Sequence alignment for CL0182

PF07854

Q9YFW4_AERPE/15-368--------------TAVLSAILILVLVLPFKVRIVEEN-----------------LEAFFF-------------------
Q8PXG5_METMA/8-368--------------LAGFLVIFLAVLFGPFKIHVIEEN-----------------LEPFLL-------------------
Q8RCZ3_THETN/45-391--------------IAALLVILLMILILPLVNRYIEHN-----------------IEYFLF-------------------
Q8R782_THETN/2-340--------------VTALVVILVLILLLPFVVKQVEHN-----------------LEYFLF-------------------
Q8ZUI4_PYRAE/6-347--------------LYLQIVFLVLLIALPILSKKVEHN-----------------LELFFL-------------------
O29471_ARCFU/14-358--------------AAGLFIILFLVLILPFRVRKIEEN-----------------LEPFFL-------------------

PF07399

Q9Z6V2_CHLPN/1-438MILPPYSYSLKIGAAVLFFCSILHTFLTPWLYTLCQSYEHKKLVFPECWKRYARLSELFRI-------------------
Q9F206_9BURK/1-428MTPTT....IQLVGAALFAVALIHTFSTKFFERLAHSQPRH..............AGLWHL-------------------
Q87F98_XYLFT/1-420MMTLT...AIQLIGALLFAVAILHTFATKFFERLSHTHPTH..............AGLWHL-------------------
O84811_CHLTR/1-438MILPHYSSGLRIGSAILFFSAVIHTFFTPWLTRLYEESQHKKMIFPERWRQYLWLSELLRI-------------------

PF03806

ABGT_ECOLI/14-507KLYGWVERIGNKVPHPFLLFIYLIIVLMVTTAILSAFG-----------------VSAKNP-------------------
Q9KEI6_BACHD/19-511RFLDIIEKYGNKLPDPIMLFVIMAVLILICSAIFSALG-----------------TSAVHP-------------------
Q9KC22_BACHD/13-510KFLNFIEVTGNRLPHPITLFAILALLVIVASGILSAFN-----------------ISVDDP-------------------
Q9A7U5_CAUCR/48-548RLLDRIERVGDALPDPVFIFIGCIAILMVGSVIASALG-----------------WSAVNP-------------------
Q99RG0_STAAM/14-511RFLNSVEKIGNKLPDPSVLFFLMCVGLAIMTWVISLFN-----------------VSVKHP-------------------
Q9AA61_CAUCR/39-553GLLGVVERLGNLLPEPVMIFVWLILGLMVLSAIGQALG-----------------WSASIT-------------------
Q9KTN8_VIBCH/19-517RFLNFIERAGNKIPDPAILFFWALVIVWVSSALLSNVS-----------------FDLTNP-------------------
Q9KTM2_VIBCH/25-532RFLDGVEYLGNLLPHPITLFAIFCVVLLVASGIAGYFE-----------------LSVVDP-------------------
Q9RNX1_NEIGO/11-519RFLRTVEWLGNMLPHPVTLFIIFIVLLLIASAVGAYFG-----------------LSVPDP-------------------

PF03606

O51783_BORBU/4-471------------MPSSFTIIFSLIVFVTILTYVIPAGK-----------------FDKEFKQMGD...............
Y594_HAEIN/12-505------------FPSAFTILFAILILAVGLTWVIPSGS-----------------YSKLTYNSTDNVFVVKAYGVDDKTY
Q9CP35_PASMU/1-448------------MDLIIGLIAVILVGYYIVKGYSATGV-----------------LMTVG....................
Q97NA1_STRPN/11-499------------MPSSYTVLLIIIAIMAVLTWFIPAGA-----------------F........................
DCUC_SHIFL/5-452------------IELLIGVVVIVGVARYIIKGYSATGV-----------------LFVGG....................
Q99YT7_STRP1/11-496------------IPSSYTVLFIIIAIMAVLTWFIPAGA-----------------YETAKG...................
YFCC_ECOLI/15-502------------MPDTLVIIFFVAILTSLATWVVPVGM-----------------FDSQEVQYQVDGQTK..........
Q9AAL9_CAUCR/33-506------------LPDTFLILLFLALAAFVSTWIFTPGR-----------------YALSAK...................
Q9CMA1_PASMU/2-462------------LGLLLGLAVTILVGYLIVKKYKAQFV-----------------LLCGG....................
Q9KAH9_BACHD/20-464------------FPHIYVILFAFVTMMAIASLFVPAGE-----------------YER......................
Q99UT9_STAAM/18-515------------MPGAFMILFILTVVAVIATWVIPAGA-----------------YSKLSYEPSSQELKIVNPHNQVKKV
DCUC_VIBCH/6-456------------LELLIGLVVTFAVGYFIVKGYKPAGI-----------------LLTAG....................
DCUD_ECOLI/2-455------------FGIIISVIVLITMGYLILKNYKPQVV-----------------LAAAG....................

PF06808

Q9Y8U1_AERPE/115-551----------------LVMFAALLKYRAI....FILNV-----------------L..LFI-------------------
Q9K7H0_BACHD/6-417----------------LVIMFVLLALGFPMMIPMLAAS-----------------AIVLFL-------------------
Q8NN88_CORGL/3-439----------------IIALLVFIAIAVILNVFLKRDI-----------------SEALLV-------------------
Q8FA80_ECOL6/7-418----------------IPLMIVCLFLNIRVYLAMFIGI-----------------I..AYF-------------------
Q9CKH6_PASMU/7-420----------------LGTMFLLTVFGLPLFYSIIFAS-----------------I.VTLF-------------------
O07838_RHOCA/7-430----------------FGLLIALMLTGMPISISLGLTV-----------------L..TFL-------------------
Q92K76_RHIME/14-514----------------FVSLIVFLLLGYPVAFSLAANG-----------------L..LFF-------------------
O29619_ARCFU/128-601----------------LAVIFVLEATRRVVNPALVVVA-----------------IIFILY-------------------
Q8G0A8_BRUSU/148-607----------------LLILILLEATRRSVGWPLPIIS-----------------VLFMLY-------------------
Q8FRN3_COREF/157-598----------------FYWVAVLEILRRCAGPIVAGLA-----------------LAVSIY-------------------
Q92PP2_RHIME/208-617----------------VGGAAVCLAMGVPIAFCFGIAT-----------------L..LFL-------------------
Q8ZKS0_SALTY/12-424----------------IAVFVVLLAMGAPIGICIVIAS-----------------FSTMML-------------------
Q8ZL80_SALTY/7-416----------------LCCLLGGIAIGLPIAWSLLLCG-----------------A..ALM-------------------
Q92PN6_RHIME/6-416----------------TGLFAALLAISVPVGYALIIAA-----------------G..AAI-------------------
Q92WB7_RHIME/5-456----------------VGSFLVLMLVGVPVAISMAAAS-----------------V..LYL-------------------
Q89FZ8_BRAJA/199-609----------------LIGFFAMLFGGLPIGFALALAA-----------------L..IFI-------------------
Q89NA6_BRAJA/151-593----------------VMWVMLMEALRRTGGWSLLLSV-----------------FPFTVY-------------------
Q89CF6_BRAJA/11-428----------------FVSLFALMLLRVPVGMAMGLVG-----------------V.SGFS-------------------

PF02667

Q9ZLE5_HELPJ/3-453------------LLRHLTSACVFLASKCLPDSFVLVAL-----------------LSFVVF-------------------
O28734_ARCFU/8-484------------ALERMGARLCASVEKWMPDPLIFALL-----------------LTLVTY-------------------
ATOE_ECOLI/1-440------------MIGRISRFMTRFVSRWLPDPLIFAML-----------------LTLLTF-------------------
ATOE_HAEIN/1-447------------MISRVSRFMTTFVSKYLPDPLIFAVL-----------------LTFVTF-------------------

PF03600

Q10RS7_ORYSJ/16-503----------------FGIFWVL---AVFP..TVPFMP-----------------VGRTAG-------------------
ARSB_DICDI/51-511----------------SLIFICS---SKNI..VTKHLP-----------------IGRAGS-------------------
CITN_BACSU/5-373----------------LGFVMMI---VFMY..LIMSNR-----------------LSALIA-------------------
Q828S1_STRAW/5-417----------------LGFTMIA---TFLV..LIMLKK-----------------MSPIAA-------------------
Q897M4_CLOTE/5-411----------------IGIILSL---VLLM..YLAYRG-----------------ITVLIL-------------------
Q8T0L2_DROME/151-567----------------ILGLYML---IIFD..VIDHTF-----------------AALIIA-------------------
Q9VU30_DROME/220-638----------------LIGFYIL---IVFE..LTDRTF-----------------AALMMA-------------------
Q9W024_DROME/212-628----------------LIGLYAI---IIWE..FSDRIL-----------------STLLIT-------------------
Q81E21_BACCR/4-425----------------VIILLAL---SLLM..FVAYRG-----------------FSVILF-------------------
Q8EMV3_OCEIH/7-393----------------IGLLVSL---VVLI..YLTMKG-----------------VNIIIG-------------------
Q8XWF6_RALSO/4-412----------------VVVLAAL---AFLM..FAAYRG-----------------YSVILF-------------------
Q88BF5_PSESM/5-378----------------LGFAMVI---AFMY..LIMSKR-----------------LTALIA-------------------
Q8I929_DROME/216-650----------------LLIFYAL---LVWE..LFERTF-----------------VAMICS-------------------
Q9K635_BACHD/2-373----------------LGIVLGL---VILM..VLAYRG-----------------WSIIWV-------------------
Q2BIE8_9GAMM/57-578----------------FILAYSL---VPLENNIHLLKS-----------------KPVLVA-------------------
Q898H6_CLOTE/4-380----------------WIIIIAL---VLFT..ILAFKR-----------------VSALIL-------------------
YRAO_BACSU/5-384----------------LGFSMVT---VFTI..LIMTKK-----------------VSPIVA-------------------
Q8FSY6_COREF/59-476----------------LGFTMIL---TFMT..LIMLGR-----------------LTPMVA-------------------
CITM_BACSU/5-378----------------LGFLMML---VFMA..LIMTKR-----------------LSVLTA-------------------
Q88FZ5_PSEPK/9-557----------------LGLLAIV---IILF..VINRPR-----------------MDVVAL-------------------
Q7PVG5_ANOGA/324-759----------------LLGLYVL---IIWE..IVHRTF-----------------AAIIAS-------------------
Q8I930_DROME/315-750----------------LCGLYVM---IIWE..IVNRTF-----------------AAIIAS-------------------
Q87EP0_XYLFT/5-388----------------LGFGMVI---TFMY..LIMSKR-----------------LSPLVS-------------------
Q81I57_BACCR/5-381----------------LGFAMVF---VFMF..LIMTKR-----------------MSALVA-------------------
Q9AV23_ORYSJ/16-429----------------FGVFWML---AVFP..SVPFLP-----------------IGRTAG-------------------
Q8DUC7_STRMU/6-410----------------LAYAMII---VFMY..VVMKKK-----------------MSPFTA-------------------
Q8NUL8_STAAW/11-402----------------MGLIIII---SIVG..LLIAKK-----------------INPVVG-------------------
Q88L78_PSEPK/5-379----------------LGLIMVV---TFTY..LIMSKR-----------------LSPIVA-------------------
O81915_ARATH/16-450----------------FAIFWIL---AVFP..SVPFLP-----------------IGRTAG-------------------
Q82YV5_ENTFA/6-407----------------LAYGMII---IFMY..VIMKKK-----------------LSPFTS-------------------
Q88IC5_PSEPK/4-409----------------LIALAAL---ALLM..LAAYRG-----------------YSVILF-------------------
Q9HTA2_PSEAE/5-378----------------LAFAMVA---TFMF..LIMTKR-----------------LSALIA-------------------

PF02040

O68021_PSEAI/3-423----------------IAFAIFL---FTLVLVIWQPRG-----------------LGIGWS-------------------
ARSB_STAXY/4-426----------------LAIVIFL---LTLIFVIWQPKG-----------------LDIGIT-------------------
ARSB2_ECOLX/3-425----------------LAGAIFV---LTIVLVIWQPKG-----------------LGIGWS-------------------
YDFA_BACSU/6-428----------------LAVFIFL---LTLVLVIWQPKN-----------------LSIGWS-------------------

PF02447

GNTP_BACLI/1-447----------------MPLLIVAIG.IVALLLLIMGLK-----------------LNTFVS-------------------
GNTU_ECOLI/4-445----------------LTLVLTAVGSVLLLLFLVMKAR-----------------MHAFLA-------------------
GNUT_PSEAE/9-449----------------YLLLDALVT.IIGLIVLITRFK-----------------VHPFIA-------------------
YJHF_ECOLI/1-448----------------MPLIIVVAG.IALLLLLTIKIK-----------------LNTFVS-------------------
YGBN_ECOLI/4-454----------------ITLLCIALAGVIMLLLLVIKAK-----------------VQPFVA-------------------
GNTT_ECOLI/1-437----------------MPLVIVAIG.VILLLLLMIRFK-----------------MNGFIA-------------------
Y1015_HAEIN/6-457----------------IPIIGLLIA.VFVLVFLVLRTR-----------------VHAFIA-------------------
YOJA_BACSU/1-443----------------MPILIVAVG.VLILLFLIIKVK-----------------LNTFVS-------------------
DSDX_ECOLI/6-444----------------WVVSTLLIS.IVLIVLTIVKFK-----------------FHPFLA-------------------
GNTP_ZYMMO/7-450----------------MLLLYALAS.IIILILMIAKWR-----------------LNPFVS-------------------
GNTP_ECOLI/4-446----------------LNILWVVFG.IGLMLVLNLKFK-----------------INSMVA-------------------
IDNT_ECOLI/1-437----------------MPLIIIAAG.VALLLILMIGFK-----------------VNGFIA-------------------

PF00939

MEMP_CUPNH/32-513----------------LTLHWGLFAAVAALLVVLAIPQPEGLTVAGQRM------LAILAF-------------------
CITT_ECOLI/5-486----------------KDNIWKLLAPLVVMGVMFLIPVPDGMPPQAWHY------FAVFVA-------------------
O84207_CHLTR/4-470----------------HKRFLSLVLLTFILLGIWFCPHSDLIDSKAWHL------FAIFTT-------------------
Q9Z8X7_CHLPN/4-470----------------KKRFLSLLFLTAVLLGIWFSPHPASINSNAWQL------FAIFTT-------------------
Q9ZMT7_HELPJ/2-480----------------IKQILTILTPFFVATLLYFLGAPDGLNPNAWLY------FCIFMG-------------------
TTDT_ECOLI/4-487----------------STEWWRYLAPLAVIAIIALLPVPAGLENHTWLY------FAVFTG-------------------
S13A2_HUMAN/6-565----------------QALWAYRSYLIVFFVPILLLPLPILVPSKEAYC------AYAIIL-------------------
Y020_HAEIN/3-476----------------LSKNTKLVILMAIPLITFLLPAPDGLSLIAWRL------LGVYIA-------------------
YFLS_BACSU/12-478----------------AVKLVPLLITVAVGLIIWFIPAPSGLEPKAWHL------FAIFVA-------------------
YBHI_ECOLI/3-474----------------KKSLWKLILILAIPCIIGFMPAPAGLSELAWVL------FGIYLA-------------------
SOT1_SPIOL/101-569----------------GASIKPLLASILTGVIIWFIPTPEGVSRNAWQL------LAIFLS-------------------

PF13726

Q9ZL85_HELPJ/10-97----------------NPAFVAI---ICMCVLSLLR..-----------------LNVMLS-------------------
A3YN61_CAMJU/6-93----------------NPIIISV---VLMTLLCLFR..-----------------FNVLLS-------------------
Q73KL4_TREDE/3-90----------------NPVVIAV---IVMMVLCLLK..-----------------INILIA-------------------
C8A2Z4_STAAU/3-90----------------NAVVIAV---ILMIVLCLCR..-----------------LNVVIS-------------------
B9EAL6_MACCJ/2-89----------------NAVLIAV---LVMVILSLCR..-----------------LNVVLS-------------------
C3F6D3_BACTU/2-89----------------NAVLVAV---AVMLLLSLLR..-----------------VQVIVA-------------------
E6U2C3_BACCJ/2-89----------------NAVLIAV---FVMILLSLLR..-----------------VHVVVA-------------------
D6XUM8_BACIE/2-89----------------NAVIVAV---LIMIVLSLSR..-----------------VHVVLA-------------------
A3IGC2_9BACI/8-95----------------NAVIVAV---AVMLILSLLR..-----------------INVVLS-------------------
A7Z8B4_BACA2/2-89----------------NAVVVAV---LLMLVLSLLR..-----------------VNIIIA-------------------
Q2B2R2_9BACI/2-89----------------NAVIAAV---LVMLALSLLR..-----------------VNVVFA-------------------
B7GKU7_ANOFW/4-91----------------NAVIISV---LVMLILSLMR..-----------------MNVVFS-------------------
Q9K7K2_BACHD/2-89----------------NAVLLAV---IVMLVLSLLR..-----------------VHVVLA-------------------
Q5WDV8_BACSK/2-89----------------NAVVVAV---GLMLLLSLLR..-----------------VHVVLA-------------------
C4L1E0_EXISA/2-89----------------NAVLLAV---IVLFALAISR..-----------------VHIVLS-------------------
B1YEV1_EXIS2/3-90----------------NAVIIAV---ALLFILAIFR..-----------------VHIVLA-------------------
A4Y5U0_SHEPC/2-89----------------NAVVIAV---CLMLALSLFR..-----------------VNVVIA-------------------
Q084K9_SHEFN/4-91----------------NAVVIAV---CLMLFLSFIR..-----------------INVVVS-------------------
A1F5K2_VIBCL/2-89----------------NPVVISV---CVMLLLALMR..-----------------VNVVVA-------------------
D0YVL6_LISDA/2-89----------------NPVVIAV---CVMLVLALLR..-----------------VNVVVA-------------------
Q1ZN28_PHOAS/2-89----------------NPVIISV---CIMLLLSLMR..-----------------LNVVVA-------------------
B5FCM4_VIBFM/2-89----------------NPIILSV---SVMLILALLR..-----------------VNVVVA-------------------
D1B1X3_SULD5/2-89----------------NPVVVAV---FLMLALSLLR..-----------------VNVVIA-------------------
A6FIU9_9GAMM/2-89----------------NPVVIAV---LAMLILSFMR..-----------------INVVVA-------------------
A4SNQ6_AERS4/2-89----------------NPVVVAV---SLMLVLSLLR..-----------------INVVVS-------------------
Q65UQ2_MANSM/4-91----------------NEVVISI---LVLLILSLLR..-----------------INVVIA-------------------
C5BE39_EDWI9/2-89----------------NAVVIAV---VVMLLLSLLR..-----------------INVVIA-------------------
A1TWP4_MARAV/2-89----------------NAVVAAV---LIMLVLSLCR..-----------------IHVVVA-------------------
A4XTU4_PSEMY/2-89----------------NAVIAAV---GIMLVLSLCR..-----------------VHVVVA-------------------
Q02NE5_PSEAB/2-89----------------NAVVLAV---ALMLVLSLCR..-----------------VHVVLA-------------------
Q2BHM1_9GAMM/2-89----------------NAVILAV---LTMLVLSLFR..-----------------THVVIA-------------------
C0W230_9ACTO/19-106----------------NAVLVAV---ILMLLLALAR..-----------------VHVVLA-------------------
C0WF19_9CORY/2-89----------------NAVLIAV---IVMLALALLR..-----------------VHVVVA-------------------
D0WS18_9ACTO/27-114----------------NSVLIAV---VVMLALSLVR..-----------------VHVVVA-------------------
C0E4G0_9CORY/2-89----------------NAVLIAV---LVMLILSVAR..-----------------VHVVIS-------------------
D1DEI3_NEIGO/2-101----------------NAVVVAV---IVMLVLSLSR..-----------------VHVVLS-------------------
D4DM42_NEIEG/10-109----------------NAVVIAV---IVMLALSLSR..-----------------IHVVLS-------------------
Q1Q9H8_PSYCK/4-91----------------NAVLLAV---VIMLGLSLAR..-----------------VHVVLS-------------------
D0BZZ4_9GAMM/2-89----------------NAVVVAI---AVMFLLSLAR..-----------------VSVVLI-------------------
C0VHK3_9GAMM/2-89----------------FAIIAAV---AVMFGLSLGR..-----------------VPVVFA-------------------
Q1QX04_CHRSD/2-89----------------NAVILAV---LVMVGLALAR..-----------------VSVVFA-------------------
A4SIT2_AERS4/144-241----------------GAAISAP---LVAILLLALRPL-----------------AGIVVD-------------------

PF06450

NHAB_HAEIN/1-513----------------M..TNIQ---AFMKNFLGASPEWYKLAIVVFLI------INPIVF-------------------
NHAB_SHEON/1-520----------------MPMTMSQ---AFIGNFLGNSPKWYKIAILSFLI------INPILF-------------------
A6B3E7_VIBPA/1-515----------------MPISLGN---AFIKNFLGKAPDWYKVAIIAFLI------INPIVF-------------------
NHAB_ECOLI/1-512----------------MEISWGR---ALWRNFLGQSPDWYKLALIIFLI------VNPLIF-------------------

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------------------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------------------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------------------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------------------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------------------

PF03553

O51582_BORBU/170-435--------------------GAM---FGD.NLSLISDT-----------------TIVSSR-------------------
NHAC_BACPE/157-449--------------------GAC---FGD.KMSPLSDT-----------------TNFAPG-------------------
Q9KQG1_VIBCH/161-453--------------------GCY---FGD.KMSPLSDS-----------------VILASS-------------------
Q9K7B7_BACHD/160-482--------------------ICV---ISP.ISSWGAYI-----------------ITIIAG-------------------
O25453_HELPY/149-430--------------------ALT---FGL.QAPYLVLP-----------------VGFGLI-------------------
Q9ZKQ5_HELPJ/165-464--------------------VCL---LVP.ISSWGAYI-----------------MGIMNN-------------------
Q9KBE2_BACHD/142-433--------------------SLT---FGL.KAPYILIP-----------------AGYGLL-------------------
Q9AFA3_VIBHA/1-333--------------------MCV---IMP.ASSWGAYI-----------------ITIIGG-------------------
Q9HS26_HALSA/183-491--------------------GAV---FGD.NLAPVSDT-----------------TIVSAV-------------------
Q99VD8_STAAM/151-432--------------------IIG---FGL.CFPYVLLP-----------------YGFGQI-------------------
YUIF_BACSU/150-436--------------------VIT---FGL.TAPYILLP-----------------VGFGQI-------------------
NHAC_BACSU/159-453--------------------GAC---FGD.KMSPMSDT-----------------TNFAAG-------------------
O59530_PYRHO/156-486--------------------VAG---IAI.VSTWIGYE-----------------LGLIKE-------------------
Q9K5Y9_BACHD/160-453--------------------GAY---FGD.KMSPLSDS-----------------TNLAAG-------------------
Q97L22_CLOAB/149-436--------------------GVY---FGD.RCSPMSSS-----------------AALVAN-------------------
Q99RU7_STAAM/184-446--------------------GAM---FGD.NLSMISDT-----------------TIAAVR-------------------
Q9Y8U6_AERPE/161-510--------------------VAG---MML.VSTWIGFE-----------------VGLIKE-------------------
ARCD_HALSA/171-466--------------------GVY---MGD.KQSPLSDT-----------------TLLASG-------------------
O51583_BORBU/175-441--------------------AGA---FGD.NMSLISDT-----------------PIISSH-------------------
Q97TG1_CLOAB/150-462--------------------LIL---LIPIATSYLGYM-----------------VTLVTN-------------------
Q9K7K2_BACHD/150-434--------------------ILT---FGL.TAPYIFLP-----------------YGFGQI-------------------
Q9KSX5_VIBCH/165-497--------------------MCV---VMP.ASSWGAYI-----------------MTIIGG-------------------
Y325_HAEIN/152-444--------------------VLT---FGL.TATYILLP-----------------VGFGKI-------------------
Q9KT98_VIBCH/150-435--------------------VLT---FGL.ITPYMVLP-----------------VGFGGI-------------------
Q9KMV5_VIBCH/168-494--------------------VCV---ITP.ISSWGAYI-----------------IALIGG-------------------
MLEN_BACSU/159-452--------------------GAY---FGD.KLSPLSDS-----------------TVLASS-------------------
Q9AGE2_YERPS/159-463--------------------GAY---FGD.KISPLSDS-----------------TNFAAI-------------------
Q9JXG2_NEIMB/166-456--------------------VIT---FGL.VTTYMFLP-----------------YGFGAI-------------------
Q9KMX3_VIBCH/172-442--------------------GAM---FGD.NLSIISDT-----------------TIAATR-------------------
Q9K0Q3_NEIMB/165-476--------------------MCV---LMP.VSSWGASI-----------------IATLAG-------------------
Q9HNR2_HALSA/161-489--------------------VAT---LG..ISSWVAFQ-----------------LSMIEK-------------------
Q9CMF8_PASMU/165-482--------------------MCV---LMP.VSSWGAYI-----------------ITLIAG-------------------
Q99RX2_STAAM/158-455--------------------GAV---FGD.KMSPLSDT-----------------TNLAAL-------------------
Y1586_HAEIN/177-494--------------------MCV---MMP.VSSWGAYI-----------------ITLIGG-------------------
Y1107_HAEIN/162-461--------------------GAY---FGD.KLSPLSDT-----------------TNIASA-------------------
Q9HNF6_HALSA/156-488--------------------VTT---FGP.VSNWIGYQ-----------------VSMIIA-------------------
Q9HNF7_HALSA/171-467--------------------GAY---AGD.KQSPLSDT-----------------TNLAAA-------------------
Q9I0I5_PSEAE/151-435--------------------VIT---FGL.ITPYMFLP-----------------VGFGNI-------------------

PF03605

Q9ZEN8_WOLSU/6-382--------------------QLL---VVLGCLFYGAKK-----------------GGIALG-------------------
DCUB_SHIFL/6-376--------------------QLI---IILICLFYGARK-----------------GGIALG-------------------
Q9CJS4_PASMU/5-375--------------------EFL---FLLVALYLGSRF-----------------GGIGLG-------------------
DCUA_WOLSU/5-365--------------------EIL---VVLAAIFLGVRL-----------------GGIAIG-------------------
Q9KNN2_VIBCH/21-383--------------------ELA---IVLLFIFIGARI-----------------GGIGIG-------------------
DCUB_HAEIN/8-372--------------------QFA---IVLLCIFVGARV-----------------GGIGLG-------------------
Q9KMW3_VIBCH/5-373--------------------EFL---FLLLMLYIGSRY-----------------GGIGLG-------------------
DCUA_SHIFL/5-365--------------------ELI---IVLLAIFLGARL-----------------GGIGIG-------------------
Q97DH7_CLOAB/5-371--------------------ELV---IVLAIIFLGVRK-----------------GGTFLA-------------------
DCUA_HELPJ/7-369--------------------QII---VLLFSLFLGARL-----------------GGLGVG-------------------

PF04165

O29978_ARCFU/17-405--------------------ASS---SLA-LLFSIAVV-----------------LILIRK-------------------
O57766_PYRHO/2-394--------------------GIT---LLL-ISFAVVIV-----------------LIWL.K-------------------
Q9V2R1_PYRAB/3-395--------------------EII---LLL-ASFLVVII-----------------LIWL.K-------------------
Q9WYV1_THEMA/3-381--------------------TLS---VLL-SLFTVIVV-----------------QRVFKK-------------------

PF02652

LCTP_BACSU/14-536----------------VSALVAL---TPILFFLLALTV-----------------LKMKGI-------------------
LUTP_BACSU/16-554----------------LSALAAL---VPIIFFFWALAI-----------------KRMKGY-------------------
LLDP_ECOLI/16-542----------------LSSLIAS---LPILFFFFALIK-----------------LKLKGY-------------------
Q9ZMU0_HELPJ/15-536----------------LSALVAL---SPIALFFISLIV-----------------FKLKGY-------------------
Y1218_HAEIN/2-525----------------LSFILSI---FPIVLLIYLMVK-----------------RNALPS-------------------
O51549_BORBU/4-500----------------YDFITAL---VPIILIIIGLGI-----------------IKKPAY-------------------
Q9ZMT9_HELPJ/16-539----------------LSALVAL---LPILLFFLSLMV-----------------FKLKGY-------------------
O29452_ARCFU/1-535----------------MDAIVAA---TPILLVLFLMAG-----------------LRMSAM-------------------

PF07854

Q9YFW4_AERPE/15-368-------------IMGLLGVATIY-----------------YYGILPTPDSLIG....LFIKAFKTPLA-----------
Q8PXG5_METMA/8-368-------------VC...GIAAMT-----------------LSGFVEIPGNETGWRMEIVEEAFTAPLH-----------
Q8RCZ3_THETN/45-391-------------SM...GVAAAF-----------------VSGV.........FSYDLIIHIFKNHLL-----------
Q8R782_THETN/2-340-------------TM...GIISVI-----------------VSKQ.........FSVELFFHIFKNPLI-----------
Q8ZUI4_PYRAE/6-347-------------AM...AVAGAT-----------------LEGL.........WSWHLLKEALLHPVA-----------
O29471_ARCFU/14-358-------------IM...GIVAVT-----------------VSGL.........WSLELIIEALETPVR-----------

PF07399

Q9Z6V2_CHLPN/1-438-------------LSRVEIVFFLW-----------------AVPL---------FFWFLYTEGYRISMA-----------
Q9F206_9BURK/1-428-------------LGEVEIVFGFW-----------------AMVL---------MLFMFGIEGKASATH-----------
Q87F98_XYLFT/1-420-------------LGEVEVVFGFW-----------------ALVL---------VVAMCVTDGAQAAIQ-----------
O84811_CHLTR/1-438-------------VSRVELVFVLW-----------------AIPL---------FCLFLYTEGYRITMA-----------

PF03806

ABGT_ECOLI/14-507--------------.TDGTP....-----------........VV---------VKNLLSVEGLHWFLP-----------
Q9KEI6_BACHD/19-511--------------...GTG....-----------......EEIE---------VVNLLNGEGFILILT-----------
Q9KC22_BACHD/13-510--------------ANPGET....-----------........VE---------VMNLLSSEGIAYIFT-----------
Q9A7U5_CAUCR/48-548--------------VTG.......-----------......QHLQ---------AESLLSRENLAKLFV-----------
Q99RG0_STAAM/14-511--------------...GTH....-----------......QTIY---------IKNIISHDGFTMIMN-----------
Q9AA61_CAUCR/39-553--------------YAGDEAPQFG-----------ELENGVLTYA---------ASSLFSEANLARLFT-----------
Q9KTN8_VIBCH/19-517--------------R..TNE....-----------.......ALE---------IKNLLTGESLAHFLA-----------
Q9KTM2_VIBCH/25-532--------------RPEGAKGR..-----------...AADGMIH---------VVSLLNADGLELIVT-----------
Q9RNX1_NEIGO/11-519--------------RPVGAKGR..-----------...ADDGLIH---------VVSLLDADGLIKILT-----------

PF03606

O51783_BORBU/4-471........GSKREIIVAGTYQYVD-----------RGSRGFLHPI---------MTILTAMSK......-----------
Y594_HAEIN/12-505PATTDTLDNLNIKIKLSNFTEGVI-----------KKPIAIPGTY---------QRVEQHHKGIEDITK-----------
Q9CP35_PASMU/1-448..............LLLLLCSVLL-----------DK.AILPNSV---------KSTGSLYLD..VFEY-----------
Q97NA1_STRPN/11-499...............IEGIYETQP-----------QNPQGIWDVL---------MAPIRAMLGTHPEEG-----------
DCUC_SHIFL/5-452..............LLLLIISAIM-----------GH.KVLPSSQ---------ASTGYSATD..IVEY-----------
Q99YT7_STRP1/11-496............GGVISGTYKTVA-----------SNPQGFFDIL---------MAPVRGMLG...VEG-----------
YFCC_ECOLI/15-502....TRKVVDPHSFRILTNEAGEP-----------EYHRVQLFTT---------GDERPGLMNFPFEGL-----------
Q9AAL9_CAUCR/33-506.............GRIDPTSFEAG-----------AAPLRAPLFG---------QDGAVGFLNVPFEGL-----------
Q9CMA1_PASMU/2-462..............IILMCFAVLF-----------GLGEILPAN.---------KSTGWVGFD..IFEF-----------
Q9KAH9_BACHD/20-464...............VEGPMGRMM-----------INPEVFSFIE---------GEQIGIMGFLTAIPN-----------
Q99UT9_STAAM/18-515PGTQQELDKMGVKIKIEQFKSGAI-----------NKPVSIPNTY---------ERLKQHPAGPEQITS-----------
DCUC_VIBCH/6-456..............ILLLILTGIL-----------GH.KVLPGQM---------ESTGNLLTD..AMEY-----------
DCUD_ECOLI/2-455..............IFLMMCGVWL-----------GFGGVLDPT.---------KSSGYLIVD..IYNE-----------

PF06808

Q9Y8U1_AERPE/115-551-------------YTLNGSWAPYP-----------FDHPGIRLER---------IITAMSVE....FET-----------
Q9K7H0_BACHD/6-417-------------FFSHVD.....-----------......PM..---------ILIQQMME.......-----------
Q8NN88_CORGL/3-439-------------GLVGTALVGGV-----------......NAPT---------LLIDAVVD.......-----------
Q8FA80_ECOL6/7-418-------------LFFSSV.....-----------......PIE.---------IAVQRLIA.......-----------
Q9CKH6_PASMU/7-420-------------YFLPNI.....-----------......PVT.---------IVAQQVMQ.......-----------
O07838_RHOCA/7-430-------------FTMTQV.....-----------......PID.---------TVALKLFT.......-----------
Q92K76_RHIME/14-514-------------IIGVELAPLSD-----------SINLSWPLLN---------ALPERFWG.......-----------
O29619_ARCFU/128-601-------------AKFGAS.LPGV-----------LSHPSYDWKQ---------ILEHLYYTKEGIFGT-----------
Q8G0A8_BRUSU/148-607-------------ALYGPS.MPGI-----------LVHPGATVSQ---------LVDHLYLTTQGIYGI-----------
Q8FRN3_COREF/157-598-------------PMFADIIPVGF-----------LQGISYDPVT---------LAQVHVMGTESIHGL-----------
Q92PP2_RHIME/208-617-------------AFTTSM.....-----------......PLV.---------VMIGRMDE.......-----------
Q8ZKS0_SALTY/12-424-------------VLPFDI.....-----------......SMF.---------ATAQKMFS.......-----------
Q8ZL80_SALTY/7-416-------------AYLDMF.....-----------......DVQ.---------IMAQTLVN.......-----------
Q92PN6_RHIME/6-416-------------LWQGGT.....-----------......PTV.---------LAVVKLFQ.......-----------
Q92WB7_RHIME/5-456-------------VSYNVA.....-----------......PDI.---------IAAQRMIA.......-----------
Q89FZ8_BRAJA/199-609-------------WVEGAL.....-----------......PGV.---------IFAQQMAR.......-----------
Q89NA6_BRAJA/151-593-------------PLFAESGWLGP-----------FRGTQSTLEQ---------ATAYHVLSGESLLGI-----------
Q89CF6_BRAJA/11-428-------------YLVGAT.....-----------......PALK---------LVGQTSMR.......-----------

PF02667

Q9ZLE5_HELPJ/3-453-------------VLVYCLTGQDA-----------SS........---------.VISSWGNG-----------------
O28734_ARCFU/8-484-------------LLVIVVMKPYT-----------VMDAGTMVKW---------LLVDVWYKG-----------------
ATOE_ECOLI/1-440-------------VIALWLTPQTP-----------IS........---------.MVKMWGDG-----------------
ATOE_HAEIN/1-447-------------ICAWGLTDSTP-----------VD........---------.LVNMWGNG-----------------

PF03600

Q10RS7_ORYSJ/16-503-------------SLLGAMLMVLF.....................---------.........RVISPE-----------
ARSB_DICDI/51-511-------------SIIGATLMVYF.....................---------.........GIIQPK-----------
CITN_BACSU/5-373-------------LIVVPIVFALI................SGF..---------......GKDLGEMMI-----------
Q828S1_STRAW/5-417-------------LVLIPALFCVF................VGK..---------......GAKLGDYVI-----------
Q897M4_CLOTE/5-411-------------APILSLLAALIS..............TIGGDG---------V..PLMATYTEIFMK-----------
Q8T0L2_DROME/151-567-------------TTAVAILAILE.....................---------.........HRPSMR-----------
Q9VU30_DROME/220-638-------------TTGIAILTALG.....................---------.........NRPTLE-----------
Q9W024_DROME/212-628-------------AMSLALLTVLG.....................---------.........SRPTLE-----------
Q81E21_BACCR/4-425-------------APIFALFAVFL................TEPSY---------....VLPFFSNIFME-----------
Q8EMV3_OCEIH/7-393-------------AIISSVIVALT.................GGLR---------....LDTALMDNYMT-----------
Q8XWF6_RALSO/4-412-------------APLAALGAVLL................TDPSA---------....VAPVFAGIFME-----------
Q88BF5_PSESM/5-378-------------LILVPIIFALF................GGF..---------......AAQIGPMML-----------
Q8I929_DROME/216-650-------------ILSVTTLACFN.....................---------.........DRPNMD-----------
Q9K635_BACHD/2-373-------------APIAAGVVALF.................GGLD---------....LLPAYTDTYME-----------
Q2BIE8_9GAMM/57-578-------------AGLIWILVALA.................FKEI---------....GATEQAHHAIK-----------
Q898H6_CLOTE/4-380-------------GPLVSLFVIVC.................SKLP---------....MFDTMLGPYMN-----------
YRAO_BACSU/5-384-------------LTITPIVFALI................GGF..---------......GKGIGDMIL-----------
Q8FSY6_COREF/59-476-------------MLLVPTIFGLI................AGA..---------......GLGMGEMVL-----------
CITM_BACSU/5-378-------------LVLTPIVFALI................AGF..---------.....GFTEVGDMMI-----------
Q88FZ5_PSEPK/9-557-------------LVILALPLLGI.....................---------...........LTVE-----------
Q7PVG5_ANOGA/324-759-------------TLAIGVLAAMN.....................---------.........ERPSMP-----------
Q8I930_DROME/315-750-------------TLSVGILAALN.....................---------.........SRPSMA-----------
Q87EP0_XYLFT/5-388-------------LIIVPIVFALA................GGF..---------......GSSMSEMML-----------
Q81I57_BACCR/5-381-------------LILIPSVFALI................GGF..---------......YADMGPMML-----------
Q9AV23_ORYSJ/16-429-------------ALLGAVLMIVF.....................---------.........HVISAD-----------
Q8DUC7_STRMU/6-410-------------LIIVPLVAVIIVILTNSANFTADKSFVEFLGG---------DKISHNLTAIGPMVL-----------
Q8NUL8_STAAW/11-402-------------MTIIPCLGAMI................LGY..---------.....SVTDLVGFFA-----------
Q88L78_PSEPK/5-379-------------LTIVPIVFALV................GGF..---------......APDLGKMML-----------
O81915_ARATH/16-450-------------SLFGAMLMVIF.....................---------.........QVITPE-----------
Q82YV5_ENTFA/6-407-------------LVIIPLIFTLIAIAT........GVASPPPGA---------D.GVVPEVNIGNFVL-----------
Q88IC5_PSEPK/4-409-------------APIAALGAVLL................TDPAA---------....VAPAFTGVFME-----------
Q9HTA2_PSEAE/5-378-------------LILVPIAFALI................GGF..---------......AAGLGPMML-----------

PF02040

O68021_PSEAI/3-423-------------ASIGALLALAL-------------------------------------GSVAPGDI-----------
ARSB_STAXY/4-426-------------ALIGAVVAIIT-------------------------------------GVVSFSDV-----------
ARSB2_ECOLX/3-425-------------ATLGAVLALIS-------------------------------------GVVHIGDI-----------
YDFA_BACSU/6-428-------------ACGGAVLALIA-------------------------------------GVVNFHDV-----------

PF02447

GNTP_BACLI/1-447-------------LIIVSFGVALA-------------------------------LGMPLDDIVKTIEE-----------
GNTU_ECOLI/4-445-------------LMVVSMGAGLF-------------------------------SGMPLDKIAATMEK-----------
GNUT_PSEAE/9-449-------------LIIAAGFLGLT-------------------------------SGMPVEKIVKSFQD-----------
YJHF_ECOLI/1-448-------------LIIVSIAVAIA-------------------------------SGMDLSKVVTSVES-----------
YGBN_ECOLI/4-454-------------LLLVSLLVALA-------------------------------AGIPAGEVGKVMIA-----------
GNTT_ECOLI/1-437-------------LVLVALAVGLM-------------------------------QGMPLDKVIGSIKA-----------
Y1015_HAEIN/6-457-------------MLIAASIAGLV-------------------------------GGMSADETLNSITK-----------
YOJA_BACSU/1-443-------------LIVVSFLVAIG-------------------------------LGMDINKIVLSIET-----------
DSDX_ECOLI/6-444-------------LLLASFFVGTM-------------------------------MGMGPLDMVNAIES-----------
GNTP_ZYMMO/7-450-------------LILVSIGMGAV-------------------------------TGMPLTKVLSAFQD-----------
GNTP_ECOLI/4-446-------------LLVAALSVGML-------------------------------AGMDLMSLLHTMKA-----------
IDNT_ECOLI/1-437-------------LVLVAAVVGFA-------------------------------EGMDAQAVLHSIQN-----------

PF00939

MEMP_CUPNH/32-513-------------AIVVWITEAVS----------------YETSA---------IMITSLMAGLIGFAP....TVNDPSV
CITT_ECOLI/5-486-------------MIVGMILEPIP----------------ATAIS---------FIAVTICVIGSNYLLFDAKELADPAF
O84207_CHLTR/4-470-------------TIIGIIVQPAP----------------MGAIV---------IMGISLL.LVTKTLT...........
Q9Z8X7_CHLPN/4-470-------------TIMGIIFQPVP----------------MGAIA---------IIGISTL.LLTQTLT...........
Q9ZMT7_HELPJ/2-480-------------MIIGLILEPVP----------------SGLIA---------LSALVPCIALKIGASSEVASAN....
TTDT_ECOLI/4-487-------------VIVGLILEPVP----------------GAVVA---------MVGISIIAILSPWLLFSPEQLAQPGF
S13A2_HUMAN/6-565-------------MALFWCTEALP----------------LAVTA---------LFPLILFPMMGIVDA...........
Y020_HAEIN/3-476-------------TIVGLVLKPYG----------------EPVIL---------LAAIAVSGVIIGNTEGAKE.......
YFLS_BACSU/12-478-------------TIIGFISKPLP----------------MGAIA---------IFALAVT.ALTGTLS...........
YBHI_ECOLI/3-474-------------AIVGLVIKPFP----------------EPVVL---------LIAVAASMVVVGNLS..DG.......
SOT1_SPIOL/101-569-------------TIVGIITQPLP----------------LGAVA---------LMGLGAS.VLTKTLT...........

PF13726

Q9ZL85_HELPJ/10-97-------------MISATLIAGLM--------------------------------------------------------
A3YN61_CAMJU/6-93-------------LLISALVAGVF--------------------------------------------------------
Q73KL4_TREDE/3-90-------------IMISGIVGGII--------------------------------------------------------
C8A2Z4_STAAU/3-90-------------LFISALVGGLI--------------------------------------------------------
B9EAL6_MACCJ/2-89-------------LFIGALAGGLV--------------------------------------------------------
C3F6D3_BACTU/2-89-------------IIVGALTGGMI--------------------------------------------------------
E6U2C3_BACCJ/2-89-------------MVTGAIVGGIV--------------------------------------------------------
D6XUM8_BACIE/2-89-------------LAAGAIAGGLT--------------------------------------------------------
A3IGC2_9BACI/8-95-------------LVLGAFVGGLT--------------------------------------------------------
A7Z8B4_BACA2/2-89-------------LMIGALAGGLT--------------------------------------------------------
Q2B2R2_9BACI/2-89-------------LIAGALVGGLT--------------------------------------------------------
B7GKU7_ANOFW/4-91-------------LLIASLVGGWF--------------------------------------------------------
Q9K7K2_BACHD/2-89-------------LSIGAIVGGVV--------------------------------------------------------
Q5WDV8_BACSK/2-89-------------LAISAIVGGLV--------------------------------------------------------
C4L1E0_EXISA/2-89-------------LILAALVGGLV--------------------------------------------------------
B1YEV1_EXIS2/3-90-------------MVLSAVAGGLI--------------------------------------------------------
A4Y5U0_SHEPC/2-89-------------LTVSALVAGLI--------------------------------------------------------
Q084K9_SHEFN/4-91-------------LTISAVVAGLV--------------------------------------------------------
A1F5K2_VIBCL/2-89-------------LTFSAVVGGLV--------------------------------------------------------
D0YVL6_LISDA/2-89-------------LTFSAIVGGLI--------------------------------------------------------
Q1ZN28_PHOAS/2-89-------------LTFSAIVGGIV--------------------------------------------------------
B5FCM4_VIBFM/2-89-------------LTFSALIGGLV--------------------------------------------------------
D1B1X3_SULD5/2-89-------------LTLSALIGGLI--------------------------------------------------------
A6FIU9_9GAMM/2-89-------------LTISAFLGGLI--------------------------------------------------------
A4SNQ6_AERS4/2-89-------------LSISAIVGGLL--------------------------------------------------------
Q65UQ2_MANSM/4-91-------------LVISALTAGLV--------------------------------------------------------
C5BE39_EDWI9/2-89-------------LIVAALVAGLS--------------------------------------------------------
A1TWP4_MARAV/2-89-------------LIIGAISGGLV--------------------------------------------------------
A4XTU4_PSEMY/2-89-------------LIVGALAGGLL--------------------------------------------------------
Q02NE5_PSEAB/2-89-------------LIIGAVVGGLF--------------------------------------------------------
Q2BHM1_9GAMM/2-89-------------LLIGALVGGLT--------------------------------------------------------
C0W230_9ACTO/19-106-------------LFIGALVGGLL--------------------------------------------------------
C0WF19_9CORY/2-89-------------LFIGAIVGGLL--------------------------------------------------------
D0WS18_9ACTO/27-114-------------LFIGAIVGGLL--------------------------------------------------------
C0E4G0_9CORY/2-89-------------LFIGALVGGLI--------------------------------------------------------
D1DEI3_NEIGO/2-101-------------LTVGAFVGGAV--------------------------------------------------------
D4DM42_NEIEG/10-109-------------LAIGAFVGGLV--------------------------------------------------------
Q1Q9H8_PSYCK/4-91-------------LLIGALAGGLI--------------------------------------------------------
D0BZZ4_9GAMM/2-89-------------LVVSAIVGGLV--------------------------------------------------------
C0VHK3_9GAMM/2-89-------------LVIGALTGGLL--------------------------------------------------------
Q1QX04_CHRSD/2-89-------------LIVGALVGGLV--------------------------------------------------------
A4SIT2_AERS4/144-241-------------PLIALPLGGLV--------------------------------------------------------

PF06450

NHAB_HAEIN/1-513-------------FFISPFIAGWL----------------LVAEF---------IFTLAMALKCYPLQP-----------
NHAB_SHEON/1-520-------------FYVSPFVAGWV----------------LVLEF---------IFTLAMALKCYPLQP-----------
A6B3E7_VIBPA/1-515-------------FLINPFVAGWL----------------LVAEF---------IFTLAMALKCYPLQP-----------
NHAB_ECOLI/1-512-------------.LISPFVAGWL----------------LVAEF---------IFTLAMALKCYPLLP-----------

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------M-----------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------M-----------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------M-----------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------M-----------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------M-----------

PF03553

O51582_BORBU/170-435-------------TQGSSILDVFI-----------------....---------........SSSFYAF-----------
NHAC_BACPE/157-449-------------IVGVDLFDHIR-----------------....---------.......H.LLWTTV-----------
Q9KQG1_VIBCH/161-453-------------MSNVEVMEHIK-----------------....---------.......G.MLPIAL-----------
Q9K7B7_BACHD/160-482-------------ILATHGVTQYG-----------------....---------......GLQAFIMMV-----------
O25453_HELPY/149-430-------------FQ.TTILEQLK-----------------....---------......ANGVSTTI.-----------
Q9ZKQ5_HELPJ/165-464-------------DNSPLLKDSFS-----------------....---------.........VLLQSL-----------
Q9KBE2_BACHD/142-433-------------FH.SIIADEMT-----------------....---------......ANGMSISI.-----------
Q9AFA3_VIBHA/1-333-------------ILVSHGITEYS-----------------....---------......ALGAYVRLI-----------
Q9HS26_HALSA/183-491-------------TQDADIGGVVA-----------------....---------......S..RFKYAG-----------
Q99VD8_STAAM/151-432-------------FQ.QIIQSGFA-----------------K...---------.....ANHPIEFNM.-----------
YUIF_BACSU/150-436-------------FQ.GMLKDNM.-----------------....---------.....ADAGLNVPL.-----------
NHAC_BACSU/159-453-------------IGEIPIFEHIR-----------------....---------.......H.MMGTTI-----------
O59530_PYRHO/156-486-------------AF....EKLH.-----------------IT..---------....MGEYYAWLHSV-----------
Q9K5Y9_BACHD/160-453-------------ITGVDLFEHIK-----------------....---------.......H.MLYTTI-----------
Q97L22_CLOAB/149-436-------------LTKTNIFTNMK-----------------....---------......N..MIYSSI-----------
Q99RU7_STAAM/184-446-------------TQHTKMKDKFR-----------------....---------........VNFKIVL-----------
Q9Y8U6_AERPE/161-510-------------AIATLEEEALA-----------------GLIP---------AAPTIEAYAAWLQSV-----------
ARCD_HALSA/171-466-------------VSDVDLWDHVR-----------------....---------.......G.MFPNTI-----------
O51583_BORBU/175-441-------------TQKVNIVDVFK-----------------....---------.......N.GAFYTF-----------
Q97TG1_CLOAB/150-462-------------NIKHKGISEKA-----------------....---------.......YSILVKSI-----------
Q9K7K2_BACHD/150-434-------------FH.GIIQSNI.-----------------....---------.....ADNGLEVTM.-----------
Q9KSX5_VIBCH/165-497-------------ILVSHGIEEYS-----------------....---------......ALGAYLRLV-----------
Y325_HAEIN/152-444-------------FIESILVKNIN-----------------Q...---------.....AGATLGLQTN-----------
Q9KT98_VIBCH/150-435-------------FLNNILLKNLH-----------------....---------.....ENGLESITA.-----------
Q9KMV5_VIBCH/168-494-------------ILAAHEMTEIS-----------------....---------......AISAFVQMI-----------
MLEN_BACSU/159-452-------------LSKVDVLAHVR-----------------....---------.......A.MLYLSI-----------
Q9AGE2_YERPS/159-463-------------VADTDLYVHIK-----------------....---------.......H.LMYTTL-----------
Q9JXG2_NEIMB/166-456-------------FLNEILLGNIH-----------------S...---------.....AAPQLDVKN.-----------
Q9KMX3_VIBCH/172-442-------------SQGCHMRDKFK-----------------....---------........ENIRIAL-----------
Q9K0Q3_NEIMB/165-476-------------LLVTYKITEYT-----------------....---------......PMGTFVAMS-----------
Q9HNR2_HALSA/161-489-------------GYETAGVSAAS-----------------R...---------....PQNFEIFLQAI-----------
Q9CMF8_PASMU/165-482-------------LLATYSITEYS-----------------....---------......PIGAFMTMS-----------
Q99RX2_STAAM/158-455-------------VTKVNIFKHI.-----------------....---------.......HSMMWTTI-----------
Y1586_HAEIN/177-494-------------LLATYSITEYT-----------------....---------......PIGAFVAMS-----------
Y1107_HAEIN/162-461-------------AAGVDLYEHIA-----------------....---------.......H.LLYTTL-----------
Q9HNF6_HALSA/156-488-------------GLEAARVSAAE-----------------LG..---------....TTPFGLFLQSI-----------
Q9HNF7_HALSA/171-467-------------VTNADLYDHIN-----------------....---------.......G.MRLGTA-----------
Q9I0I5_PSEAE/151-435-------------FLNEILLANV.-----------------....---------.....ARNGVDVSG.-----------

PF03605

Q9ZEN8_WOLSU/6-382-------------LLGGIGLVILI---------------------------------------FGFHLP-----------
DCUB_SHIFL/6-376-------------LLGGIGLVILV---------------------------------------FVFHLQ-----------
Q9CJS4_PASMU/5-375-------------VVSGIGLLIEV---------------------------------------FIFRMP-----------
DCUA_WOLSU/5-365-------------YAGGLGMIVLC---------------------------------------LGLGLK-----------
Q9KNN2_VIBCH/21-383-------------LAGGAGVIALS---------------------------------------LILGVP-----------
DCUB_HAEIN/8-372-------------VFGGLGLAILS---------------------------------------FGFGLK-----------
Q9KMW3_VIBCH/5-373-------------VVSGIGLVIEV---------------------------------------FVFKMP-----------
DCUA_SHIFL/5-365-------------FAGGLGVLVLA---------------------------------------A.IGVK-----------
Q97DH7_CLOAB/5-371-------------MAGGLGMLIMT---------------------------------------FGLHVA-----------
DCUA_HELPJ/7-369-------------YAGGLGVLILC---------------------------------------LFLGLN-----------

PF04165

O29978_ARCFU/17-405-------------VNIGLAIFVGS-----------------AILA---------YLT.LGADGLLVMLK-----------
O57766_PYRHO/2-394-------------VNIGISIFTGA-----------------LTLA---------LLSGLGISGTLKSLY-----------
Q9V2R1_PYRAB/3-395-------------VNIGVSIFLGA-----------------LTLA---------FLSGLGINGALHSLY-----------
Q9WYV1_THEMA/3-381-------------LSISLLSGVIV-----------------MILS---------LKVRNILEIFFWTVS-----------

PF02652

LCTP_BACSU/14-536-------------LAAFLTLAVSF-----------------FVSV---------WAFHMPVEKAISSVL-----------
LUTP_BACSU/16-554-------------TAGLATLGIAL-----------------IIAV---------LVYRMPAEKALMSAT-----------
LLDP_ECOLI/16-542-------------VAASWTVAIAL-----------------AVAL---------LFYKMPVANALASVV-----------
Q9ZMU0_HELPJ/15-536-------------SAGFLSLALSI-----------------LIAL---------FVYKMPVQMVSASFF-----------
Y1218_HAEIN/2-525-------------YVALPWVATLV-----------------MGVH---------LLHFNTDIVTISANV-----------
O51549_BORBU/4-500-------------YVIPISLIATV-----------------AIVI---------FYKNLGIVNTSLAML-----------
Q9ZMT9_HELPJ/16-539-------------TAAFLSVALSA-----------------IIAV---------LVYKMPVSMVGSSFL-----------
O29452_ARCFU/1-535-------------KAMPIGWLVTV-----------------IIAL---------FYWKMPPEWIAAATI-----------

PF07854

Q9YFW4_AERPE/15-368---------IAH..VGPIPI-----------------GIVQAVVFFGL-VFYFFHKHIYSILASTMEKVGIPVFAFILTF
Q8PXG5_METMA/8-368---------VGD..IFGIPI-----------------GIFQIVLVVGL-IIYKWHSPIHKAIRKLTDMLSVKVLGFLLIV
Q8RCZ3_THETN/45-391---------YL.........-----------------.VTVAVFLSGL-LFEIFKDKFKTLIEITIARIPLKVFVFLVIV
Q8R782_THETN/2-340---------YY.........-----------------.ITLAVLIAGL-IFALLKEKLKIGVEKVADKISLRLFAFIIIV
Q8ZUI4_PYRAE/6-347---------VYQPGIGYIPI-----------------GITQVVLAAGL-VFYALRHK....MAEKADALARPAVIAGLIF
O29471_ARCFU/14-358---------ITE..VMGIPV-----------------GIFQVVLIVGL-IIHYYNKQVYSFLVAVLKKLGIKVFAFLVVT

PF07399

Q9Z6V2_CHLPN/1-438---------YFNSRNYGFAV-----------------FIMVILILLESRPIVYFAELVLSSIAK.LGKTSPKSWWWTLMI
Q9F206_9BURK/1-428---------YLDTRNFTEPM-----------------FVFAIMVIAGTRPILQFAGTVVRLAASAVPLPRGMAMYFMVLA
Q87F98_XYLFT/1-420---------YIDSRNFTEPM-----------------FVFAIMVVAGTRPILHTVLAGVHLLARWVPLPGRMGFYFTVLT
O84811_CHLTR/1-438---------YFDSRNYVFSL-----------------FIIAMLILLESRPIEYFSQRVFATIAK.IGKQSPICWWWTIMI

PF03806

ABGT_ECOLI/14-507---------NVIKNFSGFAP-----------------LGAILALVLG-AGLAERVGLLPALMVKMA----SHVNARYASY
Q9KEI6_BACHD/19-511---------ELVNNFTSFPP-----------------LGLVLVVMLG-VGVAESTGLLSALMKTTI----LNAPRKLILP
Q9KC22_BACHD/13-510---------SMVSNFINFPP-----------------LGVVLATMLG-IGIAERSGLIGASLRGLV----TAVPKSLITV
Q9A7U5_CAUCR/48-548---------NMPETMTKFPP-----------------LGLVLVVMLG-AAVAERSGLFGALLGDAI----RKLPKTVLSP
Q99RG0_STAAM/14-511---------DTIKNFSEFPA-----------------LGLVLAVMIG-IGVAEKTGYFDKLMISVV----NRAPRFLILP
Q9AA61_CAUCR/39-553---------EMPKTLTSFAP-----------------LGLVLVVILG-AAVAERSGLFSALIRASL----REAPKRILTP
Q9KTN8_VIBCH/19-517---------NMVTTFTSFAP-----------------LGIVLVAMLG-VGVADSSGFITTGLKKML----NVTPAKLLTP
Q9KTM2_VIBCH/25-532---------NLVKNFVGFAP-----------------LGTVLVAMLG-VAIAEHSGLLSAAMRGLV----MGASKRMVTF
Q9RNX1_NEIGO/11-519---------HTVKNFTGFAP-----------------LGTVLVSLLG-VGIAEKSGLISALMRLLL----TKSPRKLTTF

PF03606

O51783_BORBU/4-471---------....GMEHAVE-----------------VIVFVLIVGGAYGIIMKTGAIDVGIYFLI....KKLGHKDKLL
Y594_HAEIN/12-505---------SMVEGTIEAVD-----------------VMVFIFVLGGMIGVINRTGSFNAGLMALV....KKTKGNEFFI
Q9CP35_PASMU/1-448---------VKYLLMNRGGN-----------------LGMLIMVLCGFAAYMTHIGANDMVVKLAS....QPLKYIKSPY
Q97NA1_STRPN/11-499---------SLIKETSAAID-----------------VAFFILMVGGFLGIVNKTGALDVGIASIV....KKYKGREKML
DCUC_SHIFL/5-452---------VKILLMSRGGD-----------------LGMMIMMLCGFAAYMTHIGANDMVVKLAS....KPLQYINSPY
Q99YT7_STRP1/11-496---------.....TDGAIQ-----------------VSFFILMVGGFLGVVNKTGALDTGIASVV....RKNKGREKML
YFCC_ECOLI/15-502---------TSGSKYGTAVG-----------------IIMFMLVIGGAFGIVMRTGTIDNGILALI....RHTRGNEILF
Q9AAL9_CAUCR/33-506---------VAGDRSSTTVG-----------------LMAFILVIGGVFGVLMRTGSIDRVLTALIGPPDKLGTVRGDLM
Q9CMA1_PASMU/2-462---------IKNLFSTRAAD-----------------LGLMIMAVGGFARYMDKIGASEALVNIAV....KPLNAIKAPY
Q9KAH9_BACHD/20-464---------....GMVGAAP-----------------VVFFTFMIGGTFMVLNRTGIIAYGVDRLT....RTFMKQKVMV
Q99UT9_STAAM/18-515---------SMVEGTIEAVD-----------------IMVFILVLGGLIGVVQASGSFESGLLALT....KKTKGHEFML
DCUC_VIBCH/6-456---------VKYMLQNRGGG-----------------LGMQIMLLCGFASYMTHIGANNVVVKQFS....KPLSFIKSPY
DCUD_ECOLI/2-455---------ILRMLSNRIAG-----------------LGLSIMAVGGYARYMERIGASRAMVSLLS....RPLKLIRSPY

PF06808

Q9Y8U1_AERPE/115-551---------GVFEKLPQLAL-----------------TLIGAFMLFI--SIAQAFGAVDSVIRLVIGALGSRPRLLPQAA
Q9K7H0_BACHD/6-417---------G....ISSFVL-----------------LAVPLFIFAA--DIMSKGKTSKRLLDFVGAFVGHIRGGYAVTT
Q8NN88_CORGL/3-439---------A....AQSEVT-----------------FAGMAFVFMG--IVVQSTGLIDRLIAILNSIFGRLRGGAGYVS
Q8FA80_ECOL6/7-418---------P....TQSPSL-----------------LAIPFFILLG--TLMSYTGIAERILHIANVLVGKMRGGLGVAN
Q9CKH6_PASMU/7-420---------G....LDTNAL-----------------QALAFFFLAG--ELMSVGGITNRIIRFVTSIIGRWKGSLAYIN
O07838_RHOCA/7-430---------G....IEKFEI-----------------MAIPFFILAG--NFLTHGGVAKRMINFATAMVGHWHGGLGLAG
Q92K76_RHIME/14-514---------V....MSNDTL-----------------LAIPFFTFMG--IVLERSGMAEDLLDTIGQLFGPVRGGLAYAV
O29619_ARCFU/128-601---------P....IAVSSS-----------------FVVL.FVIFG--AFLERSGAGRFFIDLAYSLTGWMVGGPAKAA
Q8G0A8_BRUSU/148-607---------A....LGVVAT-----------------YVFH.FVLFG--VFATRIGLGQLFLDCAAWVAGRFAGGPAKVS
Q8FRN3_COREF/157-598---------P....LQTAAT-----------------ILVG.FMLFG--VTLQHTGGAEFFNDLSRAIFGRYRGGSAKVS
Q92PP2_RHIME/208-617---------G....MSSLIL-----------------LSVPVFVLLG--CILDATGMGKAIVDFLASMLGHVKAGMSYVL
Q8ZKS0_SALTY/12-424---------S....LDSFAL-----------------LAVPFFVLSG--VIMNSGGIAARLVNFAKLFTGKLPGSLSYTN
Q8ZL80_SALTY/7-416---------G....ADSFSL-----------------LAIPFFVLAG--EIMNAGGLSKRIVDLPMKLVGHKPGGLGYVG
Q92PN6_RHIME/6-416---------P....TQSFPL-----------------LAIPFFILSG--SLMMSGTLGQKLVQFAAALVGRFHGGMGQVT
Q92WB7_RHIME/5-456---------G....VESFPL-----------------LAVPFFILAG--NLMNSAGVTGRIYSFAVALVGWMKGGLAQVN
Q89FZ8_BRAJA/199-609---------G....IDNFVL-----------------LAIPFFILVG--YLMEANGMSVRLIELLQRGVGRMRGGLNVVM
Q89NA6_BRAJA/151-593---------P....IQAFAD-----------------TVIG.FLVFG--TALMMTGAGKFFINLAFALCGTFRGGAAKVC
Q89CF6_BRAJA/11-428---------T....VTDYTF-----------------GVIPMFLLMG--SFVSNSGMSRELFRAANGFVGHLRGGLGIAT

PF02667

Q9ZLE5_HELPJ/3-453--------------AWTLLG-----------------FSMQMALILVLGQALASAKLVQKLLKYLASLPKGYYTALWLVT
O28734_ARCFU/8-484--------------FWGLLS-----------------FAMQMCLILVTGYAIAYHPIVYRILKKIATLPSDTKSAAALTA
ATOE_ECOLI/1-440--------------FWNLLA-----------------FGMQMALIIVTGHALASSAPVKSLLRTAASAAKTPVQGVMLVT
ATOE_HAEIN/1-447--------------FWNLLG-----------------FGMQMALIVVTGNALATSPQIRKFLSTIASIAKTPAQGVVLVT

PF03600

Q10RS7_ORYSJ/16-503---------DAYAAIDLPII-----------------GLLFGTMVVS--IFLERADMFKYLGNLLSW-KSRGS--K.DLL
ARSB_DICDI/51-511---------EIGSVINWDTI-----------------ILLMSMMMLS--NYMEQANIWGMASKILLW-KCKST--S.IFM
CITN_BACSU/5-373---------QGVTDLAPTGI-----------------MLLFAILY.F--GIMIDSGLFDPLIAKILS-FVKGD--PLKIA
Q828S1_STRAW/5-417---------DGVTSLAPTAA-----------------MLMFAIVY.F--GVMIDVGLFDPIVRGILR-FCKAD--PLRIV
Q897M4_CLOTE/5-411---------SFAGYCKAYFP-----------------IFLLGAIF.G--KIMDDSGAAKSISHNIAK-KLGKD--..KAM
Q8T0L2_DROME/151-567---------AIVSFVNFEPL-----------------MLLFGLMTIV--DIMATTGVFDFLVVWTYR-ISRGR--PWPLI
Q9VU30_DROME/220-638---------TIISWIDFETL-----------------ILLLGMMILV--AIMSETGVFDWMAVLAYR-ISKGN--PWPML
Q9W024_DROME/212-628---------TIVSWVDWETM-----------------MLLLGNMIIT--SRMADTGFFDYLAVVAYR-ISKGH--AWLLI
Q81E21_BACCR/4-425---------KMVGFIKLYFP-----------------VFLLGAIF.G--KVVEMSGIADSIAKTIIE-LVGEK--..RTI
Q8EMV3_OCEIH/7-393---------GFTGYFASWFF-----------------VFLLGAIF.G--KIMQETKSADSIAHWIKK-ILGPK--..RAV
Q8XWF6_RALSO/4-412---------KLVGFVKLYFP-----------------VFLLGAVF.G--KVIELSGFSRAIVASVIR-VVGAQ--..RAM
Q88BF5_PSESM/5-378---------AGITKLAPTGV-----------------MLMFAILY.F--ALMIDSGLFDPAVRKILK-MVKGD--PVRIS
Q8I929_DROME/216-650---------EIIQWMDMELL-----------------TLLFCMMLLI--LILTETGVFDYLAVFCFE-ISGGK--IWPMI
Q9K635_BACHD/2-373---------GFVNFAKQWFP-----------------VFMLGAIF.G--KLMEDTGAARSVASAITK-LIGTK--..RAI
Q2BIE8_9GAMM/57-578---------HAIIEYAELFL-----------------FLLVAMTY.I--NALEDRNVFQALRAYLVS-RGYSL--R.KVF
Q898H6_CLOTE/4-380---------AAANYVEKFFL-----------------VFFVGAVF.G--SIMQETGAAESIAHSLIK-ITNGK--..FVA
YRAO_BACSU/5-384---------EGIQTVASSAA-----------------LLLFAILF.F--GILIDAGLFDPLIEKILS-IVKGD--PVKIA
Q8FSY6_COREF/59-476---------DAVKDMAPTAA-----------------LLMFAIMF.F--GIMIDVGLFDPLIRGITR-VLHDD--PAKVV
CITM_BACSU/5-378---------SGIQQVAPTAV-----------------MIMFAILY.F--GIMIDTGLFDPMVGKILS-MVKGD--PLKIV
Q88FZ5_PSEPK/9-557---------QALAGFSDPNV-----------------VLIAALFVIG--EGLVRTGIAYRIGEWMSE-RAGNS--EARLL
Q7PVG5_ANOGA/324-759---------KLISWIDVETL-----------------LLLFGMMILV--AILSETGIFDYLAVYAYQ-VTNGK--VWPLI
Q8I930_DROME/315-750---------TIMGWIDVETL-----------------LLLFGMMILV--AILSETGVFDYLAVYAYK-ITNGH--VWPLI
Q87EP0_XYLFT/5-388---------EGIKKIAPTGV-----------------MLMFAILY.F--GVMIDAGLFDPLVRRILR-IVKGD--PMKIV
Q81I57_BACCR/5-381---------EGIQKLAPTGI-----------------MLMFAILY.F--GIMIDSGLFDPVISKILK-FVKGD--PLKIV
Q9AV23_ORYSJ/16-429---------DAYASIDLPIL-----------------GLLFATMVVG--GYLKNAGMFRHLGRLLAW-RSQGG--R.DLM
Q8DUC7_STRMU/6-410---------YGINNTAQTGI-----------------MLLFAILY.F--SLMLDAGLFDPITEKMIR-FAKGD--PMKVL
Q8NUL8_STAAW/11-402---------KGLDQVINVVI-----------------MFIFAIIF.F--GIMNDSGLFKPLVKRLII-MTRGN--VVIVC
Q88L78_PSEPK/5-379---------DGLKMVAPSAA-----------------LLLFAILF.F--GLMIDAGLFDPLIRKILK-RVNGD--PIKIA
O81915_ARATH/16-450---------QAYAAIDLPIL-----------------GLLFGTMVVS--IYLERADMFKYLGTLLSW-KSRGP--K.DLL
Q82YV5_ENTFA/6-407---------DGISTTSKTGI-----------------MLLFAILY.F--SIMLDAGLFDPITKKMIY-FAKGD--PMKVL
Q88IC5_PSEPK/4-409---------KMVGFIKLYFP-----------------VFLLGAVF.G--KLIELSGFSRSIVAAAIR-LLGTR--..QAM
Q9HTA2_PSEAE/5-378---------DGIRTLAPTGV-----------------MLMFAILY.F--AIMIDSGLFDPAVRKILR-LVKGD--PLKVS

PF02040

O68021_PSEAI/3-423---------PTVWNIVWNAT-----------------ATFIAVIVIS--LLLDEAGFFEWAALHVALGWR..R--TRRLF
ARSB_STAXY/4-426---------LEVTGIVWNAT-----------------LTFVAVILIS--LILDEIGFFEWSAIHMVK.ASNGN--GLKMF
ARSB2_ECOLX/3-425---------PVVWNIVWNAT-----------------ATFIAVIIIS--LLLDESGFFEWAALHVSR.WGNGR--GRLLF
YDFA_BACSU/6-428---------LTVTGIVWNAT-----------------LAFVAIILIS--LILDNIGFFEWAALHMAK.AAKGY--GVRMF

PF02447

GNTP_BACLI/1-447---------GLGGTLGHIAL-----------------IFGLGAML-G--RLIADSGGAQRIAMTLVN-KFGEE----NIQ
GNTU_ECOLI/4-445---------GMGGTLGFLAV-----------------VVALGAMF-G--KILHETGAVDQIAVKMLK-SFGHS----RAH
GNUT_PSEAE/9-449---------GFGGVLGFVGV-----------------ILALGTML-G--KLMADSGGADQIARTLIR-AFGKE----RVH
YJHF_ECOLI/1-448---------GLGGTLGHIGL-----------------IFGFGVML-G--RLLADAGGAQRIALTMLN-YFGKN----KLD
YGBN_ECOLI/4-454---------GMGGVLGSVTI-----------------IIGLGAML-G--RMIEHSGGAESLANYFSR-KLGDK----RTI
GNTT_ECOLI/1-437---------GVGGTLGSLAL-----------------IMGFGAML-G--KMLADCGGAQRIATTLIA-KFGKK----HIQ
Y1015_HAEIN/6-457---------GFGGTLGSIGI-----------------VIGLGVMM-G--SVLEVSGAAEKMAYSFIK-MLGQK----KEE
YOJA_BACSU/1-443---------GIGGQLGHLAL-----------------VFGLGAML-G--RLVSDAGGGYRIAITLID-KFGRK----RIQ
DSDX_ECOLI/6-444---------GIGGTLGFLAA-----------------VIGLGTIL-G--KMMEVSGAAERIGLTLQR-CRWLS----.VD
GNTP_ZYMMO/7-450---------GLGSGIGSTAS-----------------VIALGTML-G--KILAESGGAERIATTTIK-IFGPK----LIH
GNTP_ECOLI/4-446---------GFGNTLGELAI-----------------IVVFGAVI-G--KLMVDSGAAHQIAHTLLA-RLGLR----YVQ
IDNT_ECOLI/1-437---------GIGSTLGGLAM-----------------ILGFGAML-G--KLISDTGAAQRIATTLIA-TFGKK----RVQ

PF00939

MEMP_CUPNH/32-513QYGTSKALGMALAGFSNTAL-----------------ALVAAALFIS--AAMTVTGLDRRIALVTLS-AIGTS--T..RR
CITT_ECOLI/5-486NA.QKQALKWGLAGFSSTTV-----------------WLVFGAFIFA--LGYEVSGLGRRIALFLVK-FMGKR--T..LT
O84207_CHLTR/4-470.......LDQALSGFHSPIT-----------------WLVFLSFSIA--KGVIKTGLGERVAYFFVK-ILGKS--P..LG
Q9Z8X7_CHLPN/4-470.......LEQGLSGFHNPIA-----------------WLVFLSFSIA--KGIIKTGLGERIAYFFVS-ALGKS--P..LG
Q9ZMT7_HELPJ/2-480.....KAISWGLSGYANKTV-----------------WLVFVAFILG--LGYEKSLLGKRIALLLIR-FLGQT--P..LG
TTDT_ECOLI/4-487KF.TAKSLSWAVSGFSNSVI-----------------WLIFAAFMFG--TGYEKTGLGRRIALILVK-KMGHR--T..LF
S13A2_HUMAN/6-565........SEVAVEYLKDSN-----------------LLFFGGLLVA--IAVEHWNLHKRIALRVLL-IVGVR--PAPLI
Y020_HAEIN/3-476....LVKVGNMLDGYKSGTT-----------------WLIFTAFTLS--SAFVITGLGKRIAYHMIG-AMGST--T..LR
YFLS_BACSU/12-478.......IEDTLSGFGNKTI-----------------WLIVIAFFIS--RGFIKTGLGARISYVFVQ-KFGKK--T..LG
YBHI_ECOLI/3-474....AFKTTAVLSGYSSGTT-----------------WLVFSAFTLS--AAFVTTGLGKRIAYLLIG-KIGNT--T..LG
SOT1_SPIOL/101-569.......FSAAFSAFGDPIP-----------------WLIALAFFFA--RGFIKTGLGNRIAYQFVK-LFGSS--S..LG

PF13726

Q9ZL85_HELPJ/10-97---------GGLGITES...-----------------.........F--NMMI.DGM-----------------------
A3YN61_CAMJU/6-93---------SHLELVDT...-----------------.........M--NILI.SGM-----------------------
Q73KL4_TREDE/3-90---------GGLGLQNT...-----------------.........I--SILI.SGM-----------------------
C8A2Z4_STAAU/3-90---------SGMSIEKV...-----------------.........I--NVFG.KNI-----------------------
B9EAL6_MACCJ/2-89---------SGLGIDKT...-----------------.........I--VTFT.GGI-----------------------
C3F6D3_BACTU/2-89---------GGLGISET...-----------------.........I--NTFT.TGL-----------------------
E6U2C3_BACCJ/2-89---------AGIPFTET...-----------------.........L--DVFA.SGL-----------------------
D6XUM8_BACIE/2-89---------AGMSITET...-----------------.........V--DIFT.AGL-----------------------
A3IGC2_9BACI/8-95---------SGMSIEAT...-----------------.........V--ESFT.EGL-----------------------
A7Z8B4_BACA2/2-89---------GGLGLGET...-----------------.........V--KAFT.DGL-----------------------
Q2B2R2_9BACI/2-89---------GGLSVDKV...-----------------.........I--EVFT.NGL-----------------------
B7GKU7_ANOFW/4-91---------GNLGLSKT...-----------------.........V--ESFS.EGL-----------------------
Q9K7K2_BACHD/2-89---------GGLGFLET...-----------------.........I--EVFS.EGL-----------------------
Q5WDV8_BACSK/2-89---------GGLSFNTT...-----------------.........I--EVFT.AGL-----------------------
C4L1E0_EXISA/2-89---------GGLGFNDT...-----------------.........L--TAFS.DGL-----------------------
B1YEV1_EXIS2/3-90---------GGLGINKT...-----------------.........I--ATFA.EGL-----------------------
A4Y5U0_SHEPC/2-89---------GGMDLHQT...-----------------.........I--DAFN.TGL-----------------------
Q084K9_SHEFN/4-91---------GGLDIHQT...-----------------.........I--AAFN.DGL-----------------------
A1F5K2_VIBCL/2-89---------AGMSLNET...-----------------.........V--AAFE.SGL-----------------------
D0YVL6_LISDA/2-89---------GGLSLTDA...-----------------.........V--TAFQ.NGL-----------------------
Q1ZN28_PHOAS/2-89---------GGLSIHDT...-----------------.........I--SAFE.GGL-----------------------
B5FCM4_VIBFM/2-89---------GGLSLSET...-----------------.........I--SAFE.GGL-----------------------
D1B1X3_SULD5/2-89---------AGMPLSDT...-----------------.........I--EAFN.KGL-----------------------
A6FIU9_9GAMM/2-89---------GGLPLEEV...-----------------.........I--SAFN.SGL-----------------------
A4SNQ6_AERS4/2-89---------GGLSLADT...-----------------.........L--STFS.GGL-----------------------
Q65UQ2_MANSM/4-91---------GGLGITKT...-----------------.........I--ETFT.GGL-----------------------
C5BE39_EDWI9/2-89---------GGLTLDTT...-----------------.........I--TTFS.SGL-----------------------
A1TWP4_MARAV/2-89---------AGMSLEDT...-----------------.........I--NAFN.TGL-----------------------
A4XTU4_PSEMY/2-89---------GGLGVEGT...-----------------.........L--KAFN.QGL-----------------------
Q02NE5_PSEAB/2-89---------GGLGLEGT...-----------------.........L--KAFN.GGL-----------------------
Q2BHM1_9GAMM/2-89---------GGLGIQAT...-----------------.........I--DAFN.SGI-----------------------
C0W230_9ACTO/19-106---------GGLGFDGT...-----------------.........M--LAFQ.DGL-----------------------
C0WF19_9CORY/2-89---------SGMGLDAT...-----------------.........M--VAFQ.DGL-----------------------
D0WS18_9ACTO/27-114---------GGLGLDGT...-----------------.........L--VAFQ.EGL-----------------------
C0E4G0_9CORY/2-89---------SGIGLGPT...-----------------.........M--VAFQ.DGL-----------------------
D1DEI3_NEIGO/2-101---------AGMPLQNIADA-----------------AGQVSQAGII--PVFN.KGL-----------------------
D4DM42_NEIEG/10-109---------AGMPLANVTDV-----------------SGEVAQTGII--SAFN.EGL-----------------------
Q1Q9H8_PSYCK/4-91---------AGLGMTDT...-----------------.........L--NAFQ.EGI-----------------------
D0BZZ4_9GAMM/2-89---------AGLSLSQT...-----------------.........V--EAFN.AGL-----------------------
C0VHK3_9GAMM/2-89---------AGLGLQGT...-----------------.........L--DAFN.NGL-----------------------
Q1QX04_CHRSD/2-89---------GGLGLEDT...-----------------.........L--AAFN.DGV-----------------------
A4SIT2_AERS4/144-241---------GALMMGKFSK.-----------------.........V--NQFAVSGL-----------------------

PF06450

NHAB_HAEIN/1-513---------GGLLAIEAIIIGMTNAKHVKAEIMANFEVILLLIFMVA--GIFFMKQLLLYVFTKLLVKIRSKI--ALSIA
NHAB_SHEON/1-520---------GGLLAIEAVAIGMTSASQVLHEIEANLEVLLLLVFMVA--GIYFMKQLLLFAFTKMITKVRSKI--LVSLL
A6B3E7_VIBPA/1-515---------GGLLAIEAIAIGMTSPAQVKHELVANIEVLLLLVFMVA--GIYFMKQLLLFIFTKILLGIRSKT--LLSLA
NHAB_ECOLI/1-512---------GGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVA--GIYFMKQLLLFIFTRLLLSIRSKM--LLSLS

PF07158

P72556_STRPN/1-148---------.IH-------L-----------------IMISAIALAI--GIGY---------------------------
Q9KIE8_STRHY/1-149---------PNE-------L-----------------TGVLILAAVF--LLAG---------------------------
Q9ZIP4_RHILE/1-149---------GIE-------L-----------------LSIGLLIAMF--IIAT---------------------------
Q8P4U0_XANCP/1-149---------TPQ-------I-----------------ATILGLVIMF--IVAT---------------------------
Q9L0A3_STRCO/1-149---------SPE-------L-----------------ISILVLVVVF--VIAT---------------------------

PF03553

O51582_BORBU/170-435---------PSA-------I-----------------LTFFSFFFLS--EN.........LSNATNFLHE...--.....
NHAC_BACPE/157-449---------PSF-------V-----------------ITVILFLMIG--RSQAT....STTQDIQAMLTALDS--QF...
Q9KQG1_VIBCH/161-453---------ISY-------V-----------------ITGILFTLFG--FHYAGN..VD.MSQVETVIAAMEQ--QF...
Q9K7B7_BACHD/160-482---------PMN-------L-----------------YAIVAIGLVF--AVAW......YNLDVGAMKIHETK--AVETG
O25453_HELPY/149-430---------.AQ-------I-----------------TGVMWIAGLA--MVVG......LLVAVLTLYKK...--PR...
Q9ZKQ5_HELPJ/165-464---------SSN-------Y-----------------YAIFALIAVF--LTIL......WQINLPSMRKYQNI--GVK..
Q9KBE2_BACHD/142-433---------.EQ-------I-----------------PLAMLFPGLA--MVVG......LLVAIFITYGKDRE--PRN..
Q9AFA3_VIBHA/1-333---------PMN-------F-----------------YAVFALLMVF--AVAW......FGLDIGKMREHEIA--ASQGR
Q9HS26_HALSA/183-491---------VAA-------V-----------------LSFAAYLGAG--AVMDG...ISVAGDASAILGSNVG--PTGL.
Q99VD8_STAAM/151-432---------...-------I-----------------WKAMLIPSMG--YIVG......LLIGLYV.YRK...--PR...
YUIF_BACSU/150-436---------.AD-------I-----------------PYALIIPVAG--MVVG......LILSVIV.YRK...--PK...
NHAC_BACSU/159-453---------PAL-------L-----------------ITVVLFYFLG--SSVSAD.AAS.TDNIQQVITGIKD--AA...
O59530_PYRHO/156-486---------PYR-------F-----------------YSIFAIILVF--IVAY......THRHYGAMLKAEMR--ARTTG
Q9K5Y9_BACHD/160-453---------PGF-------V-----------------IALVFYAVLG--RSFRAD.SVE.QQGILEVMNLLQE--SF...
Q97L22_CLOAB/149-436---------VPF-------S-----------------LSLFFYYILS--ISQP.......LRNMNSNLSNEIS--G....
Q99RU7_STAAM/184-446---------PGA-------I-----------------LTIIILYFLT--NG..........ISLNHAKNY...--.....
Q9Y8U6_AERPE/161-510---------PYR-------F-----------------YSIFALLLVL--LVVL......TRRHFGPMLKAEHR--AVATG
ARCD_HALSA/171-466---------IVG-------V-----------------ISLALYAVLG--LMAETGGTGGTGAEVAQIQGGLAG--TY...
O51583_BORBU/175-441---------PAA-------I-----------------LASIAFAFLG--SY.........YCKVDSFIIEPGE--.....
Q97TG1_CLOAB/150-462---------AWN-------F-----------------FPWAMLIIGI--GITLFG.LGFGKLKLGKTDENNTE--LTKG.
Q9K7K2_BACHD/150-434---------.AE-------I-----------------PTAMTLPTIG--LVVG......LLFAIFVTYRR...--PR...
Q9KSX5_VIBCH/165-497---------PMN-------F-----------------YAIFALLMVF--AVVW......FQMDIGQMRKHEIA--ASQGR
Y325_HAEIN/152-444---------VAQ-------V-----------------SLAMLLPVIG--MILG......LLTAIFITYRK...--PR...
Q9KT98_VIBCH/150-435---------.SQ-------V-----------------PTAMILPAAG--MIFG......LLLAVLFSYRK...--PR...
Q9KMV5_VIBCH/168-494---------PMN-------L-----------------YAVFTLLMVL--AVIF......LPMDIGPMRQHEAW--AREGK
MLEN_BACSU/159-452---------PAY-------V-----------------ITAILFTVVG--FMYGGK.NID.LDKVEFLKSSLQN--TF...
Q9AGE2_YERPS/159-463---------PSF-------V-----------------LAAIVYLIAG--HSSSIGSAAT.PEKVTEIIQALEG--LY...
Q9JXG2_NEIMB/166-456---------.IN-------V-----------------MAAMAIPALG--MLAG......LLLAFVH.YRK...--PR...
Q9KMX3_VIBCH/172-442---------PAA-------L-----------------LALVVFTFSS--QT............AQSPQTS...--.....
Q9K0Q3_NEIMB/165-476---------LMN-------Y-----------------YALFALIMVF--VVAW......FSFDIGSMARFEQA--ALNE.
Q9HNR2_HALSA/161-489---------PFN-------M-----------------YSILAVVMVA--IIVL.....S.RRDYGAMLTAEHR--ATTTG
Q9CMF8_PASMU/165-482---------AMN-------F-----------------YAIFSILMVF--FVSY......YSFDIGSMARHERM--ALAR.
Q99RX2_STAAM/158-455---------PAS-------I-----------------IGLLVWFIAG--FQFKG...HSNDKQIQTLLSELAQ--IY...
Y1586_HAEIN/177-494---------SMN-------F-----------------YAIFSIIMVF--FVAY......FSFDIASMVRHEKL--ALKN.
Y1107_HAEIN/162-461---------PSF-------I-----------------LSATVYVVYG--LNYDFSNVAT.PEKVNTMIHELEQ--VY...
Q9HNF6_HALSA/156-488---------PWN-------I-----------------YCFMAFFMVG--FITI.....T.QRFFGPMLDAEWR--ARTTG
Q9HNF7_HALSA/171-467---------IAF-------G-----------------LSVLAYAVLG--VLIVD...GG.AANVTAISGPLAG--SY...
Q9I0I5_PSEAE/151-435---------.IN-------V-----------------THAMFIPALG--MLAG......LLIAVLFSYRR...--KR...

PF03605

Q9ZEN8_WOLSU/6-382---------PGK..APVDVM-----------------LTIIAVVAAS--ATLQASGGLDVMLQIAEKILRKNP--KYVTI
DCUB_SHIFL/6-376---------PGK..PPVDVM-----------------LVIIAVVAAS--ATLQASGGLDVMLQIAEKLLRRNP--KYVSI
Q9CJS4_PASMU/5-375---------PTS..PPIEVM-----------------LIILAVVTCA--SILEAAGGLKFMLQIAERVLRSNP--KRVTI
DCUA_WOLSU/5-365---------PGS..IPIDVI-----------------LIIMSVIAAI--AAMQVAGGLDYLVHLAEKLLRSQP--KHITF
Q9KNN2_VIBCH/21-383---------TKQAFIPVDVI-----------------LIIMSVITAI--AAMQVAGGMDWLVQLAENFLRKHP--ERITF
DCUB_HAEIN/8-372---------PAG..LPIDVM-----------------FMIMAVVAAA--AAMQAAGGLDYMIKIATKILRRNP--KHITF
Q9KMW3_VIBCH/5-373---------PTS..PPITVM-----------------LIILAVVTCA--SILEAAGGLKYMLQVAERMLRKNP--KRVTL
DCUA_SHIFL/5-365---------PGN..IPFDVI-----------------SIIMAVIAAI--SAMQVAGGLDYLVHQTEKLLRRNP--KYITI
Q97DH7_CLOAB/5-371---------PAD..PPITVI-----------------LIMIAVICAA--ATMQACGGLDFLVKIAEKILRKNP--KMLTI
DCUA_HELPJ/7-369---------PGK..IPFDVI-----------------LIIMAVISAI--SAMQKAGGLDYLVQIAEKILRKHP--KQINY

PF04165

O29978_ARCFU/17-405---------SLANP.QTIEI-----------------VVIVILAFTL--GYSMEY..FGMLEKVTGGLSESFG..VYSFL
O57766_PYRHO/2-394---------.LATI.SWDTM-----------------RLILIIAFIM--GITEVFSQIGYLKKMEEGTLHLFPKAKHSLW
Q9V2R1_PYRAB/3-395---------..STITSWSTL-----------------RLILIISFIM--GITSVFSQIGYLKDMENAVLHLFPKAKHSLW
Q9WYV1_THEMA/3-381---------..SDS.FWSLI-----------------VTVFLIYLLS--GMMEKS...GDYSRFSEEMRTIFS..KNVDS

PF02652

LCTP_BACSU/14-536---------LGIGSGLWPIG-----------------YIVLMAVWLY--KIAVKTGKFTIIRSSIAGISPDQR--LQLLL
LUTP_BACSU/16-554---------QGAVYGLLPIG-----------------WIIVTSVFLY--KITVKTGQFDIIRSSVLSITDDRR--LQALL
LLDP_ECOLI/16-542---------YGFFYGLWPIA-----------------WIIIAAVFVY--KISVKTGQFDIIRSSILSITPDQR--LQMLI
Q9ZMU0_HELPJ/15-536---------YGFLYGLWPIA-----------------WIVIAAIFLY--NLSVKSGYFEILKESILSLTPDHR--ILVIL
Y1218_HAEIN/2-525---------VSAIIAVQTPI-----------------TVIFGAILFN--RFSEISGATNIMRKWLGNINPNPV--AQLMI
O51549_BORBU/4-500---------EGALMGIWPIA-----------------TVIIAAIFTY--KMSEDQKDIETIKNILSNVSSDRR--IIVLL
Q9ZMT9_HELPJ/16-539---------YGFLYGLWPIA-----------------WIIIAAIFLY--KLSVKSGYFEILKESVQSITLDHR--ILVIL
O29452_ARCFU/1-535---------KGTLS.ALDIL-----------------LVVFGAVYLY--YDARLSGATRAITRGIMGLSADRR--IQAG.

PF07854

Q9YFW4_AERPE/15-368LLGLI------SSVIS----VIVTAVILAEIAAALNISRERKVK------------------------------------
Q8PXG5_METMA/8-368ILGLL------SSVMS----AILASIILVEVVNAMPLSRKSKID------------------------------------
Q8RCZ3_THETN/45-391ILGLT------ASIIT----AIIASIILVEIIHLLPLKHKDKVV------------------------------------
Q8R782_THETN/2-340ILGLM------SSIIT----AIIASLVLVEVVNYLPLTRKNKIN------------------------------------
Q8ZUI4_PYRAE/6-347GLGLS------SSVIS----AVVAAAIMAELLGFANAPHAYKAR------------------------------------
O29471_ARCFU/14-358VFGLA------SSIIS----VIVSAVILAEIALVMPLERKSKVE------------------------------------

PF07399

Q9Z6V2_CHLPN/1-438APPLL------SCLLKETGAMIIGATLLMRHFYVFSPSRRFAYA------------------------------------
Q9F206_9BURK/1-428LVPLL------GSFITEPAAMTLAALMLRDTLFSQTVSRRLMYA------------------------------------
Q87F98_XYLFT/1-420FIPLL------GSFITEPAAMTLAALMLSQGVFANKIPPYLKYA------------------------------------
O84811_CHLTR/1-438AAPLS------AFFLKESGAMIIAATLLSKQFYKFSPSPKFCYA------------------------------------

PF03806

ABGT_ECOLI/14-507MVLFI------AFFSHISSDAAL-------VIMPPMGALIFLAV------------------------------------
Q9KEI6_BACHD/19-511TIVLV------AMLGNAAADAAM-------VVLPPIVAMIFIAL------------------------------------
Q9KC22_BACHD/13-510TLVFA------GIMSSVASDAGY-------VVLPPLGAMLFIAL------------------------------------
Q9A7U5_CAUCR/48-548AIFVI------GVMSHHAADAAY-------VVLIPMAALIYAEA------------------------------------
Q99RG0_STAAM/14-511TIILI------GILGSTAGDAAT-------IILPPLAAMLFIKI------------------------------------
Q9AA61_CAUCR/39-553LVVII------GMVSHHASDAAY-------VVFIPLAGLLYAAV------------------------------------
Q9KTN8_VIBCH/19-517MLILV------AIISHTAADAGY-------VLVIPLGGIIFHAA------------------------------------
Q9KTM2_VIBCH/25-532TVVFA------GIISNTASELGY-------VVLIPLAAMLFHSL------------------------------------
Q9RNX1_NEIGO/11-519MVVFT------GILSNTASELGY-------VVLIPLSAVIFHSL------------------------------------

PF03606

O51783_BORBU/4-471IPLLM------FIFSIGGTVTGMSEET...LPFYFVMIPLIVAL------------------------------------
Y594_HAEIN/12-505VFCVS------VLMVLGGTTCGIEEEA...VAFYPILVPVFLAL------------------------------------
Q9CP35_PASMU/1-448LLMIV------AYFLACLMSLAVPSATGLGVLLMATLFPIMVNV------------------------------------
Q97NA1_STRPN/11-499ILVLM------PLFALGGTTYGMGEET...MAFYPLLVPVMMAV------------------------------------
DCUC_SHIFL/5-452LLMIA------AYFVACLMSLAVSSATGLGVLLMATLFPVMVNV------------------------------------
Q99YT7_STRP1/11-496IAILI------PLFALGGTTYGMGEET...MAFYPLLIPVMIAV------------------------------------
YFCC_ECOLI/15-502IPALF------ILFSLGGAVFGMGEEA...VAFAIIIAPLMVRL------------------------------------
Q9AAL9_CAUCR/33-506VMGLF------VAFSLAGAVFGMSEEA...IAISLILTPILVRS------------------------------------
Q9CMA1_PASMU/2-462LVLAL------AYIVGQILNIFIPSASGLGLLLMLTIFPILVNL------------------------------------
Q9KAH9_BACHD/20-464IPVLV------VTFSMITAFIGTPELS...LVYVPILIPLMIKL------------------------------------
Q99UT9_STAAM/18-515IVFVS------ILMIIGGTLCGIEEEA...VAFYPILVPIFIAL------------------------------------
DCUC_VIBCH/6-456ILLVA------AYLVACLMSLAVSSATGLGVLLMATLFPMMTAM------------------------------------
DCUD_ECOLI/2-455IILSA------TYVIGQIMAQFITSASGLGMLLMVTLFPTLVSL------------------------------------

PF06808

Q9Y8U1_AERPE/115-551VVGSM------VIAMVSGSGAANA------ASTGSITIPLMKKA------------------------------------
Q9K7H0_BACHD/6-417AITCA------LFGSISGSTQATV------VAIGKPMRERLLSL------------------------------------
Q8NN88_CORGL/3-439TLGSA------LIGLIAGSTAGNS------ATVGSVTIPWMKKT------------------------------------
Q8FA80_ECOL6/7-418ILVST------MMGGVSASNLADA------AMLSRMMVPEMERK------------------------------------
Q9CKH6_PASMU/7-420IFSSL------FFGSISGSAVAST------AAIGSSLIPEMKKR------------------------------------
O07838_RHOCA/7-430VIACA------LFAAVSGSSPATV------VAIGSVILPAMVNQ------------------------------------
Q92K76_RHIME/14-514IFVGA------LLAATTGVVAASV------IAMGLISLPIMLRY------------------------------------
O29619_ARCFU/128-601VVSSA------LMGTISGSSVANT------VTTGAFTIPLMKRV------------------------------------
Q8G0A8_BRUSU/148-607IFGSA------LFGMISGSSVANA------VTVGSLTIPAMIRL------------------------------------
Q8FRN3_COREF/157-598VASSA------SMGMMSGSAVSNV------LTTGPMTIPAMIRS------------------------------------
Q92PP2_RHIME/208-617LGSLF------LVSGISGSKVSDM------ATVAPALFPEMKRR------------------------------------
Q8ZKS0_SALTY/12-424IVGNM------MFGAISGSAIAAS------TSIGGVMVPMSARE------------------------------------
Q8ZL80_SALTY/7-416VIAAM------IMASLSGSAVADT------AAVAALLVPMMRSA------------------------------------
Q92PN6_RHIME/6-416VVGST------IFGGVSGSAVAEA------SALGSMLIPWQKKE------------------------------------
Q92WB7_RHIME/5-456IVGSV------IFSGMSGTALADA------AGIGTIEIKAMKDH------------------------------------
Q89FZ8_BRAJA/199-609VASMV------LFSGISGSKMADV------AAVGSVLIPAARRS------------------------------------
Q89NA6_BRAJA/151-593IFASG------LLGMMSGSIISNV------LTAGTMTIPVMKKS------------------------------------
Q89CF6_BRAJA/11-428VGACG------GFAAICGSSVATA------ATFSAVAYPEMRRF------------------------------------

PF02667

Q9ZLE5_HELPJ/3-453FLSLIANWINWGFGLVISAIFAK....EIAKNVKGVDYRLLIAS------------------------------------
O28734_ARCFU/8-484LIAMIAAWINWGLGLIVGAILARTIGIEFYRTGKPLHYPAVVAA------------------------------------
ATOE_ECOLI/1-440FFGSVACVINWGFGLVVGAMFAR....EVARRVPGSDYPLLIAC------------------------------------
ATOE_HAEIN/1-447FMGSIACIINWGFGLVVGAMFAK....EVARRIKGSDYALLIAC------------------------------------

PF03600

Q10RS7_ORYSJ/16-503FRVCI------VSAIASALFTNDTCCVVLT.EFILKVARQNNL-------------------------------------
ARSB_DICDI/51-511VRVCL------ISSIMSSILTNDTVCVTLT.PIVISACKSTNL-------------------------------------
CITN_BACSU/5-373VGTAV------LTMTISLDGDGTTTYMITI.AAMLPLYKRLGM-------------------------------------
Q828S1_STRAW/5-417VGTAL------LAAIVSLDGDGSTTFMITV.SAMYPLYKRLKM-------------------------------------
Q897M4_CLOTE/5-411IAVVL------SCAILTYGGVSLFVVAFAVYPIAVALFIEADI-------------------------------------
Q8T0L2_DROME/151-567FFLSM------LTAFLSAFLNSDIMALSLT.PITIRLCEEMSL-------------------------------------
Q9VU30_DROME/220-638LLLSS------ITAIMSCMLDNVTMLLLMA.PIAIRLCEAMAV-------------------------------------
Q9W024_DROME/212-628GLLGF------FVGLTSTVVDNATVVLLFC.PPVIRLCEVMDL-------------------------------------
Q81E21_BACCR/4-425LAIVL------MGAILTYSGVSVYVVVFAVYPFAAKLFRQANI-------------------------------------
Q8EMV3_OCEIH/7-393FAVVA------AAAIMTYGGVSLFVVGFAVYPIAVSLFRSANL-------------------------------------
Q8XWF6_RALSO/4-412LSIVL------VCALLTYGGVSLFVVVFAVYPFAAEMFRQGNI-------------------------------------
Q88BF5_PSESM/5-378VGTAV------LALVVSLDGDGATTYMICV.AAMLPLYSRVGM-------------------------------------
Q8I929_DROME/216-650YSLCL------VTCLVSSVLDNMTTVLLLT.PVAIRLCEVMQL-------------------------------------
Q9K635_BACHD/2-373LGVML------GCAVLTYGGISLFVVVFAMYPLALALFREANI-------------------------------------
Q2BIE8_9GAMM/57-578WVTGA------LSFVISPIADNLTTALLMG.AVVMAVGGSNIR-------------------------------------
Q898H6_CLOTE/4-380PLIMI------ITGLLTYGGISGFVVFFAMYPIAIELFKSANL-------------------------------------
YRAO_BACSU/5-384IGSAV------LAMLIALDGDGTTTYMITV.SAMLPLYKRIGM-------------------------------------
Q8FSY6_COREF/59-476LGTAI------LAGVVSLDGDGSTTFIITT.SAMLPIYLRLGM-------------------------------------
CITM_BACSU/5-378VGTAV------LTMLVALDGDGSTTYMITT.SAMLPLYLLLGI-------------------------------------
Q88FZ5_PSEPK/9-557VLLMV------AVAGLGSIMSSTGVVAIFI.PVVLSIAARLQL-------------------------------------
Q7PVG5_ANOGA/324-759NCLCV------FTAVMSSFLDNVTTVLLMT.PVTIRLCEVMEL-------------------------------------
Q8I930_DROME/315-750NCLCL------FTAVLSSFLDNVTTVLLMT.PVTIRLCEVMCL-------------------------------------
Q87EP0_XYLFT/5-388MGTAI------LALLISLDGDGSTTYMITV.SAMLPLYQRLGL-------------------------------------
Q81I57_BACCR/5-381VGTAI------LTIIVSLDGDGTTTYMITV.SAMYPLYKRLGM-------------------------------------
Q9AV23_ORYSJ/16-429CRVCV------VTALASALFTNDTCCVVLT.EFVLELAAERNL-------------------------------------
Q8DUC7_STRMU/6-410IATAI------VSAAVSLNGDGTTTTLICC.SAFLPIYKKLNM-------------------------------------
Q8NUL8_STAAW/11-402AMTAL------IGTIAQLDGAGAVTFLLSI.PALLPLYKALNM-------------------------------------
Q88L78_PSEPK/5-379IGTAL------LSLLVALDGDGTTTYMITC.AAMLPLYKRIGM-------------------------------------
O81915_ARATH/16-450CRVCL------VSAVSSALFTNDTSCVVLT.EFVLKIARQKNL-------------------------------------
Q82YV5_ENTFA/6-407MATAV------VAAAVSLNGDGTTTTLICC.SAFIPIYKKLNM-------------------------------------
Q88IC5_PSEPK/4-409LVIVL------VCALLTYGGVSLFVVVFAVYPFAAEMFRQSNI-------------------------------------
Q9HTA2_PSEAE/5-378LGTAA------LAMIVSLDGDGSTTYMICV.AAVLPLYSRLGM-------------------------------------

PF02040

O68021_PSEAI/3-423AFCVL------LGAAVSALFANDGAALILT-PIVMSMLLALRF-------------------------------------
ARSB_STAXY/4-426VFIML------LGAIVAAFFANDGAALILT-PIVLAMVRNLGF-------------------------------------
ARSB2_ECOLX/3-425TYIVL------LGAAVAALFANDGAALILT-PIVIAMLLALGF-------------------------------------
YDFA_BACSU/6-428VYVSL------LGAIVAALFANDGAALILT-PIVLAMVRALHF-------------------------------------

PF02447

GNTP_BACLI/1-447WAVVI------ASFIIGVALFFEVALVLLI-PIVFAISKELEI-------------------------------------
GNTU_ECOLI/4-445YAIGL------AGLVCALPLFFEVAIVLLI-SVAFSMARHTGT-------------------------------------
GNUT_PSEAE/9-449WSMML------AAFLVGIPLFFEIGFILLI-PLVFIVARRSGV-------------------------------------
YJHF_ECOLI/1-448WAVVC------SAFIVGIALFFEVGLILLV-PILFAIAREAKI-------------------------------------
YGBN_ECOLI/4-454AALTL------AAFFLGIPVFFDVGFIILA-PIIYGFAKVAKI-------------------------------------
GNTT_ECOLI/1-437WAVVL------TGFTVGFALFYEVGFVLML-PLVFTIAASANI-------------------------------------
Y1015_HAEIN/6-457WALAI------TGYVVSIPIFVDSAFVILY-PVAKALAKNGKR-------------------------------------
YOJA_BACSU/1-443AAVVV------ASFIIGIALFFEVGLVLLI-PIVYAIAKELKM-------------------------------------
DSDX_ECOLI/6-444VIMVL------VGLICGITLFVEVGVVLLI-PLAFSIAKKTNT-------------------------------------
GNTP_ZYMMO/7-450WAMLV------IAFIVGIPIFYQVGFILLI-PLVFTLGRASGI-------------------------------------
GNTP_ECOLI/4-446LSVII------IGLIFGLAMFYEVAFIMLA-PLVIVIAAEAKI-------------------------------------
IDNT_ECOLI/1-437WALVI------TGLVVGLAMFFEVGFVLLL-PLVFTIVASSGL-------------------------------------

PF00939

MEMP_CUPNH/32-513ILIGT------IAVTIALSLVVPSATARSA-CVV.PIMMGVIA..........AFGVDKKSN..................
CITT_ECOLI/5-486LGYAI------VIIDILLAPFTPSNTARTG-GTVFPVIKNLPP..........LFKSFPNDP..................
O84207_CHLTR/4-470LSYGL------VLTDFLLAPAIPSLTARAG-GILFPVVMGLSE..........SFGSSVEKG..................
Q9Z8X7_CHLPN/4-470LSYGL------VITDFFLAPAIPSVTARAG-GILYPVVTSLSD..........SFGSSAEKG..................
Q9ZMT7_HELPJ/2-480LGYAI------GLSELCLAPFIPSNSARSG-GILYPIVSSIPP..........LMGSTPSNN..................
TTDT_ECOLI/4-487LGYAV------MFSELILAPVTPSNSARGA-GIIYPIIRNLPP..........LYQSQPNDS..................
S13A2_HUMAN/6-565LGFML------VTAFLSMWISNTATSAMMV-PIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALP
Y020_HAEIN/3-476LGYVT------MFLDLLLSPATPSNTARSG-GIIFPIINSVVV..........ALGSDPEK...................
YFLS_BACSU/12-478LSYSL------LFSDLILSPAIPSNTARAG-GIIFPIIRSLSE..........TFGSSPANG..................
YBHI_ECOLI/3-474LGYVT------VFLDLVLAPATPSNTARAG-GIVLPIINSVAV..........ALGSEPEK...................
SOT1_SPIOL/101-569LGYSL------VFSEALLAPAIPSVSARAG-GIFLPLVKSLCI..........ACGSNVGDG..................

PF13726

Q9ZL85_HELPJ/10-97--------------------------------------------------------------------------------
A3YN61_CAMJU/6-93--------------------------------------------------------------------------------
Q73KL4_TREDE/3-90--------------------------------------------------------------------------------
C8A2Z4_STAAU/3-90--------------------------------------------------------------------------------
B9EAL6_MACCJ/2-89--------------------------------------------------------------------------------
C3F6D3_BACTU/2-89--------------------------------------------------------------------------------
E6U2C3_BACCJ/2-89--------------------------------------------------------------------------------
D6XUM8_BACIE/2-89--------------------------------------------------------------------------------
A3IGC2_9BACI/8-95--------------------------------------------------------------------------------
A7Z8B4_BACA2/2-89--------------------------------------------------------------------------------
Q2B2R2_9BACI/2-89--------------------------------------------------------------------------------
B7GKU7_ANOFW/4-91--------------------------------------------------------------------------------
Q9K7K2_BACHD/2-89--------------------------------------------------------------------------------
Q5WDV8_BACSK/2-89--------------------------------------------------------------------------------
C4L1E0_EXISA/2-89--------------------------------------------------------------------------------
B1YEV1_EXIS2/3-90--------------------------------------------------------------------------------
A4Y5U0_SHEPC/2-89--------------------------------------------------------------------------------
Q084K9_SHEFN/4-91--------------------------------------------------------------------------------
A1F5K2_VIBCL/2-89--------------------------------------------------------------------------------
D0YVL6_LISDA/2-89--------------------------------------------------------------------------------
Q1ZN28_PHOAS/2-89--------------------------------------------------------------------------------
B5FCM4_VIBFM/2-89--------------------------------------------------------------------------------
D1B1X3_SULD5/2-89--------------------------------------------------------------------------------
A6FIU9_9GAMM/2-89--------------------------------------------------------------------------------
A4SNQ6_AERS4/2-89--------------------------------------------------------------------------------
Q65UQ2_MANSM/4-91--------------------------------------------------------------------------------
C5BE39_EDWI9/2-89--------------------------------------------------------------------------------
A1TWP4_MARAV/2-89--------------------------------------------------------------------------------
A4XTU4_PSEMY/2-89--------------------------------------------------------------------------------
Q02NE5_PSEAB/2-89--------------------------------------------------------------------------------
Q2BHM1_9GAMM/2-89--------------------------------------------------------------------------------
C0W230_9ACTO/19-106--------------------------------------------------------------------------------
C0WF19_9CORY/2-89--------------------------------------------------------------------------------
D0WS18_9ACTO/27-114--------------------------------------------------------------------------------
C0E4G0_9CORY/2-89--------------------------------------------------------------------------------
D1DEI3_NEIGO/2-101--------------------------------------------------------------------------------
D4DM42_NEIEG/10-109--------------------------------------------------------------------------------
Q1Q9H8_PSYCK/4-91--------------------------------------------------------------------------------
D0BZZ4_9GAMM/2-89--------------------------------------------------------------------------------
C0VHK3_9GAMM/2-89--------------------------------------------------------------------------------
Q1QX04_CHRSD/2-89--------------------------------------------------------------------------------
A4SIT2_AERS4/144-241--------------------------------------------------------------------------------

PF06450

NHAB_HAEIN/1-513FCFSA------AFLSAFLDALTVVAVIISVAMGFYGVYHKVASGNNLIDAVDISDDRKIIE....QQHEILEKFRA----
NHAB_SHEON/1-520FCLAS------AFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKDFSADHDHTSENKNEEGEDQLNEAELESFRG----
A6B3E7_VIBPA/1-515FCFAA------AFLSAFLDALTVIAVVISVAVGFYSIYHKVASGNPIG.DHDHTQDDTITE....LTRDDLENYRA----
NHAB_ECOLI/1-512FCVAA------AFLSAFLDALTVVAVVISVAVGFYGIYHRVASSRT..EDTDLQDDSHIDK....HYKVVLEQFRG----

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------------------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------------------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------------------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------------------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------------------

PF03553

O51582_BORBU/170-435.....------..............S-----------SIDLVKT.-----------------------------------
NHAC_BACPE/157-449.....------.............TL-----------SVLTLLS.-----------------------------------
Q9KQG1_VIBCH/161-453.....------.............YI-----------TPYSFV..-----------------------------------
Q9K7B7_BACHD/160-482ELLDA------.....AKGPAPGEQD-----------QVKVVKQG-----------------------------------
O25453_HELPY/149-430.....------.............HY-----------KEKSFNI.-----------------------------------
Q9ZKQ5_HELPJ/165-464.....------............DFY-----------SEQEEDS.-----------------------------------
Q9KBE2_BACHD/142-433.....------...........DAQV-----------DEQSTIN.-----------------------------------
Q9AFA3_VIBHA/1-333GFDKD------KENDSQEAHDLNEEL-----------DIRESEKG-----------------------------------
Q9HS26_HALSA/183-491.....------...........LHLL-----------SMATVIG.-----------------------------------
Q99VD8_STAAM/151-432.....------.............EY-----------ETRKISD.-----------------------------------
YUIF_BACSU/150-436.....------.............QY-----------ETKDISG.-----------------------------------
NHAC_BACSU/159-453.....------.............NV-----------TPWALLS.-----------------------------------
O59530_PYRHO/156-486KVVRD------D...AKPLMATESDL-----------GLPLTEKG-----------------------------------
Q9K5Y9_BACHD/160-453.....------.............VI-----------SPWLLLI.-----------------------------------
Q97L22_CLOAB/149-436.....------.............TF-----------NIAFITL.-----------------------------------
Q99RU7_STAAM/184-446.....------.............DY-----------NLIKVV..-----------------------------------
Q9Y8U6_AERPE/161-510KVLRD------G...AQPLMPTETVL-----------GEKPAAKT-----------------------------------
ARCD_HALSA/171-466.....------.............TL-----------SVLVLL..-----------------------------------
O51583_BORBU/175-441.....------...............-----------INFFKII.-----------------------------------
Q97TG1_CLOAB/150-462.....------...........HIEK-----------EKAYNTSI-----------------------------------
Q9K7K2_BACHD/150-434.....------.............SY-----------ENREIN..-----------------------------------
Q9KSX5_VIBCH/165-497GFDED------PSTDTQEAHELNEEL-----------DIRESERG-----------------------------------
Y325_HAEIN/152-444.....------.............EY-----------NIN.VEE.-----------------------------------
Q9KT98_VIBCH/150-435.....------.............EY-----------QETELTV.-----------------------------------
Q9KMV5_VIBCH/168-494LWDE.------.....SKGRPAGLDM-----------EGGETARG-----------------------------------
MLEN_BACSU/159-452.....------.............DI-----------HIWMLI..-----------------------------------
Q9AGE2_YERPS/159-463.....------.............HF-----------NVLLIL..-----------------------------------
Q9JXG2_NEIMB/166-456.....------.............LY-----------QSNNADT.-----------------------------------
Q9KMX3_VIBCH/172-442.....------.............DI-----------EWLKVL..-----------------------------------
Q9K0Q3_NEIMB/165-476.....------..........AHDET-----------AVSDATKG-----------------------------------
Q9HNR2_HALSA/161-489AVTSE------D...ATPMQDVKGEL-----------GEPSAENP-----------------------------------
Q9CMF8_PASMU/165-482.....------..........VTEEE-----------KLESSNKG-----------------------------------
Q99RX2_STAAM/158-455.....------.............QI-----------NIWVWV..-----------------------------------
Y1586_HAEIN/177-494.....------..........TEDQL-----------EEETGTKG-----------------------------------
Y1107_HAEIN/162-461.....------.............HF-----------NFLLLI..-----------------------------------
Q9HNF6_HALSA/156-488DTIAD------G...ATPLSDVSNDV-----------GDPSTANP-----------------------------------
Q9HNF7_HALSA/171-467.....------.............AL-----------GPLVFL..-----------------------------------
Q9I0I5_PSEAE/151-435.....------.............VY-----------DLQRIEQ.-----------------------------------

PF03605

Q9ZEN8_WOLSU/6-382LAPLV------TMILTMLCGTGHVVY-----------TIMPIIY------------------------------------
DCUB_SHIFL/6-376VAPFV------TCTLTILCGTGHVVY-----------TILPIIY------------------------------------
Q9CJS4_PASMU/5-375LGPLV------TYTMTFMLGTGHAVY-----------SIMPIIG------------------------------------
DCUA_WOLSU/5-365LAPVV------TYFMTLLAGTGHTAF-----------STLPVIA------------------------------------
Q9KNN2_VIBCH/21-383YAPIV------TFLMTLMAGTGHTAF-----------STLPVIA------------------------------------
DCUB_HAEIN/8-372IAPAV------TWLFTLLAGTGHVAY-----------SVLPVIA------------------------------------
Q9KMW3_VIBCH/5-373IAPFV------TYTMTFMLGTGHAVY-----------SIMPIIG------------------------------------
DCUA_SHIFL/5-365LAPIV------TYFLTIFAGTGNISL-----------ATLPVIA------------------------------------
Q97DH7_CLOAB/5-371LAPVI------AYIFTFMSGTGHIVY-----------SLLPVIN------------------------------------
DCUA_HELPJ/7-369LAPSV------AYFLTILAGTGHTVF-----------SLIPVIV------------------------------------

PF04165

O29978_ARCFU/17-405LIPLL------IGLLPMPGGALISAVMLGPLTKMYRISPEKATLL-----------------------------------
O57766_PYRHO/2-394TLPAL------IGLMPMPAGALVSAPMIEGVAKKFKLNPEVKTFI-----------------------------------
Q9V2R1_PYRAB/3-395TLPAL------IGLMPMPAGALVSAPMIEPVANKFNLKPEVKTLI-----------------------------------
Q9WYV1_THEMA/3-381FVPAL------IGLMPMPGGALFTAPIVKNSLPEE..NSLKLAVK-----------------------------------

PF02652

LCTP_BACSU/14-536IGFCF------NAFLEGAAGFGVPIAISAALLVELGFKPLKAAALCLIANAASGAFGAIGIPVITGAQIGDLS.......
LUTP_BACSU/16-554IAFSF------GAFLEGAAGFGAPVAISAALLVGLGFNPLYAAGICLIANTAPVAFGAIGIPITAVEGPTGIP.......
LLDP_ECOLI/16-542VGFCF------GAFLEGAAGFGAPVAITAALLVGLGFKPLYAAGLCLIVNTAPVAFGAMGIPILVAGQVTGID.......
Q9ZMU0_HELPJ/15-536IGFCF------GSFLEGAIGFGGPVAITAAILVGLGLNPLYAAGLCLIANTAPVAFGAVGIPITAMASVVGIP.......
Y1218_HAEIN/2-525IGWAF------AFMIEGASGFGTPAAIAAPILVGLGFHPLKVAMLALIMNSVPVSFGAVGTPTWFGFGALKLSE......
O51549_BORBU/4-500VAWGF------GNFLEGVAGYGTAVAIPVSILIAMGFEPFFACLICLIMNTSSTAYGSVGIPITSLAQATNLD.......
Q9ZMT9_HELPJ/16-539IGFCF------GSFLEGAIGFGGPIAITAAILVGLGLSPLYSAGLCLIANTAPVAFGAVGIPISAMASAVGVP.......
O29452_ARCFU/1-535IAFLL------VTFFEGAAGFGTPGAIVGPLLVGIGFPPAIAAPLVLIFDSSPVSFGAVGIPVWGGLGSSLDSPVVKEVL

PF07854

Q9YFW4_AERPE/15-368-----------------------YVVYASFAVGIGAALTPLGEPLSTIAISKL.....NAHFTYLIDILGVYIVPGIAVS
Q8PXG5_METMA/8-368-----------------------LTIIACFSIGLGAALTPLGEPLSTIAISKLAGEPYNADFMFLFNMLGKYIIPGIFAF
Q8RCZ3_THETN/45-391-----------------------ITVIASLSIGMGAALTPIGEPLATIATSKL.....NESFLYLFTTLGIYIIPAVLAL
Q8R782_THETN/2-340-----------------------LIVIACFSIGLGAALTPVGEPLATIVVSKL.....HADFFYLARLIGIEIIIAILAL
Q8ZUI4_PYRAE/6-347-----------------------AAVYGAFAIGAGAALLPIGEPLSTIAVAKL.....KQGFFFLVDVLFDAVFIIVAFF
O29471_ARCFU/14-358-----------------------FVVIACFAVGFGAALTPVGEPLSTIVVKKL.....NEDFFYLIELVGEYIIPSVIIL

PF07399

Q9Z6V2_CHLPN/1-438-----------------------TMGLLFSNISIGGLTSYVSSRALFLIFPAL-----KWEHSFFLSHFAWKAIVAILIS
Q9F206_9BURK/1-428-----------------------TVGVLFVNISIGGTLTPFAAPPVLMVASAW-----NWDMTYMLTHFGWKAALAVGVN
Q87F98_XYLFT/1-420-----------------------TLGVLLVNISIGGTLTAFGAPPVLMVAAKW-----QWDNSFMLQTFGWKAVLAIFSN
O84811_CHLTR/1-438-----------------------TMGLLFSNISISGLTSSFSSRALLTILPEI-----KWTNSFIISHFCWKVILAILVS

PF03806

ABGT_ECOLI/14-507-------------------GRHPVAGLLAAIAGVGCGFTANLLIVTTDVLLSG-----IS-----------TEAAAAFNP
Q9KEI6_BACHD/19-511-------------------GRHPLAGLAAAYASVAGGFSANLILSMLDPLVAG-----FT-----------QTGAQMIDP
Q9KC22_BACHD/13-510-------------------GRHPLAGLAAAFAGVSAGFSANIFLSATDPMLGA-----LT-----------QQAAATIDP
Q9A7U5_CAUCR/48-548-------------------GRHPLAGIAIAYAGISGAFAGNMLPGQFDVLILG-----IT-----------APAAQLIDP
Q99RG0_STAAM/14-511-------------------GYHPIAGLTMAYASAVGGFAANIVVGMQDALVYS-----FT-----------EPATRIVSD
Q9AA61_CAUCR/39-553-------------------GRHPLAGIAAGFAAVSGGFAGNLTPGQFDVVLFG-----FT-----------QEAARIIDP
Q9KTN8_VIBCH/19-517-------------------GRHPLAGIAAAFAGVSGGFSANFIPSGIDPLLAG-----FT-----------QTAAQVLDQ
Q9KTM2_VIBCH/25-532-------------------GRHPLAGLAAAFAGVSGGYSANLLIGTVDPLLSG-----IT-----------ETAARMIDP
Q9RNX1_NEIGO/11-519-------------------GRHPLAGLAAAFAGVSGGYSANLFLGTLDPLLAG-----IT-----------QQAAQIIHP

PF03606

O51783_BORBU/4-471-------------------GYDSLVGAAIIALGAGVGTMA----STVNPFATG-----IA-----------SAIASISLQ
Y594_HAEIN/12-505-------------------GYDAIVCVGAIFLAASMGTAF----STINPFSVV-----IA-----------SNAAGIQFT
Q9CP35_PASMU/1-448-------------------GIS.RGAAASICASPAAIILS----PTSG..DVV-----LA-----------AEVSKMPLL
Q97NA1_STRPN/11-499-------------------GFDSLTGVAIILLGSQIGCLA----STLNPFATG-----IA-----------SATAGVGTG
DCUC_SHIFL/5-452-------------------GIS.RGAAAAICASPAAIILA----PTSG..DVV-----LA-----------AQASEMSLI
Q99YT7_STRP1/11-496-------------------GFDSIVAVAIILIGSQIGCLA----STINPFATG-----VA-----------ADAAGVSIA
YFCC_ECOLI/15-502-------------------GYDSITTVLVTYIATQIGFAS----SWMNPFCVV-----VA-----------QGIAGVPVL
Q9AAL9_CAUCR/33-506-------------------GYDSITGMLTCYVATQVGFAT----SWMNPFGLV-----IA-----------QSISGLPTL
Q9CMA1_PASMU/2-462-------------------GVS.REGAAALIATTACLDLG----PASG..NAV-----LA-----------AKTANIDIA
Q9KAH9_BACHD/20-464-------------------GYNRMLATGVALTSTTGGFLA----ALTNPGTVG-----LS-----------QQIAELPIY
Q99UT9_STAAM/18-515-------------------GYDSIVSVGAIFLASSVGSTF----STINPFSVV-----IA-----------SNAAGTTFT
DCUC_VIBCH/6-456-------------------GIS.RPAAVAVCASPAAIILS----PTSG..DVV-----IA-----------AEKSGLPLH
DCUD_ECOLI/2-455-------------------GVS.RLSAVAVIATTMSIEWG----ILET..NSI-----FA-----------AQVAGMKIA

PF06808

Q9Y8U1_AERPE/115-551-------------------GMPPVKAAAIETASSIGGQLM---PPIMGISAFV-----MA............DYLGVSYF
Q9K7H0_BACHD/6-417-------------------GYKDSKAIALIINASDVALLI---PPSIGMIIYG-----LA.............APNVSVG
Q8NN88_CORGL/3-439-------------------GWTAERSATLVAGNSGLGVAL---PPNSTMFIIL-----AL............PAAAASSA
Q8FA80_ECOL6/7-418-------------------GYNRAFAAAITAGGSLVTPII---PPGIALIIYG-----L..............VADVSIG
Q9CKH6_PASMU/7-420-------------------GYPAPFSAALTQSASIIGPII---PPSVPMIVFA-----AL............AGAGVSVG
O07838_RHOCA/7-430-------------------GFPKQFGAGVITTSGALGILI---PPSIVMVMYA-----VATSGMVVTGPDGQPVSSASVG
Q92K76_RHIME/14-514-------------------GYDRRIASGVIAASGTLAQII---PPSLVLIVLA-----D..............QLGRSVG
O29619_ARCFU/128-601-------------------GYKPEFAGAVEPAASTGGQIM---PPIMGAAAFI-----MA............EFVGMPYI
Q8G0A8_BRUSU/148-607-------------------GYKRHFAAAVESASSTGGQIT---PPIMGAAAFL-----MI............EFLNLPYT
Q8FRN3_COREF/157-598-------------------GFTPKTAGAIEATASSGGSIT---PPIMGTAAFL-----MV............SFLGIPYT
Q92PP2_RHIME/208-617-------------------GHKPKEMIALLATGAAMADTV---PPSIVLIVLG-----S..............VAGVSIA
Q8ZKS0_SALTY/12-424-------------------GYDRGFAAAVNIASAPTGMLI---PPTTAFILYA-----LA.............SGGTSIA
Q8ZL80_SALTY/7-416-------------------NYPINRSVGLIASGGIIAPII---PPSIPFIIFG-----V..............SSGLSIS
Q92PN6_RHIME/6-416-------------------GYPAGFAAAVTASSSTIAGLI---PPSIPLILFS-----T..............VANSSIA
Q92WB7_RHIME/5-456-------------------GYPVDAAVGVTAASATLGPIF---PPSLPFVIYG-----M..............MANVSIG
Q89FZ8_BRAJA/199-609-------------------KQNPGGAVALLAASAVMAETI---PPCINLIILG-----F..............VANLSIG
Q89NA6_BRAJA/151-593-------------------GFRASYAGAIEACASTGAVLA---PPVMGATAFV-----IA............QFLNVSYA
Q89CF6_BRAJA/11-428-------------------GYPQSFATGVIAAGGTLGAML---PPSTVLAVYG-----I..............ITEQDIG

PF02667

Q9ZLE5_HELPJ/3-453-------------------AY---SGF.VIWHGGLSGSIPLSVATQNENLSKI-----SA--------G..VIEKAIPIS
O28734_ARCFU/8-484-------------------GY---AGLGLTWHWGLSASAPLLINTPNHFLKDV-----FV--------ELFG.RETVPLN
ATOE_ECOLI/1-440-------------------AY---IGF.LTWGGGFSGSMPLLAATPGNPVEHI-----AG--------.......LIPVG
ATOE_HAEIN/1-447-------------------AY---IAF.MTWGGGFSGSMPLLAATPGNPVAHL-----MM--------SESNPQGIIPAV

PF03600

Q10RS7_ORYSJ/16-503-------------------PPQPFLLALATSSNIGSAATPIGNPQNLVI....-----.A---V.ESGISF...GQFLLG
ARSB_DICDI/51-511-------------------TFFPFLMAIATSANIGSSALPVGNPQNMII....-----.A---T.AGGLNF...FNFFKV
CITN_BACSU/5-373-------------------NRLVLAGIAMLGSGVMN.IIPWGGPTA.......-----.R---V.LASLKLDT.SEVFTP
Q828S1_STRAW/5-417-------------------SLVVMTGVAAMANGVMN.TLPWGGPTA.......-----.R---A.ATALKLDA.SDIFVP
Q897M4_CLOTE/5-411-------------------PKRLIPGTIALGAFTFTMTALPGTPQI.......-----.Q---N.AIPMPFFG.TDAYAA
Q8T0L2_DROME/151-567-------------------RTSYVLVVMAIFADMGGALTPLGNPPNAIVTTSP-----VA---V.AEGVDF...AHFIIH
Q9VU30_DROME/220-638-------------------QTPLVLIVVVMYSNIGGTLTPVGDPPNVIIATNS-----EV---I.SAGVDF...LDFTIH
Q9W024_DROME/212-628-------------------RTTLVLIIVAIYANIGGSITPVSGPPNTIIATNK-----MV---E.SAGINF...VRFSLL
Q81E21_BACCR/4-425-------------------PKRLIPGTIVLGAVTFTMDALPGSPQI.......-----.Q---N.VIPTTFFK.TDIYAA
Q8EMV3_OCEIH/7-393-------------------PHRFIPAALVFGSISFTMTA.PGSPEI.......-----.Q---N.IIPTEFFG.TTPTAG
Q8XWF6_RALSO/4-412-------------------PKRLIPGTIALGAFSFTMDSLPGTPQI.......-----.Q---N.IIPTTFFH.TTSWAA
Q88BF5_PSESM/5-378-------------------SPRIMAGLIILAGGVMN.MTPWGGPTA.......-----.R---A.ASALHVDA.SDIFVP
Q8I929_DROME/216-650-------------------DPLPVVMGIIVHANIGGALTPIGDPISIIVSTNH-----FI---V.DNDVTF...PTFVAH
Q9K635_BACHD/2-373-------------------SRRLIPGTIALGAFTFTMTAVPGTPQI.......-----.Q---N.LIPTSYYG.TNAMAA
Q2BIE8_9GAMM/57-578-------------------FVSIACINVVVAANAGGAFSPFGDITTLMVWQKG-----KV---EFLEFLPLFI.PSLVNW
Q898H6_CLOTE/4-380-------------------SRRLIPAAISAGAWTWSMTG.PGSPSI.......-----.Q---N.IIAMRYLE.TSSTAA
YRAO_BACSU/5-384-------------------NPMVMATLAMLSLSIVSGMTPWGGPAT.......-----.R---A.ISVLGLDP.SDFFVP
Q8FSY6_COREF/59-476-------------------SPVVLTCVAGLINGTMN.ILPWGGPTV.......-----.R---A.ATALGLDP.AEVFVP
CITM_BACSU/5-378-------------------RPIILAGIAGVGMGIMN.TIPWGGATP.......-----.R---A.ASALGVDP.AELTGP
Q88FZ5_PSEPK/9-557-------------------SPSRLMMPLAFAGLISGMLSLVATPPNVVVHSEL-----VR---HGEAGFSFFS.FTPFGL
Q7PVG5_ANOGA/324-759-------------------NPVPVLMSMVIYSNVGGTLTPVGDPPNVIIASNS-----HI---A.KNGVNF...ATFTLH
Q8I930_DROME/315-750-------------------NPVPILMCMVIYSNIGGALTPVGDPPNVIIASNS-----YI---S.KNGVNF...AVFTLH
Q87EP0_XYLFT/5-388-------------------NALNLTCVTILAGGVMN.LTPWGGPTA.......-----.R---A.ATALRVDP.ADVFIP
Q81I57_BACCR/5-381-------------------NPLILAGVVMLGAGVTN.LTPWGGPTA.......-----.R---V.MSALGLEA.SELFTP
Q9AV23_ORYSJ/16-429-------------------PAKPFLLALATSANIGSSATPIGNPQNLVI....-----.A---F.NSKISF...ISFLLG
Q8DUC7_STRMU/6-410-------------------KIMNLGVLIILQNTIMN.LLPWGGPTA.......-----.R---A.MSVLNVG..SEILGY
Q8NUL8_STAAW/11-402-------------------NKYLLILLLALSAAIMN.MVPWGGPMA.......-----.R---V.AAVLKAKSVNELWYG
Q88L78_PSEPK/5-379-------------------NPMILATVSMLSLSIMSGMSPWGGPAT.......-----.R---A.IAALGLDA.TEYFIP
O81915_ARATH/16-450-------------------PPHPFLLALATSANIGSSATPIGNPQNLVI....-----.A---V.QSKIPF...WEFLLG
Q82YV5_ENTFA/6-407-------------------KLMNLGVLVILQNTIMN.LLPWGGPTA.......-----.R---A.MAVLEVD..ADILSY
Q88IC5_PSEPK/4-409-------------------PKRLIPATIALGAFSFTMDALPGTPQI.......-----.Q---N.IIPSTFFN.TTAWAA
Q9HTA2_PSEAE/5-378-------------------SPLVMACLIMLSSGVLN.MTPWGGPTA.......-----.R---A.ASALHVDP.ADIFVP

PF02040

O68021_PSEAI/3-423-------------------SPAATLAFVMAAGFIADSASLPLVVSNLVNIV--------S---ADYFGLGF---GEYAAV
ARSB_STAXY/4-426-------------------NKKVIFPFIIASGFIADTTSLPLIVSNLVNIV--------S---ADYFDIGF---IEYFSR
ARSB2_ECOLX/3-425-------------------SKGTTLAFVMAAGFIADTASLPLIVSNLVNIV--------S---ADFFGLGF---TEYASV
YDFA_BACSU/6-428-------------------NEKLVFPFIIASGFIADTTSLPFVVSNLVNIV--------S---ADYFHITF---IDYASR

PF02447

GNTP_BACLI/1-447-------------------SISYLGIPMTAALSVTHGFLPPHPGPTAIA----------G---ELGANIGEVLLYGIIVA
GNTU_ECOLI/4-445-------------------NLVKLVIPLFAGVAAAAAFLVPGPAPMLLA----------S---QMNADFGWMILIGLCAA
GNUT_PSEAE/9-449-------------------SLIKIGIPLLAGLSAVHGLVPPHPGPLLAI----------G---VFGADIGKTILYGLIVA
YJHF_ECOLI/1-448-------------------SPMFMCVPMLSGLLVAHGFLPPHPGPTVIA----------R---EYGADVGLVLIYGIIVG
YGBN_ECOLI/4-454-------------------SPLKFGLPVAGIMLTVHVAVPPHPGPVAAA----------G---LLHADIGWLTIIGIAIS
GNTT_ECOLI/1-437-------------------PLLYVGVPMAAALSVTHGFLPPHPGPTAIA----------T---IFNADMGKTLLYGTILA
Y1015_HAEIN/6-457-------------------SLLTLGVALAGGLAVTHHTVPPTPGPLGVA----------G---LFGVDIGAMLLTGMCMA
YOJA_BACSU/1-443-------------------PFLYLGIPMAAALNVTHGFLPPHPAPTAIS----------V---AYGAHIGQVLLFGIIIA
DSDX_ECOLI/6-444-------------------SLLKLAIPLCTALMAVHCVVPPHPAALYVA----------N---KLGADIGSVIVYGLLVG
GNTP_ZYMMO/7-450-------------------SLVKLTIPLCAGLATVHGLLPPHPGSMQCV----------E---MLHADVGKTILYGFIVG
GNTP_ECOLI/4-446-------------------PFLKLAIPAVAAATTAHSLFPPQPGPVALV----------N---AYGADMGMVYIYGVLVT
IDNT_ECOLI/1-437-------------------PLLYVGVPMVAALSVTHCFLPPHPGPTAIA----------T---IFEANLGTTLLYGFIIT

PF00939

MEMP_CUPNH/32-513...................IAAGIMITVAQATSIWNVGIQTAAAQNLLTVGFM-----DK...LLGERITW---LQWLIA
CITT_ECOLI/5-486...............SARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEFV-----SK...IAGIQISW---LQWFLC
O84207_CHLTR/4-470...............TEKLLGSFLIKVAYQSSVITSAMFLTAMAGNPIISALA-----S....HSGVTLTW---AIWAKT
Q9Z8X7_CHLPN/4-470...............TQDLIGSFLIKVAYQSSVITSAMFLTAMAGNPLVAALA-----G....HVGVSLSW---VLWAKA
Q9ZMT7_HELPJ/2-480................PDKIGAYLMWVALASTCITSSMFLTALAPNPLAMEIA-----TK...MGVNEISW---FSWFLA
TTDT_ECOLI/4-487...............SSRSIGSYIMWMGIVADCVTSAIFLTAMAPNLLLIGLM-----KS...ASHATLSW---GDWFLG
S13A2_HUMAN/6-565VTSASSEGRAHLSQKHLH.LTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQI-----NSLFPQNGNVVNF---ASWFSF
Y020_HAEIN/3-476...............SPKKAGRYLMMNVYMVVKTTSYIFLTAMAPNALALSLM-----AP...ILGFETTW---IKWFLA
YFLS_BACSU/12-478...............TERKIGAFLLKTGFQGNLITSAMFLTAMAANPLIAKLA-----HD...VAGVDLTW---TSWAIA
YBHI_ECOLI/3-474...............SPRRVGHYLMMSIYMVTKTTSYMFFTAMAGNILALKMI-----ND...ILHLQISW---GGWALA
SOT1_SPIOL/101-569...............TERKLGAWLMLTCFQTSVISSSMFLTAMAANPLSATLT-----FN...TIGKAIGW---MDWAKA

PF13726

Q9ZL85_HELPJ/10-97--------------------------------------------------------------------------------
A3YN61_CAMJU/6-93--------------------------------------------------------------------------------
Q73KL4_TREDE/3-90--------------------------------------------------------------------------------
C8A2Z4_STAAU/3-90--------------------------------------------------------------------------------
B9EAL6_MACCJ/2-89--------------------------------------------------------------------------------
C3F6D3_BACTU/2-89--------------------------------------------------------------------------------
E6U2C3_BACCJ/2-89--------------------------------------------------------------------------------
D6XUM8_BACIE/2-89--------------------------------------------------------------------------------
A3IGC2_9BACI/8-95--------------------------------------------------------------------------------
A7Z8B4_BACA2/2-89--------------------------------------------------------------------------------
Q2B2R2_9BACI/2-89--------------------------------------------------------------------------------
B7GKU7_ANOFW/4-91--------------------------------------------------------------------------------
Q9K7K2_BACHD/2-89--------------------------------------------------------------------------------
Q5WDV8_BACSK/2-89--------------------------------------------------------------------------------
C4L1E0_EXISA/2-89--------------------------------------------------------------------------------
B1YEV1_EXIS2/3-90--------------------------------------------------------------------------------
A4Y5U0_SHEPC/2-89--------------------------------------------------------------------------------
Q084K9_SHEFN/4-91--------------------------------------------------------------------------------
A1F5K2_VIBCL/2-89--------------------------------------------------------------------------------
D0YVL6_LISDA/2-89--------------------------------------------------------------------------------
Q1ZN28_PHOAS/2-89--------------------------------------------------------------------------------
B5FCM4_VIBFM/2-89--------------------------------------------------------------------------------
D1B1X3_SULD5/2-89--------------------------------------------------------------------------------
A6FIU9_9GAMM/2-89--------------------------------------------------------------------------------
A4SNQ6_AERS4/2-89--------------------------------------------------------------------------------
Q65UQ2_MANSM/4-91--------------------------------------------------------------------------------
C5BE39_EDWI9/2-89--------------------------------------------------------------------------------
A1TWP4_MARAV/2-89--------------------------------------------------------------------------------
A4XTU4_PSEMY/2-89--------------------------------------------------------------------------------
Q02NE5_PSEAB/2-89--------------------------------------------------------------------------------
Q2BHM1_9GAMM/2-89--------------------------------------------------------------------------------
C0W230_9ACTO/19-106--------------------------------------------------------------------------------
C0WF19_9CORY/2-89--------------------------------------------------------------------------------
D0WS18_9ACTO/27-114--------------------------------------------------------------------------------
C0E4G0_9CORY/2-89--------------------------------------------------------------------------------
D1DEI3_NEIGO/2-101--------------------------------------------------------------------------------
D4DM42_NEIEG/10-109--------------------------------------------------------------------------------
Q1Q9H8_PSYCK/4-91--------------------------------------------------------------------------------
D0BZZ4_9GAMM/2-89--------------------------------------------------------------------------------
C0VHK3_9GAMM/2-89--------------------------------------------------------------------------------
Q1QX04_CHRSD/2-89--------------------------------------------------------------------------------
A4SIT2_AERS4/144-241--------------------------------------------------------------------------------

PF06450

NHAB_HAEIN/1-513-------------------FLRSLMMHAGVGTALGGVMTVVGEPQNLII--------------AEQAKWNF---MEFFLR
NHAB_SHEON/1-520-------------------FLRNLLMHAGVGTALGGVCTMVGEPQNLII--------------AAQANWQF---GEFAIR
A6B3E7_VIBPA/1-515-------------------FLRSLLMHAGVGTALGGVTTMVGEPQNLII--------------ADQAGWLF---GEFLIR
NHAB_ECOLI/1-512-------------------FLRSLMMHAGVGTALGGVMTMVGEPQNLII--------------AKAAGWHF---GDFFLR

PF07158

P72556_STRPN/1-148-----------------------------------------RTKINIDLLAIA-----FS---YLIATT-----------
Q9KIE8_STRHY/1-149-----------------------------------------VRGLNMGLLALV-----AT---FLLGVV-----------
Q9ZIP4_RHILE/1-149-----------------------------------------IQPINMGALAFA-----GA---FVLGSM-----------
Q8P4U0_XANCP/1-149-----------------------------------------ALPINMGAVAFA-----LA---FIIGGV-----------
Q9L0A3_STRCO/1-149-----------------------------------------TRSVNMGALAFA-----AA---FGVGTL-----------

PF03553

O51582_BORBU/170-435---------------...........VPYLMIIFFSLAGMNVFIVLFL.GILS-----.I---CLISVL...YGNLYFLD
NHAC_BACPE/157-449---------------............PLLVVI.LAMRRFPTIPVLVV.GILT-----.G---IITAAF...VQGNADVA
Q9KQG1_VIBCH/161-453---------------............PVLIVLGLLAMRMPSFPVISF.GSLL-----.G---IVWAVM...IQDVDFLQ
Q9K7B7_BACHD/160-482---------------RV.....SDLILPIVALVIGTVTFMITTGIQG....TE-----GT---VTILSI...FENTDVAR
O25453_HELPY/149-430---------------...........ENYASLQ..LN....YHDYLTF.IGIV-----VA---FVIQLA...TDS.....
Q9ZKQ5_HELPJ/165-464---------------...........SKLAPLSLLPLSILLLIVSIS.....S-----LI---FYTGVI...LKNTDASF
Q9KBE2_BACHD/142-433---------------...........ETAATEEREFFS...LKHVLTL.LAIV-----AA---LTVQIL...FQS.....
Q9AFA3_VIBHA/1-333---------------KV.....SDLILPIVTLIVATIASMLYTGGQAL.AADG-----KE---FVLLGA...FENTDVGT
Q9HS26_HALSA/183-491---------------...........TAIAGRHIVEAISWGIVVAFVLNVVFG-----LA---DVSEML..VFRASDSLW
Q99VD8_STAAM/151-432---------------...........SDNVT.ELKP.....YILIVTI.VAIL-----AT---FLVQT....FTDS....
YUIF_BACSU/150-436---------------...........AEASP....YTR...KSIGIAV.LAIV-----VS---LGVQLY...LSQTLGVE
NHAC_BACSU/159-453---------------............PLLVVL.LAMKRVSVIPVLTA.GIIS-----SG---ILTAIF...VP.YSSLQ
O59530_PYRHO/156-486---------------SV.....HFFIWPVLSLIIVTLLGLYYTGKAA....CE-----GP---CGAMDI...LSNADSAT
Q9K5Y9_BACHD/160-453---------------............PACVIF.LVIKKVPALPALTA.GVLL-----.G---FLSQIF...VQGGTVGD
Q97L22_CLOAB/149-436---------------...........FPAIIILILSLFKVKLYFSASIS..II-----IA---SIFALV...FQQHNLLD
Q99RU7_STAAM/184-446---------------............PYILVLVLALLGVNVIIVLIG.G...-----..---TLLAG....IIG.....
Q9Y8U6_AERPE/161-510---------------HAP...AWLFAVSIAVLIGVTLLGMWVTGGGD....RW-----WE---TSFIDA...LMNADSAT
ARCD_HALSA/171-466---------------............PLVITFGLAIKGYPALPSLGA.GVFS-----.A---AGVSIL...IQGRGFAE
O51583_BORBU/175-441---------------............PYIFVMVFAISGFDVFLALFL.GIVV-----.A---GIIGIY...YSDITFLL
Q97TG1_CLOAB/150-462---------------EEYPEDSKNLIIPIIILLSSTIFFFWWTGRPY.....A-----KG---FINALAFAKFNVSIFSG
Q9K7K2_BACHD/150-434---------------...........AEFKQEEISYSN...WTIACAV.VAIV-----VT---LVVQYY...S......E
Q9KSX5_VIBCH/165-497---------------TV.....LDLVLPIVFLVVATIGAMIWTGASAL.AESG-----QS---FDIFGA...FENTNVGT
Y325_HAEIN/152-444---------------...........ATTKDIEAHIANIKPKQIVASL.IAIV-----AT---FATQL....VTSS....
Q9KT98_VIBCH/150-435---------------...........VQQESSSINK.....QHIAIAG.VGIV-----AA---LAVQL....LTGS....
Q9KMV5_VIBCH/168-494---------------TM.....IDMVLPIAVLTITTLIFMIQTGNAVL.AANG-----EA---FSLIGA...LENTNVAQ
MLEN_BACSU/159-452---------------............PAVLVIVLLAMKKPSMPVIVI.GALL-----.G---AIWAVV...FQGMDIAH
Q9AGE2_YERPS/159-463---------------............PPVLVLWGAIIKWPVIPVMLA.GCAL-----.A---IVIAVV...LQGFTLQQ
Q9JXG2_NEIMB/166-456---------------...........AGNADAANRPQPSAYRSLAAA..VAIA-----VC---FAIQLM...YEDS....
Q9KMX3_VIBCH/172-442---------------............PYLTILVLAVMGLNVFLVLLV.G...-----..---ILMAAG...VGG.....
Q9K0Q3_NEIMB/165-476---------------RV.....YALIIPVLALIASTVSAMIYTGAQA.....S-----ET---FSILGA...FENTDVNT
Q9HNR2_HALSA/161-489---------------SL.....VSFFVPVAVLIAVTIATALYTGYGP......-----.D---TTLYDM...VVGADYAV
Q9CMF8_PASMU/165-482---------------HV.....LYLILPITVLILATVGMMMYTGYEAL.AADG-----KP---FDVLGA...FENTTVGI
Q99RX2_STAAM/158-455---------------............PLIVIIVCLLFKMATVPAMVI.SSFS-----.A---IIVGTF...NHHFKMTD
Y1586_HAEIN/177-494---------------QV.....RNLILPILVLIIATVSMMIYTGAEAL.AADG-----KV---FSVLGT...FENTVVGT
Y1107_HAEIN/162-461---------------............PVAIVLWGSITKKPTIPVMLL.SAFI-----.A---IINAIL...IQKFSLSD
Q9HNF6_HALSA/156-488---------------SL.....LNFFGPIAVLLAVGLGSMWYLGGGY.....K-----PG---VDIATA...LQETDVAM
Q9HNF7_HALSA/171-467---------------............PLVVTFGLAFRGYPALPSLVA.GVFA-----.G---ALTTIA...VQGASFTA
Q9I0I5_PSEAE/151-435---------------...........AERVDVSYNP.....KSLAVAG.VSIV-----AA---FVAQL....WLDS....

PF03605

Q9ZEN8_WOLSU/6-382---------------DIAIKNNIRPERPMAAASISSQMGICASPVSVA-IVSF-----VA---LLAKSHLANGAEISLIT
DCUB_SHIFL/6-376---------------DVAIKNNIRPERPMAASSIGAQMGIIASPVSVA-VVSL-----VA---MLGN.VTFDGRHLEFLD
Q9CJS4_PASMU/5-375---------------DVALKNKIRPERPMAAASVASQLAITSSPISAA-VVYY-----LA---QIVA..LPGFEHVTLLS
DCUA_WOLSU/5-365---------------KVAKEQGVKPSVPLSIAVVASQIAITASPVSAA-VVFM-----SG---ALEP......LGVGYLQ
Q9KNN2_VIBCH/21-383---------------EVAKGQGVRPSRPLSIAVVASQIAITASPISAA-VVAF-----AA---MLVP......FGVDYLT
DCUB_HAEIN/8-372---------------EVSRQNGIRPERPMSMAVIASQFAIVASPIAAA-VVAV-----VA---YLEP......QGIHLGD
Q9KMW3_VIBCH/5-373---------------DVALKNGIRPERPMAAASVASQIAITASPISAA-VVYY-----LA---ELAN..IN..HNITLLS
DCUA_SHIFL/5-365---------------EVAKEQGVKPCRPLSTAVVSAQIAITASPISAA-VVYM-----SS---VMEG......HGISYLH
Q97DH7_CLOAB/5-371---------------EIAIDTGIRPERPISASIVSSQQAITACPISAA-TVAV-----LA---FMAK...AQYTSVNIFT
DCUA_HELPJ/7-369---------------EVSQSQNIKPKAPLSLAVVSSQVAITASPVSAA-VVFM-----SG---ILEP......LGADYLT

PF04165

O29978_ARCFU/17-405---------------NYWFRHVWVTFWPLYPSVIIGAAVVNVDYFHFAAATFP-----IG---VFALTAG.LTLTRGMER
O57766_PYRHO/2-394---------------NYWFRHIWELSWPMYQAIVLMSAILGLSIREISVKMFP-----LT---ILMALIGYVFFIHPLKE
Q9V2R1_PYRAB/3-395---------------NYWFRHVWELSWPMYQAIVITSAVVGISIREISVKMFP-----LT---ILMATIGYLFFVYSLKE
Q9WYV1_THEMA/3-381---------------NYWFRHTIEFFWPIYPAVVLVSELSGIHPGKVSLTLFP-----VF---AIAFFLGWFFFNGKQLP

PF02652

LCTP_BACSU/14-536...............ALELSRTLMWTLPMISFLIPFLLVFLLDR.MKGIKQTW-----PA---LLVVSGGYTAVQTLTMA
LUTP_BACSU/16-554...............AMEISQMVGRQLPFLSVFIPLYLIIIMSG.FRKALEIW-----PA---ILVSGVSFAVVQYLSSN
LLDP_ECOLI/16-542...............SFEIGQMVGRQLPFMTIIVLFWIMAIMDG.WRGIKETW-----PA---VVVAGGSFAIAQYLSSN
Q9ZMU0_HELPJ/15-536...............ELEISQMVGRVLPIFSIGIPFFIVFLMDG.FRGIRETF-----PA---VAVTGFSFAIAQFLSSN
Y1218_HAEIN/2-525.............DMILEIGSITAFIHSIAALIIPLLALRILVN.WDDIRKNI-----VF---IYISVLGCVVPYFLIAQ
O51549_BORBU/4-500...............VNIVSSEIAFQLILPTLTIPFVLVILTGGGIKGLKGVF-----LL---TLLSGMSMAISQVFISK
Q9ZMT9_HELPJ/16-539...............AILISAMTGKILFFVSLLVPFFIVFLMDG.FKGIKETF-----PA---VFIAAFSFAGAQFLSSN
O29452_ARCFU/1-535ESYGYTLKQFLYTDVTFWTATLHGIMAVFIPLLGAVFMVKWSGGKVSDVKDAA-----PS---LLLAGLSFAIPYWILAA

PF07854

Q9YFW4_AERPE/15-368--------------------------------------------------AVAAAYSLRGEVYREGLVKF.-------.V
Q8PXG5_METMA/8-368--------------------------------------------------GIIGVFFLGKADPKEAGMKA.-------.A
Q8RCZ3_THETN/45-391--------------------------------------------------GFLGLLYINKLEKNSLIIEEN-------YV
Q8R782_THETN/2-340--------------------------------------------------GLIGTFFAKRESGIGEPTED.-------.V
Q8ZUI4_PYRAE/6-347--------------------------------------------------ALYAYFSLKRL..RQPGVEV.-------.V
O29471_ARCFU/14-358--------------------------------------------------GIYAAMRVGGVSVKE..IEI.-------.P

PF07399

Q9Z6V2_CHLPN/1-438--------------------------------------------------TTIYYFIFRKEFKKFPDIPSD.......KD
Q9F206_9BURK/1-428--------------------------------------------------AATAALLFRKELGHMGQTGADGANGTDGAT
Q87F98_XYLFT/1-420--------------------------------------------------ALGATLLLRNVLRHLPETQDN.........
O84811_CHLTR/1-438--------------------------------------------------TTIFFCLFRKEFKKFPKTIPS.......TT

PF03806

ABGT_ECOLI/14-507QM..HVSVIDNWYF------------------------------------MASSVVVLTIVGGLITDKIIEPRL------
Q9KEI6_BACHD/19-511DY..VANPAMNYYF------------------------------------LVASCLVLVPVAVWVTTKIVEPRL------
Q9KC22_BACHD/13-510AYAETINYAMNWYF------------------------------------IIASVFVLTLAGWFVTDKIVEPRL------
Q9A7U5_CAUCR/48-548NF..VMNPLGNWWF------------------------------------TLAIGTLFTPIAWWVTDRVVEPRL------
Q99RG0_STAAM/14-511SI..KTNVAMNWYF------------------------------------IAASVVVLLPTILLVTTKLIIPRL------
Q9AA61_CAUCR/39-553TW..TMNPLGNWWY------------------------------------ILAIVVVFTPIAWFLTDKVVEPRL------
Q9KTN8_VIBCH/19-517SY..QVNPLANIYF------------------------------------TGLSSIIIVAIGWYVTDKVIEPRL------
Q9KTM2_VIBCH/25-532TY..SVGPEVNWYF------------------------------------MAASTFVIAILGAFVTEKIVEPKL------
Q9RNX1_NEIGO/11-519DY..VVGPEANWFF------------------------------------MVTSTFVIALIGYFVTEKIVEPQL------

PF03606

O51783_BORBU/4-471DG--FYFRIVLYFV------------------------------------SVLAAITYV---CVYASKIKKDPS------
Y594_HAEIN/12-505EG--IGFRALGLVL------------------------------------GATCVIAYL---YWYCKKIKADPS------
Q9CP35_PASMU/1-448DF--AFHLTLPISI------------------------------------LTIISIAIA---HFFWQRYLDRK.------
Q97NA1_STRPN/11-499DG--IVLRLIFWVT------------------------------------LTALSTWFV---YRYADKIQKDPT------
DCUC_SHIFL/5-452DF--AFKTTLPISI------------------------------------AAIIGMAIA---HFFWQRYLDKK.------
Q99YT7_STRP1/11-496DG--MIWRVIQWVI------------------------------------LVGMSIWFV---YNYASKIEEDPS------
YFCC_ECOLI/15-502SG--SGLRIVVWVI------------------------------------ATLIGLIFT---MVYASRVKKNP.------
Q9AAL9_CAUCR/33-506SG--MSLRLVMWVV------------------------------------FTLVGVAYL---GWYARRVRRDP.------
Q9CMA1_PASMU/2-462EY--FVGYQLKLAI------------------------------------ITMLVISTS---HFFVQKWFDKRQ------
Q9KAH9_BACHD/20-464SG--VGFRLMVLAT------------------------------------IVLSSVLFL---MFYAKKLENHP.------
Q99UT9_STAAM/18-515DG--LYWRIGACIV------------------------------------GAIFVISYL---YWYCKTIKNDPK------
DCUC_VIBCH/6-456VF--AVETVLPVSI------------------------------------CAIIVMAAA---AYFWNQYLDKK.------
DCUD_ECOLI/2-455TY--FFHYQLPVAS------------------------------------CVIISVAIS---HFFVQRAFDKK.------

PF06808

Q9Y8U1_AERPE/115-551DV--VARGWAPALI....................................YYIGLAAAV---YLASK...AFLS......
Q9K7H0_BACHD/6-417DL--FIAGIGPGLL....................................VMFMFAAYS---YYHAK.KNNIPL......
Q8NN88_CORGL/3-439SQ--VYIALACGGA....................................YAVLYRLAV---VFYWTRKDKIPA......
Q8FA80_ECOL6/7-418KM--FIAGLVPGLL....................................CAVVLMFTV---YLVARKTNAKPS......
Q9CKH6_PASMU/7-420KM--FMSGIIPGLM....................................IALTLILIT---FIISK.IKGYGN......
O07838_RHOCA/7-430EL--FMAGVVPGLM....................................LAGFLAFTT---WNRAR.KFGYPR......
Q92K76_RHIME/14-514DM--YAGALIPGLVLTGLYMGYILLMTFVKRHSMPALPLEARTLGSGVASLAIALLVAC---AIAYAAHVYLSPTQGENA
O29619_ARCFU/128-601NI--VYAAIIPAFL....................................YFFGVFSAV---DFEAR.KENLRG......
Q8G0A8_BRUSU/148-607TI--ILAAIVPAFM....................................HFFGVLMQV---HFEAK.RTGLRG......
Q8FRN3_COREF/157-598EI--IIAATIPAAL....................................YFIGIFLQV---DGYAA.LRNLHG......
Q92PP2_RHIME/208-617AL--FTSGFAIALV....................................LLVALAALA---RIKAA.RENVDG......
Q8ZKS0_SALTY/12-424AL--FAGGLVAGVL....................................WGVGCMLVT---LVVAK.RRNYRV......
Q8ZL80_SALTY/7-416KL--FMAGIAPGIM....................................MGAALMLTW---WWQAG.RLNLPS......
Q92PN6_RHIME/6-416SL--FSAAVLPGLM....................................LAGGMMIVC---YLSGR.IRNFPR......
Q92WB7_RHIME/5-456AL--FMAGVVPGVV....................................MTVLMMLTV---AIFAY.KRGWGS......
Q89FZ8_BRAJA/199-609GL--FVAGLLPAAL....................................MALVLIAVS---IIFGK.............
Q89NA6_BRAJA/151-593DV--AVAAIIPAAL....................................YYVGLFMQV---DAYAA.RHGLKG......
Q89CF6_BRAJA/11-428KL--FIAGIIPGLL....................................AMTMYMITI---ALIGYFRPDFLP......

PF02667

Q9ZLE5_HELPJ/3-453QTIFSSYNLIIIGI------------------------------------ILIGLPFLM---AMIHPKKEEIVE------
O28734_ARCFU/8-484ETIFHPYTLINLAI------------------------------------IISFGVLAY---YALAPNRGELKG------
ATOE_ECOLI/1-440DTLFSGFNIFITVA------------------------------------LIVVMPFIT---RMMMPKPSDVVS------
ATOE_HAEIN/1-447STLFSGYNIFITLS------------------------------------LVICLPFIT---YMMMPKNGETKS------

PF03600

Q10RS7_ORYSJ/16-503----VFPAMIVGVL------------------------------------TNA...AILL---CYFWKYLSVEKDQEGGQ
ARSB_DICDI/51-511----SIVSSILGVC------------------------------------LNT...ILLL---LYFKKDLKNLNSNFNQL
CITN_BACSU/5-373----LIPAMIAGIL------------------------------------WVI...AVAY---ILGKKERKRLGVISID.
Q828S1_STRAW/5-417----MIPALAVGLL------------------------------------GVF...ALAY---VLGRRERTRLGVLTLDE
Q897M4_CLOTE/5-411----PILGIIGALL------------------------------------MGG...FGMT---WLTYRAKKAKANGEGYG
Q8T0L2_DROME/151-567----MMPGVLAAMF------------------------------------VVF...GIIY---VTHRKSIFVLDQNQLDL
Q9VU30_DROME/220-638----MLPGVLLAAV------------------------------------AGY...AVMY---VTMRKSLFKLEEQQLEL
Q9W024_DROME/212-628----MLPTALICLA------------------------------------STF...GLIY---WTMGKKIYILDEDQVNL
Q81E21_BACCR/4-425----PILGIVGAIF------------------------------------VLT...VGLL---YLESRRKKAKAEGEGYF
Q8EMV3_OCEIH/7-393----GWIGVVCALL------------------------------------IMT...LGGL---WLGSMVKKAFASGETFA
Q8XWF6_RALSO/4-412----PWLGTAGAIF------------------------------------ILA...VGMA---YLEWRRRAAVRACHGYD
Q88BF5_PSESM/5-378----MIPAMLAGVV------------------------------------AIL...AIAY---FYGKRERARLGELHLKG
Q8I929_DROME/216-650----TFPGVILAVI------------------------------------Q.....SCVY---LRLFYHNIDALRLNEPK
Q9K635_BACHD/2-373----PMMGVIAALI------------------------------------MGI...GGYT---YLVWREKKLKEAGEFFT
Q2BIE8_9GAMM/57-578----LVPAVIMNFA------------------------------------IPNEIPEASQ---EKSFMKRGAKVMMVLFL
Q898H6_CLOTE/4-380----LLPAIASALA------------------------------------QLI...LICV---WFEYRSSKLTKKGYTFY
YRAO_BACSU/5-384----LLPTMLGGIA------------------------------------CVI...FLAF---LMGRKERNRIGIVQLEP
Q8FSY6_COREF/59-476----MIPSLIAGVA------------------------------------VCI...AFAW---FLGLAERKRLGRIDSSR
CITM_BACSU/5-378----MIPVIASGML------------------------------------CMV...AVAY---VLGKAERKRLGVIELKQ
Q88FZ5_PSEPK/9-557----VVLVLGIGYM------------------------------------LLTRHWLNGE---VRKDGRVESRRTLLDLV
Q7PVG5_ANOGA/324-759----M....AIPIF------------------------------------FVM..ITTYF---QLRMKFKNINDLRFSEP
Q8I930_DROME/315-750----MLPGVLLVMV------------------------------------Q.....TYIQ---LRFKFRNISDLQFKDSP
Q87EP0_XYLFT/5-388----LIPAMGIAII------------------------------------GIL...TLAW---WLGMKERKRLGVAKLPN
Q81I57_BACCR/5-381----LIPGMIAGAI------------------------------------WVV...FVAY---YLGKKERKRLGIMDVQY
Q9AV23_ORYSJ/16-429----ILPAMLAGMG------------------------------------INM...LMLL---CMYWKELDGGACSPDEV
Q8DUC7_STRMU/6-410----LAPGMILSLL------------------------------------YVI...FFVA---RSMGKKERKRLGVTELS
Q8NUL8_STAAW/11-402----LIPIQIIGFI------------------------------------LIM...LFAV---YLGFKEQKRIKKAIERN
Q88L78_PSEPK/5-379----MLPTVIGGAA------------------------------------WVV...FTAY---LLGRAERRRIGNIALES
O81915_ARATH/16-450----VFPAMIVGIT------------------------------------VNA...MLLL---GMYWRLLSDHKEDEEEV
Q82YV5_ENTFA/6-407----LAPGMILSVL------------------------------------YVI...FFVA---YRMGKKERARLGVTTLT
Q88IC5_PSEPK/4-409----PWLGLIGTLF------------------------------------VFF...TGMA---YLQRQRNKAQRAGEGYG
Q9HTA2_PSEAE/5-378----MIPAMIAGLL------------------------------------AIF...AIAW---IYGKRERARLGELHLPT

PF02040

O68021_PSEAI/3-423----MLPVNLVSVA------------------------------------TSL---LVLF---LYFRRDL----------
ARSB_STAXY/4-426----MIIPNIFSLI------------------------------------ASI---LVLW---LYFRKSI----------
ARSB2_ECOLX/3-425----MVPVDIAAII------------------------------------ATL---VMLH---LFFRKDI----------
YDFA_BACSU/6-428----MVVPYLFSLL------------------------------------ASI---IVLY---LFFRKSI----------

PF02447

GNTP_BACLI/1-447----.IPTVLL...------------------------------------AGP---LFTK...LAKKIVPQSFEKMGSIA
GNTU_ECOLI/4-445----.IPGMII...------------------------------------AGP---LWGN...FISRYVELHIP......
GNUT_PSEAE/9-449----.LPTAAI...------------------------------------AGP---LFGA...LVSRYIPGTPS..AELV
YJHF_ECOLI/1-448----.IPTFIL...------------------------------------CGP---VLNK...FCQRIIPDAFKKEGNIA
YGBN_ECOLI/4-454----.IPVGVVGYF------------------------------------AAK---IINKRQ.YAMSVEVLEQMQLAPAS
GNTT_ECOLI/1-437----.IPTVIL...------------------------------------AGP---VYAR...VLKGIDKPIPE......
Y1015_HAEIN/6-457----FLPVVGIVLY------------------------------------AKW---LDKKYPNFNQEVFTEEELK...QK
YOJA_BACSU/1-443----.VPTTVI...------------------------------------AGP---LFNK...FAMKRFPGAYQKHGNLS
DSDX_ECOLI/6-444----.LMASLI...------------------------------------GGP---LFLK...FLGQRLPFKPVP....T
GNTP_ZYMMO/7-450----.FPAAIL...------------------------------------AGP---LYGN...WITPRIQLPAH..NPFA
GNTP_ECOLI/4-446----.IPSVIC...------------------------------------AGL---ILPK...FLGNLERPTPS....FL
IDNT_ECOLI/1-437----.IPTVIV...------------------------------------AGP---LFSK...LLTRFEKAPPE.....G

PF00939

MEMP_CUPNH/32-513GAPWAIAMSVVLYF------------------------------------LVR---LLL.---...PAETDAIP......
CITT_ECOLI/5-486....FLPVGVILLI------------------------------------IAP---WLSY---VLYKPEITHSE......
O84207_CHLTR/4-470....AILPGIISLA------------------------------------CMP---FVLF---KLFPPQITSCE......
Q9Z8X7_CHLPN/4-470....AIIPGLPSLF------------------------------------LMP---IILY---KLYPPKITSCE......
Q9ZMT7_HELPJ/2-480....FLPCGVVLIL------------------------------------LVP---LLAY---KTCKPTLKGSK......
TTDT_ECOLI/4-487....MLPLSILLVL------------------------------------LVP---WLAY---VLYPPVLKSGD......
S13A2_HUMAN/6-565....AFPTMVILLL------------------------------------LAW---LWLQ---ILFLGFNFRKNFGIGEK
Y020_HAEIN/3-476....ASVPGLLCLF------------------------------------LIP---LICY---WVSPPELKKV.......
YFLS_BACSU/12-478....AIVPGLVSLI------------------------------------ITP---LVIY---KLYPPEIKETP......
YBHI_ECOLI/3-474....AGLPGIIMLL------------------------------------VTP---LVIY---TMYPPEIKKV.......
SOT1_SPIOL/101-569....AFVPGLVSLI------------------------------------VVP---LLLY---VVYPPEIKSSP......

PF13726

Q9ZL85_HELPJ/10-97--------------------------------------------------------------------------------
A3YN61_CAMJU/6-93--------------------------------------------------------------------------------
Q73KL4_TREDE/3-90--------------------------------------------------------------------------------
C8A2Z4_STAAU/3-90--------------------------------------------------------------------------------
B9EAL6_MACCJ/2-89--------------------------------------------------------------------------------
C3F6D3_BACTU/2-89--------------------------------------------------------------------------------
E6U2C3_BACCJ/2-89--------------------------------------------------------------------------------
D6XUM8_BACIE/2-89--------------------------------------------------------------------------------
A3IGC2_9BACI/8-95--------------------------------------------------------------------------------
A7Z8B4_BACA2/2-89--------------------------------------------------------------------------------
Q2B2R2_9BACI/2-89--------------------------------------------------------------------------------
B7GKU7_ANOFW/4-91--------------------------------------------------------------------------------
Q9K7K2_BACHD/2-89--------------------------------------------------------------------------------
Q5WDV8_BACSK/2-89--------------------------------------------------------------------------------
C4L1E0_EXISA/2-89--------------------------------------------------------------------------------
B1YEV1_EXIS2/3-90--------------------------------------------------------------------------------
A4Y5U0_SHEPC/2-89--------------------------------------------------------------------------------
Q084K9_SHEFN/4-91--------------------------------------------------------------------------------
A1F5K2_VIBCL/2-89--------------------------------------------------------------------------------
D0YVL6_LISDA/2-89--------------------------------------------------------------------------------
Q1ZN28_PHOAS/2-89--------------------------------------------------------------------------------
B5FCM4_VIBFM/2-89--------------------------------------------------------------------------------
D1B1X3_SULD5/2-89--------------------------------------------------------------------------------
A6FIU9_9GAMM/2-89--------------------------------------------------------------------------------
A4SNQ6_AERS4/2-89--------------------------------------------------------------------------------
Q65UQ2_MANSM/4-91--------------------------------------------------------------------------------
C5BE39_EDWI9/2-89--------------------------------------------------------------------------------
A1TWP4_MARAV/2-89--------------------------------------------------------------------------------
A4XTU4_PSEMY/2-89--------------------------------------------------------------------------------
Q02NE5_PSEAB/2-89--------------------------------------------------------------------------------
Q2BHM1_9GAMM/2-89--------------------------------------------------------------------------------
C0W230_9ACTO/19-106--------------------------------------------------------------------------------
C0WF19_9CORY/2-89--------------------------------------------------------------------------------
D0WS18_9ACTO/27-114--------------------------------------------------------------------------------
C0E4G0_9CORY/2-89--------------------------------------------------------------------------------
D1DEI3_NEIGO/2-101--------------------------------------------------------------------------------
D4DM42_NEIEG/10-109--------------------------------------------------------------------------------
Q1Q9H8_PSYCK/4-91--------------------------------------------------------------------------------
D0BZZ4_9GAMM/2-89--------------------------------------------------------------------------------
C0VHK3_9GAMM/2-89--------------------------------------------------------------------------------
Q1QX04_CHRSD/2-89--------------------------------------------------------------------------------
A4SIT2_AERS4/144-241--------------------------------------------------------------------------------

PF06450

NHAB_HAEIN/1-513----MAPVTIPVFI------------------------------------CGLLTCFLVEKFKLFGYGEKLPDEVWKILS
NHAB_SHEON/1-520----MSPVTVPVFI------------------------------------AGILTCYIVEKFRIFGYGAQLPDAVHKILC
A6B3E7_VIBPA/1-515----MSPVTLPVFI------------------------------------CGLITCALVEKLKVFGYGAQLPDNVRQILV
NHAB_ECOLI/1-512----MSPVTVPVLI------------------------------------CGLLTCLLVEKLRWFGYGETLPEKVREVLQ

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------------------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------------------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------------------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------------------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------------------

PF03553

O51582_BORBU/170-435---------------------------------------------------VMK.......-------------------
NHAC_BACPE/157-449---------------------------------------------------RWFTIIQNGF-------------------
Q9KQG1_VIBCH/161-453---------------------------------------------------AFN.TAWAPY-------------------
Q9K7B7_BACHD/160-482---------------------------------------------------ALVYGGLIGF-------------------
O25453_HELPY/149-430---------------------------------------------------.MPLAAFLAL-------------------
Q9ZKQ5_HELPJ/165-464---------------------------------------------------SLFYGGLFSL-------------------
Q9KBE2_BACHD/142-433---------------------------------------------------.LVLGALTGI-------------------
Q9AFA3_VIBHA/1-333---------------------------------------------------SLIYGSLLGL-------------------
Q9HS26_HALSA/183-491---------------------------------------------------IARELSVLPF-------------------
Q99VD8_STAAM/151-432---------------------------------------------------.MIFGALAGV-------------------
YUIF_BACSU/150-436---------------------------------------------------GMIMGALAGL-------------------
NHAC_BACSU/159-453---------------------------------------------------AFMTALQNGT-------------------
O59530_PYRHO/156-486---------------------------------------------------SLLWGSFAMV-------------------
Q9K5Y9_BACHD/160-453---------------------------------------------------AVN.TLSDGF-------------------
Q97L22_CLOAB/149-436---------------------------------------------------IIKFIILG.F-------------------
Q99RU7_STAAM/184-446---------------------------------------------------.LIDGSFG..-------------------
Q9Y8U6_AERPE/161-510---------------------------------------------------ALLWGSFAAY-------------------
ARCD_HALSA/171-466---------------------------------------------------AWQ.IIYSGT-------------------
O51583_BORBU/175-441---------------------------------------------------LAK.......-------------------
Q97TG1_CLOAB/150-462---------------------------------------------------IMLTLLLTSL-------------------
Q9K7K2_BACHD/150-434---------------------------------------------------SMIIAGLAGL-------------------
Q9KSX5_VIBCH/165-497---------------------------------------------------SLVYGGLVGL-------------------
Y325_HAEIN/152-444---------------------------------------------------.TIIGGLIGL-------------------
Q9KT98_VIBCH/150-435---------------------------------------------------.MIIGALAGF-------------------
Q9KMV5_VIBCH/168-494---------------------------------------------------SLVYAALCSL-------------------
MLEN_BACSU/159-452---------------------------------------------------AIA.TAYNGF-------------------
Q9AGE2_YERPS/159-463---------------------------------------------------GLE.SLMDGF-------------------
Q9JXG2_NEIMB/166-456---------------------------------------------------.LVLGAMLGF-------------------
Q9KMX3_VIBCH/172-442---------------------------------------------------.LS....DGY-------------------
Q9K0Q3_NEIMB/165-476---------------------------------------------------SLVFGGTCGV-------------------
Q9HNR2_HALSA/161-489---------------------------------------------------ALIVGSFAMV-------------------
Q9CMF8_PASMU/165-482---------------------------------------------------SLVVGGLSAV-------------------
Q99RX2_STAAM/158-455---------------------------------------------------GFK.ATFSGF-------------------
Y1586_HAEIN/177-494---------------------------------------------------SLVVGGFCSI-------------------
Y1107_HAEIN/162-461---------------------------------------------------VIN.SAVNGF-------------------
Q9HNF6_HALSA/156-488---------------------------------------------------GLLHGAFAFM-------------------
Q9HNF7_HALSA/171-467---------------------------------------------------AWD.IFLNGT-------------------
Q9I0I5_PSEAE/151-435---------------------------------------------------.MIIGALVGF-------------------

PF03605

Q9ZEN8_WOLSU/6-382---------------------------------------------------VLQITIPCTI-------------------
DCUB_SHIFL/6-376---------------------------------------------------LLAITIPSTL-------------------
Q9CJS4_PASMU/5-375---------------------------------------------------IISVTVPATL-------------------
DCUA_WOLSU/5-365---------------------------------------------------LLAICIPTTF-------------------
Q9KNN2_VIBCH/21-383---------------------------------------------------LLAICIPTTF-------------------
DCUB_HAEIN/8-372---------------------------------------------------VLMVTIPSTI-------------------
Q9KMW3_VIBCH/5-373---------------------------------------------------ILMVTIPATL-------------------
DCUA_SHIFL/5-365---------------------------------------------------LLSVVIPSTL-------------------
Q97DH7_CLOAB/5-371---------------------------------------------------LLIVCIPATL-------------------
DCUA_HELPJ/7-369---------------------------------------------------LLMVWIPTTF-------------------

PF04165

O29978_ARCFU/17-405RFRVSRN....LFD------------------------------------SLINLYPIAIL-------------------
O57766_PYRHO/2-394NEKSDKNKMKGLRM------------------------------------LIESIYPIVII-------------------
Q9V2R1_PYRAB/3-395DKANGRNKVTGLKM------------------------------------LLKATYPILVI-------------------
Q9WYV1_THEMA/3-381CLSKPRS.......------------------------------------.FFNLFPLIPV-------------------

PF02652

LCTP_BACSU/14-536VLGPELANILAALF------------------------------------SMGGLALFLRK.WQPKEIYREEGAGDAGEK
LUTP_BACSU/16-554FLGPELPDVLSALV------------------------------------SMAALAVFLKW.WKPKTTFRFAGEQESAAS
LLDP_ECOLI/16-542FIGPELPDIISSLV------------------------------------SLLCLTLFLKR.WQPVRVFRFGDLGASQVD
Q9ZMU0_HELPJ/15-536YLGPQLPDIISALV------------------------------------SLVATTLFLKF.WQPKHIFTSNGKEPTIST
Y1218_HAEIN/2-525VN.YEFPSLVGGAI------------------------------------GLFISVWAANR...NIGLAKVTNTLDNNAV
O51549_BORBU/4-500TLGPELPAILGSIL------------------------------------SMTITIVYARF.FGNKETTE....RQSKNT
Q9ZMT9_HELPJ/16-539YLGPELPGIISALV------------------------------------SLVATALFLKF.WQPKTIFRSDGKAISFTK
O29452_ARCFU/1-535SLGPEFPSLLGGII------------------------------------GLVIYSATLKAGFVPKTSWDFAKKHEAGEE

PF07854

Q9YFW4_AERPE/15-368.-------------------------------------------------------------------------------
Q8PXG5_METMA/8-368D-------------------------------------------------------------------------------
Q8RCZ3_THETN/45-391E-------------------------------------------------------------------------------
Q8R782_THETN/2-340E-------------------------------------------------------------------------------
Q8ZUI4_PYRAE/6-347P-------------------------------------------------------------------------------
O29471_ARCFU/14-358E-------------------------------------------------------------------------------

PF07399

Q9Z6V2_CHLPN/1-438P-------------------------------------------------------------------------------
Q9F206_9BURK/1-428A-------------------------------------------------------------------------------
Q87F98_XYLFT/1-420A-------------------------------------------------------------------------------
O84811_CHLTR/1-438M-------------------------------------------------------------------------------

PF03806

ABGT_ECOLI/14-507-----------GQWQGN..-------------------------------------------------------------
Q9KEI6_BACHD/19-511-----------GTYTG...-------------------------------------------------------------
Q9KC22_BACHD/13-510-----------GAFKGSLE-------------------------------------------------------------
Q9A7U5_CAUCR/48-548-----------GPWTREDT-------------------------------------------------------------
Q99RG0_STAAM/14-511-----------GKYDDSLM-------------------------------------------------------------
Q9AA61_CAUCR/39-553-----------GPWGGQAD-------------------------------------------------------------
Q9KTN8_VIBCH/19-517-----------AATKVDED-------------------------------------------------------------
Q9KTM2_VIBCH/25-532-----------GKYDVSEA-------------------------------------------------------------
Q9RNX1_NEIGO/11-519-----------GPYQSDLS-------------------------------------------------------------

PF03606

O51783_BORBU/4-471-----------K.SLVYSQ-------------------------------------------------------------
Y594_HAEIN/12-505-----------F.SYTYDD-------------------------------------------------------------
Q9CP35_PASMU/1-448-----------........-------------------------------------------------------------
Q97NA1_STRPN/11-499-----------K.SLVYST-------------------------------------------------------------
DCUC_SHIFL/5-452-----------........-------------------------------------------------------------
Q99YT7_STRP1/11-496-----------K.SLVADK-------------------------------------------------------------
YFCC_ECOLI/15-502-----------....LLSR-------------------------------------------------------------
Q9AAL9_CAUCR/33-506-----------....TLSV-------------------------------------------------------------
Q9CMA1_PASMU/2-462-----------ALTGGGSE-------------------------------------------------------------
Q9KAH9_BACHD/20-464-----------.......E-------------------------------------------------------------
Q99UT9_STAAM/18-515-----------A.SYSYED-------------------------------------------------------------
DCUC_VIBCH/6-456-----------........-------------------------------------------------------------
DCUD_ECOLI/2-455-----------........-------------------------------------------------------------

PF06808

Q9Y8U1_AERPE/115-551...................-------------------------------------------------------------
Q9K7H0_BACHD/6-417...................-------------------------------------------------------------
Q8NN88_CORGL/3-439...................-------------------------------------------------------------
Q8FA80_ECOL6/7-418...................-------------------------------------------------------------
Q9CKH6_PASMU/7-420...................-------------------------------------------------------------
O07838_RHOCA/7-430...................-------------------------------------------------------------
Q92K76_RHIME/14-514DILGATVGIIFIYLAALAD-------------------------------------------------------------
O29619_ARCFU/128-601...................-------------------------------------------------------------
Q8G0A8_BRUSU/148-607...................-------------------------------------------------------------
Q8FRN3_COREF/157-598...................-------------------------------------------------------------
Q92PP2_RHIME/208-617...................-------------------------------------------------------------
Q8ZKS0_SALTY/12-424...................-------------------------------------------------------------
Q8ZL80_SALTY/7-416...................-------------------------------------------------------------
Q92PN6_RHIME/6-416...................-------------------------------------------------------------
Q92WB7_RHIME/5-456...................-------------------------------------------------------------
Q89FZ8_BRAJA/199-609...................-------------------------------------------------------------
Q89NA6_BRAJA/151-593...................-------------------------------------------------------------
Q89CF6_BRAJA/11-428...................-------------------------------------------------------------

PF02667

Q9ZLE5_HELPJ/3-453-------IDS......KLL-------------------------------------------------------------
O28734_ARCFU/8-484-------IDKVAPHIIELV-------------------------------------------------------------
ATOE_ECOLI/1-440-------IDP......KLL-------------------------------------------------------------
ATOE_HAEIN/1-447-------IDP......KLI-------------------------------------------------------------

PF03600

Q10RS7_ORYSJ/16-503PAGPEVVADDEVTSHRFTPARMSHVSSLNPDDMDCISEPIIRSNSVRSTSANENLRSRSVNS..................
ARSB_DICDI/51-511IETVNPKVEEIDNNHHDDDGANNQSKNEKEMENINKEVEEEQHNNDDDDD..............................
CITN_BACSU/5-373................................................................................
Q828S1_STRAW/5-417ALEPQEAETVLVGAGGSEEKS...........................................................
Q897M4_CLOTE/5-411E...............................................................................
Q8T0L2_DROME/151-567MEERARGKKPPSQETLDRIA............................................................
Q9VU30_DROME/220-638AAERENSRRRSSADITARAE............................................................
Q9W024_DROME/212-628AEKRRENTRTSFDIQLRVA.............................................................
Q81E21_BACCR/4-425GFNDGNTEM.......................................................................
Q8EMV3_OCEIH/7-393LPNGEGEA........................................................................
Q8XWF6_RALSO/4-412AGL.............................................................................
Q88BF5_PSESM/5-378DE..............................................................................
Q8I929_DROME/216-650EMSELRREMKVWQRALNAVASCSKDAQLV...................................................
Q9K635_BACHD/2-373E...............................................................................
Q2BIE8_9GAMM/57-578VTIVTAVSFHSFLHLPPAAGMMFGLGYLGMYSFYLKKVEGRTIMADSIFGGRSDAHQNPLSVLQAYGKDIGEHL......
Q898H6_CLOTE/4-380EDPT............................................................................
YRAO_BACSU/5-384RHIT............................................................................
Q8FSY6_COREF/59-476FGGPGLGGGTPAGARGSGTPKPTG........................................................
CITM_BACSU/5-378P...............................................................................
Q88FZ5_PSEPK/9-557LDYKLNGRERRLRIRPQSPLIGHNLGELQLRTRHGANVIGIERQHKFTTRVIAADSGTVLHQGDVLLLDLFAKHDDLRSL
Q7PVG5_ANOGA/324-759QDVQEIRHEIAVWQRAAASLSSYSKDEDLV..................................................
Q8I930_DROME/315-750EVEELRHEIHVWKRAAASLSAYSKDEELVR..................................................
Q87EP0_XYLFT/5-388SGAWNGY.........................................................................
Q81I57_BACCR/5-381LKQ.............................................................................
Q9AV23_ORYSJ/16-429AAGKQMEAIEEGRRTALNNNKKDDG.......................................................
Q8DUC7_STRMU/6-410DKE.............................................................................
Q8NUL8_STAAW/11-402ELPQTQDIDV......................................................................
Q88L78_PSEPK/5-379GG..............................................................................
O81915_ARATH/16-450QNADSEVVAQEDVQSHRFSPATFSPVSSEDSNLRMD............................................
Q82YV5_ENTFA/6-407DKE.............................................................................
Q88IC5_PSEPK/4-409T...............................................................................
Q9HTA2_PSEAE/5-378DH..............................................................................

PF02040

O68021_PSEAI/3-423--------------------------------------------------------------------------------
ARSB_STAXY/4-426--------------------------------------------------------------------------------
ARSB2_ECOLX/3-425--------------------------------------------------------------------------------
YDFA_BACSU/6-428--------------------------------------------------------------------------------

PF02447

GNTP_BACLI/1-447SLGE----------------------------------------------------------------------------
GNTU_ECOLI/4-445DDIS----------------------------------------------------------------------------
GNUT_PSEAE/9-449EQIA----------------------------------------------------------------------------
YJHF_ECOLI/1-448SLGA----------------------------------------------------------------------------
YGBN_ECOLI/4-454EEGA----------------------------------------------------------------------------
GNTT_ECOLI/1-437GLYS----------------------------------------------------------------------------
Y1015_HAEIN/6-457YDSY----------------------------------------------------------------------------
YOJA_BACSU/1-443GLGP----------------------------------------------------------------------------
DSDX_ECOLI/6-444EFAD----------------------------------------------------------------------------
GNTP_ZYMMO/7-450ESLE----------------------------------------------------------------------------
GNTP_ECOLI/4-446.KAD----------------------------------------------------------------------------
IDNT_ECOLI/1-437.LFN----------------------------------------------------------------------------

PF00939

MEMP_CUPNH/32-513......G-------------------------------------------------------------------------
CITT_ECOLI/5-486......E-------------------------------------------------------------------------
O84207_CHLTR/4-470......E-------------------------------------------------------------------------
Q9Z8X7_CHLPN/4-470......E-------------------------------------------------------------------------
Q9ZMT7_HELPJ/2-480......E-------------------------------------------------------------------------
TTDT_ECOLI/4-487......Q-------------------------------------------------------------------------
S13A2_HUMAN/6-565MQEQQQA-------------------------------------------------------------------------
Y020_HAEIN/3-476......D-------------------------------------------------------------------------
YFLS_BACSU/12-478......D-------------------------------------------------------------------------
YBHI_ECOLI/3-474......D-------------------------------------------------------------------------
SOT1_SPIOL/101-569......D-------------------------------------------------------------------------

PF13726

Q9ZL85_HELPJ/10-97--------------------------------------------------------------------------------
A3YN61_CAMJU/6-93--------------------------------------------------------------------------------
Q73KL4_TREDE/3-90--------------------------------------------------------------------------------
C8A2Z4_STAAU/3-90--------------------------------------------------------------------------------
B9EAL6_MACCJ/2-89--------------------------------------------------------------------------------
C3F6D3_BACTU/2-89--------------------------------------------------------------------------------
E6U2C3_BACCJ/2-89--------------------------------------------------------------------------------
D6XUM8_BACIE/2-89--------------------------------------------------------------------------------
A3IGC2_9BACI/8-95--------------------------------------------------------------------------------
A7Z8B4_BACA2/2-89--------------------------------------------------------------------------------
Q2B2R2_9BACI/2-89--------------------------------------------------------------------------------
B7GKU7_ANOFW/4-91--------------------------------------------------------------------------------
Q9K7K2_BACHD/2-89--------------------------------------------------------------------------------
Q5WDV8_BACSK/2-89--------------------------------------------------------------------------------
C4L1E0_EXISA/2-89--------------------------------------------------------------------------------
B1YEV1_EXIS2/3-90--------------------------------------------------------------------------------
A4Y5U0_SHEPC/2-89--------------------------------------------------------------------------------
Q084K9_SHEFN/4-91--------------------------------------------------------------------------------
A1F5K2_VIBCL/2-89--------------------------------------------------------------------------------
D0YVL6_LISDA/2-89--------------------------------------------------------------------------------
Q1ZN28_PHOAS/2-89--------------------------------------------------------------------------------
B5FCM4_VIBFM/2-89--------------------------------------------------------------------------------
D1B1X3_SULD5/2-89--------------------------------------------------------------------------------
A6FIU9_9GAMM/2-89--------------------------------------------------------------------------------
A4SNQ6_AERS4/2-89--------------------------------------------------------------------------------
Q65UQ2_MANSM/4-91--------------------------------------------------------------------------------
C5BE39_EDWI9/2-89--------------------------------------------------------------------------------
A1TWP4_MARAV/2-89--------------------------------------------------------------------------------
A4XTU4_PSEMY/2-89--------------------------------------------------------------------------------
Q02NE5_PSEAB/2-89--------------------------------------------------------------------------------
Q2BHM1_9GAMM/2-89--------------------------------------------------------------------------------
C0W230_9ACTO/19-106--------------------------------------------------------------------------------
C0WF19_9CORY/2-89--------------------------------------------------------------------------------
D0WS18_9ACTO/27-114--------------------------------------------------------------------------------
C0E4G0_9CORY/2-89--------------------------------------------------------------------------------
D1DEI3_NEIGO/2-101--------------------------------------------------------------------------------
D4DM42_NEIEG/10-109--------------------------------------------------------------------------------
Q1Q9H8_PSYCK/4-91--------------------------------------------------------------------------------
D0BZZ4_9GAMM/2-89--------------------------------------------------------------------------------
C0VHK3_9GAMM/2-89--------------------------------------------------------------------------------
Q1QX04_CHRSD/2-89--------------------------------------------------------------------------------
A4SIT2_AERS4/144-241--------------------------------------------------------------------------------

PF06450

NHAB_HAEIN/1-513DLDRTNS-------------------------------------------------------------------------
NHAB_SHEON/1-520DYDAHED-------------------------------------------------------------------------
A6B3E7_VIBPA/1-515DFDREER-------------------------------------------------------------------------
NHAB_ECOLI/1-512QFDDQSR-------------------------------------------------------------------------

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------------------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------------------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------------------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------------------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------------------

PF03553

O51582_BORBU/170-435--------------------------------------------------------------------------------
NHAC_BACPE/157-449--------------------------------------------------------------------------------
Q9KQG1_VIBCH/161-453--------------------------------------------------------------------------------
Q9K7B7_BACHD/160-482--------------------------------------------------------------------------------
O25453_HELPY/149-430--------------------------------------------------------------------------------
Q9ZKQ5_HELPJ/165-464--------------------------------------------------------------------------------
Q9KBE2_BACHD/142-433--------------------------------------------------------------------------------
Q9AFA3_VIBHA/1-333--------------------------------------------------------------------------------
Q9HS26_HALSA/183-491--------------------------------------------------------------------------------
Q99VD8_STAAM/151-432--------------------------------------------------------------------------------
YUIF_BACSU/150-436--------------------------------------------------------------------------------
NHAC_BACSU/159-453--------------------------------------------------------------------------------
O59530_PYRHO/156-486--------------------------------------------------------------------------------
Q9K5Y9_BACHD/160-453--------------------------------------------------------------------------------
Q97L22_CLOAB/149-436--------------------------------------------------------------------------------
Q99RU7_STAAM/184-446--------------------------------------------------------------------------------
Q9Y8U6_AERPE/161-510--------------------------------------------------------------------------------
ARCD_HALSA/171-466--------------------------------------------------------------------------------
O51583_BORBU/175-441--------------------------------------------------------------------------------
Q97TG1_CLOAB/150-462--------------------------------------------------------------------------------
Q9K7K2_BACHD/150-434--------------------------------------------------------------------------------
Q9KSX5_VIBCH/165-497--------------------------------------------------------------------------------
Y325_HAEIN/152-444--------------------------------------------------------------------------------
Q9KT98_VIBCH/150-435--------------------------------------------------------------------------------
Q9KMV5_VIBCH/168-494--------------------------------------------------------------------------------
MLEN_BACSU/159-452--------------------------------------------------------------------------------
Q9AGE2_YERPS/159-463--------------------------------------------------------------------------------
Q9JXG2_NEIMB/166-456--------------------------------------------------------------------------------
Q9KMX3_VIBCH/172-442--------------------------------------------------------------------------------
Q9K0Q3_NEIMB/165-476--------------------------------------------------------------------------------
Q9HNR2_HALSA/161-489--------------------------------------------------------------------------------
Q9CMF8_PASMU/165-482--------------------------------------------------------------------------------
Q99RX2_STAAM/158-455--------------------------------------------------------------------------------
Y1586_HAEIN/177-494--------------------------------------------------------------------------------
Y1107_HAEIN/162-461--------------------------------------------------------------------------------
Q9HNF6_HALSA/156-488--------------------------------------------------------------------------------
Q9HNF7_HALSA/171-467--------------------------------------------------------------------------------
Q9I0I5_PSEAE/151-435--------------------------------------------------------------------------------

PF03605

Q9ZEN8_WOLSU/6-382--------------------------------------------------------------------------------
DCUB_SHIFL/6-376--------------------------------------------------------------------------------
Q9CJS4_PASMU/5-375--------------------------------------------------------------------------------
DCUA_WOLSU/5-365--------------------------------------------------------------------------------
Q9KNN2_VIBCH/21-383--------------------------------------------------------------------------------
DCUB_HAEIN/8-372--------------------------------------------------------------------------------
Q9KMW3_VIBCH/5-373--------------------------------------------------------------------------------
DCUA_SHIFL/5-365--------------------------------------------------------------------------------
Q97DH7_CLOAB/5-371--------------------------------------------------------------------------------
DCUA_HELPJ/7-369--------------------------------------------------------------------------------

PF04165

O29978_ARCFU/17-405--------------------------------------------------------------------------------
O57766_PYRHO/2-394--------------------------------------------------------------------------------
Q9V2R1_PYRAB/3-395--------------------------------------------------------------------------------
Q9WYV1_THEMA/3-381--------------------------------------------------------------------------------

PF02652

LCTP_BACSU/14-536KAY....-------------------------------------------------------------------------
LUTP_BACSU/16-554IETARTN-------------------------------------------------------------------------
LLDP_ECOLI/16-542MTLAH..-------------------------------------------------------------------------
Q9ZMU0_HELPJ/15-536EKH....-------------------------------------------------------------------------
Y1218_HAEIN/2-525SAG....-------------------------------------------------------------------------
O51549_BORBU/4-500ISL....-------------------------------------------------------------------------
Q9ZMT9_HELPJ/16-539TNH....-------------------------------------------------------------------------
O29452_ARCFU/1-535SERI...-------------------------------------------------------------------------

PF07854

Q9YFW4_AERPE/15-368--------------------------------------------------------------------------------
Q8PXG5_METMA/8-368--------------------------------------------------------------------------------
Q8RCZ3_THETN/45-391--------------------------------------------------------------------------------
Q8R782_THETN/2-340--------------------------------------------------------------------------------
Q8ZUI4_PYRAE/6-347--------------------------------------------------------------------------------
O29471_ARCFU/14-358--------------------------------------------------------------------------------

PF07399

Q9Z6V2_CHLPN/1-438--------------------------------------------------------------------------------
Q9F206_9BURK/1-428--------------------------------------------------------------------------------
Q87F98_XYLFT/1-420--------------------------------------------------------------------------------
O84811_CHLTR/1-438--------------------------------------------------------------------------------

PF03806

ABGT_ECOLI/14-507--------------------------------------------------------------------------------
Q9KEI6_BACHD/19-511--------------------------------------------------------------------------------
Q9KC22_BACHD/13-510--------------------------------------------------------------------------------
Q9A7U5_CAUCR/48-548--------------------------------------------------------------------------------
Q99RG0_STAAM/14-511--------------------------------------------------------------------------------
Q9AA61_CAUCR/39-553--------------------------------------------------------------------------------
Q9KTN8_VIBCH/19-517--------------------------------------------------------------------------------
Q9KTM2_VIBCH/25-532--------------------------------------------------------------------------------
Q9RNX1_NEIGO/11-519--------------------------------------------------------------------------------

PF03606

O51783_BORBU/4-471--------------------------------------------------------------------------------
Y594_HAEIN/12-505--------------------------------------------------------------------------------
Q9CP35_PASMU/1-448--------------------------------------------------------------------------------
Q97NA1_STRPN/11-499--------------------------------------------------------------------------------
DCUC_SHIFL/5-452--------------------------------------------------------------------------------
Q99YT7_STRP1/11-496--------------------------------------------------------------------------------
YFCC_ECOLI/15-502--------------------------------------------------------------------------------
Q9AAL9_CAUCR/33-506--------------------------------------------------------------------------------
Q9CMA1_PASMU/2-462--------------------------------------------------------------------------------
Q9KAH9_BACHD/20-464--------------------------------------------------------------------------------
Q99UT9_STAAM/18-515--------------------------------------------------------------------------------
DCUC_VIBCH/6-456--------------------------------------------------------------------------------
DCUD_ECOLI/2-455--------------------------------------------------------------------------------

PF06808

Q9Y8U1_AERPE/115-551--------------------------------------------------------------------------------
Q9K7H0_BACHD/6-417--------------------------------------------------------------------------------
Q8NN88_CORGL/3-439--------------------------------------------------------------------------------
Q8FA80_ECOL6/7-418--------------------------------------------------------------------------------
Q9CKH6_PASMU/7-420--------------------------------------------------------------------------------
O07838_RHOCA/7-430--------------------------------------------------------------------------------
Q92K76_RHIME/14-514--------------------------------------------------------------------------------
O29619_ARCFU/128-601--------------------------------------------------------------------------------
Q8G0A8_BRUSU/148-607--------------------------------------------------------------------------------
Q8FRN3_COREF/157-598--------------------------------------------------------------------------------
Q92PP2_RHIME/208-617--------------------------------------------------------------------------------
Q8ZKS0_SALTY/12-424--------------------------------------------------------------------------------
Q8ZL80_SALTY/7-416--------------------------------------------------------------------------------
Q92PN6_RHIME/6-416--------------------------------------------------------------------------------
Q92WB7_RHIME/5-456--------------------------------------------------------------------------------
Q89FZ8_BRAJA/199-609--------------------------------------------------------------------------------
Q89NA6_BRAJA/151-593--------------------------------------------------------------------------------
Q89CF6_BRAJA/11-428--------------------------------------------------------------------------------

PF02667

Q9ZLE5_HELPJ/3-453--------------------------------------------------------------------------------
O28734_ARCFU/8-484--------------------------------------------------------------------------------
ATOE_ECOLI/1-440--------------------------------------------------------------------------------
ATOE_HAEIN/1-447--------------------------------------------------------------------------------

PF03600

Q10RS7_ORYSJ/16-503....................................EADIQLAIKSLRASSMSHEMVEVSTVTDRRDEGASSRKFTRTAS
ARSB_DICDI/51-511................................................DGFNENKNNNNNGGHAILLVASSMDSIDLSDC
CITN_BACSU/5-373................................................................................
Q828S1_STRAW/5-417............................................................................PRAT
Q897M4_CLOTE/5-411................................................................................
Q8T0L2_DROME/151-567..............................................................................LL
Q9VU30_DROME/220-638.............................................................................EMR
Q9W024_DROME/212-628...............................................................................E
Q81E21_BACCR/4-425................................................................................
Q8EMV3_OCEIH/7-393................................................................................
Q8XWF6_RALSO/4-412................................................................................
Q88BF5_PSESM/5-378................................................................................
Q8I929_DROME/216-650....................................................................RGTLQAKIKQLK
Q9K635_BACHD/2-373................................................................................
Q2BIE8_9GAMM/57-578.......................NDQPYPAFMIDKEKSVTHWNTALEELTGIKAEEVIGTKDHWKGFYKDQRPTLADAVL
Q898H6_CLOTE/4-380................................................................................
YRAO_BACSU/5-384................................................................................
Q8FSY6_COREF/59-476..........................................................................PTGGVL
CITM_BACSU/5-378................................................................................
Q88FZ5_PSEPK/9-557CQTMHLEPLHFKAAYFIDQSQDLGMAEVSLPPGSQLIGKSILELAFRTRYGLNVVGLRRDQAAIEEQLVEEKLRLGDTLL
Q7PVG5_ANOGA/324-759...................................................................RETLLKKVNRLSR
Q8I930_DROME/315-750....................................................................QTLMKKVNRLKR
Q87EP0_XYLFT/5-388................................................................................
Q81I57_BACCR/5-381................................................................................
Q9AV23_ORYSJ/16-429.........................................................................DAATPAS
Q8DUC7_STRMU/6-410................................................................................
Q8NUL8_STAAW/11-402................................................................................
Q88L78_PSEPK/5-379................................................................................
O81915_ARATH/16-450.............................................................AAETLRNRAGSAGESELIS
Q82YV5_ENTFA/6-407................................................................................
Q88IC5_PSEPK/4-409................................................................................
Q9HTA2_PSEAE/5-378................................................................................

PF02040

O68021_PSEAI/3-423--------------------------------------------------------------------------------
ARSB_STAXY/4-426--------------------------------------------------------------------------------
ARSB2_ECOLX/3-425--------------------------------------------------------------------------------
YDFA_BACSU/6-428--------------------------------------------------------------------------------

PF02447

GNTP_BACLI/1-447--------------------------------------------------------------------------------
GNTU_ECOLI/4-445--------------------------------------------------------------------------------
GNUT_PSEAE/9-449--------------------------------------------------------------------------------
YJHF_ECOLI/1-448--------------------------------------------------------------------------------
YGBN_ECOLI/4-454--------------------------------------------------------------------------------
GNTT_ECOLI/1-437--------------------------------------------------------------------------------
Y1015_HAEIN/6-457--------------------------------------------------------------------------------
YOJA_BACSU/1-443--------------------------------------------------------------------------------
DSDX_ECOLI/6-444--------------------------------------------------------------------------------
GNTP_ZYMMO/7-450--------------------------------------------------------------------------------
GNTP_ECOLI/4-446--------------------------------------------------------------------------------
IDNT_ECOLI/1-437--------------------------------------------------------------------------------

PF00939

MEMP_CUPNH/32-513--------------------------------------------------------------------------------
CITT_ECOLI/5-486--------------------------------------------------------------------------------
O84207_CHLTR/4-470--------------------------------------------------------------------------------
Q9Z8X7_CHLPN/4-470--------------------------------------------------------------------------------
Q9ZMT7_HELPJ/2-480--------------------------------------------------------------------------------
TTDT_ECOLI/4-487--------------------------------------------------------------------------------
S13A2_HUMAN/6-565--------------------------------------------------------------------------------
Y020_HAEIN/3-476--------------------------------------------------------------------------------
YFLS_BACSU/12-478--------------------------------------------------------------------------------
YBHI_ECOLI/3-474--------------------------------------------------------------------------------
SOT1_SPIOL/101-569--------------------------------------------------------------------------------

PF13726

Q9ZL85_HELPJ/10-97--------------------------------------------------------------------------------
A3YN61_CAMJU/6-93--------------------------------------------------------------------------------
Q73KL4_TREDE/3-90--------------------------------------------------------------------------------
C8A2Z4_STAAU/3-90--------------------------------------------------------------------------------
B9EAL6_MACCJ/2-89--------------------------------------------------------------------------------
C3F6D3_BACTU/2-89--------------------------------------------------------------------------------
E6U2C3_BACCJ/2-89--------------------------------------------------------------------------------
D6XUM8_BACIE/2-89--------------------------------------------------------------------------------
A3IGC2_9BACI/8-95--------------------------------------------------------------------------------
A7Z8B4_BACA2/2-89--------------------------------------------------------------------------------
Q2B2R2_9BACI/2-89--------------------------------------------------------------------------------
B7GKU7_ANOFW/4-91--------------------------------------------------------------------------------
Q9K7K2_BACHD/2-89--------------------------------------------------------------------------------
Q5WDV8_BACSK/2-89--------------------------------------------------------------------------------
C4L1E0_EXISA/2-89--------------------------------------------------------------------------------
B1YEV1_EXIS2/3-90--------------------------------------------------------------------------------
A4Y5U0_SHEPC/2-89--------------------------------------------------------------------------------
Q084K9_SHEFN/4-91--------------------------------------------------------------------------------
A1F5K2_VIBCL/2-89--------------------------------------------------------------------------------
D0YVL6_LISDA/2-89--------------------------------------------------------------------------------
Q1ZN28_PHOAS/2-89--------------------------------------------------------------------------------
B5FCM4_VIBFM/2-89--------------------------------------------------------------------------------
D1B1X3_SULD5/2-89--------------------------------------------------------------------------------
A6FIU9_9GAMM/2-89--------------------------------------------------------------------------------
A4SNQ6_AERS4/2-89--------------------------------------------------------------------------------
Q65UQ2_MANSM/4-91--------------------------------------------------------------------------------
C5BE39_EDWI9/2-89--------------------------------------------------------------------------------
A1TWP4_MARAV/2-89--------------------------------------------------------------------------------
A4XTU4_PSEMY/2-89--------------------------------------------------------------------------------
Q02NE5_PSEAB/2-89--------------------------------------------------------------------------------
Q2BHM1_9GAMM/2-89--------------------------------------------------------------------------------
C0W230_9ACTO/19-106--------------------------------------------------------------------------------
C0WF19_9CORY/2-89--------------------------------------------------------------------------------
D0WS18_9ACTO/27-114--------------------------------------------------------------------------------
C0E4G0_9CORY/2-89--------------------------------------------------------------------------------
D1DEI3_NEIGO/2-101--------------------------------------------------------------------------------
D4DM42_NEIEG/10-109--------------------------------------------------------------------------------
Q1Q9H8_PSYCK/4-91--------------------------------------------------------------------------------
D0BZZ4_9GAMM/2-89--------------------------------------------------------------------------------
C0VHK3_9GAMM/2-89--------------------------------------------------------------------------------
Q1QX04_CHRSD/2-89--------------------------------------------------------------------------------
A4SIT2_AERS4/144-241--------------------------------------------------------------------------------

PF06450

NHAB_HAEIN/1-513--------------------------------------------------------------------------------
NHAB_SHEON/1-520--------------------------------------------------------------------------------
A6B3E7_VIBPA/1-515--------------------------------------------------------------------------------
NHAB_ECOLI/1-512--------------------------------------------------------------------------------

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------------------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------------------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------------------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------------------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------------------

PF03553

O51582_BORBU/170-435--------------------------------------------------------------------------------
NHAC_BACPE/157-449--------------------------------------------------------------------------------
Q9KQG1_VIBCH/161-453--------------------------------------------------------------------------------
Q9K7B7_BACHD/160-482--------------------------------------------------------------------------------
O25453_HELPY/149-430--------------------------------------------------------------------------------
Q9ZKQ5_HELPJ/165-464--------------------------------------------------------------------------------
Q9KBE2_BACHD/142-433--------------------------------------------------------------------------------
Q9AFA3_VIBHA/1-333--------------------------------------------------------------------------------
Q9HS26_HALSA/183-491--------------------------------------------------------------------------------
Q99VD8_STAAM/151-432--------------------------------------------------------------------------------
YUIF_BACSU/150-436--------------------------------------------------------------------------------
NHAC_BACSU/159-453--------------------------------------------------------------------------------
O59530_PYRHO/156-486--------------------------------------------------------------------------------
Q9K5Y9_BACHD/160-453--------------------------------------------------------------------------------
Q97L22_CLOAB/149-436--------------------------------------------------------------------------------
Q99RU7_STAAM/184-446--------------------------------------------------------------------------------
Q9Y8U6_AERPE/161-510--------------------------------------------------------------------------------
ARCD_HALSA/171-466--------------------------------------------------------------------------------
O51583_BORBU/175-441--------------------------------------------------------------------------------
Q97TG1_CLOAB/150-462--------------------------------------------------------------------------------
Q9K7K2_BACHD/150-434--------------------------------------------------------------------------------
Q9KSX5_VIBCH/165-497--------------------------------------------------------------------------------
Y325_HAEIN/152-444--------------------------------------------------------------------------------
Q9KT98_VIBCH/150-435--------------------------------------------------------------------------------
Q9KMV5_VIBCH/168-494--------------------------------------------------------------------------------
MLEN_BACSU/159-452--------------------------------------------------------------------------------
Q9AGE2_YERPS/159-463--------------------------------------------------------------------------------
Q9JXG2_NEIMB/166-456--------------------------------------------------------------------------------
Q9KMX3_VIBCH/172-442--------------------------------------------------------------------------------
Q9K0Q3_NEIMB/165-476--------------------------------------------------------------------------------
Q9HNR2_HALSA/161-489--------------------------------------------------------------------------------
Q9CMF8_PASMU/165-482--------------------------------------------------------------------------------
Q99RX2_STAAM/158-455--------------------------------------------------------------------------------
Y1586_HAEIN/177-494--------------------------------------------------------------------------------
Y1107_HAEIN/162-461--------------------------------------------------------------------------------
Q9HNF6_HALSA/156-488--------------------------------------------------------------------------------
Q9HNF7_HALSA/171-467--------------------------------------------------------------------------------
Q9I0I5_PSEAE/151-435--------------------------------------------------------------------------------

PF03605

Q9ZEN8_WOLSU/6-382--------------------------------------------------------------------------------
DCUB_SHIFL/6-376--------------------------------------------------------------------------------
Q9CJS4_PASMU/5-375--------------------------------------------------------------------------------
DCUA_WOLSU/5-365--------------------------------------------------------------------------------
Q9KNN2_VIBCH/21-383--------------------------------------------------------------------------------
DCUB_HAEIN/8-372--------------------------------------------------------------------------------
Q9KMW3_VIBCH/5-373--------------------------------------------------------------------------------
DCUA_SHIFL/5-365--------------------------------------------------------------------------------
Q97DH7_CLOAB/5-371--------------------------------------------------------------------------------
DCUA_HELPJ/7-369--------------------------------------------------------------------------------

PF04165

O29978_ARCFU/17-405--------------------------------------------------------------------------------
O57766_PYRHO/2-394--------------------------------------------------------------------------------
Q9V2R1_PYRAB/3-395--------------------------------------------------------------------------------
Q9WYV1_THEMA/3-381--------------------------------------------------------------------------------

PF02652

LCTP_BACSU/14-536--------------------------------------------------------------------------------
LUTP_BACSU/16-554--------------------------------------------------------------------------------
LLDP_ECOLI/16-542--------------------------------------------------------------------------------
Q9ZMU0_HELPJ/15-536--------------------------------------------------------------------------------
Y1218_HAEIN/2-525--------------------------------------------------------------------------------
O51549_BORBU/4-500--------------------------------------------------------------------------------
Q9ZMT9_HELPJ/16-539--------------------------------------------------------------------------------
O29452_ARCFU/1-535--------------------------------------------------------------------------------

PF07854

Q9YFW4_AERPE/15-368--------------YEESINE......ILL--------RG-------------------------------------FRV
Q8PXG5_METMA/8-368--------------YNETVKD......VVM--------RA-------------------------------------VKV
Q8RCZ3_THETN/45-391--------------EAEEIKKIERFQFIFI--------QA-------------------------------------FKI
Q8R782_THETN/2-340--------------ADENIRE......VFI--------RA-------------------------------------FKV
Q8ZUI4_PYRAE/6-347--------------YEPELKE......VIT--------RA-------------------------------------VKI
O29471_ARCFU/14-358--------------YTETLRT......VVI--------RA-------------------------------------VRV

PF07399

Q9Z6V2_CHLPN/1-438--------------SVEKVPWWIICVNIIF.VGSIILSRS-------------------------------------TPL
Q9F206_9BURK/1-428--------------GGGRVPASIIAVQLMFLVGVVVFAHH-------------------------------------PAV
Q87F98_XYLFT/1-420--------------AGEAVPVILRVIHLLLLIGIVWFAHY-------------------------------------PVV
O84811_CHLTR/1-438--------------MNDRLPSWIIFIHVVL.VGCVILSRA-------------------------------------IPL

PF03806

ABGT_ECOLI/14-507--------------SDEKLQT....LTESQRFGLRIAGVV-------------------------------------SLL
Q9KEI6_BACHD/19-511--------------..EVEEITG..VTKEEKKGLRWAGIS-------------------------------------VVI
Q9KC22_BACHD/13-510--------------KQSIDY.....LKPEEKKGLMWASIS-------------------------------------FII
Q9A7U5_CAUCR/48-548--------------AAAAPDLALDEIGEAQKKGLRRAGVA-------------------------------------ALV
Q99RG0_STAAM/14-511--------------HDDHEEASSH.ITDKEAHALKWANIS-------------------------------------FIV
Q9AA61_CAUCR/39-553--------------DALKAELAKSAVTADEKRGLKFAGLA-------------------------------------ALA
Q9KTN8_VIBCH/19-517--------------AESAPDLGS..FTAIESKAFRYAGWA-------------------------------------MVA
Q9KTM2_VIBCH/25-532--------------SDDLSQDKMGSLTALEKKALAYAGLA-------------------------------------VVV
Q9RNX1_NEIGO/11-519--------------QEEKDIRHSNEITPLEYKGLIWAGVV-------------------------------------FVA

PF03606

O51783_BORBU/4-471--------------KDEHYQYFVKKDGLSTGD...NAQNA-------------------------------------LEF
Y594_HAEIN/12-505--------------REEFRQRYMKNFDPNTTIPFSARRKL-------------------------------------ILT
Q9CP35_PASMU/1-448--------------..EGHRAEMLAVSEIQTS....APRF-------------------------------------YAI
Q97NA1_STRPN/11-499--------------RKEDLKHFNVEESSSVESTLSSKQKS-------------------------------------VLF
DCUC_SHIFL/5-452--------------..EHISHEMLDVSEITTT....APAF-------------------------------------YAI
Q99YT7_STRP1/11-496--------------EEEHKELFQLQNSG..ED.LNKRQRN-------------------------------------VLT
YFCC_ECOLI/15-502--------------VHESDRFFREKQADVEQRPFTFGDWL-------------------------------------VLI
Q9AAL9_CAUCR/33-506--------------AFQSDARWRDTASVVDSTAFRKGDLV-------------------------------------VLA
Q9CMA1_PASMU/2-462--------------YDASLEVNLDKQDKQASP....VPAV-------------------------------------YVL
Q9KAH9_BACHD/20-464--------------QMEYKELVSDEKEKTYEIG..SRGKV-------------------------------------AGF
Q99UT9_STAAM/18-515--------------KDAFEQQWSVLKDDDSAH.FTLRKKI-------------------------------------ILT
DCUC_VIBCH/6-456--------------..DNTPMEKVDLSEMEVK....SPAY-------------------------------------YAV
DCUD_ECOLI/2-455--------------.DKNINHEQAEQKALDNV....PPLY-------------------------------------YAI

PF06808

Q9Y8U1_AERPE/115-551--------------...GTAALNIGYGRLEVYKA.....T.....................................SLM
Q9K7H0_BACHD/6-417--------------...AERFSWAARGRATAKAL.....L.....................................PLG
Q8NN88_CORGL/3-439--------------...TPDDQRVSFGEAMKTGW.....R.....................................SPL
Q8FA80_ECOL6/7-418--------------..RESWPTGKEVVFSLGQAW.....P.....................................ALF
Q9CKH6_PASMU/7-420--------------..HSVEFSLKEVKESAKDAV.....W.....................................ALL
O07838_RHOCA/7-430--------------...LEKASLRQRWTAFREAA.....W.....................................GLM
Q92K76_RHIME/14-514--------------RTLKINALSRLAQQVIIVLI.....P.....................................PLA
O29619_ARCFU/128-601--------------...LSREELPSPLQVLKGGW...........................................YYL
Q8G0A8_BRUSU/148-607--------------...MTKEEMPDLKEALKRDW...........................................PTI
Q8FRN3_COREF/157-598--------------...EDRKLLPRVSQALRDGW...........................................PYV
Q92PP2_RHIME/208-617--------------...VVRPSLKRIGGTALIAA.....P.....................................ALV
Q8ZKS0_SALTY/12-424--------------...FFTVQKGMALKVAVEAI.....P.....................................SLL
Q8ZL80_SALTY/7-416--------------...QPKATPREIWQSLVSGI.....W.....................................ALF
Q92PN6_RHIME/6-416--------------..LTDAGQLKSFGRSMLSAL.....P.....................................ALA
Q92WB7_RHIME/5-456--------------...DTPFEMKRLLAASLEVVVVLAVPLFIYLLMAAGLSMNLAVGIALVVLLALDWYFDFSAVMALM
Q89FZ8_BRAJA/199-609--------------...RPAEAEDVAPQMPVSGLWSGAIA.....................................SFG
Q89NA6_BRAJA/151-593--------------...IPRAELPRIMDTIKDGW...........................................YYV
Q89CF6_BRAJA/11-428--------------...KGKVLPWRERFAGLKEI.....W.....................................APV

PF02667

Q9ZLE5_HELPJ/3-453--------------KDEYKETELISHQQDKTIAHFLENSA-------------------------------------LLS
O28734_ARCFU/8-484--------------KKEKEEELKEKSKERVTIADKLENSK-------------------------------------VLA
ATOE_ECOLI/1-440--------------MEEADFQKQLP..KDAPPSERLEESR-------------------------------------ILT
ATOE_HAEIN/1-447--------------APDPTFDKKLD..KDATLAEKMEESR-------------------------------------FLA

PF03600

Q10RS7_ORYSJ/16-503QQRSVIIEDSPPSPASNGDKEKEDEVAEKRWRVFVWKTAV-------------------------------------YLI
ARSB_DICDI/51-511SIINKDKKKKENFIEIYFNSKEKSIETIVNIIKLIFKFRV-------------------------------------AII
CITN_BACSU/5-373..................HAPSSDPEAAPLKRPALQWFNL-------------------------------------LLT
Q828S1_STRAW/5-417GGSGSGTDADAPESATADDGFQGLDPHRATLRPKLYWFNA-------------------------------------LLT
Q897M4_CLOTE/5-411................HSAGIVEGFKEEDLPPFISSILPI-------------------------------------ILV
Q8T0L2_DROME/151-567KGSLPGKYWLRPVEGYPETLAELEASSRILDKPLLVRCCI-------------------------------------ALI
Q9VU30_DROME/220-638IRQPTGRQLLKPAENYFQTLAHLEAHHRIRDKTLLIKCLF-------------------------------------TLC
Q9W024_DROME/212-628LRRQPRSKVIPPAESYFITLATLEASNFVRKKVLLVESLL-------------------------------------ALS
Q81E21_BACCR/4-425.........AASLQVEQKNMPLTNNIEITRAQQLITFIPL-------------------------------------ILV
Q8EMV3_OCEIH/7-393..........AASMEANAIKQESDPQKEDLPNIIISSIPL-------------------------------------VLV
Q8XWF6_RALSO/4-412...............ARLVNEPDTVAGGKLAHPLVALLPL-------------------------------------VLV
Q88BF5_PSESM/5-378................VDHSEISVSQFPDARRPKLIWFNG-------------------------------------ALT
Q8I929_DROME/216-650RTLRRLQKGVGSTEVYTNTLDELKQKYPIKNKTLLLQSAG-------------------------------------ALL
Q9K635_BACHD/2-373.................PKNGEKEEEGEKVPNPWLSFLPL-------------------------------------VSV
Q2BIE8_9GAMM/57-578EDESGAGVRQHYQNKYRDNPMGGKSYDAASYFDNIGSSGA-------------------------------------YLM
Q898H6_CLOTE/4-380.............IIPYIDDKNISKNNKDLPNPIMSAIPA-------------------------------------ILI
YRAO_BACSU/5-384.............KDSSQSYMAATLESEQLKRPRLIYLNL-------------------------------------FLV
Q8FSY6_COREF/59-476VKERTEQIDLDEPTLSENLTDTLLDPHRATLRPRLFWFNA-------------------------------------LLT
CITM_BACSU/5-378................ANANEPAAAVEDEWKRPKLWWFNL-------------------------------------LLT
Q88FZ5_PSEPK/9-557VVGPWKAVRQLQSKPKDFLVLSLPAEIDLVAPARTRAPQA-------------------------------------LLS
Q7PVG5_ANOGA/324-759SLKKKLVTGSVPAESYKATLEEMKRKYPIRSKTLLVKSAI-------------------------------------TLA
Q8I930_DROME/315-750SLKKRMTAVIEPAPNYQQTLANLQAKYPIRNKPLLIKCSA-------------------------------------ALV
Q87EP0_XYLFT/5-388...........AMHDDEDALPTMEGDAEDIKRPKLLWVNF-------------------------------------ALT
Q81I57_BACCR/5-381..............MQTMDEQAATVEAAVHKRPKLLWINF-------------------------------------LLT
Q9AV23_ORYSJ/16-429PEDDDGGDAESMMSENISTKHRWFMQCSEHRRKLFLKSFA-------------------------------------YVV
Q8DUC7_STRMU/6-410...............ITELITVNDPDTLKIRRPQNFWFNG-------------------------------------ILT
Q8NUL8_STAAW/11-402........HKLVEVYERDQDVRFPVKGRARTKSWIKWVNT-------------------------------------ALT
Q88L78_PSEPK/5-379................GNCYIKEILGDNPHKRPRLAYVNL-------------------------------------VLV
O81915_ARATH/16-450CNSNASREQHNDAESQGESNNTNNMFQTKRWRRVLWKSSV-------------------------------------YFI
Q82YV5_ENTFA/6-407...............LEEMTIVNDPELLEIRRPKNFAFNG-------------------------------------ILT
Q88IC5_PSEPK/4-409................DLRNEPETAADLSLPNPWLALSPL-------------------------------------ILV
Q9HTA2_PSEAE/5-378................EDLAEISVSQYPEARRPKLLWFNA-------------------------------------ILT

PF02040

O68021_PSEAI/3-423--------------PPVYALEQLKPPRAAIRDRATFVVGG-------------------------------------WML
ARSB_STAXY/4-426--------------PKTFNTENLSDPKNVIKDPKLFKLSW-------------------------------------IVL
ARSB2_ECOLX/3-425--------------PPTYDLALLKAPAKAIKDLATFRTGW-------------------------------------IVL
YDFA_BACSU/6-428--------------PKRYDLTEVKKPVEAIKDQNMFRLSW-------------------------------------YIL

PF02447

GNTP_BACLI/1-447--------------QKTFKLEETPGFGISVFTAMLPVIIM-------------------------------------SIS
GNTU_ECOLI/4-445--------------EPHLGEGKMPSFGFSLSLILLPLVLV-------------------------------------GLK
GNUT_PSEAE/9-449--------------HEP.ETQDLPSFGVTLATVLLPVFLM-------------------------------------LLK
YJHF_ECOLI/1-448--------------TRRFSESEMPGFGISFLTAMLPVILM-------------------------------------AVV
YGBN_ECOLI/4-454--------------TKLSDKINPPGVALVTSLIVIPIAII-------------------------------------MAG
GNTT_ECOLI/1-437--------------AKTFSEEEMPSFGVSVWTSLVPVVLM-------------------------------------AMR
Y1015_HAEIN/6-457--------------IESREKKELPSLGLSLLPIVLPIVLI-------------------------------------FIK
YOJA_BACSU/1-443--------------RKEFQLDETPGFAISAVTSLFPVIFM-------------------------------------AMA
DSDX_ECOLI/6-444--------------LKVRDEKTLPSLGATLFTILLPIALM-------------------------------------LVK
GNTP_ZYMMO/7-450--------------GSSDQDKNLPGFWLTIFSILLPVLLM-------------------------------------VFS
GNTP_ECOLI/4-446--------------QPV.DMNNLPSFGVSILVPLIPAIIM-------------------------------------IST
IDNT_ECOLI/1-437--------------PHLFSEEEMPSFWNSIFAAVIPVILM-------------------------------------AIA

PF00939

MEMP_CUPNH/32-513--------------GKEAVQRELSALGPMSAPQKRLAAVS-------------------------------------LGL
CITT_ECOLI/5-486--------------VATWAGDELKTMGALTRREWTLIGLV-------------------------------------LLS
O84207_CHLTR/4-470--------------AVATAKTRLKEMGPLNQGERIILLIF-------------------------------------SLL
Q9Z8X7_CHLPN/4-470--------------AIRSAKLRLKEMGPLKKEEKTILMIF-------------------------------------FLL
Q9ZMT7_HELPJ/2-480--------------VSLWAKKELESMGRFSLKEILMLSLT-------------------------------------LLA
TTDT_ECOLI/4-487--------------VPRWAETELQAMGPLCSREKRMLGLM-------------------------------------VGA
S13A2_HUMAN/6-565--------------AYCVIQTEHRLLGPMTFAEKAISILF-------------------------------------VIL
Y020_HAEIN/3-476--------------NKAIAKKGLEELGPMSFREKALSVLF-------------------------------------VIA
YFLS_BACSU/12-478--------------AAKIATEKLKEMGPFKKSELSMVIVF-------------------------------------LLV
YBHI_ECOLI/3-474--------------NKTIAKAGLAELGPMKIREKMLLGVF-------------------------------------VLA
SOT1_SPIOL/101-569--------------APRLAKEKLDKMGPMTKNESIMAVTL-------------------------------------LLT

PF13726

Q9ZL85_HELPJ/10-97--------------------------------------------------------------------------------
A3YN61_CAMJU/6-93--------------------------------------------------------------------------------
Q73KL4_TREDE/3-90--------------------------------------------------------------------------------
C8A2Z4_STAAU/3-90--------------------------------------------------------------------------------
B9EAL6_MACCJ/2-89--------------------------------------------------------------------------------
C3F6D3_BACTU/2-89--------------------------------------------------------------------------------
E6U2C3_BACCJ/2-89--------------------------------------------------------------------------------
D6XUM8_BACIE/2-89--------------------------------------------------------------------------------
A3IGC2_9BACI/8-95--------------------------------------------------------------------------------
A7Z8B4_BACA2/2-89--------------------------------------------------------------------------------
Q2B2R2_9BACI/2-89--------------------------------------------------------------------------------
B7GKU7_ANOFW/4-91--------------------------------------------------------------------------------
Q9K7K2_BACHD/2-89--------------------------------------------------------------------------------
Q5WDV8_BACSK/2-89--------------------------------------------------------------------------------
C4L1E0_EXISA/2-89--------------------------------------------------------------------------------
B1YEV1_EXIS2/3-90--------------------------------------------------------------------------------
A4Y5U0_SHEPC/2-89--------------------------------------------------------------------------------
Q084K9_SHEFN/4-91--------------------------------------------------------------------------------
A1F5K2_VIBCL/2-89--------------------------------------------------------------------------------
D0YVL6_LISDA/2-89--------------------------------------------------------------------------------
Q1ZN28_PHOAS/2-89--------------------------------------------------------------------------------
B5FCM4_VIBFM/2-89--------------------------------------------------------------------------------
D1B1X3_SULD5/2-89--------------------------------------------------------------------------------
A6FIU9_9GAMM/2-89--------------------------------------------------------------------------------
A4SNQ6_AERS4/2-89--------------------------------------------------------------------------------
Q65UQ2_MANSM/4-91--------------------------------------------------------------------------------
C5BE39_EDWI9/2-89--------------------------------------------------------------------------------
A1TWP4_MARAV/2-89--------------------------------------------------------------------------------
A4XTU4_PSEMY/2-89--------------------------------------------------------------------------------
Q02NE5_PSEAB/2-89--------------------------------------------------------------------------------
Q2BHM1_9GAMM/2-89--------------------------------------------------------------------------------
C0W230_9ACTO/19-106--------------------------------------------------------------------------------
C0WF19_9CORY/2-89--------------------------------------------------------------------------------
D0WS18_9ACTO/27-114--------------------------------------------------------------------------------
C0E4G0_9CORY/2-89--------------------------------------------------------------------------------
D1DEI3_NEIGO/2-101--------------------------------------------------------------------------------
D4DM42_NEIEG/10-109--------------------------------------------------------------------------------
Q1Q9H8_PSYCK/4-91--------------------------------------------------------------------------------
D0BZZ4_9GAMM/2-89--------------------------------------------------------------------------------
C0VHK3_9GAMM/2-89--------------------------------------------------------------------------------
Q1QX04_CHRSD/2-89--------------------------------------------------------------------------------
A4SIT2_AERS4/144-241--------------------------------------------------------------------------------

PF06450

NHAB_HAEIN/1-513--------------EKMSKQDKIKLGMQALIAIWLIVGLA-------------------------------------FHL
NHAB_SHEON/1-520--------------ARRTNKDKMKLIVQAFIGVWLIAGLA-------------------------------------LHL
A6B3E7_VIBPA/1-515--------------KTRTNQDVAKLWVQGIIAVWLIVALA-------------------------------------LHL
NHAB_ECOLI/1-512--------------HQRTRQDKIRLIVQAIIGVWLVTALA-------------------------------------LHL

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------------------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------------------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------------------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------------------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------------------

PF03553

O51582_BORBU/170-435-------------------------------.........-------------------------------------..-
NHAC_BACPE/157-449-------------------------------SMETGNEV.-------------------------------------..-
Q9KQG1_VIBCH/161-453-------------------------------NIESGVSF.-------------------------------------..-
Q9K7B7_BACHD/160-482-------------------------------IVALVLNLV-------------------------------------..-
O25453_HELPY/149-430-------------------------------AIILLGRGI-------------------------------------..-
Q9ZKQ5_HELPJ/165-464-------------------------------IVTYLLAYP-------------------------------------F.-
Q9KBE2_BACHD/142-433-------------------------------ILMFAFRVV-------------------------------------..-
Q9AFA3_VIBHA/1-333-------------------------------AVALFTVIK-------------------------------------Q.-
Q9HS26_HALSA/183-491-------------------------------VEAINTSPE-------------------------------------..-
Q99VD8_STAAM/151-432-------------------------------LVFFISRAY-------------------------------------..-
YUIF_BACSU/150-436-------------------------------IVLFVSGVM-------------------------------------..-
NHAC_BACSU/159-453-------------------------------TFETDNEA.-------------------------------------..-
O59530_PYRHO/156-486-------------------------------AVALTLVLA-------------------------------------TK-
Q9K5Y9_BACHD/160-453-------------------------------VILTGNEM.-------------------------------------..-
Q97L22_CLOAB/149-436-------------------------------QTSPHSP..-------------------------------------..-
Q99RU7_STAAM/184-446-------------------------------...WMG...-------------------------------------..-
Q9Y8U6_AERPE/161-510-------------------------------LVALAGALA-------------------------------------TR-
ARCD_HALSA/171-466-------------------------------GPKTGVDL.-------------------------------------..-
O51583_BORBU/175-441-------------------------------.........-------------------------------------..-
Q97TG1_CLOAB/150-462-------------------------------YYMYQKIS.-------------------------------------..-
Q9K7K2_BACHD/150-434-------------------------------MILFLSGSF-------------------------------------..-
Q9KSX5_VIBCH/165-497-------------------------------AMAFVTVLR-------------------------------------Q.-
Y325_HAEIN/152-444-------------------------------IIFVLCGIF-------------------------------------..-
Q9KT98_VIBCH/150-435-------------------------------MVFTFGGVI-------------------------------------..-
Q9KMV5_VIBCH/168-494-------------------------------AVSIVLSLR-------------------------------------L.-
MLEN_BACSU/159-452-------------------------------SIKTDVEF.-------------------------------------..-
Q9AGE2_YERPS/159-463-------------------------------NLSMFADQG-------------------------------------YT-
Q9JXG2_NEIMB/166-456-------------------------------AVFMMLGVI-------------------------------------..-
Q9KMX3_VIBCH/172-442-------------------------------SLSALT...-------------------------------------..-
Q9K0Q3_NEIMB/165-476-------------------------------LAVVLCTLG-------------------------------------T.-
Q9HNR2_HALSA/161-489-------------------------------ISTYVLGLT-------------------------------------YG-
Q9CMF8_PASMU/165-482-------------------------------LISTLCILI-------------------------------------DR-
Q99RX2_STAAM/158-455-------------------------------NDSMIHQSH-------------------------------------..-
Y1586_HAEIN/177-494-------------------------------IISTLLIIL-------------------------------------DR-
Y1107_HAEIN/162-461-------------------------------DTSMIHHT.-------------------------------------S.-
Q9HNF6_HALSA/156-488-------------------------------VSGFVGALA-------------------------------------YG-
Q9HNF7_HALSA/171-467-------------------------------TPETGSEL.-------------------------------------..-
Q9I0I5_PSEAE/151-435-------------------------------VVFSLSGVV-------------------------------------..-

PF03605

Q9ZEN8_WOLSU/6-382-------------------------------AGVLAIGIF-------------------------------------SW.
DCUB_SHIFL/6-376-------------------------------IGILAIGIF-------------------------------------SW.
Q9CJS4_PASMU/5-375-------------------------------IGTIALSLY-------------------------------------SL.
DCUA_WOLSU/5-365-------------------------------IGCMITAFI-------------------------------------CN.
Q9KNN2_VIBCH/21-383-------------------------------AACMVGAFV-------------------------------------AN.
DCUB_HAEIN/8-372-------------------------------LGLFLACLF-------------------------------------VN.
Q9KMW3_VIBCH/5-373-------------------------------FGTLLMSLY-------------------------------------SL.
DCUA_SHIFL/5-365-------------------------------LAVLVMSFL-------------------------------------VTM
Q97DH7_CLOAB/5-371-------------------------------VGTVLCALA-------------------------------------VI.
DCUA_HELPJ/7-369-------------------------------LACMLTAFV-------------------------------------MG.

PF04165

O29978_ARCFU/17-405-------------------------------LILSVLLRL-------------------------------------DLL
O57766_PYRHO/2-394-------------------------------IVISVIFGV-------------------------------------DML
Q9V2R1_PYRAB/3-395-------------------------------IVLSIILGL-------------------------------------DML
Q9WYV1_THEMA/3-381-------------------------------LGTGVLILL-------------------------------------FKV

PF02652

LCTP_BACSU/14-536--------------......RAADIAKAWSPFYILTAAIT-------------------------------------IWS
LUTP_BACSU/16-554--------------PAAPAYRGGQIFKAWSPFLLLTAMIS-------------------------------------VWG
LLDP_ECOLI/16-542--------------...TGYTAGQVLRAWTPFLFLTATVT-------------------------------------LWS
Q9ZMU0_HELPJ/15-536--------------......HICKVVVAWMPFVLLTITII-------------------------------------IWT
Y1218_HAEIN/2-525--------------.........EVVKALFPTGLLIAFLI-------------------------------------VTR
O51549_BORBU/4-500--------------........SKGIIACSPYILIVTFIV-------------------------------------LVS
Q9ZMT9_HELPJ/16-539--------------......HICKIYVAWSPFVILVLVIV-------------------------------------LWI
O29452_ARCFU/1-535--------------.....EKEFSILEAMVPYVLVSLGLV-------------------------------------LTR

PF07854

Q9YFW4_AERPE/15-368F---LFVAAL----------------------------------------------------------------------
Q8PXG5_METMA/8-368Y---VFIMAL----------------------------------------------------------------------
Q8RCZ3_THETN/45-391F---VFILAL----------------------------------------------------------------------
Q8R782_THETN/2-340F---VFIFAL----------------------------------------------------------------------
Q8ZUI4_PYRAE/6-347F---IFIFAL----------------------------------------------------------------------
O29471_ARCFU/14-358Y---VFIAAL----------------------------------------------------------------------

PF07399

Q9Z6V2_CHLPN/1-438FMGALLLFYL----------------------------------------------------------------------
Q9F206_9BURK/1-428FMG.LFLFFM----------------------------------------------------------------------
Q87F98_XYLFT/1-420FIG.LFLFFL----------------------------------------------------------------------
O84811_CHLTR/1-438FLGFLFIFYL----------------------------------------------------------------------

PF03806

ABGT_ECOLI/14-507FIAAI.ALMVIPQNGILRDPINHTVM.P---------------------SPFIKGIVP--LIILFFFVVSLA--------
Q9KEI6_BACHD/19-511LAVVF.LFLTVPEQALLRDPETGSLT.V---------------------SPFMTGIVP--IMMVFFLVPALV--------
Q9KC22_BACHD/13-510TLALM.LLLVIPEWGPLRGEGDSPII.Q---------------------SPFMSSLVP--VILILFLVPGLV--------
Q9A7U5_CAUCR/48-548VIGLFAALTLWPG.APLVDHEAVGPKRM---------------------TPFYQSLIA--AFMLLFLTTGWA--------
Q99RG0_STAAM/14-511TIILL.IITAIPEHSFLRNAKTGSLLDD---------------------APLINGVGL--IILVVFLVPGLV--------
Q9AA61_CAUCR/39-553IVALFAALSLIPGFTPLIDETKTGPAQL---------------------TPFYGALIA--GFMMLFLAGGVA--------
Q9KTN8_VIBCH/19-517GIALL.VAAVWPENSALRSPDGEITAFT---------------------APIMKSIVP--LIFLLFIIPGIV--------
Q9KTM2_VIBCH/25-532VSALL.AWTIVPADGVLRG.EDGLVS.G---------------------SPFLKSIVA--FIFIFFAIPGYV--------
Q9RNX1_NEIGO/11-519LSALL.AWSIVPADGILRHPETGLVA.G---------------------SPFLKSIVV--FIFLLFALPGIV--------

PF03606

O51783_BORBU/4-471TFAHKLVLLLFGFM....ILILIFSIVN.........L...........GWWMQEMTM--LYLGVAIISAFI--------
Y594_HAEIN/12-505LFCISFPIMIWGV.......M.....VG.........G............WWFPQMAA--SFLAITIIIMFI--------
Q9CP35_PASMU/1-448LPFTPIVGVLV..........FDGKIAP.....................ELHIITIIV--ICLLLVALIDFL--------
Q97NA1_STRPN/11-499LFVLTFILMVLSFIPWTDLGVTIFDDFNTWLTGLPVIGNIVGSSTSALGTWYFPEGAM--LFAFMGILIGVI--------
DCUC_SHIFL/5-452LPFTPIIGVLI..........FDGKWGP.....................QLHIITILV--ICMLIASILEFL--------
Q99YT7_STRP1/11-496IFTLTFVIMILSLIPWEDFGIKFFTNINTWLTTMPILGGVIGKTMGAFGTWYFPEITM--LFIMMGVLVAIV--------
YFCC_ECOLI/15-502VLTAVMVWVIWG............VIVN.....................AWFIPEIAS--QFFTMGLVIGII--------
Q9AAL9_CAUCR/33-506LLLATVIWVAWG............VIAK........G.............YYLAEIAA--QFFAMGLAVGLI--------
Q9CMA1_PASMU/2-462LPLLPLVLILT..........FSKLLVS........SI...........KMNVATAMI--ISLFIAMLFEFV--------
Q9KAH9_BACHD/20-464IVILMFIGMIYG.............VLN....................FQWDFIGLAG--YFLAMGIIVGLV--------
Q99UT9_STAAM/18-515LFVLPFPIMVWGV.......M.....TQ.........G............WWFPVMAS--AFLIFTIIIMFI--------
DCUC_VIBCH/6-456LPFLPIIGVFV..........FNGETLP........GI...........TLDIYTIVV--LSIFIGVLVDYI--------
DCUD_ECOLI/2-455LPVMPLILMLGSL.......FLAHVGLM........QS...........ELHLVVVML--LSLTVTMFVEFF--------

PF06808

Q9Y8U1_AERPE/115-551ASILLLI.ILMGA.....RREY.--------------------------.PAYAALQSSILLLALL......--------
Q9K7H0_BACHD/6-417FPIIIIGGIYAGI.....FSPTE--------------------------AAGISVLYA..LILEVII.....--------
Q8NN88_CORGL/3-439IFLGILIPVILTIGPLSEWLKTH--------------------------GVGESGVKS..MSIIVWVPILIT--------
Q8FA80_ECOL6/7-418LIFAVVGGIRANI.....FTPTE--------------------------AGAVAVLIV..LAIGFFI.....--------
Q9CKH6_PASMU/7-420CPIIILYGIISGI.....FTATE--------------------------AGAVSVVYA..YLIGTFV.....--------
O07838_RHOCA/7-430LIVVVIGGIYAGI.....FTPTE--------------------------AAAMSAVYA..FFISVFV.....--------
Q92K76_RHIME/14-514LIFLVLGTIFLGI.....ATPTE--------------------------GGAMGAVGA..LVMAAG......--------
O29619_ARCFU/128-601VPLFIIIYMLVSG.....YTPIL--------------------------AGVYSIYAV..IAIMILKPLIMN--------
Q8G0A8_BRUSU/148-607IPLVVLIAVLLSG.....YTPYL--------------------------AAFWGITLC..IAVGLLNP....--------
Q8FRN3_COREF/157-598IALGILTGMLLTM.....PSEAQ--------------------------VPFYIVALL..LGIALVRP....--------
Q92PP2_RHIME/208-617LPFIIRSAVASGA.....ATATE--------------------------VSTIAVVYA..FIIGTVL.....--------
Q8ZKS0_SALTY/12-424LIVIIVGGIVQGI.....FTAIE--------------------------ASAIAVVYT..LLLTMVF.....--------
Q8ZL80_SALTY/7-416LPVIIIGGFRSGL.....FTPTE--------------------------AGAVAAFYA..LFVAVVI.....--------
Q92PN6_RHIME/6-416MPFFIILLLRAGI.....ATPTE--------------------------VSVIAVFYA..LLVSLLL.....--------
Q92WB7_RHIME/5-456TPIILIGGMTMGW.....FTPTE--------------------------AAVAAVIWS..LFLGLVR.....--------
Q89FZ8_BRAJA/199-609LIFMIFFGFKSGF.....ATATE--------------------------ISAFAVAYA..LVVGSLV.....--------
Q89NA6_BRAJA/151-593FVIALLIVMLLYF.....KRESH--------------------------APFYATALL..LVLNQLFSK...--------
Q89CF6_BRAJA/11-428LLFVFVIGGLYGLPFLPRFTPTE--------------------------AGGVGATGA..FIIGVF......--------

PF02667

Q9ZLE5_HELPJ/3-453YLLVFLGFGYLGIYFFK--------------------------------GGG...ISLNIVNTIFLFLGILL--------
O28734_ARCFU/8-484LLISILGIITMGYWFYE--------------------------------KGFFGGLNLNSLNFTFIMVGLLL--------
ATOE_ECOLI/1-440LIIGALGIAYLAMYFSE--------------------------------HGFN..ITINTVNLMFMIAGLLL--------
ATOE_HAEIN/1-447YTIGALGYSYLGMYFYK--------------------------------NGFN..LTINNVNLIFLITGIVL--------

PF03600

Q10RS7_ORYSJ/16-503TLGMLIAL............................LMGL............NMSWTA--ITAALVLLAL.D--------
ARSB_DICDI/51-511LTLVLIGF............................FIGM............HMGFTV--LF.GVSILMICE--------
CITN_BACSU/5-373VALMAAL.............................ITSL............LPLPVL--FMTAFAVALMVN--------
Q828S1_STRAW/5-417VTLLTAM.............................IMEW............LPIPVL--FLLGAALALTVN--------
Q897M4_CLOTE/5-411LVINLILSRFVFVEGRYDGS...YLTQKPYNTTLSTLAGG............WSLIIS--LVISIITAIALN--------
Q8T0L2_DROME/151-567FAFLCMLLHSI......................PKVADGA............SLGWVT--LLAAFLLIILDD--------
Q9VU30_DROME/220-638FVIIFFLLHS.......................LPFMHGA............TLGWVA--ILAAFLLLILAK--------
Q9W024_DROME/212-628FAAFCFILQSV......................PWAIPGA............SLGWIS--ILSAFLLLILID--------
Q81E21_BACCR/4-425GVMNKVFTIMIPKWYPSGFDFSAIGMKAFGKVELSAVVGI............WSVELA--LIIGILTTLLLY--------
Q8EMV3_OCEIH/7-393IVVLNVLGQF.......................MNPT...............IALLIA--LLIGIVVACLTM--------
Q8XWF6_RALSO/4-412GVMNLLFTRWIPEWYGKLVTVALPGLPKPLTVEADKLTAI............WAVEAA--LLIGIVVVVVSG--------
Q88BF5_PSESM/5-378LALMVAL.............................IMGL............LPLPVL--FMIAFSIAMIIN--------
Q8I929_DROME/216-650FVIVCFFIQS.......................VPHWRTL............PLGWVA--LLGVILLLIILN--------
Q9K635_BACHD/2-373IVTLNLLQ............................................WDIVLA--LISGIVLIMLLN--------
Q2BIE8_9GAMM/57-578FSAAPVVDES........................GETVGA..................--......VELFED--------
Q898H6_CLOTE/4-380LICFNIIE............................................LPVEGA--VTIGIISAIVLL--------
YRAO_BACSU/5-384ISIMVFI.............................VLGT............KHPSVL--FLIGFVLALTIN--------
Q8FSY6_COREF/59-476VTVMVLL.............................IADI............FPLAYI--FMVGAGLALAVN--------
CITM_BACSU/5-378LSLIGCL.............................VSGK............VSLTVL--FVIAFCIALIVN--------
Q88FZ5_PSEPK/9-557LAVMVGLM............................VSGA............VPNVIA--ALIGCLLMGAGR--------
Q7PVG5_ANOGA/324-759FVITFFFLHS.......................APDIQKL............SLGWTA--LLGALLLLILAD--------
Q8I930_DROME/315-750FVISLFFLHS.......................VPELQRL............SLGWTA--LLGAIFLIILAD--------
Q87EP0_XYLFT/5-388IALMAGL.............................VVGI............LPMPIL--FMIGFALALLIN--------
Q81I57_BACCR/5-381ATLLVCL.............................ILEV............MPLPVL--FTVAFAIAVMIN--------
Q9AV23_ORYSJ/16-429TVGMLVAY............................MLGL............NMSWTA--ITTAIALVVV.D--------
Q8DUC7_STRMU/6-410LILIAWL.............................VAGSFIS......AIEMPSLLL--FALGTCIALMVN--------
Q8NUL8_STAAW/11-402LAVILSM.............................LINI............APPEFA--FMIGVSLALVIN--------
Q88L78_PSEPK/5-379IAVMTAL.............................VLGL............MHAAIL--FMIGFVAALMIN--------
O81915_ARATH/16-450TLGMLISL............................LMGL............NMSWTA--ITAALALVVL.D--------
Q82YV5_ENTFA/6-407IVLIGWL.............................VLSSFVGQLGLPSWIEMPPLLL--FLVGTCIALMIN--------
Q88IC5_PSEPK/4-409GVMNLVFTHWIPHWYGPSHSLQLPGMSAPVQSDVTKLTAI............WAVQAA--LLVGILMVLVCA--------
Q9HTA2_PSEAE/5-378VVLMATL.............................IAGL............LPMPVL--FMIAFGIAMIVN--------

PF02040

O68021_PSEAI/3-423LVLLAGLF----------------------------ALEP------------LGVPVS--AVAAACAALLLA--------
ARSB_STAXY/4-426AILLVGYL----------------------------VSEF------------IQIPVS--IIAGIIALIFVI--------
ARSB2_ECOLX/3-425ILLLVGFF----------------------------VLEP------------LGIPVS--AIAAVGAVILFA--------
YDFA_BACSU/6-428GLLLIGYF----------------------------ASEF------------FSIPVS--VVAGSIAIIFLI--------

PF02447

GNTP_BACLI/1-447TVITLIQETMGLADNSL.LAAVR-------------LIGNAS----------TSMVIS--LLVAIYTMGIAR--------
GNTU_ECOLI/4-445TIAARFVPEGSTAYE.....WFE-------------FIGHPF----------TAILVA--CLVAIYGLAMRQ--------
GNUT_PSEAE/9-449TFADVAFPDGHAFRA.....WMD-------------MIGHPI----------SALLLA--LLVALYTFGYAR--------
YJHF_ECOLI/1-448TIIQMTHAKSAADSGLF.YNVIL-------------FLGNST----------IAMLIS--LLFAIYTMGLGR--------
YGBN_ECOLI/4-454TVSATLMPPSHPLLG.....TLQ-------------LIGSPM----------VALMIA--LVLAFWLLALRR--------
GNTT_ECOLI/1-437AIAEMILPKGHAFLP.....VAE-------------FLGDPV----------MATLIA--VLIAMFTFGLNR--------
Y1015_HAEIN/6-457AVVHLFVKDVPEALTSIPYQIVS-------------FLGHPV----------IVLALS--VLISVYTLLPKA--------
YOJA_BACSU/1-443TIFSLLLSEHSKGKD.....IIE-------------FIGTPG----------TAMLIS--LLLALYTMGYAR--------
DSDX_ECOLI/6-444TIAELNMARESGLYI.....LVE-------------FIGNPI----------TAMFIA--VFVAYYVLGIRQ--------
GNTP_ZYMMO/7-450SGANIFLPHGNNIRA.....FMN-------------FMGDPV----------VSLLIA--LLVSMVTLGFWR--------
GNTP_ECOLI/4-446TIANIWLVKDTPAWE.....VVN-------------FIGSSP----------IAMFIA--MVVAFVLFGTAR--------
IDNT_ECOLI/1-437AVCEITLPKTNTVRL.....FFE-------------FVGNPA----------VALFIA--IVIAIFTLGRRN--------

PF00939

MEMP_CUPNH/32-513LLFWATEG...........-----------------KLH.....S-------FDTATV--TFVGLVILMMPR........
CITT_ECOLI/5-486LGLWVFGS...........-----------------EV.......-------INATAV--GLLAVSLMLALH........
O84207_CHLTR/4-470ISLWTFGD...........-----------------SIG......-------ISATTT--TFIGLSLLILTN........
Q9Z8X7_CHLPN/4-470VVLWTFGD...........-----------------LLG......-------ISATTA--ALIGLSLLILTN........
Q9ZMT7_HELPJ/2-480LLGWIFGK...........-----------------SLG......-------LHASAT--ALIVMVLMAFCK........
TTDT_ECOLI/4-487LVLWIFGG...........-----------------DY.......-------IDAAMV--GYSVVALMLLLR........
S13A2_HUMAN/6-565VLLWFTREPGFFLGWGNLA-----------------FPNAKGESM-------VSDGTV--AIFIGIIMFIIPSKFPGLTQ
Y020_HAEIN/3-476LFGWIFSN...........-----------------SLH......-------INATIV--AIIVMVLCIVLS........
YFLS_BACSU/12-478LVLWIFGG...........-----------------SFN......-------IDATTT--ALIGLAVLLLSQ........
YBHI_ECOLI/3-474LLGWIFSK...........-----------------SLG......-------VDESTV--AIVVMATMLLLG........
SOT1_SPIOL/101-569VGLWVFGG...........-----------------KLG......-------VDAVTA--AILGLSVLLITG........

PF13726

Q9ZL85_HELPJ/10-97--------------------------------------------------------------------------------
A3YN61_CAMJU/6-93--------------------------------------------------------------------------------
Q73KL4_TREDE/3-90--------------------------------------------------------------------------------
C8A2Z4_STAAU/3-90--------------------------------------------------------------------------------
B9EAL6_MACCJ/2-89--------------------------------------------------------------------------------
C3F6D3_BACTU/2-89--------------------------------------------------------------------------------
E6U2C3_BACCJ/2-89--------------------------------------------------------------------------------
D6XUM8_BACIE/2-89--------------------------------------------------------------------------------
A3IGC2_9BACI/8-95--------------------------------------------------------------------------------
A7Z8B4_BACA2/2-89--------------------------------------------------------------------------------
Q2B2R2_9BACI/2-89--------------------------------------------------------------------------------
B7GKU7_ANOFW/4-91--------------------------------------------------------------------------------
Q9K7K2_BACHD/2-89--------------------------------------------------------------------------------
Q5WDV8_BACSK/2-89--------------------------------------------------------------------------------
C4L1E0_EXISA/2-89--------------------------------------------------------------------------------
B1YEV1_EXIS2/3-90--------------------------------------------------------------------------------
A4Y5U0_SHEPC/2-89--------------------------------------------------------------------------------
Q084K9_SHEFN/4-91--------------------------------------------------------------------------------
A1F5K2_VIBCL/2-89--------------------------------------------------------------------------------
D0YVL6_LISDA/2-89--------------------------------------------------------------------------------
Q1ZN28_PHOAS/2-89--------------------------------------------------------------------------------
B5FCM4_VIBFM/2-89--------------------------------------------------------------------------------
D1B1X3_SULD5/2-89--------------------------------------------------------------------------------
A6FIU9_9GAMM/2-89--------------------------------------------------------------------------------
A4SNQ6_AERS4/2-89--------------------------------------------------------------------------------
Q65UQ2_MANSM/4-91--------------------------------------------------------------------------------
C5BE39_EDWI9/2-89--------------------------------------------------------------------------------
A1TWP4_MARAV/2-89--------------------------------------------------------------------------------
A4XTU4_PSEMY/2-89--------------------------------------------------------------------------------
Q02NE5_PSEAB/2-89--------------------------------------------------------------------------------
Q2BHM1_9GAMM/2-89--------------------------------------------------------------------------------
C0W230_9ACTO/19-106--------------------------------------------------------------------------------
C0WF19_9CORY/2-89--------------------------------------------------------------------------------
D0WS18_9ACTO/27-114--------------------------------------------------------------------------------
C0E4G0_9CORY/2-89--------------------------------------------------------------------------------
D1DEI3_NEIGO/2-101--------------------------------------------------------------------------------
D4DM42_NEIEG/10-109--------------------------------------------------------------------------------
Q1Q9H8_PSYCK/4-91--------------------------------------------------------------------------------
D0BZZ4_9GAMM/2-89--------------------------------------------------------------------------------
C0VHK3_9GAMM/2-89--------------------------------------------------------------------------------
Q1QX04_CHRSD/2-89--------------------------------------------------------------------------------
A4SIT2_AERS4/144-241--------------------------------------------------------------------------------

PF06450

NHAB_HAEIN/1-513AAVGLIGLSIIIFATS--------------------FTGVTDEHTIGKAFQESLPFTA--LLVVFFSVVAVI--------
NHAB_SHEON/1-520ASVGLIGLSVIILATA--------------------FNGITDEHALGKAFEEALPFTA--LLAVFFSVVAVI--------
A6B3E7_VIBPA/1-515AAVGLIGLSVIILATS--------------------FTGVIEEHSMGKAFEEALPFTA--LLAVFFSIVAVI--------
NHAB_ECOLI/1-512AEVGLIGLSVIILATS--------------------LTGVTDEHAIGKAFTESLPFTA--LLTVFFSVVAVI--------

PF07158

P72556_STRPN/1-148--------------------------------------------------------------------------------
Q9KIE8_STRHY/1-149--------------------------------------------------------------------------------
Q9ZIP4_RHILE/1-149--------------------------------------------------------------------------------
Q8P4U0_XANCP/1-149--------------------------------------------------------------------------------
Q9L0A3_STRCO/1-149--------------------------------------------------------------------------------

PF03553

O51582_BORBU/170-435----.....-----------------------------------------------------------------------
NHAC_BACPE/157-449----.....-----------------------------------------------------------------------
Q9KQG1_VIBCH/161-453----.....-----------------------------------------------------------------------
Q9K7B7_BACHD/160-482----..KGA-----------------------------------------------------------------------
O25453_HELPY/149-430----...KF-----------------------------------------------------------------------
Q9ZKQ5_HELPJ/165-464----..LEK-----------------------------------------------------------------------
Q9KBE2_BACHD/142-433----...PF-----------------------------------------------------------------------
Q9AFA3_VIBHA/1-333----.GLPM-----------------------------------------------------------------------
Q9HS26_HALSA/183-491----..GVT-----------------------------------------------------------------------
Q99VD8_STAAM/151-432----...NW-----------------------------------------------------------------------
YUIF_BACSU/150-436----...KR-----------------------------------------------------------------------
NHAC_BACSU/159-453----.....-----------------------------------------------------------------------
O59530_PYRHO/156-486----.TMTV-----------------------------------------------------------------------
Q9K5Y9_BACHD/160-453----.....-----------------------------------------------------------------------
Q97L22_CLOAB/149-436----.....-----------------------------------------------------------------------
Q99RU7_STAAM/184-446----.....-----------------------------------------------------------------------
Q9Y8U6_AERPE/161-510----.SLSF-----------------------------------------------------------------------
ARCD_HALSA/171-466----.....-----------------------------------------------------------------------
O51583_BORBU/175-441----.....-----------------------------------------------------------------------
Q97TG1_CLOAB/150-462----....I-----------------------------------------------------------------------
Q9K7K2_BACHD/150-434----...NR-----------------------------------------------------------------------
Q9KSX5_VIBCH/165-497----.KLPT-----------------------------------------------------------------------
Y325_HAEIN/152-444----...KL-----------------------------------------------------------------------
Q9KT98_VIBCH/150-435----...AW-----------------------------------------------------------------------
Q9KMV5_VIBCH/168-494----.KLSA-----------------------------------------------------------------------
MLEN_BACSU/159-452----.....-----------------------------------------------------------------------
Q9AGE2_YERPS/159-463----VSGIV-----------------------------------------------------------------------
Q9JXG2_NEIMB/166-456----...NR-----------------------------------------------------------------------
Q9KMX3_VIBCH/172-442----.....-----------------------------------------------------------------------
Q9K0Q3_NEIMB/165-476----..IKT-----------------------------------------------------------------------
Q9HNR2_HALSA/161-489----.ILSL-----------------------------------------------------------------------
Q9CMF8_PASMU/165-482----.QVSL-----------------------------------------------------------------------
Q99RX2_STAAM/158-455----..IS.-----------------------------------------------------------------------
Y1586_HAEIN/177-494----.QVSV-----------------------------------------------------------------------
Y1107_HAEIN/162-461----.VS..-----------------------------------------------------------------------
Q9HNF6_HALSA/156-488----.TMDL-----------------------------------------------------------------------
Q9HNF7_HALSA/171-467----.....-----------------------------------------------------------------------
Q9I0I5_PSEAE/151-435----...RW-----------------------------------------------------------------------

PF03605

Q9ZEN8_WOLSU/6-382FRGKDLDKD-----------------------------------------------------------------------
DCUB_SHIFL/6-376FRGKDLDKD-----------------------------------------------------------------------
Q9CJS4_PASMU/5-375RRGKELEAD-----------------------------------------------------------------------
DCUA_WOLSU/5-365LFNTDLSKD-----------------------------------------------------------------------
Q9KNN2_VIBCH/21-383FMGSELKDD-----------------------------------------------------------------------
DCUB_HAEIN/8-372KMGKELKDD-----------------------------------------------------------------------
Q9KMW3_VIBCH/5-373RRGKELDND-----------------------------------------------------------------------
DCUA_SHIFL/5-365LFNSKLSDD-----------------------------------------------------------------------
Q97DH7_CLOAB/5-371KKGKELADD-----------------------------------------------------------------------
DCUA_HELPJ/7-369FTDLKLDSD-----------------------------------------------------------------------

PF04165

O29978_ARCFU/17-405LALVVAIAA-----------------------------------------------------------------------
O57766_PYRHO/2-394YGSFLGFLS-----------------------------------------------------------------------
Q9V2R1_PYRAB/3-395YGSLVGFLS-----------------------------------------------------------------------
Q9WYV1_THEMA/3-381SGWFALLLS-----------------------------------------------------------------------

PF02652

LCTP_BACSU/14-536LPAFKALFQ...EGGLLYQSTLLFKMPFLHQ....QIMKMPPIAP..SAMPLDAVFKV--DLLSATGTAILA--------
LUTP_BACSU/16-554IPSVKSALTGHYEGSAVFLKWLNAVGEKLTFSPGVPFLNNQIVNA..DGTPIEAVYKL--EVLGSAGTAILI--------
LLDP_ECOLI/16-542IPPFKALFA...SGGALYEWVINIPVPYLDK....LVARMPPVVS..EATAYAAVFKF--DWFSATGTAILF--------
Q9ZMU0_HELPJ/15-536QPWFKALFK...EGGALAFSNFAFEFNSISQ....KIFKTVPIVT..EATNFPVVFKL--PLILTTGTSIFL--------
Y1218_HAEIN/2-525IHQLPFKAMMNDATIWFSTTLGSLGLFEISK...GLIFSLKNIFG......SNVSSSY--KLLYVPALIPFV--------
O51549_BORBU/4-500.PLFNKIHE........YLKTF........Q....STISIYPEAN......P...LHF--KWIISPGFLIIL--------
Q9ZMT9_HELPJ/16-539QPFFKALFE...KDGLLAFSNFYFEFNNISN....HIFKSPPFVEANQSVNFPVVFKL--LLINTVGTSIFL--------
O29452_ARCFU/1-535..TVPAINQ......FVTTN...............LVIGISGILG......TSLSHTY--KLLYNPGTIFII--------

PF07854

Q9YFW4_AERPE/15-368--------------------------------------------------------ELLGASF--TPM-----VK-----
Q8PXG5_METMA/8-368--------------------------------------------------------TFLGEGF--KPL-----IL-----
Q8RCZ3_THETN/45-391--------------------------------------------------------ELLGAGF--KPV-----ID-----
Q8R782_THETN/2-340--------------------------------------------------------ELLGTGF--KPI-----ID-----
Q8ZUI4_PYRAE/6-347--------------------------------------------------------TILGEFF--KPL-----AV-----
O29471_ARCFU/14-358--------------------------------------------------------VLLGEGF--TPI-----IY-----

PF07399

Q9Z6V2_CHLPN/1-438--------------------------------------GFQKFTIFYQDPINLSKVCYVGLFY--AGL-----VVFGD--
Q9F206_9BURK/1-428--------------------------------------GFATAYSAHQDRLILKEALLVAFFL--AGL-----VVLGG--
Q87F98_XYLFT/1-420--------------------------------------GVAHAYQGYQDRLILREGLLVALFL--AGL-----VILGG--
O84811_CHLTR/1-438--------------------------------------GFQRFTIFYQHPIKTAKVCFVGLFY--VGV-----VIFGE--

PF03806

ABGT_ECOLI/14-507-------------YGIATRTIRRQADLPHL--------MIEPMKEMAGFIVMVFPLAQFVAMF--NW------SNMGK--
Q9KEI6_BACHD/19-511-------------YGFVAKVFTSSKDVADH--------LAKSMSNMGTYIVIAFVAAQMIAFF--NW------SQLGP--
Q9KC22_BACHD/13-510-------------YGAITKSIRNDKDVASQ--------MSDTMASMGMFVVLAFTAGQFVAYF--NE------TNMGL--
Q9A7U5_CAUCR/48-548-------------YGSATGSVKSHRDIVSM--------MAEGMRAMAPYLVLAFFAAHFVAMF--AW------SKMGP--
Q99RG0_STAAM/14-511-------------YGILSKEIKNTKDLGKM--------FGDAVGSMGTFIVIVFFAAQLLAYL--KW------SNLGI--
Q9AA61_CAUCR/39-553-------------YGVGVGTVKTEGDVVNM--------MADGVRSVAPYIVFAFFAAHFVAMF--NW------SRLGP--
Q9KTN8_VIBCH/19-517-------------YGRVAGTFKNSNDVIKA--------MSATMSTMGAYIVMSFFCAQFLSAF--GQ------SNIGT--
Q9KTM2_VIBCH/25-532-------------YGRVVGTMKTDRDVINA--------MAKSMSSMGMYIVLVFFAAQFVAFF--SW------TKFGQ--
Q9RNX1_NEIGO/11-519-------------YGRITRSLRGEREVVNA--------MAESMSTLGLYLVIIFFAAQFVAFF--NW------TNIGQ--

PF03606

O51783_BORBU/4-471-------------C......KLGETEMWDA--------FVKGSESLLTAALVIGLARGVMIVC--DDG.....LITDT--
Y594_HAEIN/12-505-------------S......GLSEKDIMES--------FTEGASELVGVSLIIGLARGVNLVL--EQG.....MISDT--
Q9CP35_PASMU/1-448-------------RT...FSAKKVYENLNV--------AYQGMADA..FSGVVILLVAAGVFA--QGL.....STIGF--
Q97NA1_STRPN/11-499-------------Y......GLKEDKIISS--------FMNGAADLLSVALIVAIARGIQVIM--NDG.....MITDT--
DCUC_SHIFL/5-452-------------RS...FNTQKVFSGLEV--------AYRGMADA..FANVVMLLVAAGVFA--QGL.....STIGF--
Q99YT7_STRP1/11-496-------------Y......RMSEEDFFSS--------FLTGAGEFLGVAMICAIARGIQVIM--NGG.....MITAT--
YFCC_ECOLI/15-502-------------GVVFRLNGMTVNTMASS--------FTEGARMMIAPALLVGFAKGILLLV--GNGEAGDASVLNT--
Q9AAL9_CAUCR/33-506-------------AYVLKLGQSGANDLVRA--------FGEGAAQLAPAALVVGIAKGVLLMI--GGDKPDHWSLLNS--
Q9CMA1_PASMU/2-462-------------RK...KDVKQVFAEMQV--------FFDGMGKQ..FAAVVTLIVAGETFA--KGL.....TAVGA--
Q9KAH9_BACHD/20-464-------------AG......LSGNEISEA--------FNQGFQHVLMGAMIIGIARGVSIIM--EQT.....QMIDT--
Q99UT9_STAAM/18-515-------------AGT.GKSGLGEKGTVDA--------FVNGASSLVGVSLIIGLARGINLVL--NEG.....MISDT--
DCUC_VIBCH/6-456-------------TK..RFNGKQTLEDLEA--------CYEGMADA..FKGVVMLLVAAGVFA--QGL.....MSIGA--
DCUD_ECOLI/2-455-------------RK...HNLRETMDDVQA--------FFDGMGTQ..FANVVTLVVAGEIFA--KGL.....TTIGT--

PF06808

Q9Y8U1_AERPE/115-551-------------AAAEASRGKSLHEVAGR....ILARLAETLKIFSGFVADITILLAALGVM--TGL-----MTITG--
Q9K7H0_BACHD/6-417-------------.....YRSIKLKEIPSI........ALSTGLVT....AAVFILVAAGQAF--SWL-----ISFAD--
Q8NN88_CORGL/3-439-------------AIALIEGRKRIANNMAHFRVQISKDLPQFATVG....ISLFSALAAANIM--EEL-----....G--
Q8FA80_ECOL6/7-418-------------.....YREMRISHVVKA........LGETARAT....ASVMLVIMASAAL--GWI-----FSMEH--
Q9CKH6_PASMU/7-420-------------.....YKELNLERLKKA........FISSLKGT....ITVMLIVGASSIF--AWM-----IARLQ--
O07838_RHOCA/7-430-------------.....YKDLTLRDVPRV........LLSSANMS....AMLLYIITNAVLF--SFL-----MAHEG--
Q92K76_RHIME/14-514-------------.....KGRLNMEVVRAA........LASTTRLS....AFVLFILIGARVF--SLT-----FYGVN--
O29619_ARCFU/128-601-------------YRKPAEQREPLGKVLKGSILNILSALEHGGRSA....TTVAMACASAGII--VGV-----VTLTG--
Q8G0A8_BRUSU/148-607-------------.....RKRMTIGEVFEG........LRDGAKYA....LAVGAAAATVGII--VGV-----VTLTG--
Q8FRN3_COREF/157-598-------------.....SVKFGFKELFEM........MLDAGKSL....GQIIAIIAGVGLI--LGG-----LSSTG--
Q92PP2_RHIME/208-617-------------.....YGGIGMRRTYRM........LVETAAMS....GAILLILGTAAAM--AWA-----LTQTG--
Q8ZKS0_SALTY/12-424-------------.....YRTLKIKDLPSI........LLQTVVMT....GVIMFLLATSSAM--SFS-----MSITN--
Q8ZL80_SALTY/7-416-------------.....YRELTFSSLYHV........LVNAAKTT....SVVMFLVAAAQVS--AWL-----ITIAE--
Q92PN6_RHIME/6-416-------------.....YRDLTWERIYAA........LVGTVITT....GVVMLVIAASSLV--GHV-----LITER--
Q92WB7_RHIME/5-456-------------.....YRTMTMSTLARA........TFDTIETT....ASVLFIVTAASIF--AWL-----LTVSQ--
Q89FZ8_BRAJA/199-609-------------.....FRELSFKSAAHS........FVQAATRA....GLVLFIVAAAQSL--AFT-----LTLQQ--
Q89NA6_BRAJA/151-593-------------.....DTRWTLATIGKF........LEVNGRTF....VELVGILAGCGLL--IGA-----FSMTG--
Q89CF6_BRAJA/11-428-------------.....TGRLDREKILAS........LLQATRTA....AAVFTVLIGALIF--GYF-----LTVTQ--

PF02667

Q9ZLE5_HELPJ/3-453-------------HKTPLAYVKAINHSARS--------VAGILLQFPFYAGIMGMMASHS..V--GGH---------S--
O28734_ARCFU/8-484-------------YMNPIAYMRAITRAAGA--------VAGILVQFPFYAGIMGMMRYSAVVA--GGP---------N--
ATOE_ECOLI/1-440-------------HKTPMAYMRAISAAARS--------TAGILVQFPFYAGIQLMMEHSG..L--GG.---------.--
ATOE_HAEIN/1-447-------------HGSPMAYMRAIINATRS--------TAGILVQFPFYAGVQLMMEHSG..L--GG.---------.--

PF03600

Q10RS7_ORYSJ/16-503-------------FTDAQ-ACLE.......--------..KVS-YSLL------IFFCGMFIT--VDG-----FNKTG--
ARSB_DICDI/51-511-------------RKDIT-DIIN.......--------..SVD-WELL------LFFSGLFVL--VEG-----FDRQF--
CITN_BACSU/5-373-------------YPNVK-EQQK...RISA--------HAGNA-LNVV------SMVFAAGIF--TGI-----LSGTK--
Q828S1_STRAW/5-417-------------FPHMP-DQKA...RLGA--------HAENV-LNVS------GMVFAAAVF--TGV-----LQGTG--
Q897M4_CLOTE/5-411-------------YKRFK-EVKG...SLND--------GAIGS-LLAI------VNTASEVGY--GNV-----IQSLA--
Q8T0L2_DROME/151-567-------------KNDLN-ATLG.......--------..IIQ-WTIL------LFIAALFVL--SEA-----VDQLG--
Q9VU30_DROME/220-638-------------MNDIE-AILD.......--------..QVE-WSAL------LFLAALFVL--TEA-----VDKLG--
Q9W024_DROME/212-628-------------QKDII-KVMA.......--------..SVE-WGIM------LLLASLFIF--TMV-----VDELG--
Q81E21_BACCR/4-425-------------WKRVV-TGFQ..AGLNT--------SIGGA-LLAT------MNTGAEFGF--GGV-----IAALP--
Q8EMV3_OCEIH/7-393-------------LRFLT-KFWD...SLAT--------GAQNA-LVAL------ANTCAVVGF--GSV-----AAQVS--
Q8XWF6_RALSO/4-412-------------LRAVK-DRFA..EGSKS--------AVAGA-LLAA------MNTASEYGF--GGV-----IAALP--
Q88BF5_PSESM/5-378-------------YPNLQ-DQKD...RVSA--------HAGSV-LAVV------GLIFAAGIF--TGI-----LTGTG--
Q8I929_DROME/216-650-------------RDDME-HLMH.......--------..RIE-WTTL------LFFAAMFVM--MEC-----VERLG--
Q9K635_BACHD/2-373-------------VGKVK-GFIQ...SMNQ--------GAGGS-VLAI------INTSAAVGF--GSV-----VRAVP--
Q2BIE8_9GAMM/57-578-------------MTEKR-EEVKEFDVMER--------VSRAE-WDTL------LFFYGVILC--VAG-----LSQFG--
Q898H6_CLOTE/4-380-------------WKRID-SPSEWINTLNK--------GAINS-ATAI------LNTAIVVGF--AGV-----VKETP--
YRAO_BACSU/5-384-------------YPNVK-MQKE...RIAE--------HSGNA-ITVV------LLVFSAGVF--AGI-----LSGTK--
Q8FSY6_COREF/59-476-------------FPKVK-DQAE...EMLA--------HSSSI-VGVV------SMVLAAAVL--VGV-----LNGTG--
CITM_BACSU/5-378-------------YPNLE-HQRQ...RIAA--------HSSNV-LAIG------SMIFAAGVF--TGI-----LTGTK--
Q88FZ5_PSEPK/9-557-------------CIDMN-SAYR.......--------..AIH-WQSL------VLIVGMLPF--AQA-----LQKTG--
Q7PVG5_ANOGA/324-759-------------REDIE-SVIS.......--------..RVE-WSTL------LFFAALFIL--MEA-----LSELG--
Q8I930_DROME/315-750-------------IEDME-AILA.......--------..RVE-WSTL------LFFAALFIL--MEA-----LTELG--
Q87EP0_XYLFT/5-388-------------YPNLA-EQRR...RVVN--------HAGNV-LSVV------SLIFAAGIF--TGI-----LSNTG--
Q81I57_BACCR/5-381-------------YPNLE-QQKE...RIAS--------HAGNV-LAVV------SLVFAAGIF--TGI-----LSGTK--
Q9AV23_ORYSJ/16-429-------------FRDAE-PCLD.......--------..KVS-YSLL------VFFSGMFVT--VSG-----FNKTG--
Q8DUC7_STRMU/6-410-------------YPNLK-EQSK...RISE--------NAGDA-VQVV------ILVFAAGIF--MGL-----FQGSG--
Q8NUL8_STAAW/11-402-------------FKSVD-EQME...RLRA--------HAPNA-LMMA------AVIIAAGMF--LGV-----LNETG--
Q88L78_PSEPK/5-379-------------YPQLD-LQKE...RILA--------HSGNA-MTVV------LLVFAAGIF--AGI-----FSGTK--
O81915_ARATH/16-450-------------FKDAR-PSLE.......--------..KVS-YSLL------IFFCGMFIT--VDG-----FNKTG--
Q82YV5_ENTFA/6-407-------------YPKLK-DQSS...RISA--------NAGDA-VQVV------ILVFAAGVF--MGL-----FQGSG--
Q88IC5_PSEPK/4-409-------------FGAIR-TRLA..EGTKS--------AVGGA-LLAA------MNTASEYGF--GAV-----IASLP--
Q9HTA2_PSEAE/5-378-------------YPCIQ-EQKK...RIGA--------HAENI-LAVV------SLIFAAGVF--TGI-----LSGTG--

PF02040

O68021_PSEAI/3-423-------------VAGRG-RVIS---T.RR--------VREAP-WQIV------VFSLGMYLV--VYG-----LKNAG--
ARSB_STAXY/4-426-------------LARKS-KAVH---TKQV--------IKGAP-WNIV------VFSIGMYLV--VFG-----LKNVG--
ARSB2_ECOLX/3-425-------------VANRG-HAIN---TGKV--------LRGAP-WQIV------IFSLGMYLV--VYG-----LRNAG--
YDFA_BACSU/6-428-------------AAQKS-PAVH---TKKV--------VKEAP-WAIV------FFSIGMYVV--VYG-----VRNAG--

PF02447

GNTP_BACLI/1-447-------------KIPIK-QVMD---SCST--------AITQI-GMML------LIIGGGGAF--KQV-----LINGG--
GNTU_ECOLI/4-445-------------GMPKD-KVME---ICGH--------ALQPA-GIIL------LVIGAGGVF--KQV-----LVDSG--
GNUT_PSEAE/9-449-------------GFDSK-KILR---LLDQ--------SLAPT-AAIV------MIIGAGGGF--KQM-----LVASG--
YJHF_ECOLI/1-448-------------GKTIP-DLMD---SCGK--------AIAGI-AGLL------LIIGGGGAF--KQV-----LIDSG--
YGBN_ECOLI/4-454-------------GWSLQ-HTSD---IMGS--------ALPTA-AVVI------LVTGAGGVF--GKV-----LVESG--
GNTT_ECOLI/1-437-------------GRSMD-QIND---TLVS--------SIKII-AMML------LIIGGGGAF--KQV-----LVDSG--
Y1015_HAEIN/6-457-------------DKNTT-ALH.---.LEE--------GVKTA-GIIL------LVTGAGGAL--GAV-----LRDSG--
YOJA_BACSU/1-443-------------KISMQ-EIGR---SISE--------SISQI-AMML------LIIGGGGAF--KQV-----LIDGG--
DSDX_ECOLI/6-444-------------HMSMG-TMLT---HTEN--------GFGSI-ANIL------LIIGAGGAF--NAI-----LKSSS--
GNTP_ZYMMO/7-450-------------GFSSA-DLLK---FTND--------CLGPT-AGIL------LLIGAGGGF--SEI-----LYRAG--
GNTP_ECOLI/4-446-------------GHDMQ-WVMN---AFES--------AVKSI-AMVI------LIIGAGGVL--KQT-----IIDTG--
IDNT_ECOLI/1-437-------------GRTIE-QIMD---IIGD--------SIGAI-AMIV------FIIAGGGAF--KQV-----LVDSG--

PF00939

MEMP_CUPNH/32-513...........IGVMDWK..TMQ----------------QRTP-WGTL------IVFGVGISLGTALL-----STNAG--
CITT_ECOLI/5-486.............VVPWK.DITR----------------YNSA-WNTL------VNLATLVVM..ANG-----LTRSG--
O84207_CHLTR/4-470.............ILDWQKDVLS----------------NTTA-WETF------FWFGALIMM..ASF-----LSAFG--
Q9Z8X7_CHLPN/4-470.............ILDWQKDVIA----------------NTTA-WETF------IWFGALIMM..ASF-----LNQLG--
Q9ZMT7_HELPJ/2-480.............IVSYE.DIIK----------------NKSA-FNIF------LLLGSLLTM..AGG-----LKNVG--
TTDT_ECOLI/4-487.............IISWD.DIVS----------------NKAA-WNVF------FWLASLITL..ATG-----LNNTG--
S13A2_HUMAN/6-565DPENPGKLKAPLGLLDWK..TVN----------------QKMP-WNIV------LLLGGGYAL..AKG-----SERSG--
Y020_HAEIN/3-476.............IVTWD.DILK----------------SKGA-WNTL------VWYGGIIGM..SGL-----LEKSG--
YFLS_BACSU/12-478.............VLTWD.DIKK----------------EQGA-WDTL------TWFAALVML..ANF-----LNELG--
YBHI_ECOLI/3-474.............IVTWE.DVVK----------------NKGG-WNTL------IWYGGIIGL..SSL-----LSKVK--
SOT1_SPIOL/101-569.............VVTWK.ECLA----------------ESVA-WDTL------TWFAALIAM..AGY-----LNKYG--

PF13726

Q9ZL85_HELPJ/10-97----------------------------------------KGN-LNIA------LSYILLGAL--AVA-----IAKSN--
A3YN61_CAMJU/6-93----------------------------------------KEN-LKTA------LSYILLGAI--AAA-----ISKTN--
Q73KL4_TREDE/3-90----------------------------------------GGN-AETA------LSYILLGTL--AAA-----ITSTS--
C8A2Z4_STAAU/3-90----------------------------------------VDG-AEVA------LSYALLGGF--AAL-----ISYSG--
B9EAL6_MACCJ/2-89----------------------------------------VDG-SEVA------LSYALLGGF--AAI-----LSYSG--
C3F6D3_BACTU/2-89----------------------------------------GNS-APIA------LSYAMLGGF--AIS-----LSKTG--
E6U2C3_BACCJ/2-89----------------------------------------GSG-ARIA------LSYAMLGAF--AVA-----ISYTG--
D6XUM8_BACIE/2-89----------------------------------------ETN-VSIA------LSYGLLGAF--AIS-----LNFTG--
A3IGC2_9BACI/8-95----------------------------------------GAG-ATIA------LSYGLLGAF--AIA-----IAKTG--
A7Z8B4_BACA2/2-89----------------------------------------GGN-ATVA------VSYALLGAF--AAA-----LTKTG--
Q2B2R2_9BACI/2-89----------------------------------------GGS-AEVA------LSYALLGGF--AVA-----ISKTG--
B7GKU7_ANOFW/4-91----------------------------------------GNS-AEVA------LSYALLGGF--AIA-----ISKTG--
Q9K7K2_BACHD/2-89----------------------------------------GGN-ATVA------LSYALLGAF--AVA-----ISKTG--
Q5WDV8_BACSK/2-89----------------------------------------GGN-AEIA------FSYALLGGF--AIA-----LAKTG--
C4L1E0_EXISA/2-89----------------------------------------GGG-ASIA------LSYALLGAF--AVG-----LSKTG--
B1YEV1_EXIS2/3-90----------------------------------------GAG-AEIA------LSYALLGAF--AVA-----LSKTG--
A4Y5U0_SHEPC/2-89----------------------------------------GGG-AQIA------LSYALLGAF--AVA-----LSHSG--
Q084K9_SHEFN/4-91----------------------------------------GGG-AQIA------LSYALLGAF--AAA-----LSHSG--
A1F5K2_VIBCL/2-89----------------------------------------GGG-ATIA------LSYAMLGTF--AVA-----ISKSG--
D0YVL6_LISDA/2-89----------------------------------------GGG-ATTA------LSYAMLGTF--AVA-----ISHSG--
Q1ZN28_PHOAS/2-89----------------------------------------GGG-ATIA------LSYAMLGTF--AVA-----ISRSG--
B5FCM4_VIBFM/2-89----------------------------------------GGG-ATIA------LSYAMLGAF--AVA-----ISKSG--
D1B1X3_SULD5/2-89----------------------------------------GGG-ATIA------LSYAMLGAF--AVA-----ISHSG--
A6FIU9_9GAMM/2-89----------------------------------------GGG-ASIA------LNYAMLGAF--AVA-----ISKSG--
A4SNQ6_AERS4/2-89----------------------------------------GGG-AEIA------LSYAMLGAF--AVA-----ISRSG--
Q65UQ2_MANSM/4-91----------------------------------------GGG-AEVA------MNYAILGAF--AVA-----ISKSG--
C5BE39_EDWI9/2-89----------------------------------------GGG-AEIA------LSYAMLGTF--AVA-----ISRSG--
A1TWP4_MARAV/2-89----------------------------------------GGG-ATVA------LSYATLGAF--AVA-----IGKSG--
A4XTU4_PSEMY/2-89----------------------------------------GGG-ATVA------LSYALLGAF--AVA-----IAKSG--
Q02NE5_PSEAB/2-89----------------------------------------GGG-ATVA------LSYAMLGAF--AVA-----IARSG--
Q2BHM1_9GAMM/2-89----------------------------------------GGG-ASVA------LSYALLGGF--AVA-----IAQSG--
C0W230_9ACTO/19-106----------------------------------------AGG-AKIA------LSYALLGAF--AMA-----VAESG--
C0WF19_9CORY/2-89----------------------------------------GGG-AKIA------LSYALLGAF--AMG-----VASAG--
D0WS18_9ACTO/27-114----------------------------------------SGG-AKIA------LSYALLGAF--AMA-----VANSG--
C0E4G0_9CORY/2-89----------------------------------------AGG-AKIA------LSYALLGAF--AMA-----VASSG--
D1DEI3_NEIGO/2-101----------------------------------------EGG-AKIA------LSYAMLGAF--AMA-----ITHSG--
D4DM42_NEIEG/10-109----------------------------------------KGG-AQIA------LSYAMLGAF--AMA-----ITHSG--
Q1Q9H8_PSYCK/4-91----------------------------------------KNG-AQIA------LSYALLGAF--AVA-----IAHSG--
D0BZZ4_9GAMM/2-89----------------------------------------GDG-AEVA------LAYAVLGAF--ALA-----LSKSG--
C0VHK3_9GAMM/2-89----------------------------------------GGG-AKIA------LAYGVLGAF--ALA-----LARSG--
Q1QX04_CHRSD/2-89----------------------------------------GGG-AKVA------LAYATLGAF--AVA-----ISRSG--
A4SIT2_AERS4/144-241----------------------------------------ARM-APVA------IMLLGTGTL--AGI-----IANSG--

PF06450

NHAB_HAEIN/1-513----------------IDQKLFSPIIHFVL--------SAEEN.TQLA------LFYLFNGLL--SSI-----SDNVF--
NHAB_SHEON/1-520----------------IDQQLFAPVIQWAL--------NHEGN.TQLV------IFYIANGLL--SMV-----SDNVF--
A6B3E7_VIBPA/1-515----------------IDQELFKPVIDAVL--------AVEDKGTQLA------LFYVANGLL--SMV-----SDNVF--
NHAB_ECOLI/1-512----------------IDQQLFSPIIQFVL--------QASEH.AQLS------LFYIFNGLL--SSI-----SDNVF--

PF07158

P72556_STRPN/1-148---------------------LMGLSPKEL--------LHFWP-TSLF------FTIFSVSLF--YNF-----AITNG--
Q9KIE8_STRHY/1-149---------------------ALDRTPDEV--------LAGFP-ASMF------LVLVAVTFL--FGI-----ARVNG--
Q9ZIP4_RHILE/1-149---------------------IIGMKTNEI--------FAGFP-SDLF------LTLVAVTYL--FAI-----AQING--
Q8P4U0_XANCP/1-149---------------------WVGLDGKEV--------LAGFP-GDLF------LTLVGITYL--FAI-----AQKNG--
Q9L0A3_STRCO/1-149---------------------VADLDADGI--------FAGFP-GDLF------VVLVGVTYL--FAI-----ARANG--

PF03553

O51582_BORBU/170-435-------------------.....NINKG.--------FLNMA-DLIF------LSILTGG-V--SFA-----VIHNG--
NHAC_BACPE/157-449-------------------..IDGIVNRGG--------LQSMM-WSIS------LVMIALT-L--GGV-----IQRIG--
Q9KQG1_VIBCH/161-453-------------------..IDAILNRGG--------MSSML-GSVA------VIVFGLG-F--GGL-----LDRVG--
Q9K7B7_BACHD/160-482-------------------NGLGGSLWAG.--------IKSML-PAIY------ILIFAWT-L--IGI-----IDGLG--
O25453_HELPY/149-430-------------------KETDSLMDDS.--------VKMMA-FIAF------VMLVASG-F--GEV-----LQKVH--
Q9ZKQ5_HELPJ/165-464-------------------GSFLKLIIEG.--------FKSVG-PAIL------VLTLAWA-I--GPV-----IRDDA--
Q9KBE2_BACHD/142-433-------------------HRGDEVMNEG.--------VKMMG-TIAF------VMLIASG-Y--ATV-----LKETG--
Q9AFA3_VIBHA/1-333-------------------VEIARTLWIG.--------AKSMF-GAIL------ILVFAWT-I--GSV-----IGDMK--
Q9HS26_HALSA/183-491-------------------SSVGGSLYAG.--------AQGFF-PLIV------LVLLIVA-G--AQI-----MIRGG--
Q99VD8_STAAM/151-432-------------------YELDAKFVEG.--------IKIMA-YIGV------VILTANG-F--AGV-----MNATG--
YUIF_BACSU/150-436-------------------DEADSLITDG.--------MVLMA-FIGF------VMLVAAG-F--SNV-----LTKTG--
NHAC_BACSU/159-453-------------------..AAKIINRGG--------LQSMM-GSVS------LIMIAFA-L--GGL-----MEKIG--
O59530_PYRHO/156-486-------------------EETESAIIQG.--------MKQMM-MATV------ILVLAWS-I--KSA-----TEAVG--
Q9K5Y9_BACHD/160-453-------------------..IDTLFNRGG--------IEAMM-YTVS------LTIVAMT-F--GGV-----LENTG--
Q97L22_CLOAB/149-436-------------------..LHNVLKGGG--------IVSML-QPCL------VMFVSCS-L--SGI-----FKELN--
Q99RU7_STAAM/184-446-------------------..LLDAVSKG.--------IISME-DIAM------IALLIGG-L--VGI-----IQHNG--
Q9Y8U6_AERPE/161-510-------------------STAMEYTVKG.--------MYLMV-YANA------ILLLAWS-I--KSA-----ADAVG--
ARCD_HALSA/171-466-------------------..VNNLLSTGG--------LEGSI-WVIT------IVFGALS-I--GGI-----LEATG--
O51583_BORBU/175-441-------------------.....KINEG.--------FLGLG-EMFI------LVISTGG-I--SYM-----TIKYG--
Q97TG1_CLOAB/150-462-------------------AEIEAHIIRG.--------GEKVL-SLVM------ILILSWA-L--TSI-----TQDLG--
Q9K7K2_BACHD/150-434-------------------READQAVTEG.--------MKMMA-FIGF------VMLTAAG-F--AAV-----IRETG--
Q9KSX5_VIBCH/165-497-------------------AEIAKTLWIG.--------AKSMF-GAIL------ILIFAWT-I--GSV-----IGDMK--
Y325_HAEIN/152-444-------------------KESNDIFQQG.--------LRLMA-MIGF------VMIAASG-F--ANV-----INATT--
Q9KT98_VIBCH/150-435-------------------KETHDVFTRG.--------VHMMA-MIGF------IMISAAG-F--AAV-----MKATG--
Q9KMV5_VIBCH/168-494-------------------QTWLSTAPKG.--------VMAMM-PAII------ILLFAWT-I--GGV-----VRDLQ--
MLEN_BACSU/159-452-------------------..LNGLLNRGG--------IVGML-DSLV------VIIFGLG-F--GGL-----LEKLG--
Q9AGE2_YERPS/159-463-------------------SDVPRLLNRGG--------MFSMM-STIL------LVFCAFS-F--AGA-----LTLTG--
Q9JXG2_NEIMB/166-456-------------------DKANDVFGEG.--------IKMMA-MVGF------IMIAAQG-F--AAV-----MNATG--
Q9KMX3_VIBCH/172-442-------------------....KDVYAG.--------FGNMQ-EIFL------LSMLIGG-M--GEL-----MKQQG--
Q9K0Q3_NEIMB/165-476-------------------ADYPKAVWQG.--------AKSMF-GAIA------ILILAWL-I--STV-----VGEMH--
Q9HNR2_HALSA/161-489-------------------GESVDTTVDG.--------FGIML-TAVT------ILVLAWS-I--GNV-----VDALG--
Q9CMF8_PASMU/165-482-------------------AEYGKSWILG.--------VKSML-GAVL------ILLFAWT-I--NTI-----VGDVK--
Q99RX2_STAAM/158-455-------------------SSVKSLLEQGG--------MMSMT-QILV------TIFCGYA-F--AGI-----VEKAG--
Y1586_HAEIN/177-494-------------------PEYVRSWIVG.--------IKSMS-GAIA------ILFFAWT-I--NKI-----VGDMQ--
Y1107_HAEIN/162-461-------------------SDLSRLLNRGG--------MNSMM-GTLL------ICFCALS-F--AGV-----LQLSG--
Q9HNF6_HALSA/156-488-------------------EGATDTIVDG.--------FKTMN-IALA------IIVLAWG-I--GMA-----AEKVG--
Q9HNF7_HALSA/171-467-------------------..VNNLLTTGG--------IAGSA-WTIA------VVVAALS-L--GGL-----LERTG--
Q9I0I5_PSEAE/151-435-------------------KETDDLFTEG.--------MKMMA-TIGF------IMIAAAG-F--AEV-----MKATG--

PF03605

Q9ZEN8_WOLSU/6-382-------------------PDFQAFISNPE--------NKQYV-YGESATL-LNQKLPTSQWV--AMW-----IFLAN--
DCUB_SHIFL/6-376-------------------EEFQKFISVPE--------NREYV-YGDTATL-LDKKLPKSNWL--AMW-----IFLGA--
Q9CJS4_PASMU/5-375-------------------PEYQRRLEDPV--------WRDRI-LNTTSTS-LNETLPPAARH--AVY-----LFLLA--
DCUA_WOLSU/5-365-------------------PVYQERVAKGM--------VKLRG-QTQY...-...VAKPGAKL--SVL-----IFLVG--
Q9KNN2_VIBCH/21-383-------------------PIYQERLAQGL--------IKLAG-TQKR...-...EILPTAKT--ATY-----IFLTA--
DCUB_HAEIN/8-372-------------------PEYQRRLNDPK--------YADIF-ASTT.SV-KEVEVSKTAKI--SVS-----LFLFG--
Q9KMW3_VIBCH/5-373-------------------PEYQARLQDPV--------WREKI-LNTTATS-LDETLPASARN--SVL-----LFISS--
DCUA_SHIFL/5-365-------------------PIYRKRLEEGL--------VELRG-EKQI...-...EIKSGAKT--SVW-----LFLLG--
Q97DH7_CLOAB/5-371-------------------PEFQARVSEGK--------IQDFS-KVER..N-E.KPSTKEAKI--SVI-----IFLIA--
DCUA_HELPJ/7-369-------------------PNYLERLKAGK--------ISPPM-MKKEK..-...ETSKSAKL--SLW-----IFIGG--

PF04165

O29978_ARCFU/17-405-------------------VSIHNRAKLED--------FREIF-RRTVDKK.IILLVFAVMVY--KSV-----IQNSG--
O57766_PYRHO/2-394-------------------ILIPNFMRIN.--------LKEVL-ERAFQPR.IVFLLIAVMYF--KEV-----IEVSG--
Q9V2R1_PYRAB/3-395-------------------ILLPNLKRIS.--------LKEVL-TRAFQPR.IVFLLIAVMYF--KDV-----IEASG--
Q9WYV1_THEMA/3-381-------------------TSGYAVFRRRY--------LLKTL-KQVFNKWDVFLVLFFVYIY--KVV-----VEHSG--

PF02652

LCTP_BACSU/14-536-------------AVIVTGLFSKKFSSRDA--------FASLK-ETGKELWVPIMTICFVMGF--ANL-----ANFAG..
LUTP_BACSU/16-554-------------AAVLS.KFITAISWKDW--------GTVFK-ETVQELKLPILTIASVVGF--AYV-----TNSSG..
LLDP_ECOLI/16-542-------------AALLS.IVWLKMKPSDA--------ISTFG-STLKELALPIYSIGMVLAF--AFI-----SNYSG..
Q9ZMU0_HELPJ/15-536-------------AALLS.VFLLRVKISDA--------IGVFG-ATLKEMRLPILTIGVVLAF--AYV-----ANYSG..
Y1218_HAEIN/2-525-------------ITVLIAIPFFKISSSNV--------KQILV-SSLQQSKNPFIALIGALVM--VNL-----MLVGGE.
O51549_BORBU/4-500-------------ATTIS.YSIRGVPMLKQ--------LKIFT-LTLKKMALSSFIIICIVAI--SRL-----MTHSG..
Q9ZMT9_HELPJ/16-539-------------AALVS.MLVLRVRVSDA--------LSVFG-ETLKEMRYPILTIGLVLSF--AYV-----SNYSG..
O29452_ARCFU/1-535-------------AVLIS.NAVSRLSPKHT--------ARALK-TTAIGVAPAAIALVFAVSL--SQI-----MMNSGNN

PF07854

Q9YFW4_AERPE/15-368---------WY-----FAQL-------------------------------------PSWALYWINT--ISAVVDNATLT
Q8PXG5_METMA/8-368---------EY-----FIQI-------------------------------------PSGILYWVNM--VSAILDNATLA
Q8RCZ3_THETN/45-391---------NY-----IIHL-------------------------------------DSRLLYWINV--TSAVLDNATLA
Q8R782_THETN/2-340---------LY-----IVKM-------------------------------------KSEILYWVNT--ISAIVDNATLA
Q8ZUI4_PYRAE/6-347---------A.-----VAEL-------------------------------------GREYLYVFGL--LSAVADNATLV
O29471_ARCFU/14-358---------WY-----ISKI-------------------------------------PPEIIYWVNM--VSAILDNATLA

PF07399

Q9Z6V2_CHLPN/1-438------LQEWW-----VLNLMQ--------------------------------GLSDFGYMTVSYT--LSIFLDNALVN
Q9F206_9BURK/1-428------QQQWW-----LQPVLL--------------------------------AMDADAVYFGATA--LTAITDNAALT
Q87F98_XYLFT/1-420------QQQWW-----LQPVLL--------------------------------GMTSDQVFFGAAI--LTAFTDNAALT
O84811_CHLTR/1-438------LQEWW-----MLELMH--------------------------------GMSDLGYMMTSYM--FSIFLDNALVN

PF03806

ABGT_ECOLI/14-507------FIAVG-----LTDILESSG------------------LSG---------IPAFVGLALLSS--FLCMFIASGSA
Q9KEI6_BACHD/19-511------IVAIK-----GANFLQTIG------------------FTG---------LPLLLGFIVIAA--LINLMVASASA
Q9KC22_BACHD/13-510------ILGVY-----GATFLDNIQ------------------LTG---------IPLILAFILIAG--FINLFIGSASA
Q9A7U5_CAUCR/48-548------VMAVQ-----GAETLSGLG------------------LPK---------PLLLLSLLIMSS--FLDLLIGSASA
Q99RG0_STAAM/14-511------IAAVK-----GAKLLEHQ.------------------.NG---------IVLILGIIVLSA--MVNMLIGSASA
Q9AA61_CAUCR/39-553------IAAIH-----GAETLKAMN------------------LPA---------PLLLVSVLGFSS--VLDLFIGSASA
Q9KTN8_VIBCH/19-517------MLALY-----GAEGLKAMN------------------LPG---------QATIVGMILLTA--MVNLLVGSASA
Q9KTM2_VIBCH/25-532------VLAVL-----GADFLKDIG------------------LTG---------PMLFFAFILMCG--YINLMIGSASA
Q9RNX1_NEIGO/11-519------YIAVK-----GAVFLKEVG------------------LAG---------SVLFIGFILICA--FINLMIGSASA

PF03606

O51783_BORBU/4-471------MLNAA-----TNFL---YN------------------LPR--------.PLFIILNEIIQI--FIGFVVPSSSG
Y594_HAEIN/12-505------ILDYM-----SNVV---SG------------------MPG--------.SVFILGQLVVFI--FLGLIVPSSSG
Q9CP35_PASMU/1-448------IHALI-----DSVQ---SV------------------SSG--------GFLMMLALALITA--LAAITTGSGNA
Q97NA1_STRPN/11-499------ILNWG-----KEGL---SG------------------LSS--------.QVFIVVTYIFYL--PMSFLIPSSSG
DCUC_SHIFL/5-452------IQSLI-----SIAT---SF------------------GSA--------SIILMLVLVILTM--LAAVTTGSGNA
Q99YT7_STRP1/11-496------ILHLG-----ETSL---SG------------------LSS--------.QVFVILAYIFYL--PMSFLIPSTSG
YFCC_ECOLI/15-502------ILNSI-----ANAI---SG------------------LDN--------.AVAAWFMLLFQA--VFNFFVTSGSG
Q9AAL9_CAUCR/33-506------LLHAM-----GGLT---AL------------------LPD--------.WATALGMLGFQS--AINLVIVSGSG
Q9CMA1_PASMU/2-462------IDTII-----SGAQ---TF------------------GFG--------VFLMTLVMVLIIA--LSAIVMGSGNA
Q9KAH9_BACHD/20-464------IIYGL-----SHAI---SS------------------LPS--------.SITVLGMLVTQG--LFNFFVPSGSG
Q99UT9_STAAM/18-515------ILHFS-----SSLV---QH------------------MSG--------.PLFIIVLLFIFF--CLGFIVPSSSG
DCUC_VIBCH/6-456------IDNLL-----HLAE---VA------------------GAG--------GIALMLILTGLTV--AAAIATGSGNA
DCUD_ECOLI/2-455------VDAVI-----RGAE---HS------------------GLG--------GIGVMIIMALVIA--ICAIVMGSGNA

PF06808

Q9Y8U1_AERPE/115-551------IPTRV-----GFLLLEVGA..................GN.--------.K.ILLVMLAFVFGYLVGLGL-PPVV
Q9K7H0_BACHD/6-417------IPRTF-----TDVVFSNDP..................SA.--------.LYVLLIVALFFF..IGCMFV-DPIV
Q8NN88_CORGL/3-439------VGPQL-----SNWLDSMDL..................PKS--------V..MVIIVCIMCI..VVATPL-SSTA
Q8FA80_ECOL6/7-418------AGVAV-----ANFVTSLTE..................NK.--------.YMFLLIINILLL..TLGMFL-EGNA
Q9CKH6_PASMU/7-420------ISHQV-----ASWVSSVCS..................SP.--------.LEALILINVIVL..FIGMIM-DPTA
O07838_RHOCA/7-430------IPQAL-----GEWMVNAGL..................SW.--------.WMFLIIVNILLL..AAGNFM-EPSS
Q92K76_RHIME/14-514------GHLWV-----EHLLTALPG..................GE.--------.IGFLIAVNVLVF..FLAFFL-DFFE
O29619_ARCFU/128-601------LGFKI-----AAAAIALS...................HGY--------LPIILALTMLVSL..ILGMGV-PTTA
Q8G0A8_BRUSU/148-607------VGFKI-----SYIVTSTAAQLATYFGTILPVSWFAPQTLT--------LLFTLVM