------------------------------------
W6EC69_SULMU/80-454--------------------------------------------------------------------------------
V5UKH3_9BURK/71-450--------------------------------------------------------------------------------
A1K5W5_AZOSB/82-457--------------------------------------------------------------------------------
D5SW41_PLAL2/90-465--------------------------------------------------------------------------------
H6RQU7_BLASD/80-469--------------------------------------------------------------------------------
E3I7X0_RHOVT/90-465--------------------------------------------------------------------------------
V4JLU2_9GAMM/100-475--------------------------------------------------------------------------------
D2AQS1_STRRD/453-814--------------------------------------------------------------------------------
Q46JV4_PROMT/79-453--------------------------------------------------------------------------------
F6EMC4_AMYSD/64-437--------------------------------------------------------------------------------
H1YGG8_9SPHI/83-459--------------------------------------------------------------------------------
G4T1G6_META2/87-463--------------------------------------------------------------------------------
D3SAW6_THISK/80-456--------------------------------------------------------------------------------
A4SYS7_POLSQ/71-446--------------------------------------------------------------------------------
E2S8M8_9ACTO/77-453--------------------------------------------------------------------------------
B1XPC0_SYNP2/80-456--------------------------------------------------------------------------------
T2KPV3_9FLAO/85-461--------------------------------------------------------------------------------
D8IYK0_HERSS/82-462--------------------------------------------------------------------------------
F5XHZ4_MICPN/76-452--------------------------------------------------------------------------------
C6XJH8_HIRBI/92-470--------------------------------------------------------------------------------
A5UYD4_ROSS1/77-452--------------------------------------------------------------------------------
J9ZE54_LEPFM/82-458--------------------------------------------------------------------------------
Q87VL1_PSESM/81-459--------------------------------------------------------------------------------
A6WDG9_KINRD/445-818--------------------------------------------------------------------------------
Q2RNW1_RHORT/72-447--------------------------------------------------------------------------------
A3I2G3_9BACT/78-451--------------------------------------------------------------------------------
R4K5A1_CLOPA/41-411--------------------------------------------------------------------------------
A9ER80_SORC5/102-480--------------------------------------------------------------------------------
W0J670_9BACT/89-470--------------------------------------------------------------------------------
K7SL29_PROA4/76-452--------------------------------------------------------------------------------
G0HFX2_CORVD/24-399--------------------------------------------------------------------------------
E3F0J6_KETVY/85-464--------------------------------------------------------------------------------
I2EXR3_EMTOG/104-479--------------------------------------------------------------------------------
F2J4J3_POLGS/92-470--------------------------------------------------------------------------------
W0PM07_9BURK/83-461--------------------------------------------------------------------------------
E6W066_DESIS/87-461--------------------------------------------------------------------------------
A5GKP7_SYNPW/48-421--------------------------------------------------------------------------------
K0EMX7_9NOCA/121-493--------------------------------------------------------------------------------
Q21G24_SACD2/93-468--------------------------------------------------------------------------------
E4U115_SULKY/80-452--------------------------------------------------------------------------------
G8QJ99_AZOSU/73-448--------------------------------------------------------------------------------
B9JS69_AGRVS/97-475--------------------------------------------------------------------------------
D2R8H5_PIRSD/78-453--------------------------------------------------------------------------------
Q1H4C5_METFK/75-449--------------------------------------------------------------------------------
Q128G8_POLSJ/106-485--------------------------------------------------------------------------------
R4TEB4_AMYOR/108-484--------------------------------------------------------------------------------
M1PA70_DESSD/101-461--------------------------------------------------------------------------------
I4B959_TURPD/93-471--------------------------------------------------------------------------------
F6AAJ4_PSEF1/81-449--------------------------------------------------------------------------------
M9R914_9RHOB/89-466--------------------------------------------------------------------------------
A0QWP7_MYCS2/138-508--------------------------------------------------------------------------------
D4IW41_BUTFI/40-411--------------------------------------------------------------------------------
G8NWQ7_GRAMM/93-468--------------------------------------------------------------------------------
W5X656_9BACT/89-465--------------------------------------------------------------------------------
D8IYJ5_HERSS/76-451--------------------------------------------------------------------------------
E6W510_DESIS/78-455--------------------------------------------------------------------------------
Q7V148_PROMP/83-457--------------------------------------------------------------------------------
M5DPF7_9GAMM/77-450--------------------------------------------------------------------------------
C7RNC5_ACCPU/82-461--------------------------------------------------------------------------------
D3RNV5_ALLVD/91-467--------------------------------------------------------------------------------
T2GG29_DESGI/88-464--------------------------------------------------------------------------------
D5EIM9_CORAD/78-453--------------------------------------------------------------------------------
C6X8X0_METGS/82-476--------------------------------------------------------------------------------
V6EX40_9PROT/69-445--------------------------------------------------------------------------------
F8JB62_HYPSM/71-447--------------------------------------------------------------------------------
G0JRI0_9GAMM/80-456--------------------------------------------------------------------------------
V6EWC9_9PROT/78-453--------------------------------------------------------------------------------
E4U113_SULKY/57-430--------------------------------------------------------------------------------
D0LFZ3_HALO1/89-463--------------------------------------------------------------------------------
D5EPG6_CORAD/86-455--------------------------------------------------------------------------------
V4IUU9_9GAMM/92-472--------------------------------------------------------------------------------
E2SD60_9ACTO/86-455--------------------------------------------------------------------------------
F4B594_ACIHW/66-415--------------------------------------------------------------------------------
A0R101_MYCS2/100-476--------------------------------------------------------------------------------
F4CSR5_PSEUX/451-831--------------------------------------------------------------------------------
H6N0P2_GORPV/109-487--------------------------------------------------------------------------------
C0Q902_DESAH/123-516--------------------------------------------------------------------------------
Q1GES0_RUEST/85-462--------------------------------------------------------------------------------
G2IJD5_9SPHN/91-471--------------------------------------------------------------------------------
C7N175_SLAHD/42-411--------------------------------------------------------------------------------
F2JUM4_MARM1/80-457--------------------------------------------------------------------------------
A6VTY9_MARMS/95-470--------------------------------------------------------------------------------
C6VTV2_DYAFD/86-461--------------------------------------------------------------------------------
C9RNU5_FIBSS/53-431--------------------------------------------------------------------------------
Q606G1_METCA/81-455--------------------------------------------------------------------------------
S5XRX2_PARAH/68-444--------------------------------------------------------------------------------
Q1ILC9_KORVE/89-464--------------------------------------------------------------------------------
A4XQ08_PSEMY/81-457--------------------------------------------------------------------------------
W0IWK1_9BACT/100-477--------------------------------------------------------------------------------
E3J0R4_FRASU/98-474--------------------------------------------------------------------------------
Q1B008_RUBXD/83-455--------------------------------------------------------------------------------
B1MCG6_MYCA9/121-495--------------------------------------------------------------------------------
K9P964_CYAGP/78-452--------------------------------------------------------------------------------
E3IZK2_FRASU/479-878--------------------------------------------------------------------------------
S0ETI1_CHTCT/79-456--------------------------------------------------------------------------------
GCS22_FRASC/463-838--------------------------------------------------------------------------------
F5Y2V0_RAMTT/110-485--------------------------------------------------------------------------------
K0I395_9BURK/119-505--------------------------------------------------------------------------------
Q3B321_PELLD/82-458--------------------------------------------------------------------------------
B1Y7B4_LEPCP/163-543--------------------------------------------------------------------------------
G4RA99_PELHB/73-449--------------------------------------------------------------------------------
I1YJX3_METFJ/80-455--------------------------------------------------------------------------------
Q6F9Q3_ACIAD/115-489--------------------------------------------------------------------------------
C1D8Z3_LARHH/78-451--------------------------------------------------------------------------------
Q2K491_RHIEC/98-476--------------------------------------------------------------------------------
I0KES5_9BACT/98-471--------------------------------------------------------------------------------
A5VFN0_SPHWW/94-473--------------------------------------------------------------------------------
K9SBP1_9CYAN/78-453--------------------------------------------------------------------------------
D1BUY4_XYLCX/84-460--------------------------------------------------------------------------------
B3QX29_CHLT3/81-454--------------------------------------------------------------------------------
E6XCB5_CELAD/92-469--------------------------------------------------------------------------------
I0JKT8_HALH3/75-452--------------------------------------------------------------------------------
A4YF49_METS5/52-402--------------------------------------------------------------------------------
B7JXY7_CYAP8/80-456--------------------------------------------------------------------------------
B8EJ70_METSB/97-475--------------------------------------------------------------------------------
C1D2K4_DEIDV/77-453--------------------------------------------------------------------------------
V4ID24_9DELT/78-453--------------------------------------------------------------------------------
F6IJ38_9SPHN/55-434--------------------------------------------------------------------------------
Q0S0P1_RHOSR/79-449--------------------------------------------------------------------------------
E3FXD6_STIAD/86-464--------------------------------------------------------------------------------
C5C4H9_BEUC1/80-455--------------------------------------------------------------------------------
F8EQ21_RUNSL/86-461--------------------------------------------------------------------------------
B0C6M4_ACAM1/78-453--------------------------------------------------------------------------------
H8L089_FRAAD/80-458--------------------------------------------------------------------------------
U5WDZ1_9ACTO/76-452--------------------------------------------------------------------------------
K9SIE4_9CYAN/78-453--------------------------------------------------------------------------------
X5E9H8_9CORY/446-839--------------------------------------------------------------------------------
B5HY79_9ACTO/76-452--------------------------------------------------------------------------------
M5A148_9ACTN/82-458--------------------------------------------------------------------------------
Q970N0_SULTO/87-437--------------------------------------------------------------------------------
D7A2V3_STAND/99-478--------------------------------------------------------------------------------
B2HI24_MYCMM/466-845--------------------------------------------------------------------------------
R8BNZ8_TOGMI/265-636--------------------------------------------------------------------------------
L0J1B3_MYCSM/459-838--------------------------------------------------------------------------------
B0UHH6_METS4/99-476--------------------------------------------------------------------------------
H5WQF1_9BURK/127-511--------------------------------------------------------------------------------
R5MEX2_9FIRM/41-412--------------------------------------------------------------------------------
C6D7E4_PAESJ/92-468--------------------------------------------------------------------------------
G0AG01_COLFT/82-462--------------------------------------------------------------------------------
E8X5X7_ACISM/94-468--------------------------------------------------------------------------------
L0H0G6_9GAMM/92-468--------------------------------------------------------------------------------
Q3J3Q8_RHOS4/70-446--------------------------------------------------------------------------------
F0ST86_PLABD/90-464--------------------------------------------------------------------------------
Q63MZ8_BURPS/116-505--------------------------------------------------------------------------------
I0HUW8_RUBGI/105-476--------------------------------------------------------------------------------
E4T6L1_PALPW/41-412--------------------------------------------------------------------------------
M1P4R5_DESSD/79-454--------------------------------------------------------------------------------
F4C709_SPHS2/82-458--------------------------------------------------------------------------------
Q1LSE6_RALME/97-492--------------------------------------------------------------------------------
I3UHK4_ADVKW/76-451--------------------------------------------------------------------------------
Q47BP2_DECAR/82-462--------------------------------------------------------------------------------
C1F5V5_ACIC5/89-464--------------------------------------------------------------------------------
A7HUH2_PARL1/72-448--------------------------------------------------------------------------------
Q2K5G4_RHIEC/64-440--------------------------------------------------------------------------------
Q2W953_MAGSA/89-464--------------------------------------------------------------------------------
A1VL53_POLNA/82-473--------------------------------------------------------------------------------
A9WEG4_CHLAA/89-465--------------------------------------------------------------------------------
Q218C2_RHOPB/118-497--------------------------------------------------------------------------------
V5SC31_9RHIZ/79-455--------------------------------------------------------------------------------
U5N9E3_9BURK/82-456--------------------------------------------------------------------------------
A1WTU0_HALHL/80-456--------------------------------------------------------------------------------
F4H3E4_CELFA/85-461--------------------------------------------------------------------------------
Q2W951_MAGSA/64-438--------------------------------------------------------------------------------
C7M0S6_ACIFD/80-452--------------------------------------------------------------------------------
I0IBX7_PHYMF/88-478--------------------------------------------------------------------------------
D5SW43_PLAL2/94-470--------------------------------------------------------------------------------
B2IBI8_BEII9/64-441--------------------------------------------------------------------------------
Q89QZ4_BRADU/99-478--------------------------------------------------------------------------------
G4QF49_GLANF/81-457--------------------------------------------------------------------------------
B3PB23_CELJU/109-484--------------------------------------------------------------------------------
Q2RR86_RHORT/95-470--------------------------------------------------------------------------------
F2JUM7_MARM1/91-468--------------------------------------------------------------------------------
B8HRP7_CYAP4/78-453--------------------------------------------------------------------------------
D0LCP0_GORB4/105-485--------------------------------------------------------------------------------
J7Q8I4_METSZ/74-451--------------------------------------------------------------------------------
Q9RST1_DEIRA/78-454--------------------------------------------------------------------------------
A9IGX3_BORPD/78-453--------------------------------------------------------------------------------
B6IS70_RHOCS/100-479--------------------------------------------------------------------------------
E6WAD2_PANSA/78-451--------------------------------------------------------------------------------
D5X041_THIK1/107-484--------------------------------------------------------------------------------
D4Z3J5_SPHJU/69-445--------------------------------------------------------------------------------
A9CFS0_AGRT5/94-472--------------------------------------------------------------------------------
C8XB79_NAKMY/89-466--------------------------------------------------------------------------------
A7ICN1_XANP2/116-495--------------------------------------------------------------------------------
C9RNU3_FIBSS/78-452--------------------------------------------------------------------------------
E6XCB0_CELAD/81-455--------------------------------------------------------------------------------
Q9A7W7_CAUCR/132-507--------------------------------------------------------------------------------
W0AN09_9SPHN/101-481--------------------------------------------------------------------------------
B3PB14_CELJU/144-520--------------------------------------------------------------------------------
L0EIL5_THECK/82-458--------------------------------------------------------------------------------
Q3IZ98_RHOS4/91-466--------------------------------------------------------------------------------
Q8G3Z1_BIFLO/50-423--------------------------------------------------------------------------------
K8GRH5_9CYAN/78-453--------------------------------------------------------------------------------
D7CQX8_TRURR/71-448--------------------------------------------------------------------------------
F5XQ98_MICPN/112-486--------------------------------------------------------------------------------
B8GP14_THISH/88-465--------------------------------------------------------------------------------
H0PZ42_9RHOO/82-465--------------------------------------------------------------------------------
C8X6V2_NAKMY/76-452--------------------------------------------------------------------------------
G4STX3_META2/80-456--------------------------------------------------------------------------------
F8JC31_HYPSM/93-469--------------------------------------------------------------------------------
B0SRE3_LEPBP/88-469--------------------------------------------------------------------------------
D3RNY4_ALLVD/92-467--------------------------------------------------------------------------------
D4Z5U6_SPHJU/89-469--------------------------------------------------------------------------------
R5Q6H1_9PROT/83-461--------------------------------------------------------------------------------
D5UGA1_CELFN/71-440--------------------------------------------------------------------------------
Q7UKP6_RHOBA/109-485--------------------------------------------------------------------------------
S6AN44_9PROT/80-455--------------------------------------------------------------------------------
G2LL60_CHLTF/77-452--------------------------------------------------------------------------------
Q11PG7_CYTH3/85-463--------------------------------------------------------------------------------
B1Y7B7_LEPCP/74-453--------------------------------------------------------------------------------
I0GQY2_SELRL/41-411--------------------------------------------------------------------------------
N0AX77_9BACI/79-455--------------------------------------------------------------------------------
G4R7I5_PELHB/93-472--------------------------------------------------------------------------------
W0AGS8_9SPHN/46-423--------------------------------------------------------------------------------
Q7APS0_MYCLE/130-499--------------------------------------------------------------------------------
A9H282_GLUDA/91-466--------------------------------------------------------------------------------
C7JDF7_ACEP3/93-468--------------------------------------------------------------------------------
G8QJ93_AZOSU/82-464--------------------------------------------------------------------------------

PF08443

RIMK_ECOLI/97-286--------------------------------------------------------------------------------
COFF_METJA/94-282--------------------------------------------------------------------------------
RIMK_HAEIN/105-293--------------------------------------------------------------------------------
Y016_MYCPN/90-287--------------------------------------------------------------------------------

PF02955

GSHB_SYNE7/132-305--------------------------------------------------------------------------------
GSHB_SYNY3/132-305--------------------------------------------------------------------------------
GSHB_SHEON/124-298--------------------------------------------------------------------------------
GSHB_RHOPA/124-297--------------------------------------------------------------------------------
GSHB_BUCAI/129-303--------------------------------------------------------------------------------
GSHB_PROMM/119-292--------------------------------------------------------------------------------
GSHB_CHRVO/123-297--------------------------------------------------------------------------------
Q73I56_WOLPM/115-287--------------------------------------------------------------------------------
GSHB_PROMA/119-292--------------------------------------------------------------------------------
GSHB_RALSO/123-297--------------------------------------------------------------------------------
GSHB_CAUCR/125-298--------------------------------------------------------------------------------
GSHB_BUCBP/125-300--------------------------------------------------------------------------------
Q7CU65_AGRT5/135-315--------------------------------------------------------------------------------
GSHB_YERPE/124-298--------------------------------------------------------------------------------
GSHB_THEEB/132-305--------------------------------------------------------------------------------
Q6LMM4_PHOPR/124-298--------------------------------------------------------------------------------
GSHB_PSESM/125-299--------------------------------------------------------------------------------
GSHB_COXBU/125-299--------------------------------------------------------------------------------
GSHB_WIGBR/124-297--------------------------------------------------------------------------------
GSHB_NOSS1/132-305--------------------------------------------------------------------------------
Q6LH85_PHOPR/128-308--------------------------------------------------------------------------------
Q6F702_ACIAD/123-297--------------------------------------------------------------------------------
GSHB_GLOVI/128-301--------------------------------------------------------------------------------
GSHB_PROMP/119-292--------------------------------------------------------------------------------
GSHB_SYNPX/119-292--------------------------------------------------------------------------------
GSHB_ECOLI/124-298--------------------------------------------------------------------------------
GSHB_NITEU/126-300--------------------------------------------------------------------------------
B9KHS2_ANAMF/116-287--------------------------------------------------------------------------------
Q2KDE2_RHIEC/126-297--------------------------------------------------------------------------------
Q2YQU6_BRUA2/124-296--------------------------------------------------------------------------------
Q6G4U0_BARHE/122-294--------------------------------------------------------------------------------
GSHB_BORPE/128-301--------------------------------------------------------------------------------
GSHB_NEIMB/128-301--------------------------------------------------------------------------------
GSHB_XYLFA/125-297--------------------------------------------------------------------------------

PF14398

X4ZY76_9BACL/99-361--------------------------------------------------------------------------------
H6N9W5_9BACL/97-358--------------------------------------------------------------------------------
D9SQR1_CLOC7/173-431--------------------------------------------------------------------------------
E6TW69_BACCJ/104-361--------------------------------------------------------------------------------
C5D6K4_GEOSW/101-357--------------------------------------------------------------------------------
C3AKF1_BACMY/89-337--------------------------------------------------------------------------------
U5L780_9BACI/206-461--------------------------------------------------------------------------------
H6N9W6_9BACL/111-370--------------------------------------------------------------------------------
U5L622_9BACI/95-349--------------------------------------------------------------------------------
E6TUF4_BACCJ/193-449--------------------------------------------------------------------------------
G2TQ04_BACCO/180-436--------------------------------------------------------------------------------
D3ECN5_GEOS4/201-461--------------------------------------------------------------------------------
Q5L2A7_GEOKA/101-353--------------------------------------------------------------------------------
L0EEL9_THECK/99-359--------------------------------------------------------------------------------
Q65LV1_BACLD/183-435--------------------------------------------------------------------------------
A6TTN5_ALKMQ/179-435--------------------------------------------------------------------------------
A6TTN9_ALKMQ/124-381--------------------------------------------------------------------------------
C6CSP5_PAESJ/175-432--------------------------------------------------------------------------------
X2GSI3_9BACI/89-340--------------------------------------------------------------------------------
YHED_BACSU/183-439--------------------------------------------------------------------------------
B2A793_NATTJ/122-377--------------------------------------------------------------------------------
D5WPR5_KYRT2/178-432--------------------------------------------------------------------------------
C0Z7V3_BREBN/98-355--------------------------------------------------------------------------------
H6N9W9_9BACL/114-386--------------------------------------------------------------------------------
B0TBC3_HELMI/173-432--------------------------------------------------------------------------------
L0EHT1_THECK/189-448--------------------------------------------------------------------------------
Q5L2A8_GEOKA/95-348--------------------------------------------------------------------------------
D5XE96_THEPJ/202-459--------------------------------------------------------------------------------
E6TWB3_BACCJ/112-368--------------------------------------------------------------------------------
B2A4H4_NATTJ/115-372--------------------------------------------------------------------------------
Q0AXS1_SYNWW/108-363--------------------------------------------------------------------------------
Q5L2A9_GEOKA/180-435--------------------------------------------------------------------------------
B0TBC2_HELMI/102-354--------------------------------------------------------------------------------
C8WWN4_ALIAD/106-365--------------------------------------------------------------------------------
G8PVT0_PSEUV/181-438--------------------------------------------------------------------------------
F2JGI6_CELLD/92-336--------------------------------------------------------------------------------
Q65LV0_BACLD/95-349--------------------------------------------------------------------------------
E6TUF6_BACCJ/194-450--------------------------------------------------------------------------------
D5XE97_THEPJ/198-454--------------------------------------------------------------------------------
C6CSP4_PAESJ/88-343--------------------------------------------------------------------------------
X4ZAE7_9BACL/107-363--------------------------------------------------------------------------------
X4ZY81_9BACL/193-452--------------------------------------------------------------------------------
C0ZF03_BREBN/84-336--------------------------------------------------------------------------------
D5DAR3_BACMD/184-435--------------------------------------------------------------------------------
D3ECN8_GEOS4/108-364--------------------------------------------------------------------------------
D3EDF9_GEOS4/102-361--------------------------------------------------------------------------------
C6D8D5_PAESJ/117-373--------------------------------------------------------------------------------
X4ZNC4_9BACL/96-352--------------------------------------------------------------------------------
D3ECN7_GEOS4/188-448--------------------------------------------------------------------------------
B2A820_NATTJ/90-335--------------------------------------------------------------------------------
H6N9X0_9BACL/194-451--------------------------------------------------------------------------------
E6SGJ6_THEM7/177-435--------------------------------------------------------------------------------
A9U6Q2_PHYPA/91-347--------------------------------------------------------------------------------
U5L7E4_9BACI/184-442--------------------------------------------------------------------------------
D5DAR1_BACMD/181-436--------------------------------------------------------------------------------
C3AI09_BACMY/189-446--------------------------------------------------------------------------------
E6TWB5_BACCJ/110-362--------------------------------------------------------------------------------
C0Z7V2_BREBN/197-455--------------------------------------------------------------------------------
C8W2K2_DESAS/636-889--------------------------------------------------------------------------------
D5XE94_THEPJ/106-357--------------------------------------------------------------------------------
C0Z7V4_BREBN/195-456--------------------------------------------------------------------------------
E3EEL5_PAEPS/103-359--------------------------------------------------------------------------------
D5WPR3_KYRT2/193-450--------------------------------------------------------------------------------
D9SRF0_CLOC7/100-357--------------------------------------------------------------------------------
C0ZI87_BREBN/156-418--------------------------------------------------------------------------------
YHEC_BACSU/95-349--------------------------------------------------------------------------------
U5L9I0_9BACI/129-372--------------------------------------------------------------------------------
C6D8D4_PAESJ/190-450--------------------------------------------------------------------------------
G2TQ05_BACCO/96-351--------------------------------------------------------------------------------
R4K333_CLOPA/89-340--------------------------------------------------------------------------------
C5D6K3_GEOSW/95-347--------------------------------------------------------------------------------
F2JGI4_CELLD/89-340--------------------------------------------------------------------------------
C6D2S4_PAESJ/89-343--------------------------------------------------------------------------------
Q9KDR5_BACHD/189-445--------------------------------------------------------------------------------
B2A589_NATTJ/679-925--------------------------------------------------------------------------------
B1HW17_LYSSC/95-347--------------------------------------------------------------------------------
A9U6A9_PHYPA/223-482--------------------------------------------------------------------------------
B0TBC4_HELMI/103-351--------------------------------------------------------------------------------
E3EEM0_PAEPS/175-433--------------------------------------------------------------------------------
E3E6L5_PAEPS/97-357--------------------------------------------------------------------------------
N0AWZ8_9BACI/185-443--------------------------------------------------------------------------------
G2TQ06_BACCO/184-440--------------------------------------------------------------------------------
L0EGB1_THECK/117-373--------------------------------------------------------------------------------
C5D6K2_GEOSW/180-436--------------------------------------------------------------------------------
A6TTN8_ALKMQ/106-361--------------------------------------------------------------------------------
C0Z7V1_BREBN/172-423--------------------------------------------------------------------------------
D9SQR0_CLOC7/180-436--------------------------------------------------------------------------------
X4ZWK7_9BACL/102-358--------------------------------------------------------------------------------
Q0AXS7_SYNWW/185-442--------------------------------------------------------------------------------
Q81UK8_BACAN/185-442--------------------------------------------------------------------------------
B2A4H5_NATTJ/201-449--------------------------------------------------------------------------------
D3ECN6_GEOS4/109-368--------------------------------------------------------------------------------
C6D8D3_PAESJ/115-376--------------------------------------------------------------------------------
A6TTQ6_ALKMQ/199-449--------------------------------------------------------------------------------
D9SQR2_CLOC7/185-442--------------------------------------------------------------------------------
C6D8D2_PAESJ/194-455--------------------------------------------------------------------------------
H6N9W7_9BACL/189-446--------------------------------------------------------------------------------
E3EEL7_PAEPS/107-363--------------------------------------------------------------------------------
X4ZGU1_9BACL/188-448--------------------------------------------------------------------------------
E3EEL8_PAEPS/187-447--------------------------------------------------------------------------------
L0EEL4_THECK/193-451--------------------------------------------------------------------------------
W0ECF6_9FIRM/655-901--------------------------------------------------------------------------------
D5WPR2_KYRT2/185-424--------------------------------------------------------------------------------
D9SRF2_CLOC7/187-440--------------------------------------------------------------------------------
D5XE95_THEPJ/222-483--------------------------------------------------------------------------------
E3EEL9_PAEPS/104-364--------------------------------------------------------------------------------
A9U6Q3_PHYPA/68-328--------------------------------------------------------------------------------
D5DAR2_BACMD/110-365--------------------------------------------------------------------------------
C0ZCK7_BREBN/87-344--------------------------------------------------------------------------------
C0ZHM7_BREBN/93-354--------------------------------------------------------------------------------
C6D2S3_PAESJ/3-239--------------------------------------------------------------------------------
A8FBJ2_BACP2/183-438--------------------------------------------------------------------------------
C2X028_BACCE/88-336--------------------------------------------------------------------------------

PF14397

M5DQK3_9GAMM/20-294--------------------------------------------------------------------------------
D4JSC2_9FIRM/75-334--------------------------------------------------------------------------------
Q82TT3_NITEU/69-365--------------------------------------------------------------------------------
A9KN86_CLOPH/87-363--------------------------------------------------------------------------------
B5EAA5_GEOBB/105-377--------------------------------------------------------------------------------
C4LBH6_TOLAT/23-297--------------------------------------------------------------------------------
Q883R7_PSESM/21-294--------------------------------------------------------------------------------
Q8A3L1_BACTN/286-546--------------------------------------------------------------------------------
R5RDJ1_9PROT/25-299--------------------------------------------------------------------------------
I1XM16_METNJ/34-309--------------------------------------------------------------------------------
R6N4X6_9CLOT/62-325--------------------------------------------------------------------------------
Q081M9_SHEFN/19-293--------------------------------------------------------------------------------
R7JSP6_9BACT/87-362--------------------------------------------------------------------------------
D5C4H9_NITHN/18-292--------------------------------------------------------------------------------
K0C3M9_CYCSP/19-293--------------------------------------------------------------------------------
K0NID7_DESTT/18-292--------------------------------------------------------------------------------
A1U2A6_MARAV/3-277--------------------------------------------------------------------------------
E6W1I6_DESIS/22-294--------------------------------------------------------------------------------
B8CNX1_SHEPW/19-293--------------------------------------------------------------------------------
R5B4Y6_9FIRM/84-338--------------------------------------------------------------------------------
Q21FC8_SACD2/34-307--------------------------------------------------------------------------------
F7YKT2_VIBA7/23-296--------------------------------------------------------------------------------

PF03133

TTL_YEAST/388-732--------------------------------------------------------------------------------
Q9VKL9_DROME/368-666--------------------------------------------------------------------------------
TTL3B_DROME/325-625--------------------------------------------------------------------------------
TTLL3_HUMAN/213-505--------------------------------------------------------------------------------
TTLL4_HUMAN/651-946--------------------------------------------------------------------------------
O17720_CAEEL/115-423--------------------------------------------------------------------------------
TTLL1_HUMAN/48-364--------------------------------------------------------------------------------
TTL12_CAEEL/370-662--------------------------------------------------------------------------------
TTL12_HUMAN/346-642--------------------------------------------------------------------------------
TTL_BOVIN/81-367--------------------------------------------------------------------------------
TTL_SCHPO/119-383--------------------------------------------------------------------------------
TTLL4_CAEEL/185-476--------------------------------------------------------------------------------
Q9VX74_DROME/100-420--------------------------------------------------------------------------------
Q9VGW2_DROME/126-407--------------------------------------------------------------------------------
Q9VQV6_DROME/501-799--------------------------------------------------------------------------------
TTL3A_DROME/342-640--------------------------------------------------------------------------------
Q9VBX5_DROME/261-558--------------------------------------------------------------------------------
Q9VB58_DROME/190-486--------------------------------------------------------------------------------
Q9VZ97_DROME/119-439--------------------------------------------------------------------------------
Q4Q4Y1_LEIMA/123-420--------------------------------------------------------------------------------

PF05770

Q7XBW0_ORYSJ/9-321--------------------------------------------------------------------------------
ITPK2_ARATH/34-338--------------------------------------------------------------------------------
ITPK1_ARATH/2-311--------------------------------------------------------------------------------
ITPK1_HUMAN/1-318--------------------------------------------------------------------------------
Q9AYJ2_ORYSJ/16-320--------------------------------------------------------------------------------

PF02750

SYN2_HUMAN/214-416--------------------------------------------------------------------------------
SYN3_RAT/192-394--------------------------------------------------------------------------------

PF08442

MTKA_METEA/2-203---------------------------------------------------------D------VHEYQAKELLASFG--
SUCB1_CAEEL/25-233---------------------------------------------------------M------LHEHHGMKILQNYE--
SUCC2_STRCO/2-191---------------------------------------------------------D------LYEHQARELFKEHG--
SUCC2_ARCFU/2-195---------------------------------------------------------R------LHEYQAKQIFSKHG--
SUCC_HAEIN/2-203---------------------------------------------------------N------LHEYQAKQLFEHYG--
SUCC_METTH/2-194---------------------------------------------------------K------FYEYSAKEIFRAEG--
SUCB2_CAEEL/21-231---------------------------------------------------------N------LQEFQSKEILEKHG--
SUCC_METJA/2-193---------------------------------------------------------K------LHEYEAKNIFKKYG--
SUCB2_PIG/40-248---------------------------------------------------------N------LQEYQSKKLMSDNG--
SUCC1_ARCFU/2-195---------------------------------------------------------R------LHEHQAKQIFAKHG--
SUCC_AQUAE/2-199---------------------------------------------------------K------LHEHQAKEIFAKYG--
SUCC_BACSU/2-203---------------------------------------------------------N------IHEYQGKEVLRKYG--
SUCB_YEAST/32-240---------------------------------------------------------S------IHEYRSAQLLREYG--
SUCB_SCHPO/24-232---------------------------------------------------------A------LHEYISHDILRKFG--
SUCC_COXBU/2-204---------------------------------------------------------N------LHEYQSKHLLKKYN--
SUCC_RICPR/2-203---------------------------------------------------------N------IHEYQAKEILRKYG--
A2EBX0_TRIVA/11-220---------------------------------------------------------N------ILEWQSKEICAKYN--
SUCC_ECOLI/2-203---------------------------------------------------------N------LHEYQAKQLFARYG--
SUCC_MYCTU/2-194---------------------------------------------------------D------LFEYQAKELFAKHN--
Q5SKV5_THET8/15-207---------------------------------------------------------N------LHEYQAKEILARYG--

PF13549

Q30WE4_DESAG/474-696--------------------------------------------------EALDQ..Q..RQV.LTVAETTGILKAYG--
B5EIR8_GEOBB/481-697--------------------------------------------------QARKE..G..RQV.LSATDVYSIFEAYG--
A7HUK1_PARL1/484-706--------------------------------------------------TALAE..K..REW.LSEAEAKHLLAAYG--
Q1D3M9_MYXXD/505-726--------------------------------------------------SARAE..G..RTL.LTEYESKKLLAAYG--
A2BJ63_HYPBU/14-235--------------------------------------------------QALRE..G..RSK.LLEHEALAVAELYG--
A9EVP6_SORC5/499-721--------------------------------------------------GVRAS..G..RTL.LDEVESKQLMAAYG--
B7K6U2_CYAP7/499-721--------------------------------------------------SVQQS..G..RTI.LTEAESKQILAAYG--
Q02CN5_SOLUE/497-719--------------------------------------------------KARQE..G..RSI.LTEFESKQVLAAYG--
C8X4E1_DESRD/482-705--------------------------------------------------KALEE..G..RAT.LSEPEAKEVLGAYG--
Q2W464_MAGSA/483-705--------------------------------------------------EALAK..G..GGT.LNEPEAKAVLEAYG--
B8CEH1_THAPS/525-748--------------------------------------------------EAQSS..G..RTI.LTELESKQLLSAYG--
C1DBF7_LARHH/480-702--------------------------------------------------TALDE..G..RSV.LSELESKALLAAFN--
Q2LRG1_SYNAS/43-258--------------------------------------------------QAIRE..N..RTY.LMEHECKEILENMG--
D2R7V1_PIRSD/482-704--------------------------------------------------QILKS..S..DGV.LTENASKDLLETYG--
A8I025_AZOC5/478-700--------------------------------------------------AVIGA..G..RSV.LTEVEAKAVLAAYD--
Q1QYL0_CHRSD/482-704--------------------------------------------------GVIAA..G..RSV.LTEPEAVAVLAAYD--
Q0W5Z5_UNCMA/472-693--------------------------------------------------DARKA..G..ISV.L.GLEALPVLEAYG--
Q12E86_POLSJ/490-712--------------------------------------------------QALHE..G..REW.LDGAPAQALLRAYG--
D5CS41_SIDLE/485-707--------------------------------------------------GAMQE..H..RKV.LTEMESKALLAAFN--
Q223I3_ALBFT/478-701--------------------------------------------------DALAS..G..REM.LTEPEAKAVLDACH--
A2SHI2_METPP/474-697--------------------------------------------------RALDA..G..REM.LDESEAKAVLVAYG--
B0CB03_ACAM1/496-716--------------------------------------------------DATAC..D..RTL.LSEWESKQFLQSYG--
B1XHT3_SYNP2/500-722--------------------------------------------------SIRAE..G..RTL.LTESESKKVLAAYG--
A9B7A3_HERA2/473-695--------------------------------------------------QVREA..G..RVE.LGEIEAREVMAAYG--
A5V1W2_ROSS1/474-696--------------------------------------------------RVRSE..G..RVE.LGELEARQVIEAYG--
Q7NLP6_GLOVI/494-729--------------------------------------------------AARQA..G..RTL.LTEFEAKALLAAYG--
C9R913_AMMDK/477-698--------------------------------------------------RARQE..R..RRS.LLSSEAAAVASAYG--
D6Z2N4_DESAT/474-696--------------------------------------------------RRRRS..G..HRQ.LGEVRAKSILGAYG--
Q0KA53_CUPNH/481-703--------------------------------------------------NALRA..G..RAL.LTEPEAKAALAAYG--
E3HYZ8_RHOVT/480-705--------------------------------------------------SVLAE..K..RDL.MTEPEAKAVLAAYG--
A1K623_AZOSB/482-704--------------------------------------------------TALAE..R..RKV.LNEMESKALLAAFR--
B8GPY5_THISH/486-708--------------------------------------------------GVLAE..G..RKV.LGSLEAKAVLSAFR--
Q2LUQ3_SYNAS/506-727--------------------------------------------------KALGE..G..RTL.LNEDESKEFLAAYG--
Q47CI3_DECAR/482-704--------------------------------------------------ALLAE..R..RKV.LSEMESKAILRAFR--
A1RXS7_THEPD/479-701--------------------------------------------------SALKE..G..RTT.LTPSEAAALVGYYG--
Q6MAV5_PARUW/501-722--------------------------------------------------KAQEE..K..RTI.LTEFESKQVLSLYG--
C6C1C2_DESAD/472-693--------------------------------------------------NALRS..G..RSE.LVEFQARDIVTAYG--
Q8DJG8_THEEB/495-717--------------------------------------------------QVRSE..G..RTL.LTEWEAKTVLAAYG--
B0UM89_METS4/27-247--------------------------------------------------RVKAD..G..RDA.LTAPEGRIVCDAYG--
A8ZZJ4_DESOH/481-703--------------------------------------------------TCRQE..G..QTY.LGELEGNEVLSCYG--
Q92Z73_RHIME/480-705--------------------------------------------------RVAAE..G..RRM.LNEPEAKAVLAAYG--
Q7NRV4_CHRVO/480-702--------------------------------------------------AALAE..G..RTV.LSERESKQVLAAFH--
Q2Y8E7_NITMU/478-700--------------------------------------------------GAMQE..Q..RTI.LTAMESKAVLAAFH--
Q6AQI6_DESPS/472-694--------------------------------------------------RSQAS..G..VRR.LGEVRAKKILDAYG--
Q3SEU0_THIDA/481-703--------------------------------------------------SALAH..G..RHL.LNEVESKALLSAFR--
D0L1W1_HALNC/488-710--------------------------------------------------AARSA..G..RKV.LTTRESKAILNAFH--
A1VIA4_POLNA/472-694--------------------------------------------------HVLAE..R..RKV.LTEMESKTLLSAFH--
O29057_ARCFU/463-681--------------------------------------------------KLLES..G..GRV.V.GAEGLPVLEAYG--
B8HP40_CYAP4/501-729--------------------------------------------------TVRGE..G..RTL.LTEAEAKQVLEAYG--
C4ZP31_THASP/482-704--------------------------------------------------MALSE..R..RKK.LNEMESKALLAAFR--
C7RIF7_ACCPU/482-704--------------------------------------------------AVLQE..R..RKL.LSEMESKAILRAFR--
B5HI28_STRPR/17-237--------------------------------------------------GALAE..G..RTA.LTAPEGKAVTDAYG--
Q13N88_BURXL/472-694--------------------------------------------------SVLAE..R..RKV.LTEMESKALLAAFH--
A5D252_PELTS/478-700--------------------------------------------------DVTRD..R..RLT.LLGSEAAEVAIAYG--
D2PSA1_KRIFD/14-237--------------------------------------------------QALAE..G..RSS.LSAPEAKQVADAYG--
Q89QG9_BRADU/95-315--------------------------------------------------QVKAD..N..RTS.LTAPEGKLVCDAYG--
Q2LV27_SYNAS/9-227--------------------------------------------------KGEVK..M..ERL.LLGVEAFDFLEKEG--
B9TF03_RICCO/23-245--------------------------------------------------TARAE..G..RTL.LNEIEAKALLTAYG--
A5D1F4_PELTS/478-699--------------------------------------------------DVKKD..N..RLV.LLGSEAAEVVAAYG--
B8FK52_DESAA/483-704--------------------------------------------------EKLKD..V.DRVT.LPQSEANEILKIYG--
C9ZD67_STRSW/15-235--------------------------------------------------AVRAE..G..RSA.LTAPEGKVIADAYG--
Q2LPY3_SYNAS/483-704--------------------------------------------------KAVSE..E..RTL.LSDRESKAFLAGYG--
D4GVH7_HALVD/472-692--------------------------------------------------TVKDR..D...ET.RLGVEAMELLDAYG--
C0QHK1_DESAH/488-708--------------------------------------------------KAKSQ..G..RKV.LLEHEAKQLLKLHG--
B4RED1_PHEZH/481-703--------------------------------------------------GVLAE..G..RSS.LAPLEIQAVLRAYG--
Q9HQZ0_HALSA/317-537--------------------------------------------------DAADR..G..ATR.L.GVEAMDLLDAYG--
C0QJ02_DESAH/490-712--------------------------------------------------GCLDA..G..KTR.LGELDGIELLKCYG--
C0QHB0_DESAH/487-709--------------------------------------------------GALAE..N..RSW.LTVSEAMAVLAAYA--
Q1LF49_RALME/14-234--------------------------------------------------IAKKE..G..RNA.LTAPEGKLVCDAYG--
D3STG0_NATMM/473-693--------------------------------------------------RVERR.....DDN.RLGIESMALLDAYG--
E6VV76_DESAO/485-707--------------------------------------------------HALDK..G..RTS.LTEPEAKDTLAAYG--
A4J695_DESRM/478-699--------------------------------------------------DVIRD..R..RSV.LLGSEAAVVAEAYG--
A5D034_PELTS/478-700--------------------------------------------------DVIKD..K..RLT.LLGSEAAEVAMAYG--
A4YYL2_BRASO/483-708--------------------------------------------------SALAD..G..RTW.LDPVEISRLLEAYD--
A4SW96_POLSQ/471-693--------------------------------------------------NVLAS..R..RTV.LTEMESKALLSAFH--
A7MH14_CROS8/473-695--------------------------------------------------QACAE..G..VTQ.LDTHEVRPILEAYG--
Q988U3_RHILO/480-705--------------------------------------------------QVARE..G..RRM.LTEPEAKAAICAYG--
D7AUW7_NOCDD/22-244--------------------------------------------------RARAE..G..RTA.LTAPEGRVLADAYG--
B1I353_DESAP/478-699--------------------------------------------------AVKED..N..RLV.LLGSEGAAVVEAYG--
A0B6M1_METTP/11-226--------------------------------------------------QALEE..G..RTY.LMEHESKRILMDVG--
Q20Z65_RHOPB/482-707--------------------------------------------------AAVDD..G..RIW.LDPVEVKALFDAYR--
Q604W6_METCA/481-703--------------------------------------------------GALGD..K..RSL.LSPLETRAILGAFR--
Q3IQS4_NATPD/472-692--------------------------------------------------SVEDR..P...DN.RLGIEAMGLLDAYG--
Q2NFU6_METST/479-700--------------------------------------------------EAKQK..G..RDA.LLGSEAYQVAKAYG--
C6BU19_DESAD/485-707--------------------------------------------------KALSE..G..RQE.LNEPEARRVLAAYG--
A0LJP9_SYNFM/480-702--------------------------------------------------TNLSR..G..RTY.LADADGNEILRCYG--
Q0A9U7_ALKEH/468-689--------------------------------------------------AALTA..G..RDQ.LNEYQAQQLLTAYE--
C0QAQ8_DESAH/481-702--------------------------------------------------AALAE..N..NME.FTEVEAKDLLRAYG--
A5D530_PELTS/478-699--------------------------------------------------DVKKD..N..RLA.LLGSEAAEVIAAYG--
D2U861_XANAP/477-702--------------------------------------------------AALAA..G..QAW.LDPLATTQLLAAYG--
Q11G56_CHESB/480-705--------------------------------------------------KAASE..G..RRM.LTEPEAKAAIEAYG--
B8DM77_DESVM/483-705--------------------------------------------------DALEA..K..RML.LTPAEAHAVLTAYG--
Q7N786_PHOLL/472-694--------------------------------------------------QALEQ..G..NSR.LDTHEVQPILEAYG--
Q1QM20_NITHX/483-708--------------------------------------------------SAVAE..G..RGW.LDPIEVMGVLDAYG--
Q2W7Y3_MAGSA/500-722--------------------------------------------------RGLAE..A..GGN.LTEPDAKALLSAYG--
E3I048_RHOVT/473-695--------------------------------------------------NGLSR..P..DGV.LSEPDSRRLLASYG--
B1LZ43_METRJ/472-697--------------------------------------------------GALRQ..G..AAW.LDPVAVNGLLQAYG--
D3RU01_ALLVD/481-703--------------------------------------------------GVMSE..G..RKV.LGTIEAKAILSAFR--
Q3AFE8_CARHZ/490-711--------------------------------------------------NALVE..G..RRN.LTGYETAEVLKAFG--
B8FE80_DESAA/10-226--------------------------------------------------CVKKE..E..RAS.LTEAESKILLSAYG--
C7LTU8_DESBD/481-703--------------------------------------------------TALDE..D..RNH.LTEDESRQVLAAYG--
B8FIX8_DESAA/9-225--------------------------------------------------RVLSA..G..RKA.LTESESKALLAEYG--
Q12WB1_METBU/472-693--------------------------------------------------DAISN..G..RRT.L.GLESFDILRAYG--
B2FMM9_STRMK/482-707--------------------------------------------------AALAN..G..QQW.LDPLATHELLKAYG--
D3V3Z2_XENBS/472-694--------------------------------------------------QVLDS..G..NTL.LDTHEVQPILEAYG--
B8IED3_METNO/488-713--------------------------------------------------AAVRE..G..RTW.LDPREVAGLFAAYA--
E6WFR2_PANSA/472-694--------------------------------------------------QALDQ..G..ITT.LDTHEVQPVLQAYG--
C4ZKF4_THASP/487-709--------------------------------------------------GALAQ..S..RAS.LTESESKDVLAAYG--
A1S6F9_SHEAM/486-708--------------------------------------------------AALAK..G..KTV.LETYDASAILGAYG--
A3QEK7_SHELP/486-708--------------------------------------------------RAIAD..N..KQV.IETHEASAILKAYG--
C0QFL6_DESAH/13-229--------------------------------------------------AALAS..G..RNA.LLEDDAKKLIAGFG--
Q4XQ92_PLACH/180-403--------------------------------------------------KAFEN..K..NYI.LNEYDSKQILEAYD--
Q1QWA2_CHRSD/486-716--------------------------------------------------SAKQR..G..RDR.LTHQETAEVLAAYG--
B4EUX9_PROMH/472-694--------------------------------------------------DALDK..K..QYR.LDTHQVQPIMEAYG--
A1WTN4_HALHL/467-689--------------------------------------------------AALTA..G..RDH.LNEYQTGRLLSAYG--
O28761_ARCFU/667-877--------------------------------------------------EAIG...R..REW.LSPPEAFELLRCFG--
D3PVJ8_STANL/666-881--------------------------------------------------EALRT..G..GGW.QNAEWSRGLLASYG--
Q082P1_SHEFN/486-708--------------------------------------------------RALDN..G..QTV.VETHQAVDILRAYG--
D3FEQ9_CONWI/670-890--------------------------------------------------RALAE..QPGGGW.LDALATHDLLACHG--
A1RWD9_THEPD/9-229--------------------------------------------------KALSE..N..RKN.LSLGEAFAVCEYYG--
B8CM86_SHEPW/486-708--------------------------------------------------MALSQ..G..KTI.LETHESSSILGAYG--
B9M8K3_GEODF/479-695--------------------------------------------------EARQA..G..RSV.LSATDVYTIFEAYG--
B3LBB6_PLAKH/551-775--------------------------------------------------NALKN..K..NYI.LNEFDSKKILQSYG--
C4XLT1_DESMR/479-701--------------------------------------------------RAFAE..G..RLT.LTDPEAKEVLGYYG--
A4FCG4_SACEN/661-877--------------------------------------------------SAIAE..D.TDGW.LGPDQVQRVLTAFG--
C5B797_EDWI9/472-694--------------------------------------------------QAQTD..G..VTR.LDTHEVRDILACYG--
Q12N16_SHEDO/486-708--------------------------------------------------LARAR..G..QYQ.LATHETGEILAAYG--
Q3IFA9_PSEHT/480-701--------------------------------------------------EFLEE..G..QSY.LPTHQASQILSHYG--
E6VZV8_DESAO/478-699--------------------------------------------------KARRI..G..LQE.LPFADAMSVAAAYE--
C6C0V7_DESAD/480-701--------------------------------------------------NCRKT..G..LTE.LVELDAQQLASAYE--
A0KEL7_AERHH/447-666--------------------------------------------------QALER..K..QLT.LDTHLAHPILQAAG--
Q2NRP0_SODGM/472-694--------------------------------------------------EALDQ..G..ITR.LETHEVRPIVKAYG--
Q47QC0_THEFY/653-870--------------------------------------------------EFLKR..HPEGGW.LPLDQTMEVLGCYG--
C8X6G7_NAKMY/699-910--------------------------------------------------GALAA..G..AGW.LTAAEVERLLAAYG--
Q8IL89_PLAF7/540-763--------------------------------------------------KAIQN..K..SYI.LNEFDSKVILQNYD--
B5YGW4_THEYD/482-700--------------------------------------------------RAISE..G..RSI.PTFFEASEILSAYG--
B1VXP6_STRGG/739-955--------------------------------------------------TAPDP..R..GRP.LTHDEARELLGRYG--
A4FAM1_SACEN/663-876--------------------------------------------------AWLTD..D..LQR.LTDDRTVELLRCYG--
D1BG29_SANKS/695-919--------------------------------------------------RHTRE..G..ERVDLAPAEVRALLACYG--
O50516_STRCO/806-1022--------------------------------------------------HLARG..Q..GLT.LGSQETCDLLGRYG--
C7LRJ9_DESBD/471-692--------------------------------------------------DCLDA..R..KTE.LFGFEVQPLLMAYE--
C5C5J4_BEUC1/666-884--------------------------------------------------RVAPA..E..RRR.LDAPRATELLGAYG--
C5BNQ0_TERTT/484-704--------------------------------------------------TALRS..E..QFQ.LSETESKTILAAFG--
C6WAF3_ACTMD/668-881--------------------------------------------------SVPHA..E..LVK.LDDGTTMRLLACYG--
C4ZP63_THASP/474-692--------------------------------------------------TLLNQ..R..RHI.LSAMESKALLRSFG--
A8B3P9_GIAIC/94-343--------------------------------------------------SASSR..P..DGL.LYEYEAYELFELIG--
Q2SCW5_HAHCH/482-712--------------------------------------------------KIYAS..G..RRV.LTNAESRQILTDYG--
A8B4I3_GIAIC/26-275--------------------------------------------------QASSR..P..DGL.LYEYEAYELFELIG--
A1R5M2_ARTAT/645-861--------------------------------------------------GVTGE..K..IRK.LDAGAAAALLSGYG--
A6W895_KINRD/666-883--------------------------------------------------RALAAHPG..GTA.LGGRERTELLEAVG--
A5FUU0_ACICJ/447-667--------------------------------------------------LARNG..G..RTA.LPQDAGFAILRAYG--
E3IU41_FRASU/495-709--------------------------------------------------GAPRG..A..DGL.LDEPTSQAVLAAVG--
A2F811_TRIVA/22-271--------------------------------------------------KVIAE..R.PDGL.LAEHEVLSIIGDLG--
C7RR50_ACCPU/477-694--------------------------------------------------EAVDA..G..SDV.PSAEQARRVLRAYG--
A1W7H4_ACISJ/481-702--------------------------------------------------.VLAE..R..RNV.LTEMESKTLLAAFH--
A5UN98_METS3/478-698--------------------------------------------------.VKAD..G..RDT.LLGSEAYAVAEAYG--
A9WDH8_CHLAA/474-695--------------------------------------------------.VREA..G..RVE.LGEVEAREVIEAYG--
B7VRZ9_VIBSL/486-706--------------------------------------------------..LDK..D..TVS.LDTHQNSQFFKHFN--
C0ZYS6_RHOE4/678-886--------------------------------------------------.......P..GRW.LSDVEAAALLECYG--
C5AV44_METEA/480-704--------------------------------------------------.ALAE..G..RTW.LDPYAVTELLTAYR--
D4ZKT1_SHEVD/490-708--------------------------------------------------....R..G..KKI.LETHESQEILSAYG--
D5A1V4_ARTPN/500-721--------------------------------------------------KVRHQ..G..RSL.LTEFESKELLALYG--
E0SDH6_DICD3/473-694--------------------------------------------------QALQE..G..TTR.LDTHEVQPILQAYG--
F7PKW5_9EURY/446-663--------------------------------------------------....E..R..DTN.KLGVEAMELLEAYG--
G2IXU4_PSEUL/481-702--------------------------------------------------.ALAE..G..RVI.LSERESKEVLSAFN--
G8PQP7_PSEUV/483-707--------------------------------------------------.ALEN..G..QKW.LTPLQTRELLRAYS--
I0DX01_PROSM/473-695--------------------------------------------------QALQN..N..NLH.LDTHEVQPILQAYG--
M1FE38_9ALTE/482-712--------------------------------------------------NALRA..G..RHY.LTNEEARGVLSDYN--
Q6LIT6_PHOPR/492-712--------------------------------------------------..LAQ..D..ITH.LETHEVRPVLESYG--
Q6N212_RHOPA/482-707--------------------------------------------------KALRE..G..RTW.LDPLEISGLFAAYQ--
Q726Y6_DESVH/483-698--------------------------------------------------.ALEA..K..RQI.LDPAEARAVLEAYG--
Q88GJ8_PSEPK/476-696--------------------------------------------------.ALTG..E..SRL.LDEWQSKQALRAFG--
Q8P3T1_XANCP/482-706--------------------------------------------------.ALAA..G..RRW.LDPVATNRLLAAYG--
V6F1Q9_9PROT/484-706--------------------------------------------------.VMER..G..DNI.LTEAEAKTVLSAYG--

PF15632

A5WBK0_PSYWF/12-367VLQHAIKANTKVLLTGR..NSITYEAQRAQFEQA.....GIRLLTGATSTEMLQK--ID-DKFAFMSH----CQ-AHN..
A7MPT7_CROS8/12-350IQETIQNHGIHHIHTGR..NSQWFEEHRTAIESA.....GATLTTGATGVDWLIL--AD-EKVTFAQF----ME-QNG..
C0Z9Z4_BREBN/4-333CLSFCKKHRIDVFLPNY..RLVEISRHIKEFERQ.....GTQVMIAQEH.QLLED--IS-DKGKLFQL----FQ-DVP..
F9Z982_ODOSD/8-339LMSICKDRNVKAILPQNTAELLLLAKHKKMFSDI.....GVGIVVSNY..DAIEK--AN-NKYKLFQI----AE-SLN..
I3YAU9_THIV6/3-337CLGFCRKRRIDFLWPGK..GVQWLAAHQERFAEQ.....GVRVLTPASA.DHLTT--LM-DKARFYAE----AR-RFS..
A8KXY8_FRASN/5-351ALAACRRHGIDVFVPGR..NMLDVAARVGEFEAA.....GVRVMCSPA..ASARI--FT-TKSGQYAA----MA-ARG..
W0LEM0_SERFO/4-342ILSTVKDHGIRAIHTGR..HALWFESHRKQIESS.....GASLTTGATSTGMFEL--AD-DKVAFAHA----ME-KRG..
F2JJ82_CELLD/4-341CLTFCREHQVDVFIPKR..HMIAIAKRKEAFTEL.....GIKVLVEDDI.ELLEN--FN-NKVKTAEL----FK-SLP..
F8A3W6_CELGA/3-315VVQMCADDEIDVVFPTVDVELPRLAAARDRLTDV.....GTRLASPAL..RTLEA--AL-DKLALARV----CE-RAC..
U5N6U2_9BURK/2-337CLGFCQQHRVDIFVPGK..EATLLAGAQDRFAAL.....GVRMLCCADG.PTLQL--LH-DKARFCST----VR-VPT..
E8U3T8_DEIML/7-342LLDTCARLRVDAFLVGK..EPKSVARRAAEFEAR.....GVHLIVPADA.DTLTL--LD-HKDQFLAG----WD-ADL..
C9LVE5_SELS3/2-335CLEFCKAHHIDIFFPRR..ALTLLSRYREEFLAA.....GTKLAVGSDY.KIMRL--LD-DKAATYAF----FE-ARD..
Q7CKQ4_YERPE/4-342IRHIVKAFDIEAIHTGR..SCLWFEQHRAAIEGL.....GVKLTTGAQCPATFTL--AD-NKVEYAAY----MA-QKG..
R6L1S2_9BACE/13-342LIMICQKCNVDIIFPQNTAELSLLSEYKQKFSDI.....NVKIIVSGY..KSIEL--AN-NKYKLFQI----AE-QQS..
E3EE70_PAEPS/5-337CADFCRRHEIDVFIPRW..NMLDISKHLYLFDDI.....GTEVMVCRDT.ELLEQ--LM-EKDLFYES----IR-QKD..
B5HSJ5_9ACTO/6-337ALDQCQKRGIDVFVPRL..HQAAIVAHRADFAAL.....GTALLAPPP..EAVAV--FH-DKVIAYEA----VK-AVG..
H8GG73_METAL/2-335CLDFCREHRIELFWPGK..EAALACKNRAPFESE.....GVRLMAAADY.PTLTL--LH-NKADFYAD----LP-REV..
Q6FAX4_ACIAD/20-348VLQQAQRLNVKLIIAGH..HAAIYLAEKHRFEQL.....GIRLMAGCDTLDQIEQ--LN-DKSLFTQI----CL-NHS..
Q2RVZ8_RHORT/2-333CLEQCRARGVDLFVPQR..RRQVIGRQRAAFEAA.....GVRLSIMAEP.AVMDL--VD-QKHAFYDD----LI-GSG..
I0DSI2_PROSM/4-341ITRLVEKEKISAIQAGR..NSEWFESHRQQIESL.....GVKLTTGAMSVSALQL--AD-DKYAFAQS----ME-KHG..
J7IZM6_DESMD/16-343CLDFCQKHNINIFIPRY..NVSTLIKFKDLFENL.....GVKVMFVGNS.ETYQL--LD-NKLKTYEA----LK-NKD..
C9ZBJ4_STRSW/6-337ALDQCAKRGIDVFVPRL..HQAALAAHREEFAAA.....GTALLAPTA..EAIEL--FE-DKVTAYEA----VQ-AHG..
D1BH78_SANKS/2-339ALAFCQAHAIDVLLPGK..EMLAIATRAVEFAAL.....GVHVLASPA..PSIAL--LD-DKDATYAS----AS-ALG..
J7U1Y0_MORMO/5-342ILSVTEKYGIQVIHAGR..NIPWFETHRNTITAS.....GPRLITGVASLSDYAV--AD-DKVRFAAE----MA-SHG..
Q4FTP6_PSYA2/16-380VLEQAKNNNVKVLLTGR..NGIDYEAQREKFTAA.....GIRLLTGATSVAALES--ID-DKFAFMQQ----CH-EHD..
Q888T3_PSESM/1-329VLETARSLGVKTIVAGR..VGGIYEAQRARFVAE.....GLDLVTGGTSLQTFLD--VD-DKSRFTAA----AE-AAG..
B8GGE3_METPE/6-335LLSICEDEEVDVVLPQNTLELSVLAENRSSFSSI.....GTSIAVSDA..SAISI--AN-DKFKLMKL----AE-RIG..
D1BIK1_SANKS/4-313VLDMCRDDGVTVLVPTVDVELEGLVARRTEFAAH.....GIQIAAPSA..ETLAS--TL-DKHALALA----CA-GA...
U5LE31_9BACI/6-343CLDFCARNEIDIFIPRK..ENVLISRNLPRFEAI.....GVKVLVCPDP.MLMSF--MD-NKAAIYRS----IE-EKNSA
D7DRZ5_METV3/6-343LIDICKKEEIDVILPQVTNELLPLSKNKKLFNELEDNKNGTKIAISSE..KSIKF--AN-DKFELIKT----CK-KLD..
Q5NWT2_AROAE/3-338CLAFCKEQRVDIFVPGK..EATLIGRHAKRFLDQ.....GVRVLSAAAP.DTLER--LH-DKARFYAE----AC-APS..
Q9RSB2_DEIRA/9-335LLGTCAEHGFDLVLPGK..ERERLAAYRDTFAAQ.....GTQLVVPADE.ATQRH--LE-RKDEFLRG----WD-TDI..

PF13535

B6B6A2_9RHOB/129-318------------------------------------------------------S--MD.NKIETVRI....GN.KAG..
B0NR58_BACSE/114-290------------------------------------------------------L--LM.DKEKMRLL....AE.KYN..
B9DMB9_STACT/529-710------------------------------------------------------A--LN.NKARIPEW.......TAG..
C0WVD3_LACFE/116-306------------------------------------------------------D--LT.DKETFYEA....CE.KYG..
C1F6E3_ACIC5/100-273------------------------------------------------------R--LM.EKSEQVQL....AR.EAG..
C4FBF5_9ACTN/118-307------------------------------------------------------A--VC.DKDTFAEL....CA.AHG..
C7N331_SLAHD/459-648------------------------------------------------------Q--VS.DKVTFHTL....CQ.NVG..
Q3A6W8_PELCD/114-298------------------------------------------------------M--LM.DKLQFYAF....AR.EAG..
D1C2W8_SPHTD/155-337------------------------------------------------------W--IW.DKRRTYDM....AG.QLG..
Q0ACF5_ALKEH/120-296------------------------------------------------------A--VL.DKAETLRL....AK.NLS..
A3CVX7_METMJ/109-278------------------------------------------------------L--AG.NKDKTMQL....AE.SIG..
B8GVA8_THISH/116-296------------------------------------------------------A--AA.DKRTTLEL....AM.QLG..
A5G3Z6_GEOUR/110-292------------------------------------------------------A--VS.NKYTLFQS....AC.RLG..
Q3S8Y0_PSESH/109-293------------------------------------------------------R--LG.GKEYVSSL....IP......
B5XPP6_KLEP3/106-292------------------------------------------------------E--LA.SKYAVGKI....VP.EH...
Q5WS01_LEGPL/99-278------------------------------------------------------L--LS.HKDLMYQK....LD.GS...
Q5WSD6_LEGPA/104-283------------------------------------------------------L--LS.HKDLMYQK....LD.GL...
Q7N5R8_PHOLL/91-265------------------------------------------------------C--VT.NKWRMRKC....LE.DE...
D4GMV9_PANAM/88-261------------------------------------------------------I--AT.NKFLMRNF.......CSG..
N8ZXH9_ACIBI/125-307------------------------------------------------------Q--LN.DKSLFTQI....CL.NHS..
B2Q6S1_PROST/113-295------------------------------------------------------L--AD.DKYAFAQS....ME.KHG..
Q48NB4_PSE14/107-288------------------------------------------------------D--VD.DKSRFTAA....AE.AAG..
E7FN57_9LACO/100-280------------------------------------------------------L--FK.DKYYMRSV....LQ.GK...
B2E5U2_STREE/105-289------------------------------------------------------L--FK.DKYFMRSF....LV.GV...
Q1QXJ8_CHRSD/106-286------------------------------------------------------L--LR.DKALMKRR....AQ.LGG..
A7N2D3_VIBCB/102-283------------------------------------------------------I--IR.DKTRTREL....AN.RCS..
D2QAU0_BIFDB/128-311------------------------------------------------------S--CR.DKVTMKQS....AL.NAG..
A7NRD0_ROSCS/111-286------------------------------------------------------G--IK.RKSEMKRL....FT.RAQ..
C5NY10_9BACL/132-310------------------------------------------------------F--TK.YKSKMKER....FI.KAK..
C5NXU5_9BACL/109-287------------------------------------------------------K--TK.HKSEMKKY....FE.KAG..
A3CN29_STRSV/109-286------------------------------------------------------K--TK.FKSEMKKL....FK.KAG..
A0A034V0G1_ERWAM/99-280------------------------------------------------------F--FR.DKFLQKLK....LS.DV...
C6WFN8_ACTMD/117-298------------------------------------------------------S--MR.DKYVQKDL....VR.GVG..
D9TNI3_THETC/106-294------------------------------------------------------A--FR.DKFYQKKL....LR.GV...
A7N6T3_VIBCB/145-320------------------------------------------------------F--FR.DKIYMKSQ....VN.KMG..
S0AIU0_SERPL/113-299------------------------------------------------------P--FI.NKLRMKAV....IA.AGD..
D3DDW6_9ACTO/102-274------------------------------------------------------P--LR.DKWLMRTR....AA.AAG..
Q01ZL3_SOLUE/109-290------------------------------------------------------H--FR.DKLAMRMK....AR.ECG..
C6W4G0_DYAFD/113-294------------------------------------------------------Y--FR.DKLAMRTK....AL.ESG..
D7W254_9FLAO/112-293------------------------------------------------------Y--FR.DKLAMRQK....AK.DSG..
D7VTF5_9SPHI/110-291------------------------------------------------------Y--FR.DKLAMRQM....AK.DNG..
D9T7Z5_MICAI/109-288------------------------------------------------------A--FR.DKNVMHRR....AV.ELG..
E8RY18_MICSL/111-299------------------------------------------------------P--FV.DKMASKAA....LA.GSG..
D0FMQ8_ERWPE/108-286------------------------------------------------------K--YR.DKQQMKKV....AS.FHG..
F3IMV4_PSESL/114-292------------------------------------------------------R--FR.DKRRMKKI....AQ.KFN..
H3RK27_PANSE/114-292------------------------------------------------------R--FR.DKKKMKEI....AC.RAG..
A0A034UUS3_ERWAM/114-292------------------------------------------------------R--FR.DKKRMKQI....AQ.RAG..
F3IMV3_PSESL/112-290------------------------------------------------------S--FR.DKKAMKEI....AQ.HAG..
A0A034US15_ERWAM/112-290------------------------------------------------------K--FR.DKKRMKEI....AQ.QAG..
Q0RGQ9_FRAAA/107-286------------------------------------------------------R--FR.DKLVMNQV....AE.AAG..
B5SP77_9ACTO/100-278------------------------------------------------------A--FR.DKHVMKTA....AA.AAG..
B4VDU1_9ACTO/110-294------------------------------------------------------V--YR.DKWEMKRA....AV.RAG..
Q0SCF9_RHOSR/101-280------------------------------------------------------A--YR.DKILMKEL....AQ.AAG..
D5WN11_BURSC/115-291------------------------------------------------------R--FR.NTAVTKNT....IA.AAG..
B1HFG7_BURPE/117-293------------------------------------------------------R--FR.DKTEMKRL....LR.AAG..
D0FNI3_ERWPE/106-290------------------------------------------------------L--SR.NKLMMKAA....VA.SSG..
Q0S8A9_RHOSR/103-283------------------------------------------------------I--VN.DKVAMKAA....VA.GCG..
Q12II4_SHEDO/108-288------------------------------------------------------R--VR.DKLVMKHQ....VQ.AAG..
B9B6B5_9BURK/104-287------------------------------------------------------L--VR.NKVLMKRA....VR.DSG..
Q1JXP0_DESAC/85-278------------------------------------------------------L--FK.DKCAFRDL....LK......
C6BWA6_DESAD/85-278------------------------------------------------------S--FK.DKSAFRDM....VR......
Q8TPB8_METAC/85-278------------------------------------------------------L--FK.NKIKFRKL....LE......
C0QL65_DESAH/85-278------------------------------------------------------L--FK.NKLKFREL....TK......
Q3A2P7_PELCD/85-278------------------------------------------------------L--FK.NKVKFREM....TR......
B8J4T0_DESDA/96-289------------------------------------------------------K--LK.NKALTREL....LR.PLD..
E6VR59_DESAO/87-280------------------------------------------------------V--CK.DKARFREV....TA......
D5WN64_BURSC/107-292------------------------------------------------------A--RR.NKFHMIEA....LR.KTA..
F3K8S3_PSESZ/109-294------------------------------------------------------A--RR.DKYTMHES....LK.AVG..
A0A023X9K0_BRAJP/112-298------------------------------------------------------A--RR.DKARLSCA....LT.YAG..
C4L724_EXISA/89-275------------------------------------------------------T--LT.NKAKFRTF....LQ.RHD..
D3DDW5_9ACTO/117-307------------------------------------------------------G--LR.DKLTMREQ....LR.EHG..
B9B6B7_9BURK/48-238------------------------------------------------------Q--LR.NKLFVRQT....LR.QAG..
Q12II2_SHEDO/112-302------------------------------------------------------L--LR.DKHLLRKV....LY.DAG..
Q2SKF8_HAHCH/104-284------------------------------------------------------L--FSIDKSLMRDT....LV.EKG..
D3D707_9ACTO/131-310------------------------------------------------------L--GL.DKHRFRAVESASADHPAG..
Q83Z60_STRCL/126-311------------------------------------------------------T--AN.EKDRLRLA....LG.DVP..
C7Q3P0_CATAD/103-280------------------------------------------------------A--LA.SKTLVRER....MR.SLG..
A8FIK7_BACP2/134-334------------------------------------------------------L--AR.DKSQMRAA....FN.EAG..
C4T7U3_YERIN/81-287------------------------------------------------------R--SR.NKFLMRES....FS.EAG..
C7M0Y2_ACIFD/99-282------------------------------------------------------R--AT.HKDQLRST....LD.RAE..
B8J507_ANAD2/110-303------------------------------------------------------R--AA.DKHAMRAT....LR.DAG..
Q02BT0_SOLUE/124-303------------------------------------------------------A--CL.DKNLARQL....FQ.AAG..
C2CRI1_CORST/134-299------------------------------------------------------P--LR.DKIAFRR........CVG..
D3PFD6_CRAVI/610-811------------------------------------------------------I--AK.KKSATQNT....L..CDRTA
CRNS1_HUMAN/500-699------------------------------------------------------L--AK.QKSLTQLH....LLHHHG..
CRNS1_CHICK/606-804------------------------------------------------------L--AK.QKSRTHQH....LQ.RCR..
C2CRI1_CORST/498-675------------------------------------------------------K--AR.NKFEMRKA....VQSIAP..
B4EQF8_BURCJ/110-298------------------------------------------------------N--VR.DKAATRRV....LD.AVP..
Q0RYD4_RHOSR/107-296------------------------------------------------------R--AR.NKHSMRSA....MA.DQP..
B1SDM3_9STRE/91-282------------------------------------------------------N--AR.NKFLMRKA....ISEENP..
B7GNZ5_BIFLS/108-299------------------------------------------------------N--AR.NKYLMRSA....IALKHP..
A8M0K3_SALAI/103-297------------------------------------------------------R--SR.NKYLMRRA....YE.EGG..
E8SDA7_MICSL/98-270------------------------------------------------------R--CK.DKATMRRA....LA.AAG..
D2B0J8_STRRD/100-269------------------------------------------------------A--TK.NKALTRRR....LA.AAG..
Q121X7_POLSJ/108-282------------------------------------------------------R--AK.NKAQMRVH....LQ.ALG..
Q1QB93_PSYCK/115-289------------------------------------------------------V--FK.DKYLMRTQ....LH.SAH..
A0A034SRJ0_9ENTR/96-265------------------------------------------------------A--AK.EKWRMRQR....LA.QLG..
D4F6G3_EDWTA/108-277------------------------------------------------------A--AK.EKWRMRQR....LA.HLG..
A3UL12_VIBSP/111-283------------------------------------------------------K--AK.NKYLTRQV....LN.EKS..
Q1VG50_VIBAL/111-283------------------------------------------------------K--AK.NKHLTRQV....LN.EKA..
B8CGT7_SHEPW/109-279------------------------------------------------------Q--AK.NKAAMRTK....LL.LAE..
C1DMZ3_AZOVD/112-284------------------------------------------------------A--AK.NKAEMRER....LQ.RLG..
D2UCG0_XANAP/114-286------------------------------------------------------A--AK.NKAAMRQR....LR.AQG..
B0RPV7_XANCB/115-287------------------------------------------------------A--AK.NKAAMRQR....LQ.ARG..
Q1MX58_9ACTO/104-292------------------------------------------------------R--LV.DKLQQRRA....FA.EAG..
D9T106_MICAI/109-294------------------------------------------------------R--LT.RKSLQREA....LA.SAG..

PF02786

PCCA_HUMAN/176-385------------------------------------------------------------DKIESKLL----AK-KAE--
CARY_BACSU/128-334------------------------------------------------------------DREKFRSL----MN-ELK--
PYR1_DICDI/525-729------------------------------------------------------------DRGIFAEK----LS-EIN--
CARB_ECOLI/128-335------------------------------------------------------------DRRRFDVA----MK-KIG--
CPSM_HUMAN/546-750------------------------------------------------------------DRQLFSDK----LN-EIN--
BCCA_MYCLE/122-331------------------------------------------------------------DKVTARHI----AA-RAQ--
PYR1_SCHPO/593-797------------------------------------------------------------DRELFARA----MD-EIN--
ACCC_PSEAE/115-324------------------------------------------------------------DKVSAKDA----MK-RAG--
CARB_YEAST/149-353------------------------------------------------------------DRDLFASA----LK-DIN--
ACCC_ECOLI/115-324------------------------------------------------------------DKVSAIAA----MK-KAG--
ACCC_NOSS1/116-325------------------------------------------------------------DKSTAKET----MQ-KAG--
PYC1_YEAST/135-344------------------------------------------------------------DKVSARNL----AA-KAN--
E9QAT6_MOUSE/514-717------------------------------------------------------------DRRAFAAR----MA-EIG--
K1V2B9_TRIAC/311-514------------------------------------------------------------DRDLFVQA----LN-EID--
BCCA_MYCTU/115-324------------------------------------------------------------DKIAAKNA----VA-AFD--
Q5L0U3_GEOKA/128-333------------------------------------------------------------DREQFRAL----MN-ELG--

PF02655

O27028_METTH/106-265---------------------------------------------------------VE-DKYRLYRR----IRNS..--
Q603D9_METCA/124-284---------------------------------------------------------AA-SKLATTQA----LERHHL--
Y776_METJA/124-282---------------------------------------------------------IS-NKYKTYKK----LKNL.G--
Q7UJD2_RHOBA/127-319---------------------------------------------------------AS-DKWFTAKW----LMEH.A--
Q6LZR0_METMP/123-259---------------------------------------------------------AG-DKFLTYEA----IKNA..--
O29201_ARCFU/107-251---------------------------------------------------------TS-DKWELYKK----LRGE..--
O28027_ARCFU/97-247---------------------------------------------------------VA-NKLKFYRE----LEKA.G--
Q97H24_CLOAB/105-271---------------------------------------------------------CN-DKWKSYEF----FKEN.Q--
Q8TQR5_METAC/109-277---------------------------------------------------------CA-DKVLCTKV----LKKA.G--
Q6M182_METMP/105-262---------------------------------------------------------IS-DKYKTVKK----LENL.G--
Q8TJB8_METAC/125-298---------------------------------------------------------AS-NKLHLAKK----LEAL.G--
O26923_METTH/114-270---------------------------------------------------------CS-DKRLTYRA----LDGR..--
Q8TZ26_METKA/104-247---------------------------------------------------------AA-DKRKTEDA----LRDARS--
Y815_METJA/136-272---------------------------------------------------------AG-NKYLTYLA----IKDA..--
Q8TV12_METKA/118-275---------------------------------------------------------AA-DKLELFNR----LSDV..--

PF02222

PURK_BACSU/115-285------------------------------------------------------------------------I.QSAG--
PURT_METJA/120-294------------------------------------------------------------------------AAEKLG--
PURT_ECOLI/121-295------------------------------------------------------------------------AAEELQ--
PUR6_YEAST/113-285------------------------------------------------------------------------L.IKNG--
PUR6_CANGA/113-284------------------------------------------------------------------------L.VKNR--
PUR6_SCHPO/111-282------------------------------------------------------------------------L.QVFK--
PURK_ECOLI/87-254------------------------------------------------------------------------F.DKLH--
PURK_HAEIN/92-261------------------------------------------------------------------------L.DELN--
PURK_PSEAE/105-272------------------------------------------------------------------------F.KDLG--
PURK_SULSO/109-273------------------------------------------------------------------------Y.RQHN--
PURK_AQUAE/100-266------------------------------------------------------------------------L.KKHG--
PURK_SYNY3/112-284------------------------------------------------------------------------L.QNLG--
PURK_SYNE7/116-285------------------------------------------------------------------------L.TRLG--
PURK_MYCLE/120-300------------------------------------------------------------------------L.AALG--
PURT_BACSU/113-287------------------------------------------------------------------------AAETLG--
PURT_SYNY3/117-292------------------------------------------------------------------------AAQQLG--
M9WZK1_PASHA/123-295------------------------------------------------------------------------..EELG--
PURK_MYCTU/125-297------------------------------------------------------------------------..AAAG--
Q84TI2_ARATH/198-369------------------------------------------------------------------------..SQHG--
PURT_PYRFU/127-303------------------------------------------------------------------------..KEAK--

PF07478

DDL_BORBU/136-344------------------------------------------------------------------------LLKSFD--
DDLB_ECOLI/103-303------------------------------------------------------------------------LWQGAG--
DDL_ENTFA/138-341------------------------------------------------------------------------LLQTVG--
DDL_SYNY3/134-342------------------------------------------------------------------------VFERAG--
VANB_ENTFA/138-337------------------------------------------------------------------------LTKNAG--
DDL_AQUAE/101-291------------------------------------------------------------------------IVKSLG--
MUDD_CHLTR/569-778------------------------------------------------------------------------FMSDLG--
DDL_BACSU/135-338------------------------------------------------------------------------LFAQVG--
DDL_HAEIN/106-303------------------------------------------------------------------------LWKAFG--
DDL_TREPA/143-347------------------------------------------------------------------------LWQAAG--
DDLA_ECOLI/147-348------------------------------------------------------------------------LLRDAG--
DDL_MYCTU/158-363------------------------------------------------------------------------LLAADG--
DDL_LEUMM/142-349------------------------------------------------------------------------LLTVNG--

PF01071

Q20143_CAEEL/100-292------------------------------------------------------------TSKSFSKH----FMKEYG--
PUR2_BACSU/101-293------------------------------------------------------------GSKQFAKD----LMKKYD--
PUR2_ARATH/198-392------------------------------------------------------------GSKNFMKN----LCHKYN--
PUR2_MYCLE/101-292------------------------------------------------------------GSKAFAKE----VMAAAG--
PUR2_HAEIN/103-296------------------------------------------------------------GSKAFTKD----FLARHK--
PUR2_METTH/100-298------------------------------------------------------------TDKSFMRK----LFEDYR--
PUR2_SCHPO/109-301------------------------------------------------------------GSKVFSKD----FMHRNN--
PUR2_YEAST/108-308------------------------------------------------------------ASKAFSKR----FMSKHN--
PUR2_HELPY/105-292------------------------------------------------------------ASKSYMKA----FVKECG--
PUR2_ARCFU/109-334------------------------------------------------------------ASKCWAKD----FLKRIG--
PUR2_METJA/103-304------------------------------------------------------------TNKEFMRN----LFKKYN--
PUR2_CHICK/105-298------------------------------------------------------------SSKSFTKS----FLDRHG--
PUR2_HUMAN/105-298------------------------------------------------------------SSKRFAKE----FMDRHG--
PUR2_SYNY3/103-291------------------------------------------------------------ASKSWTKQ----LLIEAG--
PUR2_YARLI/108-301------------------------------------------------------------GSKTFSKD----FMKKHN--
PUR2_DROME/108-301------------------------------------------------------------ADKKWAKD----FMLRHG--

PF14305

Q7AJR3_BACHD/224-461-----------------------------------ANLSIRLRKKQFGTILPEWL--LD-QKKVAYRF----MDSLH.--
Q8CX82_OCEIH/200-437-----------------------------------ASLTNRMRQYQITGELPEMV--LD-DKKIAYRF----MESQQ.--
Q8A829_BACTN/55-295-----------------------------------EKLQWLKLY...DRHPEYTQ--MV-DKATVKEY----VASIIG--
B9JHB1_AGRRK/64-304-----------------------------------DKIQARKLY...DRNPLFTG--FV-DKAGAKTL----IAERVG--
Q6AIA9_DESPS/77-317-----------------------------------EKIQWLKLN...IRNQDLSK--YV-DKYDVKKI----ISEKTG--

PF06973

I0A0Q1_FERFK/170-355------------------------------------------------------------DIKEKLSD----LK-KSG--
E3GY13_METFV/174-361------------------------------------------------------------EFYEKIEI----MK-KKN--
D1Z1I1_METPS/179-365------------------------------------------------------------EYEKKSKE----RI-RKG--
F6D2X5_METSW/176-363------------------------------------------------------------EFDSKIDS----ML-KRK--
A8AB21_IGNH4/178-366------------------------------------------------------------DYWKRVKE----LK-EAG--
A8M9J4_CALMQ/163-349------------------------------------------------------------..LRKVKE----LA-DKG--
PURP_METS5/151-332------------------------------------------------------------EVKEGIRR----LQ-EKG--
PURP_KORCO/176-365------------------------------------------------------------EFYEKFSE----LK-ERG--
B8D424_DESK1/179-369------------------------------------------------------------DFYKKMKR----LV-NNS--
Q8U3N6_PYRFU/189-380------------------------------------------------------------EFKEKSEK----LI-RLG--
PURP_METST/176-363------------------------------------------------------------EFQNKIQE----MK-ERN--
K4MLW3_9EURY/192-385------------------------------------------------------------.YLEKSQA----LL-KQG--
PURP_SULSO/152-336------------------------------------------------------------EVKEGIQK----LI-ESK--
E0SQP6_IGNAA/182-372------------------------------------------------------------DFQKRFNK----LV-ADG--
F2KQP9_ARCVS/170-356------------------------------------------------------------EFYEKAKQ----MV-EKG--
A9A5F5_NITMS/177-363------------------------------------------------------------DYVKTSEE----KI-KQG--
PURP_UNCMA/179-365------------------------------------------------------------.FDEKMKL----MI-NKG--
PURP_METS3/176-363------------------------------------------------------------EFNKKIDA----MK-ARG--
PURP_METMP/174-361------------------------------------------------------------EFWRKIDE----FK-AKG--
PURP_PYRFU/150-334------------------------------------------------------------DFWRKAEK----FL-G..--
E1QNA3_VULDI/179-369------------------------------------------------------------DFWRKFRK----LV-SDG--
O29983_ARCFU/174-373------------------------------------------------------------DYYEQAER----LL-KEG--
G0EE86_PYRF1/180-370------------------------------------------------------------DLERKLQE----LM-EKG--
F4B7X4_ACIHW/160-347------------------------------------------------------------DFDKKLEE----LE-KDG--
Q8ZYV4_PYRAE/159-346------------------------------------------------------------.LLKKAKR----LS-EAG--
PURP_METJA/174-361------------------------------------------------------------EFYKKAED----LK-KRG--
PURP_METKA/174-359------------------------------------------------------------EFEEKAER----LI-EDG--
D1Z1I2_METPS/172-358------------------------------------------------------------.FHRKFSD----MV-RRG--
F4B7X3_ACIHW/152-334------------------------------------------------------------EVKEGLNK----LL-EAK--
PURP_ARCFU/172-358------------------------------------------------------------EFYEISDE----MV-KKG--
F7XPS6_METZD/191-385------------------------------------------------------------EYMEKAES----LL-KQG--
D3RZQ2_FERPA/169-355------------------------------------------------------------DFKEKAKK----FV-KAG--
R9SKL3_9EURY/176-363------------------------------------------------------------EFNEKIES----MK-KRG--
PURP_NITMS/156-341------------------------------------------------------------DYNTKRNQ----LI-SEG--
PURP_CENSY/156-341------------------------------------------------------------EYESKRLS----LI-ESG--
I0A0P9_FERFK/179-369------------------------------------------------------------DFYRKFNR----LV-NDG--
K0ILQ3_NITGG/143-327------------------------------------------------------------.FEEGARR----LI-DQK--
G0EEZ5_PYRF1/172-355------------------------------------------------------------.VRRGLER----AV-REG--
M9SKX6_9EURY/192-385------------------------------------------------------------.YVEKSQE----LI-RQG--
PURP_METTH/176-363------------------------------------------------------------EFNEKIDS----ML-ERG--
A4YCP1_METS5/159-347------------------------------------------------------------DFQEKLRK----LE-KDG--
D7E8D4_METEZ/189-383------------------------------------------------------------EYLDKANN----LL-DRG--
B1L3X8_KORCO/189-379------------------------------------------------------------EFEERSRE----LL-ERG--
R9T5A2_9EURY/191-385------------------------------------------------------------EYVEKSEQ----LI-KQG--
N0BIZ6_9EURY/179-365------------------------------------------------------------DFLQKSEQ----ML-KQG--
Q980P6_SULSO/161-349------------------------------------------------------------DFEAKLNE----LL-RNN--
PURP_SULTO/152-333------------------------------------------------------------EAKEGLNK----LL-EQK--
H3ZJJ4_THELN/150-333------------------------------------------------------------EFWKKASK----LG-...--
A0B858_METTP/188-379------------------------------------------------------------EYYEKSEL----LL-RQG--
Q4JAU2_SULAC/161-348------------------------------------------------------------DFEEKLNT----LL-KVG--
E1QNA2_VULDI/169-353------------------------------------------------------------.VARGVEE----RV-KEG--
D2RDT4_ARCPA/168-351------------------------------------------------------------DFYKKFEK----LK-AEG--
B8D426_DESK1/170-355------------------------------------------------------------EIEAKLRK----YI-EDG--
A0RW22_CENSY/177-363------------------------------------------------------------DYKEQSKS----KI-ERG--
U6EAL6_9EURY/176-363------------------------------------------------------------EFDQKIES----ML-ERK--
D3E1N5_METRM/176-363------------------------------------------------------------EFDAKIDA----MK-ERG--
E0SQP8_IGNAA/175-356------------------------------------------------------------....KLKT----YV-DRG--
N0BIR8_9EURY/179-375------------------------------------------------------------DYYRQAEE----LI-KQG--
PURP_THEKO/148-331------------------------------------------------------------DFWKKAER----LG-...--
K0IE82_NITGG/179-366------------------------------------------------------------DYKKKSKQ----KI-EQG--
E6N6E4_9ARCH/154-341------------------------------------------------------------.LEKKLGE----MI-AKG--

PF03738

A9WS88_RENSM/12-384-------------------WKQKIEEQVLVFSTSF..TADGQPVE.........Y--WNERAYYEFEL----AEVER.--
A4YN97_BRASO/12-390-------------------WRQTAQQCGFDFCE.......VDGER.........Y--WDERAYYAFSL----AEIEHG--
B0SZP5_CAUSK/12-383-------------------WQAKAEAVGFVYHH.......TEGQA.........Y--WDESAAYAFTL----EQVEQD--
D3UH97_HELM1/10-389-------------------DEKTLEQIGLQWHS......DEDQTP.........Y--ISDE.LIVVSE----EEAEA.--
Q7NXU8_CHRVO/12-377-------------------WQARCEEDGFSIHS.......IDGL..........Y--WNEGYAFRFSG----AEIDA.--
B1ME79_MYCA9/12-385-------------------WEQTVVSQGMCYGTPAR.MADGSDRP.........Y--WDESVHYVFDM----DEVLS.--
B3PBJ7_CELJU/12-388-------------------WRAHAEEVGFLFHT.......FDGEP.........Y--WDETAYYQFSL----RQVEED--
C6WDU1_ACTMD/12-385-------------------WQRTVSDQGLVFGAPAS.RVDGTPRP.........Y--WDESVHYAFDM----SDVLS.--
Q7VK77_HELHP/10-389-------------------DKNVLESMGLTWHT......DMDNTS.........Y--LSDE.LIHISG----AEAEA.--
B8HN62_CYAP4/12-376-------------------WVHKCEDLGFSFHSL.....DPEAGK.........Y--WDESIVYHLTA----AEVDE.--
D2NP05_ROTMD/13-409-------------------WENVIIEEGLTYSVDGPHDTDH.............Y--WNEYAAYIFSP----QEMDS.--
A6WBP0_KINRD/12-396-------------------WRATVEGQGLAYAVAR..GGDGTERL.........Y--WDESAAYVVDV----AEADE.--
A6Q7W3_SULNB/11-391-------------------TTNYLESLGFVWHT......DSDESA.........Y--ISNE.LVVISE----DEAEA.--
Q7MSC7_WOLSU/10-389-------------------SNEFLESIGFAWHT......DPNQTS.........Y--VANE.AVVLSE----AEAEG.--
C5B6G4_METEA/12-387-------------------WRAKAQREGFVFHT.......PAGVP.........Y--WREDAHYAFTL----RQIEHD--
D1AYZ0_SULD5/11-391-------------------SKDFLESIGFYWHT......DSDETS.........Y--VADE.LVLVSH----DEVEA.--
A4F635_SACEN/12-385-------------------WQSKVEELGLVFGTPAR.AADGSQRP.........Y--WDEGVHYEFGL----DEVLS.--
B1M2K4_METRJ/12-384-------------------WRLHAARAGFTFHT.......FDGAP.........Y--WDESAYYAFSL----AEIEDA--
D1A3Z2_THECD/12-380-------------------WERTIEEQGLGFHRYVAQGDDG..RP.........Y--WDESAYYSFTM----AEVLG.--
C6CYE8_PAESJ/19-410-------------------WADLYGEE...........................Y--SLYD.LYDMTK----EEVHK.--
Q7MZH8_PHOLL/12-386-------------------WKVRAKEFGFGFHT.......IDNEP.........Y--WTEDRYYQFTL----KQIEEH--
C1CWU9_DEIDV/12-384-------------------WEARLKQVGFTWYAP....TPEHPVP.........Y--WGEDVAYAFTP----EQIAG.--
A7ZBD7_CAMC1/11-391-------------------NNEFMEKIGFAWHT......DNDNSS.........Y--IADE.IVQVSE----NEANA.--
Q5YS21_NOCFA/12-385-------------------WQRIIEEQGLVYGSPGR.DAHGAPRP.........Y--WDESVHYEFDM----AEILA.--
Q9A5T6_CAUCR/12-385-------------------WEQQAEAVGFTWRH.......ADGRR.........Y--WDERAAYAFTL----GEVEGH--
C6W6C0_DYAFD/11-389-------------------PQAALQKAGWDWAL......GTDTAP.........Y--VVND.MVVVTA----QQAES.--
Q0KFM7_CUPNH/12-388-------------------WPRELEKVGFHFHSL.....DEFNVPREVDDNTFFY--WREDAAYAFSK----QEVET.--
A8ETQ4_ARCB4/10-391-------------------TDEYLESIGFIWHT......DKDNSS.........Y--ISDE.IVVISE----DEANA.--
A0RRF5_CAMFF/10-390-------------------DNEYLESIGFSWHT......DPDNTP.........Y--VADE.LVVVSQ----DECEA.--
Q8ZK95_SALTY/12-385-------------------LDKIACDHGFDFHV.......IDNEI.........Y--WDESRAYRFTL----RQIEEQ--
Q30QI3_SULDN/11-391-------------------KPAQLEELGFTWHT......DSDESN.........Y--ISDT.LVNITH----DEAEA.--
Q89T52_BRADU/12-385-------------------WRQTAAQCGFVFHT.......IDGER.........Y--WDERAYYAFTL----DEIERG--
B6INZ6_RHOCS/12-390-------------------WQARLEALGFDFHS.......GGGVP.........Y--WDETAAWEFTT----AEIDR.--
Q87QT2_VIBPA/12-386-------------------WRELARQFGFGFHS.......MYGQP.........Y--WDESAYYQFTL----EQIEHD--
B4EW39_PROMH/12-385-------------------WREKATEYGFNFHT.......MYGEP.........Y--WCEDAYYQFSM----EEVET.--
C7Q215_CATAD/12-391-------------------WRQAVESQGLVFPVTD..LEDGSVVP.........Y--WYESAHYSFTM----AEVDA.--
Q114E2_TRIEI/12-374-------------------WQQKCEAVGFHFYN.......MYSQP.........Y--WYESACYHFST----SEINE.--
Q01QL8_SOLUE/12-375-------------------WQRKVEEVGLTWHT........GEQT.........Y--WNEAAFYEFTA----KEVDV.--
Q3IWQ4_RHOS4/12-395-------------------WRDRAEELGFTFAD.......MHGEP.........Y--WDETSAYGFGL----AEVEEM--
E8RVG1_ASTEC/12-399-------------------WKARVEAEGMLWHS.......APGLT.........Y--WHEGVAYRFTE----AEIEA.--
Q2S7Y7_HAHCH/12-386-------------------WRDLAHEYGFQFHT.......MHGEV.........Y--WDESAYYQFSL----EQIENG--
C5BUP2_TERTT/12-387-------------------WEQKAAEYGFKFHT.......MYGEK.........Y--WDETAYYQFTL----AQIEND--
Q2G5S8_NOVAD/12-379-------------------WQASVAELGLLWHS.......DADGP.........Y--WDESAAYALSM----EQVET.--
C7MS99_SACVD/12-385-------------------WERIVAEQGLVFGTPAR.YASGEPRP.........Y--WDESVHYVLQM----DEVLS.--
C4K7Y5_HAMD5/12-384-------------------WREKASEFGFYFHS.......MHGKA.........Y--WSEEAYYQFTL----AQIEE.--
D3FUB3_BACPE/20-413-------------------WDRLYGME...........................Y--ALYD.YIPLSN----RQVAE.--
D2SBB5_GEOOG/6-397-------------------WEAEIEAQGLVYNRTD..LPGGEVRS.........Y--WREGPFYDFTM----AEVER.--
D1BLL0_VEIPT/15-434-------------------FVEYEGYDDR.........................Y--PSLS.MQAFSS----DFYDE.--
Q15WJ3_PSEA6/12-386-------------------WQRKAADFGFKFHT.......MHGEP.........Y--WDESAYYQFTL----NQIEND--
Q4K4Q9_PSEF5/12-383-------------------WQATAEQLGFAFHT.......FDGEP.........Y--WDESAYYRFSL----RQIEDD--
Q7MJ95_VIBVY/27-401-------------------WRALAKRYGFGFHT.......MYGQP.........Y--WDESAYYQFNL----QQIEQD--
D2QD19_SPILD/11-389-------------------PTTQLQNLGWDWML......GQDTLP.........Y--LANE.VVTIKS----AEADA.--
Q5FTG8_GLUOX/15-386-------------------WQAEADRLGYHYYR......NADGSF.........A--WREDVRYEFDA----AAVAL.--
D2B8Z4_STRRD/12-384-------------------WESIIEGHGLAYHRSA..HPDGLDRP.........Y--WDESVQYVFSM----DEVLD.--
A1B1F8_PARDP/12-405-------------------WRDKAEELGFTFAD.......MGGEP.........Y--WDETSAYRFTL----REIEED--
B3E4M1_GEOLS/12-372-------------------WQQTVESQGMVYHTI....DD...EP.........Y--WDETACYQFDS----AEIDL.--
D2PYF3_KRIFD/12-390-------------------WRDKVVEQGLVYPMTE..LPDGTERP.........Y--WNESAWYEVTM----EEVLH.--
C5D289_GEOSW/22-423-------------------WADLYGAE...........................Y--ALFD.YYTLTA----REVEQ.--
A0JZG2_ARTS2/12-384-------------------WKQKIEEQGLVFSTTT..MPDGKKIE.........Y--WNESAYYEFTM----DEVET.--
A6L652_BACV8/13-373-------------------.REKIEALGFDFHG.......D.............Y--WREEAYYRFTA----EETAC.--
B2FMH2_STRMK/12-382-------------------WRARAEEAGFRFHT.......IDGQP.........Y--WDESAYYAFTL----RQIEQD--
C5AU12_METEA/12-384-------------------WREIAGDAGFAFHT.......IDGEP.........Y--WDESHAYAFTL----AEIEDD--
D4ZZ36_ARTPN/26-390-------------------WKDKCDEVGFHFYE.......ID.GL.........Y--WNESVCYQFTS----EQIDE.--
E0SI48_DICD3/12-384-------------------WQEKAAEYGFRFHT.......MYGEP.........Y--WCEDAYYQFTL----AQIEE.--
F3ZL76_9ACTO/12-395-------------------WQETVEEQGLVYPLTR..HPDGTFRP.........Y--WDESAYYVFTL----PEVEA.--
I0DVC8_PROSM/16-395-------------------....TQDYGFDFHI.......IDNEI.........Y--WDESHAYCFTL----AQIESG--
O25019_HELPY/12-388-------------------..KTLEEIGLDWHT......NDDMSS.........Y--IADE.MVVVSQ----KEADA.--
Y929_HAEIN/15-391-------------------..QQLLNVGFDYYNL....PSSDGSH.........Y--WSDNVAYEFTL----AEIDR.--
Q0PBD8_CAMJE/11-387-------------------.KDYLENIGFSWHT......DEDGSD.........Y--ISNK.LVCVKE----SEANA.--
Q6LL61_PHOPR/12-386-------------------WRELAAEYGFGFHS.......MYEDP.........Y--WDETAYYQFTL----EQIERD--
Q7CGH0_YERPE/12-384-------------------WREKATEFGFRFHT.......MHGEP.........Y--WCEDAYYEFTL----AQIEE.--
Q7CPS0_SALTY/12-384-------------------WRDKATEYGFNFHT.......MYGEP.........Y--WCEDAYYKLTL----AQVEK.--
Q87YL5_PSESM/12-383-------------------WRATAEREGFNFHT.......IDGER.........Y--WDERGYYLFTE----QQITRD--
Q8P6Y2_XANCP/12-386-------------------WRTQAESLGFQFHT.......IDGEP.........Y--WDESAYYAFSL----RQIEDD--

PF04174

Q0RH44_FRAAA/80-411-----------------------------------------PRLLDGDEWDVIER--GVTQRVQALEAFLADVY---GPA
A9H282_GLUDA/91-422-----------------------------------------PRVLTAAEWDHVNR--GVQQRVTALNHFLWDIY---HER
B6IMV0_RHOCS/77-408-----------------------------------------PRIISAAEWARLEA--GVQQRVKALNLFLHDIY---HDQ
B3E3V9_GEOLS/83-414-----------------------------------------PRIITAPEWSRIES--GLKQRVKALNLFLEDLY---GEQ
Q97YL5_SULSO/75-386-----------------------------------------PRIITSELFFKISN--YLVARSYVLNKFIREVY---QEG
Q970N0_SULTO/87-396-----------------------------------------PRLVSKDFFNKVSR--YLIARSYVLNRLIKEVY---EEK
D0L0C4_HALNC/81-412-----------------------------------------PRVFGANEWRRLEL--GLKQRVRALNMFLHDIY---HDQ
B2HNB5_MYCMM/115-443-----------------------------------------PLVVSAQDWEVLEA--GLVQRSRLLDAVLADLY---GPR
B1M6F7_METRJ/100-432-----------------------------------------PLVIEGPEWAALSA--GIVQRAELMEAILADAY---GEG
B2ICY7_BEII9/94-428-----------------------------------------PLLIEANEWREIAA--GICQRVQLMEAILADVY---GEG
A0QWP7_MYCS2/138-466-----------------------------------------PMVISAEEWDVLEA--GLVQRSRLLDAVLADLY---GER
A1A098_BIFAA/50-378-----------------------------------------PRIIESDEFDRMEA--GLKQRVNALNAYLRDIY---SDK
B4EHB6_BURCJ/116-451-----------------------------------------PLIVTPEDWVVIER--GVLQRVRLLNATLADLY---GPQ
Y2411_MYCTU/100-431-----------------------------------------PRVISAPEWTRLER--GITQRVKALECYLDDIY---GDQ
Q2K491_RHIEC/98-432-----------------------------------------PVLIDEREWQALSA--GLVQRADLLEAIIADIY---GEN
Q6N7S9_RHOPA/71-403-----------------------------------------PRILSAQEWARMEL--GLKQRVRALNMFLRDIY---HGR
Q8Y0C3_RALSO/108-439-----------------------------------------PRIFPAGEWATLER--GLRQRVDALNRFLYDIY---HAQ
Q9HUN7_PSEAE/81-412-----------------------------------------PNLLSAAEWQPIAA--GVAQRARLLNALLADLY---GDQ

PF14403

B0SRE6_LEPBP/78-451-----------------------------------------PRIVPSEEWINIEK--GLKQRILALNLFLNDIY...SER
B2U9B5_RALPJ/95-470-----------------------------------------PRIFPASEWATLER--GLRQRVDALNRFLHDIY...HEQ
Q7UKP3_RHOBA/129-506-----------------------------------------PRIISPDVWTHIDS--GLKQRIRALNRFLSDIY...NER
A2SIW6_METPP/106-491-----------------------------------------PLLIEPADWQVIEA--GIAQRARLLEAMLADCY...GPQ
A8L1J5_FRASN/461-842-----------------------------------------PRVVTAGDWERLQS--GLTQRVRALEAFLRDTY...SER
Q2SNA4_HAHCH/81-457-----------------------------------------PRVMSKKEWDVVDA--GLKQRVKALNMFIDDIY...HDQ
G0A368_METMM/76-451-----------------------------------------PRIFGAKEWQRLQM--GIKQRVKALNAFLHDIY...HDQ
G8TDU5_NIAKG/82-458-----------------------------------------PRIITASEWDHIEK--GIKQRLKALNFFLKDVY...HKQ
R7GX10_9FIRM/44-409-----------------------------------------...ISAASFSLLEQ--GLIQRVQAWNLFLSDIY...GEG
E4PGP6_MARAH/87-466-----------------------------------------PLVLGADEWQWLSK--AVAQRAELLDSVLADLY...GEQ
A6X4S6_OCHA4/70-446-----------------------------------------PRIISGQEWRRLSQ--GIEQRVMALNAFLDDIY...HRQ
C7MDA1_BRAFD/81-458-----------------------------------------PRVIAAEEWRRVSA--GVGQRVRALERFLDDLY...NDQ
E0TD75_PARBH/78-455-----------------------------------------PRVLGASEWDRLAE--AIKQRAKALNAFLYDIY...HRR
M5E9Z3_9GAMM/88-463-----------------------------------------PNIISSDEWGTIEA--GLQERGELFNLLLRDIY...GPG
A5GWV9_SYNR3/98-472-----------------------------------------PRLIDQQDWQRLDQ--GLKQRLEAIDCFLADIY...GKR
G8ANL6_AZOBR/76-451-----------------------------------------PRVISAKEWAHLEA--GITQRVTALNLFLHDIY...HDQ
F7QPB4_9BRAD/100-477-----------------------------------------PRILSGKEWTTLEK--GLKQRVKALNMFLSDIY...HNR
C8XDV8_NAKMY/113-485-----------------------------------------PLVVGDSDWTGLEA--GLIQRSTLLDAMLTDLY...GPG
C7PAP4_CHIPD/82-458-----------------------------------------PRIITGKEWEHIEA--GIKQRLKALNLFLKDIY...NGQ
C5BPD7_TERTT/80-455-----------------------------------------PALISSEEWGVIES--GLLERAELFNAILKDLY...GER
M4S737_9SPHN/75-454-----------------------------------------PLLMGEDEWRGLAR--GIAQRAELLEAILDDMF...GAQ
Q0BUT6_GRABC/74-457-----------------------------------------...ITAREFSTLAR--GLAQRASLLSAMVQDVY...GPQ
B8EIB3_METSB/73-449-----------------------------------------PRIMLRSEWTRLEA--GLLQRVKALNAFLKDVY...GAQ
R6N2N2_9BACE/41-413-----------------------------------------PRIICKTDWDKLEK--GLIQRVNALNLFLYDIY...HEK
Q98HG7_RHILO/95-474-----------------------------------------PLLIEDNEWAAISA--GLVQRAELFEETIADIY...GPN
I0INR8_LEPFC/82-459-----------------------------------------PRIFSRSEWRILSN--GSCQRIRAINAFLYDIY...HGR
R4LWB6_9ACTO/464-838-----------------------------------------PRIVPGDDWEQLQG--GLIQRVRALDAFVNDVY...GER
Q28NW9_JANSC/74-451-----------------------------------------PRIISGREWTRLTR--GIEQRVRALNAFLYDIY...HRQ
I4B961_TURPD/78-451-----------------------------------------PRIIRSDEWASLEG--GLVQRTLALNAFLNDIY...GKQ
G8MNB3_9BURK/97-486-----------------------------------------PLIIDEHEWAAIER--GVAQRARLMEAIVADVY...GPQ
L0G4F9_ECHVK/78-451-----------------------------------------PRIIPNSEWLQLEA--GLKQRINALNHFIQDIY...NDQ
C0Q8Z8_DESAH/78-453-----------------------------------------PRIIENKDWIEIEL--GLKQRIYAMNKFINDIY...HDR
B0RAK7_CLAMS/92-468-----------------------------------------PRVIEQAEWSRLEK--GVAQRVRALEAFLADVY...GPQ
B3E3V9_GEOLS/83-458-----------------------------------------PRIITAPEWSRIES--GLKQRVKALNLFLEDLY...GEQ
E6U6S7_ETHHY/43-414-----------------------------------------PRVIPADQFARLER--GLIQRVCALNLFLSDIY...SKR
W6EFT2_SULMU/57-431-----------------------------------------PRIVSPSEFAYLEK--GIQQRIFALNLFLEDVY...GAQ
D6Z885_SEGRD/105-486-----------------------------------------PLVLSAHDWSSLEE--GLAQRARLFVALLADLY...GPQ
C6CZ87_PAESJ/86-462-----------------------------------------PRVIPKHEWEAVDR--GVRQRTKALNMFIHDIY...HAQ
A6TAV7_KLEP7/78-451-----------------------------------------PRIIPAGEWQRIDR--GIRQRVKALNAFLYDIY...HEQ
A4SY70_POLSQ/99-486-----------------------------------------PLIINTESWQEIQS--GVLQRARLLEAIVQDIY...GPQ
Q2SNA6_HAHCH/93-464-----------------------------------------PMVMSEADWSPIET--GLQQRAHLFSRVLADLL...GPQ
D9QNT2_BRESC/66-443-----------------------------------------PRIIGAAEWEQLEK--GLKQRVTALNAFLKDIY...GPQ
K0I269_9BURK/78-457-----------------------------------------PRIIPAHEWASMQQ--GLVQRVTALNRFIHDVY...HGQ
D9SI67_GALCS/71-450-----------------------------------------PRIIPAREWTRLEQ--GLRQRVRALNAFLHDIY...HGQ
A8LRF1_DINSH/95-474-----------------------------------------PVLLSQEEWTEIAA--GLIARADLLEQVVADLY...GEN
Q0AAK8_ALKEH/80-455-----------------------------------------PRIIERQEWATIQA--GLFQRLRALNLFINDIY...NDQ
F0ST83_PLABD/75-454-----------------------------------------PRLIGGGEWKQVEK--GLRQRIYALNQFVQDIY...NEQ
Q21VI9_ALBFT/96-493-----------------------------------------PLIIEPASWQQIES--GVLQRVRLLERIMADIY...GPQ
H6NBM0_9BACL/88-465-----------------------------------------PRIIPPGEWERLEA--GLLQRVRALNRFLHDIY...HDG
B1HML8_LYSSC/75-453-----------------------------------------PIIIPQTQWAIIEV--GVKQRVEALNLFLQDVY...DEQ
F7QLS6_9BRAD/69-448-----------------------------------------PLLIGEAEWKQISD--GVAQRAELFELILRDLY...GEG
H8GJT5_METAL/83-459-----------------------------------------PRIIAKNEWDTIEK--GLKQRVTALNRFIDDLY...HDQ
A0L4M7_MAGSM/83-454-----------------------------------------PLILDTGNWKALEE--GVIQRHRLLTLLHRDIY...GKQ
C5AZ44_METEA/105-482-----------------------------------------PLVIDAADWAELSA--GIVQRAGLMERIVADIY...GAG
A0JWU1_ARTS2/82-458-----------------------------------------PRVIPADEWTVLEK--GVAQRVRALEAFLNDVY...DKM
I4BBL4_TURPD/78-451-----------------------------------------PRILAGEEWAQLEA--GLTQRITALNLFLEDIY...HDQ
G7US46_PSEUP/77-453-----------------------------------------PRVIPRKEWEVTEA--GLKQRMRALNLFIGDIY...GKQ
Y335_SYNY3/78-454-----------------------------------------PRIIAEAEWRSLEK--GLKQRIKALNCFLTDIY...GPQ
J7QJ85_METSZ/88-467-----------------------------------------PLLIPESEWRDIAA--GVAQRAELLDQILHDVY...GEA
J9SHX4_9ACTO/88-468-----------------------------------------PLVVDGVEWAELEK--AITQRSMLLDLLLRDLY...RDQ
D5BCY0_ZUNPS/86-464-----------------------------------------PRIIDHKEWSHIEK--GVLQRSKALNHFLWDIY...HDK
G0HBD1_CORVD/76-453-----------------------------------------PRLIQRAEFERTER--GLKQRVRALEAFLADVY...GPG
I4ESF5_MODMB/82-471-----------------------------------------PRVLSAADWAHLSA--GVEQRTRALNAFLADVYRPTGRR
A0L4N2_MAGSM/83-457-----------------------------------------PRCIPDGEWQQLEA--GLLQRSQALNAFIHDLY...NDQ
D7A0C0_STAND/71-448-----------------------------------------PRILTGGEWRRMSR--GLEQRVKALNLYLRDIY...SRR
Q0ATT5_MARMM/69-446-----------------------------------------PRIISAREWARLEK--GIDQRVRAINAFLHDIY...HDQ
D5UNK9_TSUPD/57-430-----------------------------------------PVLLSTDEWEPLAR--GAAQRSTLLDALLRDFY...GEQ
C5CSR6_VARPS/152-536-----------------------------------------PLIVSPESWAQIET--GVLQRTRVLDRVMADVY...GPQ
I3Y9R4_THIV6/92-476-----------------------------------------PLLIRSDEWAELER--GLIQRAELFNLILLDLY...GSR
X2GX35_9BACI/76-454-----------------------------------------PIIIPHAQWKMIET--GMKQRVKALNCFLHDIY...HEQ
E8RKL3_ASTEC/78-453-----------------------------------------PRLVSAADWDKLER--GINQRIRALNLFIQDIY...NDQ
K9ULM7_9CHRO/78-453-----------------------------------------PRTVAEGEWQWLER--GLKQRIHALNIFLDDIY...GRQ
B2JQR2_BURP8/100-483-----------------------------------------PFIIDEDEWAQIER--GVKQRAKLLNAIVADVY...GPQ
R5QN47_9PROT/73-432-----------------------------------------PFLMSAEDFELISK--GLIERAHLLNRVLADIY...GEQ
F6IN23_9SPHN/75-454-----------------------------------------PRIITAREWRKLTR--GIEQRVRALNAFLQDLY...HRQ
B0UGL6_METS4/78-455-----------------------------------------PRVLTKPEWGFLER--GLKQRVTALNAFLADIY...GPQ
M5APU0_9ACTN/67-443-----------------------------------------PRIIDGDEWTQVEA--GLAQRLRAVNMFIDDIY...NEQ
D5V7Y1_ARCNC/57-430-----------------------------------------PRIIDSKEFDKLDK--GLSQRIKALNLFLEDLY...THK
M7T6M7_EUTLA/444-819-----------------------------------------PRVIHEHEWQKLAE--GLTQRARALELFLRDIY...SEQ
E4RQ16_LEAB4/78-451-----------------------------------------PRIIRAKEWEHLEK--GLKQRIFALNEFLKDIY...SEQ
Q21G21_SACD2/80-457-----------------------------------------PRVISSKQWERAEA--GLKQRLQALNLFIDDLY...HDQ
Q92M17_RHIME/95-473-----------------------------------------PVLIDEAEWATVSA--GLVQRAELLERVLADVY...GKN
D5V7X8_ARCNC/79-456-----------------------------------------PFVVTKEEWEEVSK--GLAQRAKLLNLIFKDIY...TEQ
I0JSH6_HALH3/77-456-----------------------------------------PIIIPEPQWNKVEE--GMKQRIKALNLFLEDIY...HDQ
G8APY9_AZOBR/89-465-----------------------------------------PLLIPSHEWKAVES--GLIQRATLLNAVLADIY...GPQ
Q31PF7_SYNE7/78-453-----------------------------------------PRLMNATEWWPLER--GLKQRITALNCFLQDIY...NDQ
U5QND4_9CYAN/83-459-----------------------------------------PRIIPNSEWQVLER--GLKQRLYALNLFLKDLY...NDQ
I0IHC7_PHYMF/105-493-----------------------------------------PVVIGPAAWDHLRR--GLEQRARLLEAVLRDLH...GPA
I2EYM9_EMTOG/80-453-----------------------------------------PRVIDSQEWDNLEK--GLVQRITALNLFLQDIY...NEQ
G2IYZ6_PSEUL/78-452-----------------------------------------PRIVPAAEWRALEA--GMRQRVKALNAFLHDIY...HDH
A8EX29_ARCB4/79-455-----------------------------------------PLVITEEEWNEVTK--GLKQRAKLLNLIFKDLY...TEQ
Q13L11_BURXL/97-482-----------------------------------------PFLISEDEWAHIER--GVTQRAHLLNAIVADIY...GPQ
A4CLL4_ROBBH/85-463-----------------------------------------PRIIGAEEWDHIER--GAKQRCLALNKFLWDLY...HEQ
I3TKS7_TISMK/114-492-----------------------------------------PRIVTGEEWSTLSR--GLAQRVRALNAFLTDIY...HGQ
G2IJ61_9SPHN/69-445-----------------------------------------PRIFTAMEWQRLEA--GIRQRAAALNAFLLDVY...NRG
F0JK82_DESDE/78-453-----------------------------------------PRIIEAADWNRLEL--GLKQRIEALNLFIDDIY...HDQ
L0DKM2_SINAD/84-459-----------------------------------------PRLIADDEWRLIER--GLTQRVRALNLFVHDIY...HKR
E3I492_RHOVT/91-466-----------------------------------------PRVITAEDWKTLDR--GVKQRIKALNLFLWDVY...HDR
D2R7T8_PIRSD/92-467-----------------------------------------PLLVQGSEWNKLSA--GLTQRATLLNLILADLY...GQQ
W0DUN0_9GAMM/77-453-----------------------------------------PRVIEASEWQSVAA--GLQQRLRALNCFIDDVY...NEQ
A9B2Y8_HERA2/82-457-----------------------------------------PRLLTAKEWDTIER--GLAQRVTALNLFLRDIY...HEE
Q97YL5_SULSO/75-427-----------------------------------------PRIITSELFFKISN--YLVARSYVLNKFIREVY......
F2IUX9_POLGS/74-450-----------------------------------------PRIISAAEWRRLSA--GIDQRVRALNAFLHDIY...HRQ
R5DYJ0_9BURK/41-413-----------------------------------------PRIIPADEFAEIEA--GLIQRVDALNAFLRDIY...TEK
Q0BV94_GRABC/93-468-----------------------------------------PRIITSAEWAQLEA--GVKQRVTALNAFLHDVY...HEQ
K0CEB2_ALCDB/78-452-----------------------------------------PRIIPEQEWHHLEQ--GTAQRVRALNQFLDDIY...HGQ
B3DZH2_METI4/107-482-----------------------------------------PRLILKKEWEKIKI--GLIQRLRALNLFIEDVY...HDR
Q21VL2_ALBFT/82-461-----------------------------------------PRIIAAQDWAFLER--GLVQRVTALNRFLHDVY...HEQ
A3HSI5_9BACT/83-460-----------------------------------------PMVFESQEWEELDK--GLVQRTELLNLILKDLY...GEQ
C6XLI1_HIRBI/77-454-----------------------------------------PRIISAQEWSKLSE--GIEQRVRAINAFLHDIY...HRQ
C4KD55_THASP/91-485-----------------------------------------PYMLPAAEWAQIEA--AVIQRATLFDRILADLY...GEQ
A8IHP2_AZOC5/108-487-----------------------------------------PLLLEKSDWQVLAE--GLIERAELLEALLADLY...GPG
B1M6F7_METRJ/100-481-----------------------------------------PLVIEGPEWAALSA--GIVQRAELMEAILADAY...GEG
E8R5T8_ISOPI/108-483-----------------------------------------PRIVPASDWAVIER--GLTQRITALNLFLRDIY...HDG
I4ERM1_MODMB/76-452-----------------------------------------PRVIGHEEWSLIER--GVAQRVHALEAFLADVY...GAG
D7DK31_METV0/96-471-----------------------------------------PLLLANEEWRDIEL--GLLERAELLNLILTDIY...GPR
G8SAR1_ACTS5/450-824-----------------------------------------PRIVPAADWAELRA--GLTQRVRALNAFLSDVY...DDR
B4S7R2_PROA2/82-458-----------------------------------------PRVIPSTEWSMIER--GLEQRITALNLFLHDIY...HDQ
B0SXI0_CAUSK/100-478-----------------------------------------PLILGEGEWASIAE--GVAQRATLLEAVLTDLY...GDA
D3RNR2_ALLVD/81-457-----------------------------------------PRIIPQSEWTRVEA--GLRQRVQALNLFIDDLY...HDQ
D5ATU8_RHOCB/90-477-----------------------------------------PVILHETEWETICA--GLTQRADLLEAVMADLY...GPG
F8A772_CELGA/73-449-----------------------------------------PVVVDEDEWARLEA--GLVQRAELLDALLTDLY...GAR
C4XHJ1_DESMR/78-453-----------------------------------------PRIIEAAEWDALER--GLIQRIRALNLFIDDVY...HKG
M1FFR1_9ALTE/77-450-----------------------------------------PRVISSSDWQKLQA--GLRQRVQALNRFLFDIY...HGY
F4KUW8_HALH1/85-463-----------------------------------------PRIIPSTDWNKLER--GLIQRNVALNLFIQDVY...GDR
B2ICY7_BEII9/94-472-----------------------------------------PLLIEANEWREIAA--GICQRVQLMEAILADVY...GEG
T2KQP6_9FLAO/86-464-----------------------------------------PRIIDHDEWQTIEI--GALQRCKALNAFIGDIY...HDQ
A4XVI7_PSEMY/72-445-----------------------------------------PRAIPASEWRIVER--GCIQRVQALNLFLADLY...HDQ
Q9HUN7_PSEAE/81-462-----------------------------------------PNLLSAAEWQPIAA--GVAQRARLLNALLADLY...GDQ
T2G776_DESGI/78-453-----------------------------------------PRVVSAADWDMLER--GLAQRIAALNLFLQDIY...NEQ
D3F1T9_CONWI/90-466-----------------------------------------PRVLSGEEWRSIKR--GLAQRIRALNAFVDDVY...HGR
Q024T8_SOLUE/78-453-----------------------------------------PRIITAAEWDRVER--GLKQRIHALNAFIDDIY...HDQ
W6EC69_SULMU/80-454-----------------------------------------PFVITKTEWKTIKQ--GIKQRAKLFNLILKDLY...GEQ
V5UKH3_9BURK/71-450-----------------------------------------PRIIPAHEWQTLQS--GLRQRVEALNKFIHDVY...HDQ
A1K5W5_AZOSB/82-457-----------------------------------------PLLVSADEWKGIAG--AISQRARLLNAILADLY...GPQ
D5SW41_PLAL2/90-465-----------------------------------------PRIVPAHEWEWLER--GLKQRIQALNLFINDIY...HDQ
H6RQU7_BLASD/80-469-----------------------------------------PRVLDAGTWAALSG--GVAQRHRALNAFLADVYRPAGRR
E3I7X0_RHOVT/90-465-----------------------------------------PIMISAAEWAMLER--GMIQRVQLCDMMVKDFY...GPQ
V4JLU2_9GAMM/100-475-----------------------------------------PRIITALEWAHIEA--GLKQRIRALNLFLKDLY...HGQ
D2AQS1_STRRD/453-814-----------------------------------------PRLVPPGEWAEIQR--ALPQRVRALEAFLHDVY...GGR
Q46JV4_PROMT/79-453-----------------------------------------PRVIGSLEWLGLER--GLIQRLEAIDLFLADVY...GKQ
F6EMC4_AMYSD/64-437-----------------------------------------PLVVSAKEWNRLEA--AMAQRARLLDALLTDLY...GEQ
H1YGG8_9SPHI/83-459-----------------------------------------PMVFSQQEWENIER--GLVQRAELLNLILTDIY...GER
G4T1G6_META2/87-463-----------------------------------------PLLISSEEWAVIEA--GLIQRAELFNLILKDIY...GEQ
D3SAW6_THISK/80-456-----------------------------------------PRVITKAEWERVSE--GLEQRLTALNMFINDIY...NKQ
A4SYS7_POLSQ/71-446-----------------------------------------PRIFTAKEWEQLEA--GLRQRVKALNRFIYDVY...HEE
E2S8M8_9ACTO/77-453-----------------------------------------PRVIEAADWAHVDL--GVRQRVRALEAFLADVY...GPG
B1XPC0_SYNP2/80-456-----------------------------------------PRIIAQTEWDWLEK--GLQQRIEALNHFLDDIY...NEQ
T2KPV3_9FLAO/85-461-----------------------------------------PFLIHQKEWDKIEK--GLQQRSELLNLTLKDIY...GKR
D8IYK0_HERSS/82-462-----------------------------------------PHLVSSEEWDFLER--AVGQRARLMNGLLSDIY...GPQ
F5XHZ4_MICPN/76-452-----------------------------------------PRVIPADDWEIIDS--GVAQRIRALEAFLADVY...ADG
C6XJH8_HIRBI/92-470-----------------------------------------PVLVAEGEWKNICE--GLSQRADLLEEVLNDVY...GDN
A5UYD4_ROSS1/77-452-----------------------------------------PRIIPAAEWSVIER--GLTQRITALNMFLRDVY...HEG
J9ZE54_LEPFM/82-458-----------------------------------------PRILGAEEWSVVAR--GCIQRVRAVNLFLKDLY...HEQ
Q87VL1_PSESM/81-459-----------------------------------------PHIIAADEWQHVAA--GIAQRARLLNAVLADLY...GPQ
A6WDG9_KINRD/445-818-----------------------------------------PRVVLPHEWRQLRR--GLVQRARAIECFLRDVY...GEQ
Q2RNW1_RHORT/72-447-----------------------------------------PRIISKKEWDILSR--GVCQRVDALNRFIYDVY...HDQ
A3I2G3_9BACT/78-451-----------------------------------------PRIISNQEWKKLEA--GLKQRIYALNLFLQDIY...NEQ
R4K5A1_CLOPA/41-411-----------------------------------------PRIINEDKFAMLEK--GLIQRVCALNLFLKDIY...SSR
A9ER80_SORC5/102-480-----------------------------------------PRMLSAADWAHMER--GLEQRVRALGLFLDDVY...GDQ
W0J670_9BACT/89-470-----------------------------------------PLLLGAGDWSLITD--GLRQRARLYNALLNDLY...GAQ
K7SL29_PROA4/76-452-----------------------------------------PRIIEAREWDTISI--GVAQRVYTLERFLGDVY...GSG
G0HFX2_CORVD/24-399-----------------------------------------PRIIDGDVWTELAA--GVEQRARALDRFLADVY...GAS
E3F0J6_KETVY/85-464-----------------------------------------PVLVDDAEWQDITA--GLIQRADLLEQIVADLY...GPA
I2EXR3_EMTOG/104-479-----------------------------------------PFLIHEKEWQQIEK--GIKQRAQLLDLILKDIY...GPQ
F2J4J3_POLGS/92-470-----------------------------------------PVLIDEREWRAIAA--GLVQRADLLEDVVADLY...GAN
W0PM07_9BURK/83-461-----------------------------------------PYVISAQEWGFIEQ--AVTQRAAVINATLRDIY...GPQ
E6W066_DESIS/87-461-----------------------------------------PLLIEGEEWLTVEA--GLLQRACLLDMIMADLY...GPR
A5GKP7_SYNPW/48-421-----------------------------------------PRVIHGADWDGLCA--GISQRHQAINCFVADVY...SRQ
K0EMX7_9NOCA/121-493-----------------------------------------PLLISADDWTRLEA--GLVQRSRVLDEVLTDVY...GPR
Q21G24_SACD2/93-468-----------------------------------------PALISSGQWNKIES--GLLERAELLNALLKDIY...GPR
E4U115_SULKY/80-452-----------------------------------------PLIIEEEQWNLVEE--GLKQRCRLFNLLLQDIY...GEQ
G8QJ99_AZOSU/73-448-----------------------------------------PRVIPADEWKALKA--GLKQRVKALNLFLHDIY...HDQ
B9JS69_AGRVS/97-475-----------------------------------------PVLIADAEWQVLAR--GLVQRAELLEQVVTDIY...SDN
D2R8H5_PIRSD/78-453-----------------------------------------PRIIDGAEWETIER--GLKQRIHALNLFIDDVY...NGR
Q1H4C5_METFK/75-449-----------------------------------------PRILSASEWARLSD--GAIQRVKALNMFLHDVY...HDQ
Q128G8_POLSJ/106-485-----------------------------------------PMMVSAADWAVIEA--GIQQRARLLDRIMADIY...GPQ
R4TEB4_AMYOR/108-484-----------------------------------------PRVITTAEWSKLER--GVAQRVRALEAFLADVY...GDR
M1PA70_DESSD/101-461-----------------------------------------....AAEEWANLET--GLIQRARLLDQILADTY...GAQ
I4B959_TURPD/93-471-----------------------------------------PFLMESSEFSSLER--GLLQRGELLNALFKDLY...GPR
F6AAJ4_PSEF1/81-449-----------------------------------------PNLIPAAEWQTIAA--GVAQRAGLLDKVLADLY...GPQ
M9R914_9RHOB/89-466-----------------------------------------PRIISDKEWTKLSK--GIEQRVYAINAFLHDVY...NRQ
A0QWP7_MYCS2/138-508-----------------------------------------PMVISAEEWDVLEA--GLVQRSRLLDAVLADLY...GER
D4IW41_BUTFI/40-411-----------------------------------------PRIIDKDEFTYLEK--GLKQRVVALNCFINDIY...GEK
G8NWQ7_GRAMM/93-468-----------------------------------------PRIITSAEWATVER--GLTQRITALNLFLKDIY...NEG
W5X656_9BACT/89-465-----------------------------------------PRIVPAAEWRHIEK--GLEQRVRALNLFLHDVY...HEG
D8IYJ5_HERSS/76-451-----------------------------------------PRIIHKAEWARLEA--GLVQRVRALNMFIHDIY...HEQ
E6W510_DESIS/78-455-----------------------------------------PRIITGQEWSALEQ--GLLQRTHAINTFLQDIY...NDK
Q7V148_PROMP/83-457-----------------------------------------PRIISKHDWITLEE--GLKQRLEAIDLFLDDIY...NSQ
M5DPF7_9GAMM/77-450-----------------------------------------PRIIPASEWSMLER--GMRQRVAALNAFLYDIY...HDQ
C7RNC5_ACCPU/82-461-----------------------------------------PLILSAAEWQELAG--AVTQRARLLNAVLGDLY...GPQ
D3RNV5_ALLVD/91-467-----------------------------------------PRLVTAGEWTPIEA--GLKQRIRALDRFIHDVY...HEQ
T2GG29_DESGI/88-464-----------------------------------------PWVIAPADWEQLEA--GLTQRAMVLDLLFKDLY...GPR
D5EIM9_CORAD/78-453-----------------------------------------PRVIPNSEWLQLEK--GLTQRITALNLFLKDIY...NEQ
C6X8X0_METGS/82-476-----------------------------------------PFILPQDEWAHIEA--AVIQRATILNTVLRDIY...GEQ
V6EX40_9PROT/69-445-----------------------------------------PRIIAAKEWKHLST--GCCQRVRALNAFLTDLY...HGQ
F8JB62_HYPSM/71-447-----------------------------------------PRIISADEWRRLEL--GIEQRVRALNAFLYDIY...HRQ
G0JRI0_9GAMM/80-456-----------------------------------------PRIMSRREWTRIEE--GLKQRLQAINLFIDDLY...NEQ
V6EWC9_9PROT/78-453-----------------------------------------PLLLPAAEWDWIAR--AVAQRAGLLNEVMADLY...GKR
E4U113_SULKY/57-430-----------------------------------------PRIIPKSEFDELEE--GIIQRVKALNAFLNDIY...NDQ
D0LFZ3_HALO1/89-463-----------------------------------------PRIIDAAHWQRIER--GLAQRVAALNAFLGDVY...GPQ
D5EPG6_CORAD/86-455-----------------------------------------...LSLEEWQGIER--GVVQRALAFNAYATDLY...SEQ
V4IUU9_9GAMM/92-472-----------------------------------------PLLIRGEEWTSLER--GLIQRAELLNAVLLDLY...GPR
E2SD60_9ACTO/86-455-----------------------------------------PLVVTAEEWAPLEV--GLAQRAELLNAVLVDLY...GPQ
F4B594_ACIHW/66-415-----------------------------------------PRILKKEEFWKISE--GLKSRAEAINKFLYSYY......
A0R101_MYCS2/100-476-----------------------------------------PRVISAAEWSRLER--GIRQRVKALEMYLDDIY...GEQ
F4CSR5_PSEUX/451-831-----------------------------------------PRIISAEDWAMLSA--GLAQRVRALELFLRDVY...GPR
H6N0P2_GORPV/109-487-----------------------------------------PLIIDGVEWAALEK--AITQRSMLLDLILRDLY...RDQ
C0Q902_DESAH/123-516-----------------------------------------...IAAQTWLALEK--GVAQRTRLLGAIHADIY...GSQ
Q1GES0_RUEST/85-462-----------------------------------------PRIISGSEWARLSR--GIEQRVRAINAFLYDIY...HKQ
G2IJD5_9SPHN/91-471-----------------------------------------PILLHATEWRGIED--GLAQRADLLEAVLDDVY...GAG
C7N175_SLAHD/42-411-----------------------------------------.RVIPADDWRNLER--GLAQRVDALNAFLKDVY...GPQ
F2JUM4_MARM1/80-457-----------------------------------------PRTIDATDWKIAEA--GLKQRLTALNQFIDDLY...HDQ
A6VTY9_MARMS/95-470-----------------------------------------PNIIPTDEWLEIEQ--GLAQRSNLFDLILKDLY...GPQ
C6VTV2_DYAFD/86-461-----------------------------------------PFLIEHREWHGISK--GLQQRAVLMDLILKDLY...GPR
C9RNU5_FIBSS/53-431-----------------------------------------PLVITAEEWKTLEA--GVAQRAKLFNALAKDIY...GEQ
Q606G1_METCA/81-455-----------------------------------------PRLIRTEEWRSVER--GLKQRTRALNLFIDDIY...HAQ
S5XRX2_PARAH/68-444-----------------------------------------PRVFSQAEWRKLER--GIKQRARALNAFLRDVY...SRG
Q1ILC9_KORVE/89-464-----------------------------------------PRIVTSAEWARIEQ--GLAQRITALNLFLKDIY...NDG
A4XQ08_PSEMY/81-457-----------------------------------------PNLIPADEWQQIAA--GVAQRATLLNRVLADLY...GPQ
W0IWK1_9BACT/100-477-----------------------------------------PRIIPAAEWESLEA--GLVQRITALNLFLHDIY...HDQ
E3J0R4_FRASU/98-474-----------------------------------------PRLLSGSEWDTIER--GVVQRVRALEAFLADIY...GRA
Q1B008_RUBXD/83-455-----------------------------------------PRIVAAPDWERLER--GIAQRMRALNAFLRRLE......
B1MCG6_MYCA9/121-495-----------------------------------------PLLLDPADWNVLEV--GLTQRATLLDAVLSDLY...GAQ
K9P964_CYAGP/78-452-----------------------------------------PRLIGARDWERLER--GLFQRLEAIDRFLADVY...GDQ
E3IZK2_FRASU/479-878-----------------------------------------PRIVDAADWALIGT--GLVQRVRALEAFLRDVY...ADG
S0ETI1_CHTCT/79-456-----------------------------------------PRIIPAHEWEILEK--GLTQRVVALNLFLQDIY...HEQ
GCS22_FRASC/463-838-----------------------------------------PRIIAADDWTTLTT--GLSQRVRALEAFLHDIY...GER
F5Y2V0_RAMTT/110-485-----------------------------------------PLIVTPQSWQQIET--GVLQRVRLMEGLMADVY...GPQ
K0I395_9BURK/119-505-----------------------------------------PLILSQGDWAHIER--GVLQRARLLDRVMADVY...GPQ
Q3B321_PELLD/82-458-----------------------------------------PRVIPAAEWALIER--GLAQRIAALNLFLYDIY...HTQ
B1Y7B4_LEPCP/163-543-----------------------------------------PLLIAPREWAHIER--GVRQHARLLNAAMADIY...GAQ
G4RA99_PELHB/73-449-----------------------------------------PRVIAAQEWRRLEK--GIEQRVKALNMFLWDLY...HSQ
I1YJX3_METFJ/80-455-----------------------------------------PRVLSKQEWDCTEK--GLVQRIRALNRFIDDIY...NEQ
Q6F9Q3_ACIAD/115-489-----------------------------------------PRVIEKKQWEKISS--GCEQRVKALNLFLDDIY...HNQ
C1D8Z3_LARHH/78-451-----------------------------------------PRILPAADWRLLER--GLTQRVAALNAFLHDLY...HEQ
Q2K491_RHIEC/98-476-----------------------------------------PVLIDEREWQALSA--GLVQRADLLEAIIADIY...GEN
I0KES5_9BACT/98-471-----------------------------------------PRIIESAEWDQMEQ--GLIQRIKALNLFIHDLY...NEQ
A5VFN0_SPHWW/94-473-----------------------------------------PLLIGEDDWAVIAA--GIAQRAELLERLLDDVF...GEQ
K9SBP1_9CYAN/78-453-----------------------------------------PRVVAAAEWDALER--GLRQRIEALNTFLNDIY...HDQ
D1BUY4_XYLCX/84-460-----------------------------------------PRVIEPEEWDTVTQ--GVAQRVRALEAFLADVY...GPQ
B3QX29_CHLT3/81-454-----------------------------------------PRIISGSDWDALEK--GLKQRIEALNLFIGDIY...NEQ
E6XCB5_CELAD/92-469-----------------------------------------PMIFGQEDWNVIES--GLKQRTILLNHILKDIY...GNR
I0JKT8_HALH3/75-452-----------------------------------------PIIIPEEKWKEVEK--GLKQRVEALSHFLEDIY...GEK
A4YF49_METS5/52-402-----------------------------------------PRVISSDFYSRISD--YLVKRNLVLNHLVKEIY......
B7JXY7_CYAP8/80-456-----------------------------------------PRIIDNNQWLTLEK--GLKQRIQALNLFLADIY...DRQ
B8EJ70_METSB/97-475-----------------------------------------PLLIEATEWDQIAR--GVEQRAELLERIIADIY...GPG
C1D2K4_DEIDV/77-453-----------------------------------------PRIIPASEWSALEA--GLKQRVKALNAFLRDVY...SDG
V4ID24_9DELT/78-453-----------------------------------------PRIIERTEWEGLER--GLKQRIHALNLFIDDVY...HEQ
F6IJ38_9SPHN/55-434-----------------------------------------PLIIAADEWAKVER--GLVQRATLMEQLAADIY...GSQ
Q0S0P1_RHOSR/79-449-----------------------------------------PLIVAAEEWEQLAA--GFVQRSRLLDAVLADLY...GPM
E3FXD6_STIAD/86-464-----------------------------------------PRLVSARDWAHLER--GLEQRVRALSAFLDDIY...GEQ
C5C4H9_BEUC1/80-455-----------------------------------------PVLLDEVEWARIES--GLRQRALLLDLVLTDLY...SGA
F8EQ21_RUNSL/86-461-----------------------------------------PFLIEQKEWDHISK--GLKQRALVLDLMLKDIY...GPQ
B0C6M4_ACAM1/78-453-----------------------------------------PRVISAQDWSFLEQ--GLKQRIHALNLFIDDIY...NDQ
H8L089_FRAAD/80-458-----------------------------------------PWLLDAGEWSQLAA--GVAQRAQLLDRLLADLY...GPQ
U5WDZ1_9ACTO/76-452-----------------------------------------PRIIAAAEWRKVEL--GVAQRIRALEAFLADVY...GAG
K9SIE4_9CYAN/78-453-----------------------------------------PRVISAQEWSTLER--GLKQRIYALNSFLCDIY...GDR
X5E9H8_9CORY/446-839-----------------------------------------PRIITESTWDTLSA--GVEQRMRAINAFLDDIY...GDR
B5HY79_9ACTO/76-452-----------------------------------------PRILDALEWDLIQR--GVGQRVRALEAYLADAY...GPA
M5A148_9ACTN/82-458-----------------------------------------PFVVPSDEWQAIER--GMVQRAELLDLALADLY...GER
Q970N0_SULTO/87-437-----------------------------------------PRLVSKDFFNKVSR--YLIARSYVLNRLIKEVY......
D7A2V3_STAND/99-478-----------------------------------------PLVIDAREWRALER--GLIQRAQMMEAVLADLY...GPA
B2HI24_MYCMM/466-845-----------------------------------------PRIVTADEWAQLSQ--GLAQRARALDAFLRDVY...SEQ
R8BNZ8_TOGMI/265-636-----------------------------------------PRVIQGHDWEELSQ--GLTQRARALELFIRDMY...GEQ
L0J1B3_MYCSM/459-838-----------------------------------------PRLVAADEWAELTA--GLGQRAKALNAFLRDIY...SEQ
B0UHH6_METS4/99-476-----------------------------------------PLLIEGDEWAEIAA--GVAQRASLLETILADLY...GEA
H5WQF1_9BURK/127-511-----------------------------------------PFLLGADEWADIEA--GVVQRARLLNATLADVY...GPQ
R5MEX2_9FIRM/41-412-----------------------------------------PRIIPKNEFEFLEK--GLKQRVYALNLFLNDIY...SDK
C6D7E4_PAESJ/92-468-----------------------------------------PRMITTEDWALLSQ--GLKQRVKALNLFIRDIY...HEQ
G0AG01_COLFT/82-462-----------------------------------------PQIISADEWQTLSA--AVVQRARLLNAVLADLY...GPQ
E8X5X7_ACISM/94-468-----------------------------------------PLLIAEDEWRFLEA--GIIQRAELLSRLLEDLY...GPQ
L0H0G6_9GAMM/92-468-----------------------------------------PVLIRSDEWAQLER--GLIQRAELLNQLLLDLY...GPR
Q3J3Q8_RHOS4/70-446-----------------------------------------PRVFTAREWSRLER--GIKQRARALNAFLCDVY...GRG
F0ST86_PLABD/90-464-----------------------------------------PVLFEADEWGVVQA--GIEQRARLVEALTRDLY...GSQ
Q63MZ8_BURPS/116-505-----------------------------------------PLIIAPDDWAAIER--GVLQRVRLSNAILADLY...GEQ
I0HUW8_RUBGI/105-476-----------------------------------------PLLIEPADWAEIEA--GVTQRAALLERVLDDLY...GAR
E4T6L1_PALPW/41-412-----------------------------------------PRVISHKDWLEIEA--GLIQRVNALNMFLEDVY...NEK
M1P4R5_DESSD/79-454-----------------------------------------PRIVSGSDWQQIEN--GLKQRIFALNEFLQDIY...NGK
F4C709_SPHS2/82-458-----------------------------------------PRIITGAEWEEIEK--GIIQRLKVLNLFLKDIY...HEQ
Q1LSE6_RALME/97-492-----------------------------------------PLLVPEQDWATIEA--GVAQRATLANAIMADIY...GPQ
I3UHK4_ADVKW/76-451-----------------------------------------PRVFPQREWNALQR--GVEQRVRALNMFLHDVY...HDK
Q47BP2_DECAR/82-462-----------------------------------------PLIIPPDEWAEVSA--AVAQRATLLNAILADLY...GEQ
C1F5V5_ACIC5/89-464-----------------------------------------PRIVTHQEWEIISK--GLEQRIMALNLFLRDIY...HEG
A7HUH2_PARL1/72-448-----------------------------------------PRILEAAEWRQISD--GLIQRVRALNAFIADIY...GSQ
Q2K5G4_RHIEC/64-440-----------------------------------------PRIISAREWRKLAQ--GIEQRVIALNAFLDDIY...HKQ
Q2W953_MAGSA/89-464-----------------------------------------PRVITAGEWSRLEA--GIIQRVTAINLFLADLY...GDQ
A1VL53_POLNA/82-473-----------------------------------------PMILPHDEWAGIEA--AVIQRATLMNRLLIDVY...GEQ
A9WEG4_CHLAA/89-465-----------------------------------------PRIIAADEWQHIER--GLHQRIVALNLFLHDVY...HNE
Q218C2_RHOPB/118-497-----------------------------------------PLLIDETEWQQIAA--GIVQRATLLESVLTDLY...GDG
V5SC31_9RHIZ/79-455-----------------------------------------PRIISAAEWRRLSA--GIEQRVKALNAFMYDIY...HRQ
U5N9E3_9BURK/82-456-----------------------------------------PRLIEFQEWKRIEA--GLQQRLKALNCFINDVY...NSQ
A1WTU0_HALHL/80-456-----------------------------------------PRVVDAREWAQIEA--GLKQRLAALNALIEDLY...NDQ
F4H3E4_CELFA/85-461-----------------------------------------PRVVAGDEWEHVAP--GVAQRVRALEAFLADVY...GAQ
Q2W951_MAGSA/64-438-----------------------------------------PLILSAEEWSAIAE--GIEQRASLLDSVLADLY...GER
C7M0S6_ACIFD/80-452-----------------------------------------PRILTESAWRHIAA--GVRQRVRALEAFLDDVY...GAQ
I0IBX7_PHYMF/88-478-----------------------------------------PRVIAADEWARLED--GLGQRILALNKFLEDLY...GEQ
D5SW43_PLAL2/94-470-----------------------------------------PLIIPPDQWQKLAR--GLSQRAYLLNMIIRDLY...GEQ
B2IBI8_BEII9/64-441-----------------------------------------PRLLGRGEWARLET--GLVQRVKALNMFLADIY...GPQ
Q89QZ4_BRADU/99-478-----------------------------------------PLLIDEADWKQLCD--GITQRAELLELVLRDIY...GEG
G4QF49_GLANF/81-457-----------------------------------------PRLIDAKEWVEIEA--GLKQRVKALNMFIDDLY...NDQ
B3PB23_CELJU/109-484-----------------------------------------PLLISSDEWETTEA--MLVERADVFNLLLQDIY...SDR
Q2RR86_RHORT/95-470-----------------------------------------PLLLDAREWGYIEY--ALTQRATLFNAVLADLY...GNR
F2JUM7_MARM1/91-468-----------------------------------------PYLIESESWTTLER--GMEQRSKLFDLIMKDLY...GEQ
B8HRP7_CYAP4/78-453-----------------------------------------PRIVSAPEWRSLEQ--GLKQRIHALNLFIADIY...GDQ
D0LCP0_GORB4/105-485-----------------------------------------PLIVDGVQWAALEK--ALAQRSMLLDLLLRDLY...RDQ
J7Q8I4_METSZ/74-451-----------------------------------------PRILARSEWATLEK--GLIQRVAALNAFLADIY...GAG
Q9RST1_DEIRA/78-454-----------------------------------------PRIIPASEWAHLEA--GLTQRVRALNAFLNDIY...HDA
A9IGX3_BORPD/78-453-----------------------------------------PRIIPADEWQRLDA--GLKQRVRALNLFIHDIY...HGH
B6IS70_RHOCS/100-479-----------------------------------------PLLLPAEEWRAIAD--GVMQRARLLETVLADLY...GGQ
E6WAD2_PANSA/78-451-----------------------------------------PRIIPASEWAMLDR--GIRQRVQALNAFLHDIY...HQQ
D5X041_THIK1/107-484-----------------------------------------PLLVDAASWKQIST--GIAQRAALLNTILADLY..TGPQ
D4Z3J5_SPHJU/69-445-----------------------------------------PRIFTGQEWRVLDK--GIRQRARALNAFLHDVY...HRG
A9CFS0_AGRT5/94-472-----------------------------------------PVLIDDREWTVLSE--GLKQRANLLEAMVADFY...GEN
C8XB79_NAKMY/89-466-----------------------------------------PRVIGLADWDAIRA--GLQQRARALNAFLDDVY...GEL
A7ICN1_XANP2/116-495-----------------------------------------PLLIEDADWQALSA--GLIERAELLEVVLQDLY...GAG
C9RNU3_FIBSS/78-452-----------------------------------------PRIVSAADWKHLEA--GLKQRTEALNCFLTDIY...NDR
E6XCB0_CELAD/81-455-----------------------------------------PRIIDHKEWTHLER--GLQQRIKALNLFIQDIY...NDQ
Q9A7W7_CAUCR/132-507-----------------------------------------PRIIPASEWARIEA--GLTQRLRALNLFLADIY...GDQ
W0AN09_9SPHN/101-481-----------------------------------------PLLIPEADWSGIAE--GVAQRARLMDMLLADIY...GAQ
B3PB14_CELJU/144-520-----------------------------------------PRIIPQREWQKTER--GLIQRLTALNCFINDIY...NDQ
L0EIL5_THECK/82-458-----------------------------------------PRIIPAEEWSVIEK--GIEQRVRALNAFLADIY...HEQ
Q3IZ98_RHOS4/91-466-----------------------------------------PVLIDEAEWQRLGE--GLIQRADLLEALMADLY...GAN
Q8G3Z1_BIFLO/50-423-----------------------------------------PRIIESDEYDELEK--GLKQRVNALNAYLKDIY...SDK
K8GRH5_9CYAN/78-453-----------------------------------------PRIVAAADWELLEK--GLKQRIHVLNLFLSDIY...SDQ
D7CQX8_TRURR/71-448-----------------------------------------PRVIPAHEWAHLEA--GLIQRVRALNLFLRDIY...FEQ
F5XQ98_MICPN/112-486-----------------------------------------PLVLAEREWSAVEA--GVVQRAELLDAIVADLY...GAQ
B8GP14_THISH/88-465-----------------------------------------PLLMDSGEWAGIET--GLIQRAELLNLVLRDLY...GPR
H0PZ42_9RHOO/82-465-----------------------------------------PFILPIEEWAQVEA--AVAQRAHLLDRVLADLY...GPQ
C8X6V2_NAKMY/76-452-----------------------------------------PRIVTAAEWQTVEK--GVPQRVRALEAFLADVY...GQG
G4STX3_META2/80-456-----------------------------------------PRIIDAKEWHIIER--GLKQRLSALNCFISDVY...DKQ
F8JC31_HYPSM/93-469-----------------------------------------PVVISAAEWRGLER--ALIQRARLFDAILNDVY...GDQ
B0SRE3_LEPBP/88-469-----------------------------------------PLVMESEEWRILER--GLNQRADLLDALIRDVY...SKR
D3RNY4_ALLVD/92-467-----------------------------------------PLLIRSDEWAELER--GLIQRAELLNLILRDLY...GPR
D4Z5U6_SPHJU/89-469-----------------------------------------PLLIGAREWTHIEQ--GLVQRAQLLERVISDIY...STQ
R5Q6H1_9PROT/83-461-----------------------------------------PRILSNCEWEKLNA--GICQRVKALNAFIEDVY...TTR
D5UGA1_CELFN/71-440-----------------------------------------PVVVDEPEWTRLEA--ALTQRAELLDAVLHDLY...GPR
Q7UKP6_RHOBA/109-485-----------------------------------------PMAIAEQDWNRLAT--GLAQRTRVLEAILADLL...GPQ
S6AN44_9PROT/80-455-----------------------------------------PRIVEASDWQYIER--GLKQRIHALNLFLDDIY...HEQ
G2LL60_CHLTF/77-452-----------------------------------------PRVIAAREWAWIEA--GLQQRIRALNAFIADVY...GEQ
Q11PG7_CYTH3/85-463-----------------------------------------PRMIPSEEWKTIEV--GIKQRNKAINLFLWDIY...HEQ
B1Y7B7_LEPCP/74-453-----------------------------------------PRVIPAHEWREMEK--GLRQRVTALNRFIHDVY...HGQ
I0GQY2_SELRL/41-411-----------------------------------------PRQIEARDYEMLEK--GLRQRVTALNLFLADIY...GKK
N0AX77_9BACI/79-455-----------------------------------------PRIIPANEWNMIER--GVKQRVTALNQFIRDIY...HEQ
G4R7I5_PELHB/93-472-----------------------------------------PLLIAEDEWRGIEA--GLAQRADLLETVIADIY...GNN
W0AGS8_9SPHN/46-423-----------------------------------------PRMFTWSEWSRLSD--GLVQRVQALNAFLDDIY...GER
Q7APS0_MYCLE/130-499-----------------------------------------PLLVSATDWEVLEA--GLIQRSRLLDAVLTDLY...GPR
A9H282_GLUDA/91-466-----------------------------------------PRVLTAAEWDHVNR--GVQQRVTALNHFLWDIY...HER
C7JDF7_ACEP3/93-468-----------------------------------------PRVITAQEWDHVER--GVQQRIQAINLFLHDIY...HDR
G8QJ93_AZOSU/82-464-----------------------------------------PLIIPADEWRQLAA--AVAQRATLLNAVLADLY...GPQ

PF08443

RIMK_ECOLI/97-286------------------------------------------------------A--RD--KLRSMQLLA-------RQG
COFF_METJA/94-282------------------------------------------------------T--SD--KFKCIKLLA-------KNK
RIMK_HAEIN/105-293------------------------------------------------------A--RD--KWKSLQLLL-------KAG
Y016_MYCPN/90-287------------------------------------------------------A--DN--KALSHAVLA-------QHP

PF02955

GSHB_SYNE7/132-305----------------------------------------------------------E--KMY.ALQFQ....---S--
GSHB_SYNY3/132-305----------------------------------------------------------E--KMY.TLQFA....---A--
GSHB_SHEON/124-298----------------------------------------------------------E--KLF.TAWFS....---E--
GSHB_RHOPA/124-297----------------------------------------------------------E--KLF.VMDFT....---E--
GSHB_BUCAI/129-303----------------------------------------------------------E--KIF.TSWFP....---D--
GSHB_PROMM/119-292----------------------------------------------------------E--KLG.ALRFN....---N--
GSHB_CHRVO/123-297----------------------------------------------------------E--KLA.ILHFP....---E--
Q73I56_WOLPM/115-287----------------------------------------------------------E--KLI.TSLFP....---E--
GSHB_PROMA/119-292----------------------------------------------------------E--KLG.ALRFS....---K--
GSHB_RALSO/123-297----------------------------------------------------------E--KLA.IAQFR....---E--
GSHB_CAUCR/125-298----------------------------------------------------------E--KLF.VTDFP....---G--
GSHB_BUCBP/125-300----------------------------------------------------------E--KLFTTTHFP....---Q--
Q7CU65_AGRT5/135-315----------------------------------------------------------N--KLY.FQSFP....---E--
GSHB_YERPE/124-298----------------------------------------------------------E--KLF.TAWFP....---E--
GSHB_THEEB/132-305----------------------------------------------------------E--KMY.ALQFT....---S--
Q6LMM4_PHOPR/124-298----------------------------------------------------------E--KLF.TAWFP....---E--
GSHB_PSESM/125-299----------------------------------------------------------E--KLF.ATLFP....---Q--
GSHB_COXBU/125-299----------------------------------------------------------E--KLF.TGWFP....---H--
GSHB_WIGBR/124-297----------------------------------------------------------E--KIS.TLSF.....---K--
GSHB_NOSS1/132-305----------------------------------------------------------E--KMY.ALQFT....---K--
Q6LH85_PHOPR/128-308----------------------------------------------------------N--KLY.TASLPDPNN---E--
Q6F702_ACIAD/123-297----------------------------------------------------------E--KLF.ATQFP....---E--
GSHB_GLOVI/128-301----------------------------------------------------------E--KLY.ALHFP....---D--
GSHB_PROMP/119-292----------------------------------------------------------E--KLG.ALRYS....---H--
GSHB_SYNPX/119-292----------------------------------------------------------E--KLG.ALRFS....---R--
GSHB_ECOLI/124-298----------------------------------------------------------E--KLF.TAWFS....---D--
GSHB_NITEU/126-300----------------------------------------------------------E--KLA.ITEFP....---R--
B9KHS2_ANAMF/116-287----------------------------------------------------------E--KLL.PLSFP....---K--
Q2KDE2_RHIEC/126-297----------------------------------------------------------E--KIF.VTEFS....---D--
Q2YQU6_BRUA2/124-296----------------------------------------------------------E--KIF.VTEFP....---D--
Q6G4U0_BARHE/122-294----------------------------------------------------------E--KIF.VTEFP....---D--
GSHB_BORPE/128-301----------------------------------------------------------E--KLA.ITEFP....---D--
GSHB_NEIMB/128-301----------------------------------------------------------E--KLA.ILNFS....---R--
GSHB_XYLFA/125-297----------------------------------------------------------E--KLA.AQLFP....---Q--

PF14398

X4ZY76_9BACL/99-361-------------------------------------------YNHLTFLNRP.L--RN..KWTIHQTFS-------QKG
H6N9W5_9BACL/97-358-------------------------------------------YAKLRYLSRK.L--AN..KWTVHQALA-------EHD
D9SQR1_CLOC7/173-431-------------------------------------------..GDTLFNNY.I--FN..KWEAHKWLW-------CFD
E6TW69_BACCJ/104-361-------------------------------------------QKKCLYLNYPNG--FD..KWENHKHLQ-------KCE
C5D6K4_GEOSW/101-357-------------------------------------------DEHVLMFNHR.F--LH..KWEVHECLM-------SHP
C3AKF1_BACMY/89-337-------------------------------------------.DRIPFTSHS.I--GD..KLSVYNRIK-------KAK
U5L780_9BACI/206-461-------------------------------------------ELGIPMFNDC.F--LS..KDLVYDILA-------GEE
H6N9W6_9BACL/111-370-------------------------------------------HRQIHFFNPS.F--FN..KWTLFEWLS-------KSK
U5L622_9BACI/95-349-------------------------------------------RSDILFLGHG.L--PN..KLELYKILA-------Q.S
E6TUF4_BACCJ/193-449-------------------------------------------KYEIPWFNPG.F--FD..KSKIYDILI-------QLD
G2TQ04_BACCO/180-436-------------------------------------------EKGIDFFNAK.Y--LT..KMEVYECLY-------ANR
D3ECN5_GEOS4/201-461-------------------------------------------RFGTHIFNEK.F--LD..KSDVFEALG-------PDA
Q5L2A7_GEOKA/101-353-------------------------------------------..NGMMFNHR.F--LH..KWEVHCHFE-------RHE
L0EEL9_THECK/99-359-------------------------------------------YAHHLFLNKP.I--GN..KWSVYRTLA-------RDT
Q65LV1_BACLD/183-435-------------------------------------------EYRIPWFNPG.F--FN..KWEIYECLQ-------QDE
A6TTN5_ALKMQ/179-435-------------------------------------------KMGDKVFNSY.W--LNLDKWETWEFLS-------NNP
A6TTN9_ALKMQ/124-381-------------------------------------------EFDIKLINYLYC--FN..KWEIYEHLS-------DYQ
C6CSP5_PAESJ/175-432-------------------------------------------SLGRAVFNNF.R--LD..KWSMHKLLS-------RNG
X2GSI3_9BACI/89-340-------------------------------------------KKEIPFTTHS.I--GN..KWNVMERLK-------EAK
YHED_BACSU/183-439-------------------------------------------EYQIPWFNKT.F--FN..KWNVHQLLE-------KDP
B2A793_NATTJ/122-377-------------------------------------------QFGARFINPLQS--FD..KWTTYKHLQ-------KYP
D5WPR5_KYRT2/178-432-------------------------------------------QRGIAVFNSG.F--LD..KWSTFRILR-------RVS
C0Z7V3_BREBN/98-355-------------------------------------------DRNITFLGHG.L--SG..KWQVHQMLA-------KSP
H6N9W9_9BACL/114-386-------------------------------------------EPGVQLLGSP.L--PG..KWDVHRHLE-------RDG
B0TBC3_HELMI/173-432-------------------------------------------.PGLILFNPR.Y--LD..KWETHRLLQ-------QHA
L0EHT1_THECK/189-448-------------------------------------------.KNIPFFNWS.F--FN..KSDVYDLLQ-------GDP
Q5L2A8_GEOKA/95-348-------------------------------------------RPDLTFLGYG.L--PG..KWDVYEALS-------SHP
D5XE96_THEPJ/202-459-------------------------------------------VPGLHHFNPR.F--LN..KWETHTILS-------RNP
E6TWB3_BACCJ/112-368-------------------------------------------....KQINPKHD--FN..KWELYEKLS-------KGR
B2A4H4_NATTJ/115-372-------------------------------------------EMNVKKLNSGPT--FN..KWHVLKVLK-------ENN
Q0AXS1_SYNWW/108-363-------------------------------------------HEGLYLFNSR.Y--LD..KWEVYQTLS-------SHP
Q5L2A9_GEOKA/180-435-------------------------------------------TYGIPIFNGC.F--FN..KWDIYRRLA-------AHP
B0TBC2_HELMI/102-354-------------------------------------------.QGDVLFNPG.Y--LS..KAVLYRTLS-------GSA
C8WWN4_ALIAD/106-365-------------------------------------------AYGDRFFNDG.F--FD..KWQIYEWLR-------RSP
G8PVT0_PSEUV/181-438-------------------------------------------ALGSHIYNPG.F--FD..KWEVHEHLM-------HGQ
F2JGI6_CELLD/92-336-------------------------------------------...IPCTTFW.V--GD..KMMINNRLK-------KGG
Q65LV0_BACLD/95-349-------------------------------------------YPKTTFLGLG.L--PD..KWTVYKALK-------ADP
E6TUF6_BACCJ/194-450-------------------------------------------EMNIPHFNDR.F--IH..KWDTFSYLF-------EEP
D5XE97_THEPJ/198-454-------------------------------------------...DKFFNPK.F--FD..KWRTHLWLS-------EHA
C6CSP4_PAESJ/88-343-------------------------------------------NSGIPFAGDW.L--GN.DKWSIHKHLL-------VNS
X4ZAE7_9BACL/107-363-------------------------------------------YPGIRLYNPY.F--FN..KWSLFEWLR-------GSN
X4ZY81_9BACL/193-452-------------------------------------------RYGTHFFNEK.F--LD..KSEVFEALR-------RDP
C0ZF03_BREBN/84-336-------------------------------------------.QKKTVFNGLVV--RD..KRKVHQMLW-------KNE
D5DAR3_BACMD/184-435-------------------------------------------EHDVPFFNAR.Y--LN..KWTVYQQLK-------DVV
D3ECN8_GEOS4/108-364-------------------------------------------HPHIDLYNPH.F--FN..KWRLFAWLN-------KSR
D3EDF9_GEOS4/102-361-------------------------------------------...LLFLNRP.L--RN..KWTIHQILS-------TKK
C6D8D5_PAESJ/117-373-------------------------------------------DPRIKLFNPS.F--FN..KWYLFEWLR-------GSK
X4ZNC4_9BACL/96-352-------------------------------------------AYGVKVFNRQSR--YG..KDEIHRLLE-------LDS
D3ECN7_GEOS4/188-448-------------------------------------------KRNIKFFNWA.F--FN..KSDVYSQLD-------GDL
B2A820_NATTJ/90-335-------------------------------------------RKKIPFTKNL.I--HD..KLGFYVLMN-------KTG
H6N9X0_9BACL/194-451-------------------------------------------RYNAVMFNEK.Y--LN..KTEVFDALR-------KET
E6SGJ6_THEM7/177-435-------------------------------------------.RGTRLFDTE.C--AD..KWTVYRWLS-------ARP
A9U6Q2_PHYPA/91-347-------------------------------------------QSGIELYNPF.F--FN..KWNLFEWLK-------KSK
U5L7E4_9BACI/184-442-------------------------------------------DYLIPWYNPG.F--FN..KLDVFERLQ-------QEE
D5DAR1_BACMD/181-436-------------------------------------------DYGIPFFNPD.F--FN..KWEIHELLK-------LNE
C3AI09_BACMY/189-446-------------------------------------------KYTIPWFNPG.F--FN..KWNIHQLLT-------NEK
E6TWB5_BACCJ/110-362-------------------------------------------....KFINSPKG--FN..NWVAYNHLN-------QSP
C0Z7V2_BREBN/197-455-------------------------------------------YPNLPMFNQG.F--FN..KWGVHQLLY-------PNP
C8W2K2_DESAS/636-889-------------------------------------------RENTALINSRRF--FG..KYQTIQSIK-------FLN
D5XE94_THEPJ/106-357-------------------------------------------AYGKRFFNPF.F--LN..KWSIYRILA-------SYR
C0Z7V4_BREBN/195-456-------------------------------------------EASIPFFNER.F--LN..KWHVHAALE-------NQP
E3EEL5_PAEPS/103-359-------------------------------------------....VYLNRP.L--SN..KWAIHQQLA-------RKA
D5WPR3_KYRT2/193-450-------------------------------------------....RYFNAG.F--FD..KWTMFQWLS-------ADD
D9SRF0_CLOC7/100-357-------------------------------------------EYRIPFINSKAY--FN..KLETHQVLS-------KNL
C0ZI87_BREBN/156-418-------------------------------------------QNWFRYANNR.F--SN..KYVVHQILI-------QDP
YHEC_BACSU/95-349-------------------------------------------YPKTEFIGRG.L--PD..KWTVLHDLQ-------QHS
U5L9I0_9BACI/129-372-------------------------------------------AKKIPFFNPC.F--LE..KFECYSKLK-------QEP
C6D8D4_PAESJ/190-450-------------------------------------------RKKIPFFNWG.F--FN..KSDVYKLLD-------NDP
G2TQ05_BACCO/96-351-------------------------------------------RKDLTFLGYG.L--PN..KAMLYDRLK-------EIP
R4K333_CLOPA/89-340-------------------------------------------KKQIPFTSYP.I--GN..KMQVYQTLK-------KNS
C5D6K3_GEOSW/95-347-------------------------------------------RPDITFLGHG.F--PS..KWELYKKVI-------EHP
F2JGI4_CELLD/89-340-------------------------------------------KERIPFTSYS.V--GR..KKKVYERLK-------NEK
C6D2S4_PAESJ/89-343-------------------------------------------APSFPFTGYG.I--GN..KIRIQKHLL-------TSP
Q9KDR5_BACHD/189-445-------------------------------------------EQQIPWFNVD.F--FN..KWDLYTKLK-------NHR
B2A589_NATTJ/679-925-------------------------------------------.....AINNKRF--FG..KWETWDSVN-------FFE
B1HW17_LYSSC/95-347-------------------------------------------KEEIPFTTYS.I--GN..KWNVMKRLK-------EAK
A9U6A9_PHYPA/223-482-------------------------------------------RYGTQVFNEK.F--LD..KNEVFGALG-------HES
B0TBC4_HELMI/103-351-------------------------------------------.RGIPIFNPP.F--GG..KYGVYRRLL-------HDP
E3EEM0_PAEPS/175-433-------------------------------------------QYGTAFFNEK.F--LD..KNEVFDALK-------SNS
E3E6L5_PAEPS/97-357-------------------------------------------.KGFYIFNEQNR--FG..KDHIHAILQ-------EDP
N0AWZ8_9BACI/185-443-------------------------------------------EYLIPWYNPG.F--FN..KLDIYERLY-------QND
G2TQ06_BACCO/184-440-------------------------------------------EYFIPWYNPG.F--FN..KLEINERLF-------QDP
L0EGB1_THECK/117-373-------------------------------------------HPNIRLFNPA.F--FN..KWSLFEWLS-------MSK
C5D6K2_GEOSW/180-436-------------------------------------------EYGIPWFNEN.F--FN..KWEIYRLLE-------KHP
A6TTN8_ALKMQ/106-361-------------------------------------------.KKVKPLNYLNG--FN..KWEVYNNLS-------RDE
C0Z7V1_BREBN/172-423-------------------------------------------MPNVTLFNRS.F--FD..KQQLFTMLE-------SHL
D9SQR0_CLOC7/180-436-------------------------------------------KLGDKIFNSF.F--FT..KWDMWELLS-------PYE
X4ZWK7_9BACL/102-358-------------------------------------------....LVWSRG.L--PD..KWRVYELLR-------RSR
Q0AXS7_SYNWW/185-442-------------------------------------------LPYLKYFNPS.F--LN..KWKVYQLLI-------NDP
Q81UK8_BACAN/185-442-------------------------------------------DYAIPWFNPG.F--FN..KWEVHQLLM-------KDE
B2A4H5_NATTJ/201-449-------------------------------------------...IEKINNTIY--FD..KWNVYKALA-------KSE
D3ECN6_GEOS4/109-368-------------------------------------------QLGVKLWSRG.L--PG..KQKVHQLLK-------RSS
C6D8D3_PAESJ/115-376-------------------------------------------QKPVTTLNGS.L--PG..KWEVYSTLR-------QDS
A6TTQ6_ALKMQ/199-449-------------------------------------------AHNIQWINTTRT--FG..KWETFQALS-------LFR
D9SQR2_CLOC7/185-442-------------------------------------------LTGNRVFNST.R--FD..KWEMHKILE-------RHK
C6D8D2_PAESJ/194-455-------------------------------------------THHVSVFNEK.F--LD..KMEVFDALK-------KDE
H6N9W7_9BACL/189-446-------------------------------------------.RGIPLFNWS.F--FD..KWDVYHLLE-------G.T
E3EEL7_PAEPS/107-363-------------------------------------------ASGVELYNPG.F--FN..KWELFKWLR-------TSE
X4ZGU1_9BACL/188-448-------------------------------------------RKKIPFFNWS.F--FN..KSDIYRLLE-------NDS
E3EEL8_PAEPS/187-447-------------------------------------------RKRIPFFNWS.F--FN..KSDIYHLLE-------NNP
L0EEL4_THECK/193-451-------------------------------------------RFGTQVFNEK.F--LD..KSEVFSALR-------KQA
W0ECF6_9FIRM/655-901-------------------------------------------.....PINAKRY--FG..KWETYTAVT-------FFD
D5WPR2_KYRT2/185-424-------------------------------------------....LNLAPD.I--GD..KWRITKFLL-------LEG
D9SRF2_CLOC7/187-440-------------------------------------------NYNIQLINNCNM--LG..KWELCEVLY-------RYP
D5XE95_THEPJ/222-483-------------------------------------------IMQIPVFNPG.F--LD..KCEVQEKLV-------VHA
E3EEL9_PAEPS/104-364-------------------------------------------SCKLIYWSRN.L--PG..KWQVYRALH-------TVD
A9U6Q3_PHYPA/68-328-------------------------------------------AYKHRYWSAS.L--PG..KWEVHRVLS-------RNA
D5DAR2_BACMD/110-365-------------------------------------------REDVIFLGHG.L--PN..KLDVYEVIK-------KDS
C0ZCK7_BREBN/87-344-------------------------------------------TSNFLYANNR.L--AN..KWRVHEVLH-------RDP
C0ZHM7_BREBN/93-354-------------------------------------------.DLFFFANSP.F--SK..KWRVTNLLA-------SDE
C6D2S3_PAESJ/3-239-------------------------------------------GYMIKYPGR...--....KWLKHVALS-------GEE
A8FBJ2_BACP2/183-438-------------------------------------------DYDIPWFNPS.F--FN..KWDIHEQLL-------TDE
C2X028_BACCE/88-336-------------------------------------------HDKVPFTSHS.I--GN..KLSVYNRIN-------RAK

PF14397

M5DQK3_9GAMM/20-294-------------------------------------------RRNSRYISRYNP--RR--LFPLVDNKL....---KTK
D4JSC2_9FIRM/75-334-------------------------------------------NDNITISKRCND--RT--YFHIFDNKSEFDE---AFR
Q82TT3_NITEU/69-365-------------------------------------------EMADRFYRKYNP--GA--AVPNIEDKF....---IFT
A9KN86_CLOPH/87-363-------------------------------------------LFSTELEPLLNP--RS--ISLTLEDKNLLEP---LYK
B5EAA5_GEOBB/105-377-------------------------------------------YQRRQFKKFIYS--RE--NFVLFANKQ....---ICY
C4LBH6_TOLAT/23-297-------------------------------------------QRNVSYIGRYNP--RS--LYPLVDNKL....---KTK
Q883R7_PSESM/21-294-------------------------------------------RRNADYVLKYNK--RS--LYPVVDDKI....---ITK
Q8A3L1_BACTN/286-546-------------------------------------------SLRHELTRQVND--PC--EALVLKDKVRFSE---VFE
R5RDJ1_9PROT/25-299-------------------------------------------RRNYNVIAKYNP--RR--LYPLVDDKV....---QTK
I1XM16_METNJ/34-309-------------------------------------------RRNVSYISRYNP--RH--LFPLVDDKL....---QTK
R6N4X6_9CLOT/62-325-------------------------------------------QDNLRVCRLAND--KA--YLPLFEDKLQFNE---KFR
Q081M9_SHEFN/19-293-------------------------------------------RRNISYIGRYNQ--RK--FYKRVDDKL....---ITK
R7JSP6_9BACT/87-362-------------------------------------------LFSTRLEPKLNP--YR--EAEILGDKSFLPL---LFS
D5C4H9_NITHN/18-292-------------------------------------------QRNADYILPFNP--RR--HYPLVDDKR....---LTK
K0C3M9_CYCSP/19-293-------------------------------------------SRNIDYIGRSND--RR--LFPLVDDKL....---KTK
K0NID7_DESTT/18-292-------------------------------------------NRNANYTLKYNI--RS--KYPIVDNKL....---KTK
A1U2A6_MARAV/3-277-------------------------------------------RRNVDYIARYND--RT--SYPLVDNKL....---KTK
E6W1I6_DESIS/22-294-------------------------------------------..NIDFIGRYNP--RH--LYPLVDDKL....---KTK
B8CNX1_SHEPW/19-293-------------------------------------------KRNIDYIGRYNP--RK--FYKRVDDKL....---TTK
R5B4Y6_9FIRM/84-338-------------------------------------------VEATLLMRPYNS--AA--E.PYLKSKVTFLK---NFT
Q21FC8_SACD2/34-307-------------------------------------------RRNAQYISPNNA--RY--LFPLVDDKL....---QTK
F7YKT2_VIBA7/23-296-------------------------------------------KRNHSYIGRYND--RS--KYPLVDDKL....---QTK

PF03133

TTL_YEAST/388-732--------------------------------EQLDMDK...LMELPNNYFTNSY--IYRKALIRKHFLS-------HTI
Q9VKL9_DROME/368-666--------------------------------KAIRS......YQKINHLPGSFR--IGRKD.SCWKNLQ-------RQM
TTL3B_DROME/325-625--------------------------------VRHAEHYS..LDDARIKPPTPAE--IVENQTFMVQSTD-------VLK
TTLL3_HUMAN/213-505--------------------------------MDIDKD.....LEAPLYLTPEGW--SLFLQ.RYYQVVH-------EGA
TTLL4_HUMAN/651-946--------------------------------RSIRE......HQKLNHFPGSFQ--IGRKD.RLWRNLS-------RMQ
O17720_CAEEL/115-423--------------------------------MRELMP.....WQRLNQFPRSTE--LTKKD.RLYENIE-------RSK
TTLL1_HUMAN/48-364--------------------------------FSVEAGYRLSDDQIVNHFPNHYE--LTRKD.LMVKNIK-------RYR
TTL12_CAEEL/370-662--------------------------------QLSEENP....CGMINQFPFESC--ITVKD.LLAACAM-------RDP
TTL12_HUMAN/346-642--------------------------------KLSQERP....GVLLNQFPCENL--LTVKD.CLASIAR-------RAG
TTL_BOVIN/81-367--------------------------------IKTSPEL....AESCTWFPESYV--IYPTN.LKTPVAP-------AQD
TTL_SCHPO/119-383--------------------------------SLMEA......YELRQELEENAT--KNISE.KQWYILK-------PSM
TTLL4_CAEEL/185-476--------------------------------RALQP......HQKVNHFPGAFH--IGRKD.RLWMHIR-------KQQ
Q9VX74_DROME/100-420--------------------------------FGIDHPYRMRSDQVINHFPNSIE--LSRKD.LLIKNIK-------RYR
Q9VGW2_DROME/126-407--------------------------------ANLKNLG...QHQVVNHYPGCGY--LTNKV...D....-------..L
Q9VQV6_DROME/501-799--------------------------------RTIRS......HQKYNHIPGSFR--IGRKD.TMWRSIY-------NNM
TTL3A_DROME/342-640--------------------------------IDSCQHN....DIDFEDPPKIWE--HDWDA.FLFQHQQ-------LVN
Q9VBX5_DROME/261-558--------------------------------VRNLAP.....YQRVNHFPRSYE--MTRKD.RLYKNIE-------RMQ
Q9VB58_DROME/190-486--------------------------------FKNMKR.....FQQINHFPGMIE--ICRKD.LLSRNLN-------RML
Q9VZ97_DROME/119-439--------------------------------FSVDSGYRMHDNQMINHFPNHYE--LSRKD.LLVKNIK-------RYR
Q4Q4Y1_LEIMA/123-420--------------------------------.TLKSSM....VTALLKHHNYNW--NTLGD.YLPMSFK-------LTP

PF05770

Q7XBW0_ORYSJ/9-321----------------------------GDGQRRRYLIGYALAPKKQQSFIQPSL--VSRAAGRGMDLVPVDPS---RPL
ITPK2_ARATH/34-338----------------------------AFPVKKSIIVGYALTSKKIKSFLQPKL--EGLARNKGILFVAIDQN---KPL
ITPK1_ARATH/2-311----------------------------SDSIQERYLVGYALAAKKQHSFIQPSL--IEHSRQRGIDLVKLDPT---KSL
ITPK1_HUMAN/1-318----------------------------MQTFLKGKRVGYWLSEKKIKKLNFQAF--AELCRKRGMEVVQLNLS---RPI
Q9AYJ2_ORYSJ/16-320----------------------------VAVAGQRLVVGYALTKKKVKSFLQPKL--LSLARKKSIHFVSIDET---RPL

PF02750

SYN2_HUMAN/214-416-------------------------------------------NSLESIYNFCDK------PWVFAQLVAIYKT---LGG
SYN3_RAT/192-394-------------------------------------------NSLYSVYNFCSK------PWVFSQLIKIFHS---LGP

PF08442

MTKA_METEA/2-203---------VAVP-----------------------------KGAV---AF-SP--------------------------
SUCB1_CAEEL/25-233---------IKVP-----------------------------PFGV---AQ-DA--------------------------
SUCC2_STRCO/2-191---------IVVP-----------------------------RAEV---TD-SP--------------------------
SUCC2_ARCFU/2-195---------IRVA-----------------------------RGEL---AT-SV--------------------------
SUCC_HAEIN/2-203---------LPVK-----------------------------NGAV---CQ-SV--------------------------
SUCC_METTH/2-194---------ISTP-----------------------------RGGV---AE-TP--------------------------
SUCB2_CAEEL/21-231---------CSVQ-----------------------------NFVV---AS-NR--------------------------
SUCC_METJA/2-193---------IPVP-----------------------------ESFL---VS-KE--------------------------
SUCB2_PIG/40-248---------VKVQ-----------------------------RFFV---AD-TA--------------------------
SUCC1_ARCFU/2-195---------IRVP-----------------------------RGEV---AT-SP--------------------------
SUCC_AQUAE/2-199---------IPVP-----------------------------EGKV---AF-SL--------------------------
SUCC_BACSU/2-203---------VSVP-----------------------------EGKV---AF-TA--------------------------
SUCB_YEAST/32-240---------IGTP-----------------------------EGFP---AF-TP--------------------------
SUCB_SCHPO/24-232---------VDVP-----------------------------RGAP---AR-SG--------------------------
SUCC_COXBU/2-204---------IPVP-----------------------------ASEV---VF-NP--------------------------
SUCC_RICPR/2-203---------VPTS-----------------------------TGLV---VT-KT--------------------------
A2EBX0_TRIVA/11-220---------VAAG-----------------------------INLV---AR-SP--------------------------
SUCC_ECOLI/2-203---------LPAP-----------------------------VGYA---CT-TP--------------------------
SUCC_MYCTU/2-194---------VPST-----------------------------PGRV---TD-TA--------------------------
Q5SKV5_THET8/15-207---------VPVP-----------------------------PGKV---AY-TP--------------------------

PF13549

Q30WE4_DESAG/474-696---------INIP-----------------------------ETRT...VP.DV--------------------------
B5EIR8_GEOBB/481-697---------IPVA-----------------------------PWRM...AG.SA--------------------------
A7HUK1_PARL1/484-706---------VPVV-----------------------------DTRI...VS.SA--------------------------
Q1D3M9_MYXXD/505-726---------IPTV-----------------------------ETRL...AV.TE--------------------------
A2BJ63_HYPBU/14-235---------VPVA-----------------------------GYGL...AR.NE--------------------------
A9EVP6_SORC5/499-721---------IPTV-----------------------------PTAV...AR.SA--------------------------
B7K6U2_CYAP7/499-721---------IPIV-----------------------------RTAT...AT.SE--------------------------
Q02CN5_SOLUE/497-719---------IPVA-----------------------------KTII...AV.NA--------------------------
C8X4E1_DESRD/482-705---------IPIV-----------------------------PTRI...AL.DD--------------------------
Q2W464_MAGSA/483-705---------IPTV-----------------------------ETHV...AR.SP--------------------------
B8CEH1_THAPS/525-748---------IPTV-----------------------------TTIL...AC.TA--------------------------
C1DBF7_LARHH/480-702---------LPVN-----------------------------QVRL...AR.TS--------------------------
Q2LRG1_SYNAS/43-258---------IATT-----------------------------GFLV...AG.SE--------------------------
D2R7V1_PIRSD/482-704---------IPVT-----------------------------KPIA...AS.TA--------------------------
A8I025_AZOC5/478-700---------IPVV-----------------------------ETRT...AA.SP--------------------------
Q1QYL0_CHRSD/482-704---------IPTV-----------------------------PAIV...AR.TP--------------------------
Q0W5Z5_UNCMA/472-693---------IPTL-----------------------------KYRI...VD.SA--------------------------
Q12E86_POLSJ/490-712---------IPGV-----------------------------EAVQ...AR.DV--------------------------
D5CS41_SIDLE/485-707---------IPVA-----------------------------RTMV...AH.SP--------------------------
Q223I3_ALBFT/478-701---------IPVV-----------------------------PTRR...IRATA--------------------------
A2SHI2_METPP/474-697---------IPVV-----------------------------KTLA...VDASA--------------------------
B0CB03_ACAM1/496-716---------IPTV-----------------------------LSHL...AQ.TP--------------------------
B1XHT3_SYNP2/500-722---------IPIV-----------------------------PTGN...AS.TP--------------------------
A9B7A3_HERA2/473-695---------MRLP-----------------------------DSRL...SR.SP--------------------------
A5V1W2_ROSS1/474-696---------MRLP-----------------------------RSLL...AQ.SP--------------------------
Q7NLP6_GLOVI/494-729---------IPTV-----------------------------ETRV...AA.DE--------------------------
C9R913_AMMDK/477-698---------IPVA-----------------------------PIQL...AQ.RA--------------------------
D6Z2N4_DESAT/474-696---------FQIP-----------------------------EGYL...AT.TA--------------------------
Q0KA53_CUPNH/481-703---------VPVV-----------------------------ATRT...AA.SV--------------------------
E3HYZ8_RHOVT/480-705---------IPTV-----------------------------PTLV...AR.TP--------------------------
A1K623_AZOSB/482-704---------IPIA-----------------------------QTVI...AR.SA--------------------------
B8GPY5_THISH/486-708---------IPVT-----------------------------QTLL...AR.TP--------------------------
Q2LUQ3_SYNAS/506-727---------IPTT-----------------------------VPSL...TS.SV--------------------------
Q47CI3_DECAR/482-704---------VPVA-----------------------------QTMV...AR.TA--------------------------
A1RXS7_THEPD/479-701---------IPVL-----------------------------AKKI...AK.SP--------------------------
Q6MAV5_PARUW/501-722---------IPII-----------------------------QTEV...AK.NA--------------------------
C6C1C2_DESAD/472-693---------LPTP-----------------------------ESDL...AR.SG--------------------------
Q8DJG8_THEEB/495-717---------LPVV-----------------------------ETCI...AR.SE--------------------------
B0UM89_METS4/27-247---------IPVP-----------------------------KEAV...AT.SA--------------------------
A8ZZJ4_DESOH/481-703---------FSVL-----------------------------PTKL...AE.TP--------------------------
Q92Z73_RHIME/480-705---------IPVP-----------------------------QTII...AT.SP--------------------------
Q7NRV4_CHRVO/480-702---------IPVN-----------------------------PTTL...AR.TA--------------------------
Q2Y8E7_NITMU/478-700---------IPVA-----------------------------PTML...AR.SP--------------------------
Q6AQI6_DESPS/472-694---------FNVP-----------------------------EGYL...VD.SA--------------------------
Q3SEU0_THIDA/481-703---------IPIA-----------------------------QTLI...AR.DP--------------------------
D0L1W1_HALNC/488-710---------IPTT-----------------------------QTIL...AR.DA--------------------------
A1VIA4_POLNA/472-694---------IPVT-----------------------------QTIL...AR.SA--------------------------
O29057_ARCFU/463-681---------IEVA-----------------------------PYGI...AR.NV--------------------------
B8HP40_CYAP4/501-729---------IPTV-----------------------------KVCV...AT.SV--------------------------
C4ZP31_THASP/482-704---------IPIA-----------------------------QTVV...AR.SA--------------------------
C7RIF7_ACCPU/482-704---------IPVA-----------------------------QTMV...AH.TP--------------------------
B5HI28_STRPR/17-237---------IPTP-----------------------------AEGL...AE.TA--------------------------
Q13N88_BURXL/472-694---------IPIT-----------------------------QTIL...AH.NA--------------------------
A5D252_PELTS/478-700---------IPAA-----------------------------PAVL...TT.TP--------------------------
D2PSA1_KRIFD/14-237---------IPTP-----------------------------GEGL...AT.TA--------------------------
Q89QG9_BRADU/95-315---------IPVP-----------------------------KEGV...AR.SA--------------------------
Q2LV27_SYNAS/9-227---------IPIL-----------------------------KTVL...AK.DE--------------------------
B9TF03_RICCO/23-245---------VATV-----------------------------PTRL...AA.TA--------------------------
A5D1F4_PELTS/478-699---------VPVA-----------------------------PTVL...SS.SP--------------------------
B8FK52_DESAA/483-704---------FPVL-----------------------------QNRV...AT.SP--------------------------
C9ZD67_STRSW/15-235---------IAVP-----------------------------GEEL...AR.DV--------------------------
Q2LPY3_SYNAS/483-704---------IPSV-----------------------------DSHL...AG.TL--------------------------
D4GVH7_HALVD/472-692---------IETP-----------------------------AGDI...VD.DP--------------------------
C0QHK1_DESAH/488-708---------ASTS-----------------------------ADKV...AL.SE--------------------------
B4RED1_PHEZH/481-703---------VPIL-----------------------------ETRI...VR.DP--------------------------
Q9HQZ0_HALSA/317-537---------IPTP-----------------------------TGDV...VD.SP--------------------------
C0QJ02_DESAH/490-712---------MSVL-----------------------------PTKL...AK.TA--------------------------
C0QHB0_DESAH/487-709---------IPVV-----------------------------ATHE...AS.SP--------------------------
Q1LF49_RALME/14-234---------ISVP-----------------------------GEGV...AR.SP--------------------------
D3STG0_NATMM/473-693---------IPTP-----------------------------PGEI...VD.DP--------------------------
E6VV76_DESAO/485-707---------IPVV-----------------------------ETRI...AR.SA--------------------------
A4J695_DESRM/478-699---------ISTA-----------------------------PIKL...AI.TP--------------------------
A5D034_PELTS/478-700---------IPAA-----------------------------PIVL...AT.SP--------------------------
A4YYL2_BRASO/483-708---------IAMV-----------------------------PTFA...AS.SV--------------------------
A4SW96_POLSQ/471-693---------IPIT-----------------------------QTIL...AK.SA--------------------------
A7MH14_CROS8/473-695---------LHTL-----------------------------PTWI...AG.DS--------------------------
Q988U3_RHILO/480-705---------IPVP-----------------------------ETII...AR.SP--------------------------
D7AUW7_NOCDD/22-244---------IPVP-----------------------------GEDL...AH.SA--------------------------
B1I353_DESAP/478-699---------IPVS-----------------------------PTRL...AT.RA--------------------------
A0B6M1_METTP/11-226---------LETT-----------------------------GAHL...AS.SA--------------------------
Q20Z65_RHOPB/482-707---------IPTV-----------------------------PVLA...AA.DA--------------------------
Q604W6_METCA/481-703---------IPML-----------------------------PALP...AH.SP--------------------------
Q3IQS4_NATPD/472-692---------IPTL-----------------------------DSEI...VE.SP--------------------------
Q2NFU6_METST/479-700---------ISAA-----------------------------PIIL...AT.TK--------------------------
C6BU19_DESAD/485-707---------LPVV-----------------------------ETKV...AL.SA--------------------------
A0LJP9_SYNFM/480-702---------FPTL-----------------------------PTFT...AK.SR--------------------------
Q0A9U7_ALKEH/468-689---------IPCV-----------------------------PSRR...AT.TP--------------------------
C0QAQ8_DESAH/481-702---------IPVN-----------------------------ACLL...AE.TA--------------------------
A5D530_PELTS/478-699---------VAAV-----------------------------ATEL...SQ.SP--------------------------
D2U861_XANAP/477-702---------IPTA-----------------------------PVVQ...AA.SA--------------------------
Q11G56_CHESB/480-705---------ISVP-----------------------------ETIV...VR.TG--------------------------
B8DM77_DESVM/483-705---------IPVA-----------------------------ETRH...VK.TP--------------------------
Q7N786_PHOLL/472-694---------LNTL-----------------------------PTWI...AH.NS--------------------------
Q1QM20_NITHX/483-708---------IASV-----------------------------PTRA...AA.NA--------------------------
Q2W7Y3_MAGSA/500-722---------IKTQ-----------------------------DTRL...AP.DV--------------------------
E3I048_RHOVT/473-695---------IPTL-----------------------------ESIL...VG.TA--------------------------
B1LZ43_METRJ/472-697---------IPTV-----------------------------PITL...AP.DT--------------------------
D3RU01_ALLVD/481-703---------IPTM-----------------------------QAIL...AR.TP--------------------------
Q3AFE8_CARHZ/490-711---------FPVL-----------------------------PVKL...VR.NV--------------------------
B8FE80_DESAA/10-226---------IPVV-----------------------------EEAI...VT.EE--------------------------
C7LTU8_DESBD/481-703---------VPVV-----------------------------ETRI...CK.SA--------------------------
B8FIX8_DESAA/9-225---------VPVV-----------------------------EEKI...AD.SP--------------------------
Q12WB1_METBU/472-693---------IPVV-----------------------------ETLN...VK.TL--------------------------
B2FMM9_STRMK/482-707---------IPSA-----------------------------PVMH...AR.DA--------------------------
D3V3Z2_XENBS/472-694---------LNTL-----------------------------PTWI...AY.TS--------------------------
B8IED3_METNO/488-713---------IPML-----------------------------PVHF...AA.DA--------------------------
E6WFR2_PANSA/472-694---------LATL-----------------------------PTWI...AA.DS--------------------------
C4ZKF4_THASP/487-709---------VPVI-----------------------------QTHL...AA.TP--------------------------
A1S6F9_SHEAM/486-708---------LNTI-----------------------------DTWF...AK.DA--------------------------
A3QEK7_SHELP/486-708---------LNTI-----------------------------ETHF...AA.SA--------------------------
C0QFL6_DESAH/13-229---------IPVV-----------------------------DEHR...VS.SA--------------------------
Q4XQ92_PLACH/180-403---------IPVV-----------------------------NTKI...YK.TL--------------------------
Q1QWA2_CHRSD/486-716---------IPAA-----------------------------PSQY...VF.GP--------------------------
B4EUX9_PROMH/472-694---------FNTL-----------------------------PTWI...AH.NA--------------------------
A1WTN4_HALHL/467-689---------IPCV-----------------------------DSRR...AN.DP--------------------------
O28761_ARCFU/667-877---------ISFP-----------------------------EYEY...VK.TP--------------------------
D3PVJ8_STANL/666-881---------IPHV-----------------------------ETRF...AT.SV--------------------------
Q082P1_SHEFN/486-708---------LNTI-----------------------------ETRF...VK.DV--------------------------
D3FEQ9_CONWI/670-890---------LPLP-----------------------------SQRV...VR.SP--------------------------
A1RWD9_THEPD/9-229---------LPLL-----------------------------GYRF...IG.VD--------------------------
B8CM86_SHEPW/486-708---------LNTI-----------------------------ETWF...AN.TA--------------------------
B9M8K3_GEODF/479-695---------IPVA-----------------------------GWGV...TV.NT--------------------------
B3LBB6_PLAKH/551-775---------IPTV-----------------------------STEV...FY.TL--------------------------
C4XLT1_DESMR/479-701---------VRAV-----------------------------ASQL...TE.DI--------------------------
A4FCG4_SACEN/661-877---------LPAV-----------------------------PTTV...CA.DE--------------------------
C5B797_EDWI9/472-694---------LDTL-----------------------------PGWI...AN.DS--------------------------
Q12N16_SHEDO/486-708---------LNTI-----------------------------DTDF...AL.DT--------------------------
Q3IFA9_PSEHT/480-701---------IECI-----------------------------QTEV...AY.TP--------------------------
E6VZV8_DESAO/478-699---------LPVP-----------------------------ETRL...VR.TS--------------------------
C6C0V7_DESAD/480-701---------LPVP-----------------------------ETVL...AR.TS--------------------------
A0KEL7_AERHH/447-666---------LSTL-----------------------------PTWI...VS.DA--------------------------
Q2NRP0_SODGM/472-694---------IKTL-----------------------------PTWI...AA.DS--------------------------
Q47QC0_THEFY/653-870---------VTVA-----------------------------PWQW...TH.TP--------------------------
C8X6G7_NAKMY/699-910---------LPTC-----------------------------PQRP...AT.GV--------------------------
Q8IL89_PLAF7/540-763---------IPIV-----------------------------QTRI...FE.NV--------------------------
B5YGW4_THEYD/482-700---------IPVI-----------------------------LTKR...AN.TL--------------------------
B1VXP6_STRGG/739-955---------IDVR-----------------------------PTLP...AP.DP--------------------------
A4FAM1_SACEN/663-876---------IELV-----------------------------AFRR...AD.SP--------------------------
D1BG29_SANKS/695-919---------IDVW-----------------------------ESVP...VR.DA--------------------------
O50516_STRCO/806-1022---------VHVH-----------------------------RALP...AA.TP--------------------------
C7LRJ9_DESBD/471-692---------LGFP-----------------------------RTEL...AR.TS--------------------------
C5C5J4_BEUC1/666-884---------IRLW-----------------------------PAIG...VA.SA--------------------------
C5BNQ0_TERTT/484-704---------IPIA-----------------------------PTIL...VH.SA--------------------------
C6WAF3_ACTMD/668-881---------IDVV-----------------------------PFRV...VS.SA--------------------------
C4ZP63_THASP/474-692---------IPVT-----------------------------HTTV...AR.DA--------------------------
A8B3P9_GIAIC/94-343---------IKVP-----------------------------EFRYFPLHS.SL--------------------------
Q2SCW5_HAHCH/482-712---------INML-----------------------------DTRY...CE.TE--------------------------
A8B4I3_GIAIC/26-275---------IKVP-----------------------------EFRYFPLHS.SL--------------------------
A1R5M2_ARTAT/645-861---------IKVV-----------------------------PSLG...FG.TS--------------------------
A6W895_KINRD/666-883---------VRLL-----------------------------PRAE...VG.GV--------------------------
A5FUU0_ACICJ/447-667---------IETA-----------------------------ATRI...VD.TP--------------------------
E3IU41_FRASU/495-709---------VEGP-----------------------------RQIV...VD.TP--------------------------
A2F811_TRIVA/22-271---------FSIA-----------------------------PHCY...AT.KT--------------------------
C7RR50_ACCPU/477-694---------IAVA-----------------------------DHSL...AS.SV--------------------------
A1W7H4_ACISJ/481-702---------IPVT-----------------------------KTLL...AR.SS--------------------------
A5UN98_METS3/478-698---------IEAA-----------------------------PIKL...AT.NA--------------------------
A9WDH8_CHLAA/474-695---------MRLP-----------------------------KSRL...AQ.TP--------------------------
B7VRZ9_VIBSL/486-706---------LDVL-----------------------------PTWI...AS.DP--------------------------
C0ZYS6_RHOE4/678-886---------VAVV-----------------------------EFRS...VL.SE--------------------------
C5AV44_METEA/480-704---------IVSV-----------------------------PVTL...AP.DP--------------------------
D4ZKT1_SHEVD/490-708---------LKTI-----------------------------DTYV...AQ.DP--------------------------
D5A1V4_ARTPN/500-721---------IPVV-----------------------------DTRM...AS.TV--------------------------
E0SDH6_DICD3/473-694---------LNTL-----------------------------PTWI...AG.DS--------------------------
F7PKW5_9EURY/446-663---------IPTP-----------------------------QGAI...VS.EK--------------------------
G2IXU4_PSEUL/481-702---------IPVN-----------------------------PTRL...AR.DP--------------------------
G8PQP7_PSEUV/483-707---------VNQV-----------------------------ELHL...VK.TV--------------------------
I0DX01_PROSM/473-695---------LNSL-----------------------------PTWI...AH.SS--------------------------
M1FE38_9ALTE/482-712---------IRAI-----------------------------DTLF...CD.DV--------------------------
Q6LIT6_PHOPR/492-712---------FKTL-----------------------------PTWI...AS.DP--------------------------
Q6N212_RHOPA/482-707---------IPMI-----------------------------PTLA...AT.NA--------------------------
Q726Y6_DESVH/483-698---------IPVA-----------------------------EALH...VR.EP--------------------------
Q88GJ8_PSEPK/476-696---------LPVP-----------------------------AG.V...LS.TP--------------------------
Q8P3T1_XANCP/482-706---------IPIV-----------------------------PVQV...AA.TA--------------------------
V6F1Q9_9PROT/484-706---------IPTV-----------------------------PTHI...AG.TP--------------------------

PF15632

A5WBK0_PSYWF/12-367....-----IAAA-----------------------------EGWR------FD--------------------------
A7MPT7_CROS8/12-350....-----LPVV-----------------------------PSWR------VN--------------------------
C0Z9Z4_BREBN/4-333...E-----VPIP-----------------------------AYAI------VN--------------------------
F9Z982_ODOSD/8-339....-----IPVA-----------------------------KYSL------VS--------------------------
I3YAU9_THIV6/3-337....-----IPPP-----------------------------DYLE------FR--------------------------
A8KXY8_FRASN/5-351....-----LPVP-----------------------------HTRT------VT--------------------------
W0LEM0_SERFO/4-342....-----LPVV-----------------------------PSIR------VT--------------------------
F2JJ82_CELLD/4-341..EI-----CNVP-----------------------------PFEV------VT--------------------------
F8A3W6_CELGA/3-315.GPA-----VHVP-----------------------------RTEL------VG--------------------------
U5N6U2_9BURK/2-337....-----APPP-----------------------------LWHP------CT--------------------------
E8U3T8_DEIML/7-342....-----LPIP-----------------------------AWTT------FR--------------------------
C9LVE5_SELS3/2-335...A-----SLVP-----------------------------AHLI------AG--------------------------
Q7CKQ4_YERPE/4-342....-----LPVV-----------------------------PSIQ------IA--------------------------
R6L1S2_9BACE/13-342....-----IPVA-----------------------------NYTL------VS--------------------------
E3EE70_PAEPS/5-337...I-----VTIP-----------------------------DYAI------AS--------------------------
B5HSJ5_9ACTO/6-337....-----VPVP-----------------------------PWWR------VR--------------------------
H8GG73_METAL/2-335....-----ALVM-----------------------------DFVA------VN--------------------------
Q6FAX4_ACIAD/20-348....-----LAVA-----------------------------PATI------VE--------------------------
Q2RVZ8_RHORT/2-333....-----VAVP-----------------------------PYRL------FR--------------------------
I0DSI2_PROSM/4-341....-----LPVV-----------------------------PSIQ------ID--------------------------
J7IZM6_DESMD/16-343...I-----LGIP-----------------------------KSFS------VR--------------------------
C9ZBJ4_STRSW/6-337....-----VPVP-----------------------------PWFR------VT--------------------------
D1BH78_SANKS/2-339....-----VPVP-----------------------------PWRT------AQ--------------------------
J7U1Y0_MORMO/5-342....-----LPVV-----------------------------PSVQ------IT--------------------------
Q4FTP6_PSYA2/16-380....-----IPVA-----------------------------DAWR------FD--------------------------
Q888T3_PSESM/1-329....-----LACI-----------------------------PAIT------AC--------------------------
B8GGE3_METPE/6-335....-----IPAP-----------------------------KCSL------VD--------------------------
D1BIK1_SANKS/4-313....-----LRVP-----------------------------ATEL------LD--------------------------
U5LE31_9BACI/6-343GKQL-----VSIP-----------------------------DYEV------VN--------------------------
D7DRZ5_METV3/6-343....-----IPYP-----------------------------ECYL------VK--------------------------
Q5NWT2_AROAE/3-338....-----APSP-----------------------------ELEV------FE--------------------------
Q9RSB2_DEIRA/9-335....-----LPIP-----------------------------RWTT------FQ--------------------------

PF13535

B6B6A2_9RHOB/129-318.........VPSV-----------------------------PNVL------AE--------------.....-------
B0NR58_BACSE/114-290.........LKTP-----------------------------QTWI------IS--------------.....-------
B9DMB9_STACT/529-710.........KYLP-----------------------------KRQI------VE--------------.....-------
C0WVD3_LACFE/116-306.........LPYP-----------------------------KTSI------LK--------------.....-------
C1F6E3_ACIC5/100-273.........FQVL-----------------------------PSWL------LH--------------.....-------
C4FBF5_9ACTN/118-307.........LETP-----------------------------RTEV------AR--------------.....-------
C7N331_SLAHD/459-648.........IDVP-----------------------------KTEV------VK--------------.....-------
Q3A6W8_PELCD/114-298.........FRVP-----------------------------DTWF------IH--------------.....-------
D1C2W8_SPHTD/155-337.........IPAP-----------------------------RTWC------PR--------------.....-------
Q0ACF5_ALKEH/120-296.........IPAP-----------------------------ETFY------VS--------------.....-------
A3CVX7_METMJ/109-278.........IAIP-----------------------------KTFY------PQ--------------.....-------
B8GVA8_THISH/116-296.........VPVP-----------------------------RSIV------LE--------------.....-------
A5G3Z6_GEOUR/110-292.........IAMP-----------------------------ETVY------VA--------------.....-------
Q3S8Y0_PSESH/109-293.........EYSP-----------------------------ISME------VG--------------.....-------
B5XPP6_KLEP3/106-292.........VPAE-----------------------------VQIS------FS--------------.....-------
Q5WS01_LEGPL/99-278.........FPFP-----------------------------KTTT------LI--------------.....-------
Q5WSD6_LEGPA/104-283.........FSYP-----------------------------KTTT------LI--------------.....-------
Q7N5R8_PHOLL/91-265.........LPAP-----------------------------RCWL------SG--------------.....-------
D4GMV9_PANAM/88-261........FLSCP-----------------------------KFWL------SG--------------.....-------
N8ZXH9_ACIBI/125-307.........LAVA-----------------------------PATI------VE--------------.....-------
B2Q6S1_PROST/113-295.........LPVV-----------------------------PSIQ------ID--------------.....-------
Q48NB4_PSE14/107-288.........LACI-----------------------------PGIA------AS--------------.....-------
E7FN57_9LACO/100-280.........IEQP-----------------------------DFVA------MT--------------.....-------
B2E5U2_STREE/105-289.........VNQP-----------------------------YFRL------LE--------------.....-------
Q1QXJ8_CHRSD/106-286.........IRVG-----------------------------IFEE------AH--------------.....-------
A7N2D3_VIBCB/102-283.........DVDA-----------------------------PYDI------VV--------------.....-------
D2QAU0_BIFDB/128-311.........LKII-----------------------------PYTS------CK--------------.....-------
A7NRD0_ROSCS/111-286.........VDVA-----------------------------RGIL------AH--------------.....-------
C5NY10_9BACL/132-310.........VPVA-----------------------------KGRA------VK--------------.....-------
C5NXU5_9BACL/109-287.........VPVV-----------------------------PGFL------VK--------------.....-------
A3CN29_STRSV/109-286.........VPVV-----------------------------PGQI------VN--------------.....-------
A0A034V0G1_ERWAM/99-280.........VPHA-----------------------------NCKY------VT--------------.....-------
C6WFN8_ACTMD/117-298.........IPVT-----------------------------RCRA------VD--------------.....-------
D9TNI3_THETC/106-294.........VPVT-----------------------------DSWM------ID--------------.....-------
A7N6T3_VIBCB/145-320.........FRVP-----------------------------KYFS------LS--------------.....-------
S0AIU0_SERPL/113-299.........IDIP-----------------------------LVVP------FS--------------PQAYQ-------
D3DDW6_9ACTO/102-274.........IAQP-----------------------------AFWS------VA--------------.....-------
Q01ZL3_SOLUE/109-290.........LAVP-----------------------------EFVH------VL--------------.....-------
C6W4G0_DYAFD/113-294.........ILVP-----------------------------GFSA------LF--------------.....-------
D7W254_9FLAO/112-293.........ISVP-----------------------------EFTA------VF--------------.....-------
D7VTF5_9SPHI/110-291.........IHIP-----------------------------SFVP------VF--------------.....-------
D9T7Z5_MICAI/109-288.........VPVA-----------------------------RSCR------PD--------------.....-------
E8RY18_MICSL/111-299.........LRLP-----------------------------RHLR------FD--------------RDRHA-------
D0FMQ8_ERWPE/108-286.........IPTP-----------------------------EQFS------QE--------------.....-------
F3IMV4_PSESL/114-292.........IPTA-----------------------------KELS------LD--------------.....-------
H3RK27_PANSE/114-292.........ILTA-----------------------------REIS------PQ--------------.....-------
A0A034UUS3_ERWAM/114-292.........IATA-----------------------------REIS------MD--------------.....-------
F3IMV3_PSESL/112-290.........IRTA-----------------------------REIT------LS--------------.....-------
A0A034US15_ERWAM/112-290.........IKTA-----------------------------REIT------LD--------------.....-------
Q0RGQ9_FRAAA/107-286.........IPAP-----------------------------AFAD------AP--------------.....-------
B5SP77_9ACTO/100-278.........VRTA-----------------------------EMAL------VD--------------.....-------
B4VDU1_9ACTO/110-294.........IPVA-----------------------------DHVL------LR--------------.....-------
Q0SCF9_RHOSR/101-280.........LLVP-----------------------------AFAP------VL--------------.....-------
D5WN11_BURSC/115-291.........LRVP-----------------------------RFAA------LE--------------.....-------
B1HFG7_BURPE/117-293.........LRVP-----------------------------AWFA------CD--------------.....-------
D0FNI3_ERWPE/106-290.........LATP-----------------------------TCYS------LN--------------.....-------
Q0S8A9_RHOSR/103-283.........LRVP-----------------------------RFVR------CD--------------.....-------
Q12II4_SHEDO/108-288.........LHVP-----------------------------RFFE------LA--------------.....-------
B9B6B5_9BURK/104-287.........LRVP-----------------------------RFAT------LS--------------.....-------
Q1JXP0_DESAC/85-278.........DAFP-----------------------------DFFY------AE--------------.....-------
C6BWA6_DESAD/85-278.........DMYP-----------------------------EFFY------RT--------------.....-------
Q8TPB8_METAC/85-278.........RIYP-----------------------------DFYF------QG--------------.....-------
C0QL65_DESAH/85-278.........SLFP-----------------------------DFYF------KG--------------.....-------
Q3A2P7_PELCD/85-278.........PIFP-----------------------------EFYF------RE--------------.....-------
B8J4T0_DESDA/96-289..........QDY-----------------------------YYRR------LD--------------.....-------
E6VR59_DESAO/87-280.........CLYP-----------------------------DYRF------AR--------------.....-------
D5WN64_BURSC/107-292.........VPSM-----------------------------RQFA------SR--------------.....-------
F3K8S3_PSESZ/109-294.........LRSM-----------------------------DHFL------AV--------------.....-------
A0A023X9K0_BRAJP/112-298.........VRSI-----------------------------RQVV------SD--------------.....-------
C4L724_EXISA/89-275.........FAVP-----------------------------KTFA------FT--------------.....-------
D3DDW5_9ACTO/117-307.........LSQV-----------------------------AAWP------FD--------------.....-------
B9B6B7_9BURK/48-238.........LSNV-----------------------------DARA------LT--------------.....-------
Q12II2_SHEDO/112-302.........LSQV-----------------------------NSRI------LT--------------.....-------
Q2SKF8_HAHCH/104-284.........LSSV-----------------------------QSFR------TT--------------.....-------
D3D707_9ACTO/131-310.........YTPL-----------------------------RSLV------VH--------------.....-------
Q83Z60_STRCL/126-311.........YNIP-----------------------------HARV------SS--------------.....-------
C7Q3P0_CATAD/103-280.........LSDI-----------------------------RFSG------DP--------------.....-------
A8FIK7_BACP2/134-334.........VKAV-----------------------------KTKP------VT--------------.....-------
C4T7U3_YERIN/81-287.........VPNP-----------------------------KYLK------LT--------------.....-------
C7M0Y2_ACIFD/99-282.........LPQP-----------------------------SWHV------AD--------------.....-------
B8J507_ANAD2/110-303.........VPVP-----------------------------GFRL------HA--------------.....-------
Q02BT0_SOLUE/124-303.........LRVP-----------------------------AFFR------AS--------------.....-------
C2CRI1_CORST/134-299...........GV-----------------------------QWTE------VK--------------.....-------
D3PFD6_CRAVI/610-811DIPHFPRTHLYAE-----------------------------RCHH------IE--------------.....-------
CRNS1_HUMAN/500-699..PPWPAPSLHAV-----------------------------PCCP------LE--------------.....-------
CRNS1_CHICK/606-804.........RGRP-----------------------------PPAA------FS--------------VPCRR-------
C2CRI1_CORST/498-675.........HMVP-----------------------------SFSF------IE--------------.....-------
B4EQF8_BURCJ/110-298.........NANP-----------------------------RYAV------VS--------------.....-------
Q0RYD4_RHOSR/107-296.........QFIP-----------------------------RFRH------VR--------------.....-------
B1SDM3_9STRE/91-282.........ELCP-----------------------------KFLR------VT--------------.....-------
B7GNZ5_BIFLS/108-299.........ELCP-----------------------------RFKS------VR--------------.....-------
A8M0K3_SALAI/103-297.........VPVP-----------------------------RYRL------VE--------------.....-------
E8SDA7_MICSL/98-270.........LDPV-----------------------------RAVT------VD--------------.....-------
D2B0J8_STRRD/100-269.........VETV-----------------------------RSVR------LA--------------.....-------
Q121X7_POLSJ/108-282.........IDTL-----------------------------WHAT------VC--------------.....-------
Q1QB93_PSYCK/115-289.........LYQA-----------------------------GYQL------LT--------------.....-------
A0A034SRJ0_9ENTR/96-265.........LPSL-----------------------------WSQR------LL--------------.....-------
D4F6G3_EDWTA/108-277.........LPSV-----------------------------WSLP------LL--------------.....-------
A3UL12_VIBSP/111-283.........LPNT-----------------------------QSVL------LS--------------.....-------
Q1VG50_VIBAL/111-283.........LPNT-----------------------------QSCL------LH--------------.....-------
B8CGT7_SHEPW/109-279.........LPNT-----------------------------WSLS------WA--------------.....-------
C1DMZ3_AZOVD/112-284.........LPGP-----------------------------WFRV------LT--------------.....-------
D2UCG0_XANAP/114-286.........LPTP-----------------------------WFFC------LP--------------.....-------
B0RPV7_XANCB/115-287.........MPSP-----------------------------WFCT------LA--------------.....-------
Q1MX58_9ACTO/104-292.........LDDL-----------------------------PFAP------VA--------------.....-------
D9T106_MICAI/109-294.........VDGL-----------------------------AFRL------VR--------------.....-------

PF02786

PCCA_HUMAN/176-385---------VNTI-----------------------------PGFD------GV------------------.-------
CARY_BACSU/128-334---------QPVP-----------------------------ESEI------V.------------------.-------
PYR1_DICDI/525-729---------ERIA-----------------------------PSMA------C.------------------.-------
CARB_ECOLI/128-335---------LETA-----------------------------RSGI------A.------------------.-------
CPSM_HUMAN/546-750---------EKIA-----------------------------PSFA------V.------------------.-------
BCCA_MYCLE/122-331---------APLV-----------------------------PGTP------DP------------------.-------
PYR1_SCHPO/593-797---------EKCA-----------------------------KSAS------A.------------------.-------
ACCC_PSEAE/115-324---------VPTV-----------------------------PGSD------GP------------------L-------
CARB_YEAST/149-353---------IPIA-----------------------------ESFA------C.------------------.-------
ACCC_ECOLI/115-324---------VPCV-----------------------------PGSD------GP------------------L-------
ACCC_NOSS1/116-325---------VPTV-----------------------------PGSE------GL------------------.-------
PYC1_YEAST/135-344---------VPTV-----------------------------PGTP------GP------------------.-------
E9QAT6_MOUSE/514-717---------EHVA-----------------------------PSEA------A.------------------.-------
K1V2B9_TRIAC/311-514---------IPAA-----------------------------QSTA------V.------------------.-------
BCCA_MYCTU/115-324---------VPVV-----------------------------PGVA------RA------------------.-------
Q5L0U3_GEOKA/128-333---------EPVP-----------------------------ESAI------I.------------------.-------

PF02655

O27028_METTH/106-265---------YPTP-----------------------------ETHL------IS--------------------------
Q603D9_METCA/124-284---------AVVP-----------------------------....------..--------------------------
Y776_METJA/124-282---------FNIP-----------------------------ETKK------IN--------------------------
Q7UJD2_RHOBA/127-319---------IPTP-----------------------------QTWA------ME--------------------------
Q6LZR0_METMP/123-259---------VNTP-----------------------------....------..--------------------------
O29201_ARCFU/107-251---------VQVP-----------------------------....------..--------------------------
O28027_ARCFU/97-247---------LPFP-----------------------------....------..--------------------------
Q97H24_CLOAB/105-271---------VKCP-----------------------------....------.I--------------------------
Q8TQR5_METAC/109-277---------VKAP-----------------------------....------..--------------------------
Q6M182_METMP/105-262---------FNVP-----------------------------VTYL------VN--------------------------
Q8TJB8_METAC/125-298---------MPNP-----------------------------....------..--------------------------
O26923_METTH/114-270---------..VP-----------------------------....------LI--------------------------
Q8TZ26_METKA/104-247---------FQLP-----------------------------....------..--------------------------
Y815_METJA/136-272---------VKTP-----------------------------....------..--------------------------
Q8TV12_METKA/118-275---------LPMP-----------------------------....------..--------------------------

PF02222

PURK_BACSU/115-285---------CEVA-----------------------------PYSI------VK--------------------------
PURT_METJA/120-294---------LKTA-----------------------------KYEF------AD--------------------------
PURT_ECOLI/121-295---------LPTS-----------------------------TYRF------AD--------------------------
PUR6_YEAST/113-285---------IAVT-----------------------------QSVP------VE--------------------------
PUR6_CANGA/113-284---------IPVV-----------------------------PSIT------VE--------------------------
PUR6_SCHPO/111-282---------IALP-----------------------------EFCD------AP--------------------------
PURK_ECOLI/87-254---------LPTA-----------------------------PWQL------LA--------------------------
PURK_HAEIN/92-261---------LSTS-----------------------------PWCL------LK--------------------------
PURK_PSEAE/105-272---------IPTP-----------------------------DFAD------VQ--------------------------
PURK_SULSO/109-273---------LPTP-----------------------------RFYV------AE--------------------------
PURK_AQUAE/100-266---------FPVP-----------------------------EFLV------IK--------------------------
PURK_SYNY3/112-284---------LPVP-----------------------------DFWA------LE--------------------------
PURK_SYNE7/116-285---------LPTP-----------------------------RFLA------IA--------------------------
PURK_MYCLE/120-300---------AAMP-----------------------------RFMA------LD--------------------------
PURT_BACSU/113-287---------LATA-----------------------------GYEF------AN--------------------------
PURT_SYNY3/117-292---------VRTA-----------------------------RYNY------AT--------------------------
M9WZK1_PASHA/123-295---------LKTS-----------------------------PYRF------VD--------------------------
PURK_MYCTU/125-297---------VAVP-----------------------------RYAG------IK--------------------------
Q84TI2_ARATH/198-369---------IPLP-----------------------------EFME------IS--------------------------
PURT_PYRFU/127-303---------VPTS-----------------------------RYMY------AT--------------------------

PF07478

DDL_BORBU/136-344---------IPLV-----------------------------PFIG------FR--------------QHDYF-------
DDLB_ECOLI/103-303---------LPVA-----------------------------PWVA------LT--------------RAEFE-------
DDL_ENTFA/138-341---------IPQV-----------------------------PFVP------VL--------------RSDWK-------
DDL_SYNY3/134-342---------LPQV-----------------------------NYMG------VE--------------RGEIW-------
VANB_ENTFA/138-337---------IAVP-----------------------------EFQM------IE--------------KGDKP-------
DDL_AQUAE/101-291---------INTP-----------------------------DWET------FI--------------SEGDV-------
MUDD_CHLTR/569-778---------IPVV-----------------------------PYLP------LT--------------LAGWK-------
DDL_BACSU/135-338---------LAQA-----------------------------KYAA------FL--------------KKDWT-------
DDL_HAEIN/106-303---------LPVA-----------------------------DMKV------VT--------------RETFS-------
DDL_TREPA/143-347---------LPVL-----------------------------PFVF------FR--------------KDAWR-------
DDLA_ECOLI/147-348---------LNIA-----------------------------PFIT------LT--------------RANRH-------
DDL_MYCTU/158-363---------LPVG-----------------------------AYAV------LR--------------PPRST-------
DDL_LEUMM/142-349---------IRNT-----------------------------KYIV------VD--------------PESAN-------

PF01071

Q20143_CAEEL/100-292---------LPTA.----------------------------DFVT------VS--------------------------
PUR2_BACSU/101-293---------IPTA.----------------------------EYET------FT--------------------------
PUR2_ARATH/198-392---------IPTA.----------------------------KYKT------FS--------------------------
PUR2_MYCLE/101-292---------VRTS.----------------------------RSEI------VN--------------------------
PUR2_HAEIN/103-296---------IPTA.----------------------------EYQN------FT--------------------------
PUR2_METTH/100-298---------IPGSI----------------------------TYRV------FS--------------------------
PUR2_SCHPO/109-301---------IPTA.----------------------------VYKS------FS--------------------------
PUR2_YEAST/108-308---------IPTA.----------------------------SYDV------FT--------------------------
PUR2_HELPY/105-292---------IKSA.----------------------------SYFE------TN--------------------------
PUR2_ARCFU/109-334---------VPIP.----------------------------EYAN------FD--------------------------
PUR2_METJA/103-304---------IKGSL----------------------------MYKA------FE--------------------------
PUR2_CHICK/105-298---------IPTA.----------------------------RWKS------FT--------------------------
PUR2_HUMAN/105-298---------IPTA.----------------------------QWKA------FT--------------------------
PUR2_SYNY3/103-291---------VPTA.----------------------------FGET------FT--------------------------
PUR2_YARLI/108-301---------IPTA.----------------------------AFEN------FT--------------------------
PUR2_DROME/108-301---------IPTA.----------------------------RYES------FT--------------------------

PF14305

Q7AJR3_BACHD/224-461---------..IDR----------------------------PWVS------DD--------------------------
Q8CX82_OCEIH/200-437---------..VRI----------------------------PWLS------VE--------------------------
Q8A829_BACTN/55-295---------EKYII----------------------------PTLG------VW--------------------------
B9JHB1_AGRRK/64-304---------SQYVI----------------------------PTQW------VG--------------------------
Q6AIA9_DESPS/77-317---------KDKII----------------------------PTIG------VW--------------------------

PF06973

I0A0Q1_FERFK/170-355---------II...----------------------------DDEK------NV--------------------------
E3GY13_METFV/174-361---------WI.SE----------------------------DDIS------KA--------------------------
D1Z1I1_METPS/179-365---------IV.SA----------------------------EMLK------SS--------------------------
F6D2X5_METSW/176-363---------WI.SE----------------------------EDIA------KA--------------------------
A8AB21_IGNH4/178-366---------VI.DD----------------------------EGLK------NA--------------------------
A8M9J4_CALMQ/163-349---------II.RL----------------------------SDLD------NA--------------------------
PURP_METS5/151-332---------LI...----------------------------NNVE------EL--------------------------
PURP_KORCO/176-365---------LV...----------------------------GSLE------DV--------------------------
B8D424_DESK1/179-369---------VI.RK----------------------------EDIV------SA--------------------------
Q8U3N6_PYRFU/189-380---------VI.TR----------------------------EDLE------KA--------------------------
PURP_METST/176-363---------WI.TD----------------------------SDVK------DA--------------------------
K4MLW3_9EURY/192-385---------VI.TQ----------------------------EALE------HA--------------------------
PURP_SULSO/152-336---------MI...----------------------------RDEN------EV--------------------------
E0SQP6_IGNAA/182-372---------II.KP----------------------------EDMS------RA--------------------------
F2KQP9_ARCVS/170-356---------LI.DA----------------------------GDVE------NA--------------------------
A9A5F5_NITMS/177-363---------VI.AR----------------------------KDLE------KA--------------------------
PURP_UNCMA/179-365---------WL.TE----------------------------EDRA------KA--------------------------
PURP_METS3/176-363---------WL.ED----------------------------SDVA------NA--------------------------
PURP_METMP/174-361---------VL.TE----------------------------DDVS------KA--------------------------
PURP_PYRFU/150-334---------.IKRK----------------------------EDLK------NI--------------------------
E1QNA3_VULDI/179-369---------VV.SE----------------------------GDLN------RA--------------------------
O29983_ARCFU/174-373---------VI.DE----------------------------EGLK------KA--------------------------
G0EE86_PYRF1/180-370---------II.DD----------------------------KSLE------EM--------------------------
F4B7X4_ACIHW/160-347---------II.DE----------------------------ESIK------EM--------------------------
Q8ZYV4_PYRAE/159-346---------II.RL----------------------------EDLE------NA--------------------------
PURP_METJA/174-361---------IL.TD----------------------------EDIA------NA--------------------------
PURP_METKA/174-359---------VI.DE----------------------------EDLE------QA--------------------------
D1Z1I2_METPS/172-358---------LL.KE----------------------------EDKE------NI--------------------------
F4B7X3_ACIHW/152-334---------LI...----------------------------KSID------EV--------------------------
PURP_ARCFU/172-358---------LI.GE----------------------------EDIK------NA--------------------------
F7XPS6_METZD/191-385---------TI.TR----------------------------DDLD------NA--------------------------
D3RZQ2_FERPA/169-355---------FI.SE----------------------------EDVE------KA--------------------------
R9SKL3_9EURY/176-363---------WL.TD----------------------------EDVP------NA--------------------------
PURP_NITMS/156-341---------VISED----------------------------ETL.------..--------------------------
PURP_CENSY/156-341---------VISTD----------------------------EDL.------..--------------------------
I0A0P9_FERFK/179-369---------IV.NK----------------------------EDIN------HA--------------------------
K0ILQ3_NITGG/143-327---------AIRSE----------------------------NDL.------..--------------------------
G0EEZ5_PYRF1/172-355---------LI...----------------------------RDPR------EA--------------------------
M9SKX6_9EURY/192-385---------VL.DE----------------------------DFEK------HA--------------------------
PURP_METTH/176-363---------WI.TE----------------------------DDVK------DA--------------------------
A4YCP1_METS5/159-347---------II.DQ----------------------------QGIS------QM--------------------------
D7E8D4_METEZ/189-383---------II.TQ----------------------------DALD------NA--------------------------
B1L3X8_KORCO/189-379---------LI.KK----------------------------EALD------EA--------------------------
R9T5A2_9EURY/191-385---------VI.DR----------------------------ETLQ------TA--------------------------
N0BIZ6_9EURY/179-365---------LI.EE----------------------------KDLK------EV--------------------------
Q980P6_SULSO/161-349---------VI.DN----------------------------EGLK------NM--------------------------
PURP_SULTO/152-333---------MI...----------------------------RSID------EV--------------------------
H3ZJJ4_THELN/150-333---------.IKDK----------------------------EDLK------HI--------------------------
A0B858_METTP/188-379---------VI.DS----------------------------DGLE------LA--------------------------
Q4JAU2_SULAC/161-348---------II.DD----------------------------EAIK------NM--------------------------
E1QNA2_VULDI/169-353---------LV...----------------------------KTPK------DA--------------------------
D2RDT4_ARCPA/168-351---------LV...----------------------------ESLD------DI--------------------------
B8D426_DESK1/170-355---------LL...----------------------------RSPR------EA--------------------------
A0RW22_CENSY/177-363---------LI.SE----------------------------KALE------SA--------------------------
U6EAL6_9EURY/176-363---------WI.EE----------------------------KDIK------NA--------------------------
D3E1N5_METRM/176-363---------WI.ED----------------------------EDVA------QA--------------------------
E0SQP8_IGNAA/175-356---------II...----------------------------KSID------EA--------------------------
N0BIR8_9EURY/179-375---------VI.TE----------------------------EGLK------KA--------------------------
PURP_THEKO/148-331---------.VRSK----------------------------EDLS------RV--------------------------
K0IE82_NITGG/179-366---------LV.TK----------------------------QDLD------KA--------------------------
E6N6E4_9ARCH/154-341---------LV.DE----------------------------KSLE------RV--------------------------

PF03738

A9WS88_RENSM/12-384---------LEETA----------------------------EELH------RM--------------CLEAA-------
A4YN97_BRASO/12-390---------IEEPT----------------------------AEIE------QI--------------CLELV-------
B0SZP5_CAUSK/12-383---------LEPAA----------------------------AELH------DL--------------CLDLV-------
D3UH97_HELM1/10-389---------FYEAG----------------------------NTLY------DM--------------FVEAA-------
Q7NXU8_CHRVO/12-377---------LDDAT----------------------------AELH------AM--------------CLDLV-------
B1ME79_MYCA9/12-385---------LEATV----------------------------EVLH------SM--------------CLEAV-------
B3PBJ7_CELJU/12-388---------LETPT----------------------------EALH------QM--------------VMDMV-------
C6WDU1_ACTMD/12-385---------MEADV----------------------------ELLH------NM--------------CMEAV-------
Q7VK77_HELHP/10-389---------YYEAG----------------------------NELY------DM--------------FIEAG-------
B8HN62_CYAP4/12-376---------LEDAT----------------------------AIMH------HL--------------CLEVV-------
D2NP05_ROTMD/13-409---------VRAQA----------------------------EEMH------RM--------------CLETV-------
A6WBP0_KINRD/12-396---------LERVT----------------------------EELH------GM--------------AVTAA-------
A6Q7W3_SULNB/11-391---------YYEAA----------------------------NTLY------DM--------------YVETG-------
Q7MSC7_WOLSU/10-389---------FYSAA----------------------------NELY------DM--------------FVEAG-------
C5B6G4_METEA/12-387---------IEGPT----------------------------AEID------AM--------------VLDLV-------
D1AYZ0_SULD5/11-391---------YYEAA----------------------------NELY------DM--------------FAEAG-------
A4F635_SACEN/12-385---------LEADV----------------------------ELLH------SM--------------CLDAV-------
B1M2K4_METRJ/12-384---------IEAPS----------------------------AALH------DL--------------CLAFV-------
D1A3Z2_THECD/12-380---------LEDTV----------------------------TELH------RM--------------CLNAV-------
C6CYE8_PAESJ/19-410---------IREST----------------------------NRIG------HI--------------FYKTA-------
Q7MZH8_PHOLL/12-386---------IEDPT----------------------------AEIH------RL--------------SLQAV-------
C1CWU9_DEIDV/12-384---------LQRDA----------------------------QELT------GL--------------ILDAT-------
A7ZBD7_CAMC1/11-391---------YYEAA----------------------------NELY------DM--------------YVNAA-------
Q5YS21_NOCFA/12-385---------LEADV----------------------------ELLH------SM--------------CLNAV-------
Q9A5T6_CAUCR/12-385---------LEPAT----------------------------EALH------KL--------------CLELV-------
C6W6C0_DYAFD/11-389---------YYEAA----------------------------GTLY------DM--------------LIEAG-------
Q0KFM7_CUPNH/12-388---------LYAAA----------------------------YDLN------QR--------------CLEAV-------
A8ETQ4_ARCB4/10-391---------FYEAT----------------------------NELY------DM--------------FVEAG-------
A0RRF5_CAMFF/10-390---------YYKAA----------------------------NELY------DM--------------YVTAA-------
Q8ZK95_SALTY/12-385---------IEKPT----------------------------AELH------QM--------------CLEIV-------
Q30QI3_SULDN/11-391---------YYEAA----------------------------NEIY------DM--------------YAKAA-------
Q89T52_BRADU/12-385---------IETPT----------------------------GEID------AM--------------CLELA-------
B6INZ6_RHOCS/12-390---------LDDAA----------------------------VELH------RL--------------CLEAA-------
Q87QT2_VIBPA/12-386---------LESPT----------------------------EELH------QM--------------CLSIV-------
B4EW39_PROMH/12-385---------LEETT----------------------------EELH------QM--------------CLQVA-------
C7Q215_CATAD/12-391---------LEDTT----------------------------AELH------AM--------------CLAAA-------
Q114E2_TRIEI/12-374---------LEVAT----------------------------NALQ------EL--------------YIEAA-------
Q01QL8_SOLUE/12-375---------LEAAT----------------------------NELE------TM--------------TLQAA-------
Q3IWQ4_RHOS4/12-395---------IEDPA----------------------------TALH------AM--------------CREAA-------
E8RVG1_ASTEC/12-399---------IHDAT----------------------------EACH------QM--------------ALAAA-------
Q2S7Y7_HAHCH/12-386---------LEDPS----------------------------AEIH------QM--------------CLEVV-------
C5BUP2_TERTT/12-387---------LEQPT----------------------------EEIH------QM--------------CLHVV-------
Q2G5S8_NOVAD/12-379---------LETAT----------------------------EEVH------RL--------------YLEAG-------
C7MS99_SACVD/12-385---------VEADV----------------------------ELLH------SM--------------CLEAV-------
C4K7Y5_HAMD5/12-384---------LENTT----------------------------AQLH------QM--------------CLEAV-------
D3FUB3_BACPE/20-413---------VQQAT----------------------------EEAY------SI--------------FKKTN-------
D2SBB5_GEOOG/6-397---------LEGWV----------------------------AQLF------EM--------------CVAAG-------
D1BLL0_VEIPT/15-434---------IRHVS----------------------------RRLF------QI--------------FCKAA-------
Q15WJ3_PSEA6/12-386---------IEQPT----------------------------ADIH------QM--------------CLAVV-------
Q4K4Q9_PSEF5/12-383---------LEDPT----------------------------QELH------EL--------------CMALV-------
Q7MJ95_VIBVY/27-401---------LEAPT----------------------------EEIH------QM--------------CLSIV-------
D2QD19_SPILD/11-389---------YYEAA----------------------------NELF------EM--------------FIAAG-------
Q5FTG8_GLUOX/15-386---------IRKVS----------------------------ETLH------RL--------------CLSVV-------
D2B8Z4_STRRD/12-384---------LENQV----------------------------EELH------RM--------------CLHAV-------
A1B1F8_PARDP/12-405---------IEAPA----------------------------TELH------AL--------------CREAV-------
B3E4M1_GEOLS/12-372---------LEDAT----------------------------NELQ------ER--------------CIEAA-------
D2PYF3_KRIFD/12-390---------LERVT----------------------------EELY------EM--------------CKHAA-------
C5D289_GEOSW/22-423---------IRTTT----------------------------DRIG------HL--------------YRKTA-------
A0JZG2_ARTS2/12-384---------LEKTA----------------------------EDMH------LM--------------CLEAA-------
A6L652_BACV8/13-373---------LEEAT----------------------------NEAY------RL--------------YCEAA-------
B2FMH2_STRMK/12-382---------IEDPS----------------------------AELH------QM--------------ALDLV-------
C5AU12_METEA/12-384---------IEGPS----------------------------AELH------AL--------------CLDFA-------
D4ZZ36_ARTPN/26-390---------IEAAT----------------------------QELH------EL--------------CLEAV-------
E0SI48_DICD3/12-384---------LEDAT----------------------------AELN------QM--------------CLQVV-------
F3ZL76_9ACTO/12-395---------LEETV----------------------------EELH------EL--------------CLAAA-------
I0DVC8_PROSM/16-395---------IEDPT----------------------------EELH------QM--------------CLEVV-------
O25019_HELPY/12-388---------YYDAC----------------------------NELY------DM--------------FVETA-------
Y929_HAEIN/15-391---------IEDTT----------------------------NELH------SM--------------CLDFA-------
Q0PBD8_CAMJE/11-387---------YYEAV----------------------------NELY------DM--------------FIAAA-------
Q6LL61_PHOPR/12-386---------IEDPT----------------------------EEIH------QM--------------CLDVV-------
Q7CGH0_YERPE/12-384---------LEETT----------------------------AELH------QM--------------CLQVV-------
Q7CPS0_SALTY/12-384---------LEDVT----------------------------AELH------QM--------------CLKVV-------
Q87YL5_PSESM/12-383---------LEAPT----------------------------QALH------QM--------------CMDAV-------
Q8P6Y2_XANCP/12-386---------IETPT----------------------------QELH------DM--------------AMQLV-------

PF04174

Q0RH44_FRAAA/80-411E--------VLADG-------------------------IV-PRRL------VL--------------T---S-------
A9H282_GLUDA/91-422R--------ILRDG-------------------------II-PADL------VL--------------G---N-------
B6IMV0_RHOCS/77-408K--------ILKDG-------------------------IV-PADL------VL--------------G---N-------
B3E3V9_GEOLS/83-414K--------IIKDG-------------------------VI-PPEL------IY--------------Q---G-------
Q97YL5_SULSO/75-386.--------...SN-------------------------PI-PDWI------VK--------------T---T-------
Q970N0_SULTO/87-396.--------...SS-------------------------PI-PDWI------IK--------------T---A-------
D0L0C4_HALNC/81-412E--------IIKAG-------------------------VI-PASQ------VL--------------G---N-------
B2HNB5_MYCMM/115-443R--------LLTEG-------------------------LL-PSEL------VF--------------G---H-------
B1M6F7_METRJ/100-432R--------LVAEG-------------------------LL-PAAI------VA--------------G---T-------
B2ICY7_BEII9/94-428R--------LVRSG-------------------------AL-PATA------VT--------------G---S-------
A0QWP7_MYCS2/138-466R--------SITSG-------------------------VL-PAQL------LF--------------S---H-------
A1A098_BIFAA/50-378Q--------AIKDG-------------------------IV-PEEY------VY--------------T---S-------
B4EHB6_BURCJ/116-451T--------ILQRG-------------------------LL-PPAL------VT--------------G---H-------
Y2411_MYCTU/100-431E--------ILRDG-------------------------VI-PRRL------VT--------------S---C-------
Q2K491_RHIEC/98-432R--------LVEEG-------------------------FL-PPAL------IA--------------A---N-------
Q6N7S9_RHOPA/71-403D--------ILRAG-------------------------VI-PDDL------IF--------------Q---N-------
Q8Y0C3_RALSO/108-439D--------IIRAG-------------------------LI-PPDQ------IY--------------N---N-------
Q9HUN7_PSEAE/81-412R--------LLAEG-------------------------LL-PSEL------VF--------------G---H-------

PF14403

B0SRE6_LEPBP/78-451K........ILKDK-------------------------II-PSEI------ID--------------S---S-------
B2U9B5_RALPJ/95-470N........ILRAG-------------------------VI-PPDQ------IY--------------N---N-------
Q7UKP3_RHOBA/129-506K........IIEDG-------------------------II-PASI------VD--------------S---C-------
A2SIW6_METPP/106-491R........LLHEG-------------------------LL-PPAL------VL--------------G---H-------
A8L1J5_FRASN/461-842A........AVADG-------------------------VI-PAWL------VN--------------D---S-------
Q2SNA4_HAHCH/81-457K........IVKDK-------------------------VF-PKDL------LS--------------K---S-------
G0A368_METMM/76-451E........IIKAG-------------------------II-SARQ------VL--------------D---N-------
G8TDU5_NIAKG/82-458F........ILKDG-------------------------VV-PIDM------VY--------------S---C-------
R7GX10_9FIRM/44-409A........ILSAG-------------------------IV-PDQL------VF--------------S---A-------
E4PGP6_MARAH/87-466S........LLKEG-------------------------LM-PPAL------VY--------------G---Q-------
A6X4S6_OCHA4/70-446E........IVRAG-------------------------RI-PKDL------IS--------------K---N-------
C7MDA1_BRAFD/81-458S........AISDG-------------------------VI-PVEL------VT--------------S---S-------
E0TD75_PARBH/78-455E........ILRAG-------------------------II-PERL------VI--------------E---N-------
M5E9Z3_9GAMM/88-463K........LLRQG-------------------------II-PAEA------LF--------------S---H-------
A5GWV9_SYNR3/98-472Q........ILSDG-------------------------VI-PLEA------IE--------------S---S-------
G8ANL6_AZOBR/76-451K........ILKDG-------------------------VI-PADL------VL--------------G---N-------
F7QPB4_9BRAD/100-477D........ILRAK-------------------------VV-PDDL------IF--------------Q---N-------
C8XDV8_NAKMY/113-485K........LVENG-------------------------LL-PAEL------VY--------------Q---Y-------
C7PAP4_CHIPD/82-458Q........ILKDK-------------------------IV-PASL------IA--------------S---C-------
C5BPD7_TERTT/80-455E........LIRHG-------------------------II-PPEA------LF--------------A---H-------
M4S737_9SPHN/75-454A........LFRDE-------------------------AL-PALL------AA--------------G---S-------
Q0BUT6_GRABC/74-457R........VLSEG-------------------------WL-PPAL------IY--------------G---N-------
B8EIB3_METSB/73-449E........IIKSG-------------------------KI-PADL------IL--------------N---N-------
R6N2N2_9BACE/41-413K........IIKDG-------------------------II-PAEF------VY--------------S---S-------
Q98HG7_RHILO/95-474R........LIEKG-------------------------IL-PAGL------IA--------------A---S-------
I0INR8_LEPFC/82-459E........IIRAG-------------------------II-PESQ------IM--------------G---N-------
R4LWB6_9ACTO/464-838T........VVKDG-------------------------IV-PEWV------ID--------------G---S-------
Q28NW9_JANSC/74-451E........ILRAG-------------------------RV-PREL------ID--------------G---N-------
I4B961_TURPD/78-451Q........IIKDK-------------------------II-TREV------VE--------------S---S-------
G8MNB3_9BURK/97-486T........LLHRG-------------------------LL-PSAL------VF--------------G---H-------
L0G4F9_ECHVK/78-451H........ILNDG-------------------------IV-PRDL------IE--------------N---S-------
C0Q8Z8_DESAH/78-453K........ILKDK-------------------------VV-PEDL------IM--------------T---C-------
B0RAK7_CLAMS/92-468R........AIRDG-------------------------VI-PARL------IS--------------S---S-------
B3E3V9_GEOLS/83-458K........IIKDG-------------------------VI-PPEL------IY--------------Q---G-------
E6U6S7_ETHHY/43-414C........ILRDG-------------------------VI-PPEF------IY--------------S---S-------
W6EFT2_SULMU/57-431K........ILKDG-------------------------II-PSEF------VF--------------S---S-------
D6Z885_SEGRD/105-486R........VLEQG-------------------------LV-PPEL------VF--------------A---H-------
C6CZ87_PAESJ/86-462R........IVSDG-------------------------VI-PRRM------IV--------------S---N-------
A6TAV7_KLEP7/78-451N........ILRAG-------------------------LI-PAEQ------VL--------------A---N-------
A4SY70_POLSQ/99-486T........LLKEG-------------------------YI-PPAL------VY--------------G---H-------
Q2SNA6_HAHCH/93-464T........CLKQG-------------------------VL-PPEL------VL--------------Q---H-------
D9QNT2_BRESC/66-443E........CIKAG-------------------------IV-PAEL------IF--------------T---N-------
K0I269_9BURK/78-457D........IIRAG-------------------------IV-PADL------IL--------------N---N-------
D9SI67_GALCS/71-450E........ILKAG-------------------------RI-PARQ------VL--------------G---N-------
A8LRF1_DINSH/95-474R........LLAEG-------------------------HL-PAEL------IA--------------Q---N-------
Q0AAK8_ALKEH/80-455R........ALRDG-------------------------VV-PESV------VL--------------Q---S-------
F0ST83_PLABD/75-454K........ILKDG-------------------------VI-PQEL------IH--------------S---A-------
Q21VI9_ALBFT/96-493Q........LLMKG-------------------------WL-PPAL------VQ--------------G---H-------
H6NBM0_9BACL/88-465H........IIRDG-------------------------IV-PRRM------VV--------------A---N-------
B1HML8_LYSSC/75-453R........IIRDG-------------------------YI-PRQL------VE--------------N---N-------
F7QLS6_9BRAD/69-448R........LIADG-------------------------AL-PAAA------IA--------------G---S-------
H8GJT5_METAL/83-459E........IIRAG-------------------------II-PQEI------IA--------------S---S-------
A0L4M7_MAGSM/83-454T........SVRQG-------------------------LL-PPEL------LY--------------R---C-------
C5AZ44_METEA/105-482R........LVADG-------------------------FL-PAGV------VA--------------G---H-------
A0JWU1_ARTS2/82-458S........VVADG-------------------------VI-PRQL------VT--------------T---S-------
I4BBL4_TURPD/78-451K........IIKDG-------------------------II-PADV------IF--------------S---S-------
G7US46_PSEUP/77-453Q........IVKDK-------------------------VF-PAML------LK--------------D---S-------
Y335_SYNY3/78-454N........IVKDG-------------------------IV-PLDI------VE--------------S---A-------
J7QJ85_METSZ/88-467R........LVAEG-------------------------LL-PAAA------VT--------------G---S-------
J9SHX4_9ACTO/88-468K........TIAAG-------------------------LV-APEM------VF--------------G---H-------
D5BCY0_ZUNPS/86-464K........ILKQG-------------------------IV-PIDL------IN--------------S---S-------
G0HBD1_CORVD/76-453R........VFTDG-------------------------VI-PRSV------VT--------------T---S-------
I4ESF5_MODMB/82-471RTDEEKQPEVVRAG-------------------------VV-PEWL------VS--------------A---S-------
A0L4N2_MAGSM/83-457K........IIKDK-------------------------KF-PGEL------LD--------------K---S-------
D7A0C0_STAND/71-448E........ILKAG-------------------------IV-PEDL------VY--------------Q---N-------
Q0ATT5_MARMM/69-446D........IIRAG-------------------------RI-PESL------IA--------------N---N-------
D5UNK9_TSUPD/57-430R........TIRDG-------------------------LL-PPEV------LF--------------A---H-------
C5CSR6_VARPS/152-536Q........LLAEG-------------------------LL-PAAL------VH--------------G---H-------
I3Y9R4_THIV6/92-476D........LIRTG-------------------------LL-PAEL------ID--------------G---N-------
X2GX35_9BACI/76-454L........IVTAG-------------------------II-PKNL------IE--------------Q---N-------
E8RKL3_ASTEC/78-453K........ILKDK-------------------------VI-PAEL------IF--------------S---S-------
K9ULM7_9CHRO/78-453Q........IVVDG-------------------------II-PQAA------IY--------------S---A-------
B2JQR2_BURP8/100-483T........LLLRS-------------------------KL-PPAL------VF--------------G---H-------
R5QN47_9PROT/73-432K........LISSG-------------------------IL-PPGT------VF--------------A---N-------
F6IN23_9SPHN/75-454E........IIRSG-------------------------RL-PIHA------LR--------------N---N-------
B0UGL6_METS4/78-455E........CIKAG-------------------------II-PGDL------VY--------------R---N-------
M5APU0_9ACTN/67-443R........IVADG-------------------------VF-PAEL------LE--------------D---S-------
D5V7Y1_ARCNC/57-430K........ILKDK-------------------------II-PEEF------IY--------------Q---A-------
M7T6M7_EUTLA/444-819R........VVHDG-------------------------IV-PAEQ------IT--------------G---I-------
E4RQ16_LEAB4/78-451K........ILEDK-------------------------VM-PSET------IF--------------S---S-------
Q21G21_SACD2/80-457K........IIKDG-------------------------II-PEFI------LK--------------Q---S-------
Q92M17_RHIME/95-473R........LVKAG-------------------------LL-PPAL------IA--------------S---N-------
D5V7X8_ARCNC/79-456R........LIKEG-------------------------IV-PAEI------IY--------------G---H-------
I0JSH6_HALH3/77-456K........IIEAG-------------------------II-PRDL------IE--------------N---N-------
G8APY9_AZOBR/89-465T........LTRSG-------------------------RL-SPAV------IH--------------A---D-------
Q31PF7_SYNE7/78-453K........ILKDR-------------------------VI-PEEL------IL--------------S---A-------
U5QND4_9CYAN/83-459K........ILRDK-------------------------VV-PRHL------VE--------------S---A-------
I0IHC7_PHYMF/105-493E........LIAQA-------------------------VV-PAAL------IL--------------G---N-------
I2EYM9_EMTOG/80-453R........IINDG-------------------------II-PREI------IE--------------S---S-------
G2IYZ6_PSEUL/78-452A........IVKAG-------------------------II-PAEQ------VF--------------T---