Sequence alignment for CL0184

PF13536

B8J0H9_DESDA/85-197--------------------------------------------------------------------------------
Q30W64_DESDG/78-190--------------------------------------------------------------------------------
B2TJQ9_CLOBB/79-191--------------------------------------------------------------------------------
B1KVC8_CLOBM/79-191--------------------------------------------------------------------------------
Q6AM78_DESPS/78-190--------------------------------------------------------------------------------
A8MJF3_ALKOO/79-191--------------------------------------------------------------------------------
A6TUT9_ALKMQ/87-199--------------------------------------------------------------------------------
B6W8K1_9FIRM/81-193--------------------------------------------------------------------------------
Q14LA4_SPICI/73-193--------------------------------------------------------------------------------
C4L5N6_EXISA/35-152--------------------------------------------------------------------------------
C1EC76_MICSR/42-154--------------------------------------------------------------------------------
Q9KE50_BACHD/35-155--------------------------------------------------------------------------------
Q6ANG8_DESPS/36-150--------------------------------------------------------------------------------
Q0G3H6_9RHIZ/48-151--------------------------------------------------------------------------------
C6C7K8_DICDC/40-153--------------------------------------------------------------------------------
B1YFT7_EXIS2/35-146--------------------------------------------------------------------------------
D7VRB0_9SPHI/41-156--------------------------------------------------------------------------------
C3LF25_BACAC/35-151--------------------------------------------------------------------------------
A1SUW4_PSYIN/36-150--------------------------------------------------------------------------------
Q4MHH3_BACCE/35-151--------------------------------------------------------------------------------
Q4FTR9_PSYA2/36-150--------------------------------------------------------------------------------
A0RFB5_BACAH/35-151--------------------------------------------------------------------------------
Q29AX3_DROPS/271-397--------------------------------------------------------------------------------
B0W9C1_CULQU/259-385--------------------------------------------------------------------------------
B1HZ47_LYSSC/43-163--------------------------------------------------------------------------------
A5WDV4_PSYWF/36-149--------------------------------------------------------------------------------
C2MRF9_BACCE/12-136--------------------------------------------------------------------------------
B2ZC64_9GAMM/12-126--------------------------------------------------------------------------------
C2P113_BACCE/12-136--------------------------------------------------------------------------------
D5WE59_BURSC/39-154--------------------------------------------------------------------------------
C2WCR1_BACCE/35-159--------------------------------------------------------------------------------
B8BX33_THAPS/230-337--------------------------------------------------------------------------------
Q4CM94_TRYCC/68-183--------------------------------------------------------------------------------
Q4SHD3_TETNG/80-186--------------------------------------------------------------------------------
B0CPS2_LACBS/61-181--------------------------------------------------------------------------------
A7Z3M1_BACA2/35-159--------------------------------------------------------------------------------
B0B9E1_CHLT2/32-143--------------------------------------------------------------------------------
C2KU03_9ACTO/27-127--------------------------------------------------------------------------------
A5WEC6_PSYWF/36-151--------------------------------------------------------------------------------
C6JKK4_FUSVA/36-156--------------------------------------------------------------------------------
Q13J39_BURXL/39-154--------------------------------------------------------------------------------
E8WPA4_GEOS8/36-150--------------------------------------------------------------------------------
E6VZC7_DESAO/35-148--------------------------------------------------------------------------------
D1AJ88_SEBTE/34-147--------------------------------------------------------------------------------
B5ZTE1_RHILW/38-151--------------------------------------------------------------------------------
C4LLH4_CORK4/10-124--------------------------------------------------------------------------------
C0QIH1_DESAH/36-150--------------------------------------------------------------------------------
C6E0G2_GEOSM/36-150--------------------------------------------------------------------------------
C7PA25_CHIPD/42-158--------------------------------------------------------------------------------
A6CI48_9BACI/35-159--------------------------------------------------------------------------------
C6R7K6_9CORY/19-136--------------------------------------------------------------------------------
A1R4E7_ARTAT/168-283--------------------------------------------------------------------------------

PF00892

YCXC_BACSU/18-142-------------------------------------------------FI-IGL-------------------------
YHBE_SHIFL/169-292-------------------------------------------------TV-WVS-------------------------
YBFH_BACSU/18-141-------------------------------------------------LI-WGT-------------------------
Y1552_ARCFU/19-133-------------------------------------------------VL-MGT-------------------------
YD3A_METJA/13-135-------------------------------------------------VF-YGV-------------------------
YYAM_BACSU/15-140-------------------------------------------------IF-TGA-------------------------
YXXF_BACSU/166-292-------------------------------------------------VL-AAL-------------------------
O58666_PYRHO/13-134-------------------------------------------------LI-GML-------------------------
Y355_SYNY3/182-308-------------------------------------------------LS-MAV-------------------------
O58347_PYRHO/160-285-------------------------------------------------IL-WSI-------------------------
Y510_ARCFU/159-285-------------------------------------------------FL-WAV-------------------------
Y355_SYNY3/22-146-------------------------------------------------FL-WGT-------------------------
O80521_ARATH/206-335-------------------------------------------------VS-WAA-------------------------
Y1533_ARCFU/154-274-------------------------------------------------FS-WAL-------------------------
O59388_PYRHO/20-144-------------------------------------------------FT-WAL-------------------------
O50525_STRCO/162-288-------------------------------------------------VA-WGV-------------------------
YDFC_BACSU/17-140-------------------------------------------------GL-WAS-------------------------
O68125_RHOCA/19-144-------------------------------------------------LF-WAG-------------------------
SAM_RICPR/160-281-------------------------------------------------IS-FAM-------------------------
Q9Z6F0_MYCSM/162-288-------------------------------------------------IA-AAI-------------------------
YXXF_BACSU/24-147-------------------------------------------------VI-FGS-------------------------
Q9Z6F0_MYCSM/18-141-------------------------------------------------AA-FSF-------------------------
O86204_ECOLX/16-139-------------------------------------------------FS-WGA-------------------------
YTR1_BUCSC/162-288-------------------------------------------------TS-HAI-------------------------
Y1552_ARCFU/150-269-------------------------------------------------LS-YAI-------------------------
Q9ZAR1_ENTAG/155-287-------------------------------------------------IF-WAI-------------------------
O85844_SPHAR/180-306-------------------------------------------------FL-YSA-------------------------
YVBV_BACSU/18-141-------------------------------------------------IM-WGV-------------------------
YDED_BACSU/171-296-------------------------------------------------FA-AAF-------------------------
O59158_PYRHO/33-155-------------------------------------------------LL-WST-------------------------
Q9Z799_CHLPN/11-135-------------------------------------------------FI-WSS-------------------------
YIJE_ECOLI/20-142-------------------------------------------------LI-WSY-------------------------
YCBK_BACSU/173-303-------------------------------------------------AV-YAG-------------------------
SAM_RICPR/20-142-------------------------------------------------VT-SSI-------------------------
O66073_BACLI/169-302-------------------------------------------------LS-SAG-------------------------
Y1533_ARCFU/12-136-------------------------------------------------IC-WAF-------------------------
YETK_BACSU/187-314-------------------------------------------------IG-EAL-------------------------
O57793_PYRHO/12-137-------------------------------------------------SM-WGT-------------------------
Y266_ARCFU/12-133-------------------------------------------------TF-WGL-------------------------
Q9ZF46_BACME/165-289-------------------------------------------------VT-SAF-------------------------
Y510_ARCFU/14-136-------------------------------------------------LI-WAG-------------------------
Y878_HAEIN/166-289-------------------------------------------------LI-WVA-------------------------
YSO2_ACIAM/116-237-------------------------------------------------FF-WAL-------------------------
Y1164_SYNY3/191-319-------------------------------------------------FI-SAI-------------------------
YDED_BACSU/18-149-------------------------------------------------TC-WGI-------------------------
Y976A_HAEIN/35-161-------------------------------------------------II-FAA-------------------------
O68125_RHOCA/168-295-------------------------------------------------VA-WAL-------------------------
Y788_ARCFU/178-306-------------------------------------------------LF-CAL-------------------------
PECM_DICD3/12-130-------------------------------------------------CV-WGT-------------------------
O58983_PYRHO/16-140-------------------------------------------------FF-ASL-------------------------
YEDA_ECOLI/160-285-------------------------------------------------IS-WAF-------------------------
Y1164_SYNY3/39-164-------------------------------------------------IE-LGK-------------------------
Y878_HAEIN/17-142-------------------------------------------------MA-WGS-------------------------
YTR1_BUCSC/16-140-------------------------------------------------IT-WGT-------------------------
YWFM_BACSU/15-138-------------------------------------------------FF-WGT-------------------------
O85844_SPHAR/31-156-------------------------------------------------FF-WAL-------------------------
Y266_ARCFU/150-274-------------------------------------------------VA-AAI-------------------------
O57793_PYRHO/155-274-------------------------------------------------FT-YAL-------------------------
YVBV_BACSU/161-287-------------------------------------------------VS-WAL-------------------------
YHBE_SHIFL/17-144-------------------------------------------------IC-WGA-------------------------
YICL_ECOLI/16-145-------------------------------------------------VL-WGS-------------------------
PAGO_SALTY/161-287-------------------------------------------------LI-HAI-------------------------
O66073_BACLI/23-147-------------------------------------------------FY-HWF-------------------------
Y270_BUCAP/15-139-------------------------------------------------IT-WGT-------------------------
O59388_PYRHO/165-290-------------------------------------------------LL-WTI-------------------------
RHTA_ECOLI/158-281-------------------------------------------------AC-WAI-------------------------
YIJE_ECOLI/162-290-------------------------------------------------VS-WGA-------------------------
O50525_STRCO/20-140-------------------------------------------------GV-WGA-------------------------
Q56929_YEREN/17-141-------------------------------------------------VT-WGT-------------------------
O67627_AQUAE/15-141-------------------------------------------------FI-WGT-------------------------
Y841_METTH/216-340-------------------------------------------------FF-WSL-------------------------
Y788_ARCFU/52-166-------------------------------------------------LI-WGS-------------------------
SAMHT_CHLTR/34-158-------------------------------------------------FI-WSS-------------------------
Y1234_HELPY/17-141-------------------------------------------------LC-FGI-------------------------
YOAV_BACSU/13-137-------------------------------------------------LI-WGY-------------------------
O85268_YEREN/163-289-------------------------------------------------IM-HAL-------------------------
Q9ZF46_BACME/15-143-------------------------------------------------TM-WGV-------------------------
YEDA_ECOLI/18-141-------------------------------------------------II-WGS-------------------------
YETK_BACSU/38-163-------------------------------------------------AI-VGS-------------------------
O58347_PYRHO/13-140-------------------------------------------------FC-WGT-------------------------
YRDR_BACSU/175-300-------------------------------------------------VY-TMG-------------------------
YDFC_BACSU/160-285-------------------------------------------------FS-ESI-------------------------
YCB6_PSEDE/14-140-------------------------------------------------AF-AAL-------------------------
Y841_METTH/55-192-------------------------------------------------IF-FGI-------------------------
YICL_ECOLI/167-291-------------------------------------------------FA-AAF-------------------------
Q9ZAR1_ENTAG/14-139-------------------------------------------------LI-WGT-------------------------
O59158_PYRHO/178-298-------------------------------------------------II-WAI-------------------------
Y270_BUCAP/161-287-------------------------------------------------LS-HAV-------------------------
PAGO_SALTY/15-139-------------------------------------------------LT-WGT-------------------------
YOAV_BACSU/159-285-------------------------------------------------LS-WGI-------------------------
SAMHT_CHLTR/185-314-------------------------------------------------LS-SYG-------------------------
O86204_ECOLX/162-286-------------------------------------------------LS-AAF-------------------------
YRDR_BACSU/18-146-------------------------------------------------MS-WGA-------------------------
Y3017_CLOK5/166-292-------------------------------------------------VV-WSL-------------------------
Y1319_SYNY3/191-316-------------------------------------------------IV-YAG-------------------------
YWFM_BACSU/158-282-------------------------------------------------AS-FAG-------------------------
YYAM_BACSU/164-290-------------------------------------------------VC-WAL-------------------------
O58324_PYRHO/19-137-------------------------------------------------AI-WGT-------------------------

PF04142

S35A5_HUMAN/78-366-------------------------HQSRNLKYASWKEF...SDFM-KWSI-PAF-------------------------
O76865_DROME/83-334-------------------------KFVRSLHKTIIANP...MDTL-KVCV-PSL-------------------------
GMS1_SCHPO/79-315-------------------------KEAKLRAFLPQIFG...GDSW-KLAI-PAF-------------------------
S35A2_HUMAN/96-331-------------------------HLVLFLHEAVLVQY...VDTL-KLAV-PSL-------------------------
UGTP1_CAEEL/104-343-------------------------QFSEQVSKYYINAP...RELA-KMSV-PSF-------------------------
S35A1_HUMAN/72-306-------------------------RFKASLRENVLGSP...KELL-KLSV-PSL-------------------------
O02345_CAEEL/69-352-------------------------KGLRKIHHEFFVNW...RDTL-KVLV-PSA-------------------------
S35A3_CANFA/68-306-------------------------ALNRILHDEILNKP...METL-KLAI-PSG-------------------------
O16658_CAEEL/74-318-------------------------GMLNELNREIFASPQTRADSL-KVAV-PAI-------------------------
O01879_CAEEL/71-306-------------------------KYINELKLAIFEHR...SETL-KVCI-PAL-------------------------

PF05653

Q90YI4_TAKRU/4-304--------------------------------NRLDFYIGLSLAVS-SSAF-IGA-------------------------
NIPA2_HUMAN/6-306--------------------------------GKYDFYIGLGLAMS-SSIF-IGG-------------------------
Q9VK62_DROME/41-342--------------------------------SNTDFYIGVGLAIS-SCFF-IGS-------------------------
Q9SST0_ARATH/15-267--------------------------------MSSDNVKGLVLALS-SSIF-IGA-------------------------
Q8LA45_ARATH/1-300--------------------------------MSPDNIHGVILAVS-SSIF-IGS-------------------------
Q9SKQ1_ARATH/1-295--------------------------------METDNGKGLILAVA-SSVF-IGS-------------------------
NPAL2_MOUSE/43-336--------------------------------RNQIHLFGVLLAIL-GNLV-ISI-------------------------

PF10639

Q4TT81_CAEEL/12-122-------------------------------------------IIV-VGFV-WGA-------------------------
Q4V4P6_DROME/6-122-------------------------------------------LLA-VGLL-WGV-------------------------
A0C2W3_PARTE/7-116-------------------------------------------LLV-VGII-WGI-------------------------
Q4D1L3_TRYCC/4-115-------------------------------------------LLL-AAII-WGI-------------------------
Q22BW6_TETTS/16-127-------------------------------------------LIL-VGIM-WGI-------------------------
Q4RMD0_TETNG/95-210-------------------------------------------LLL-VSVL-WGC-------------------------
TM234_ANOGA/20-135-------------------------------------------ILL-VAIM-WGA-------------------------
TM234_PONAB/11-126-------------------------------------------LVL-VAAL-WGG-------------------------
Q0U0B5_PHANO/22-148-------------------------------------------FLM-VGAC-WGL-------------------------
A4I0H4_LEIIN/5-115-------------------------------------------MLL-AALL-WGV-------------------------
TM234_DICDI/9-124-------------------------------------------LLL-VGFI-WGG-------------------------
A4FVN3_DANRE/1-116-------------------------------------------LLL-VAIL-WGG-------------------------
A7SF34_NEMVE/12-127-------------------------------------------LLG-VALL-WGV-------------------------
Q57W61_TRYB2/4-115-------------------------------------------LLL-AGII-WGI-------------------------
Q5B4G5_EMENI/114-201-------------------------------------------TKV-VSLF-WTV-------------------------
Q179X3_AEDAE/11-126-------------------------------------------IVV-VALL-WGA-------------------------

PF00893

QACC_STAAU/1-93-------------------------------------------------MP-YI.-------------------------
MMR_MYCTU/1-94-------------------------------------------------MI-YL.-------------------------
EMRE_ECOLI/2-94-------------------------------------------------NP-YI.-------------------------
YVAE_BACSU/1-93-------------------------------------------------MN-WV.-------------------------
P96460_STAAU/1-93-------------------------------------------------MP-YI.-------------------------
MDTI_ECOLI/4-99-------------------------------------------------FE-WVH-------------------------
Q7B1Y7_SALEN/2-94-------------------------------------------------KG-WL.-------------------------
YVDS_BACSU/1-89-------------------------------------------------MN-WV.-------------------------
EBRB_BACSU/2-94-------------------------------------------------RG-LL.-------------------------
YKKD_BACSU/2-94-------------------------------------------------LH-WI.-------------------------
EBRA_BACSU/3-95-------------------------------------------------IG-YI.-------------------------
YVDR_BACSU/1-93-------------------------------------------------MA-WF.-------------------------
MDTJ_SHIFL/3-95-------------------------------------------------IY-WI.-------------------------
Y4NH_RHISN/1-106-------------------------------------------------MN-AVP-------------------------
YKKC_BACSU/1-90-------------------------------------------------MK-WG.-------------------------
SUGE_SHIFL/1-93-------------------------------------------------MS-WI.-------------------------
SUGE_PROVU/1-93-------------------------------------------------MS-WI.-------------------------

PF04657

Q21DH8_SACD2/19-159------------------------------------------LPAM.LALL-AGA-------------------------
Q8CTN3_STAES/3-144------------------------------------------FLYL.LGIF-VGM-------------------------
Q39SB9_GEOMG/5-141------------------------------------------ALFL.LMMC-GGT-------------------------
A6TN22_ALKMQ/4-138------------------------------------------IAML.LSIL-AGV-------------------------
A3QFA9_SHELP/30-170------------------------------------------LNLM.LGLL-GGV-------------------------
A6VSJ3_MARMS/9-148------------------------------------------MLAA.VAVI-AGA-------------------------
Q6M695_CORGL/164-304------------------------------------------LWRL.FGVV-MGM-------------------------
B8FYQ2_DESHD/4-140------------------------------------------LFVL.VALC-GGM-------------------------
Q1GQL8_SPHAL/9-147------------------------------------------AFAA.IMLL-TGV-------------------------
Q1Z706_PHOPR/6-152------------------------------------------FNIV.LALI-GGA-------------------------
Q1QZC8_CHRSD/5-140------------------------------------------VILL.AVLL-AGM-------------------------
A5W524_PSEP1/11-150------------------------------------------LPAA.MALL-AGA-------------------------
Q1QB44_PSYCK/4-140------------------------------------------LLIL.IVVL-GGM-------------------------
Q394M9_BURS3/11-150------------------------------------------PLAV.AAFV-AGA-------------------------
Q2RGM8_MOOTA/15-156------------------------------------------VFFF.LALG-IGA-------------------------
Q0AXV4_SYNWW/5-143------------------------------------------LYLS.LAAL-SGA-------------------------
Q390H3_BURS3/7-143------------------------------------------GLAA.IAAI-GGC-------------------------
Q7N4X7_PHOLL/3-137------------------------------------------SLIF.IAFL-NGI-------------------------
Q49VG4_STAS1/3-144------------------------------------------LLYI.IGIV-AGM-------------------------
Q03TA8_LACBA/2-142------------------------------------------LPVT.IGII-IGG-------------------------
A6LU87_CLOB8/1-136------------------------------------------MYNI.LSLL-IGV-------------------------
A0SZ10_9BURK/18-157------------------------------------------VFAP.LAML-AGA-------------------------
Q03TA8_LACBA/164-305------------------------------------------PWRL.LGIV-GGA-------------------------
Q11NT1_CYTH3/6-142------------------------------------------TTFI.MLAI-AGI-------------------------
A0RGL9_BACAH/9-144------------------------------------------LYNF.LSVF-IGV-------------------------
A0PSE0_MYCUA/6-144------------------------------------------IIPF.I.IL-GGA-------------------------
A4FZS2_METM5/5-144------------------------------------------WALI.FAIV-VGF-------------------------
Q0SPU1_CLOPS/2-138------------------------------------------LGII.LAII-SGA-------------------------
A1VA83_DESVV/4-141------------------------------------------VLLL.MGLL-AGA-------------------------
Q0FRW8_9RHOB/3-140------------------------------------------IHAL.TMLA-AGI-------------------------
A0AHV4_LISW6/4-145------------------------------------------LFIV.SGLL-AGM-------------------------
Q0KF63_CUPNH/16-155------------------------------------------LPLG.TAVL-AGA-------------------------
A1AK06_PELPD/5-141------------------------------------------TLIL.LMLC-GGM-------------------------
Q1M5R3_RHIL3/11-151------------------------------------------IYFI.GAFA-TGG-------------------------
Q5KZC7_GEOKA/4-140------------------------------------------VWML.LALT-AGM-------------------------
A9VF57_BACWK/2-138------------------------------------------IGFS.LAIL-AGI-------------------------
Q0I1U4_HAES1/4-144------------------------------------------PFIL.IALC-AGI-------------------------
Q4KHW5_PSEF5/5-144------------------------------------------ISIL.LSLL-AGF-------------------------
Q49VG4_STAS1/163-305------------------------------------------IWLV.IGFI-FGF-------------------------
A0JUK3_ARTS2/163-299------------------------------------------LPVL.LPVI-AGF-------------------------
Q7UTT1_RHOBA/5-133------------------------------------------IWIL.MALA-AGS-------------------------
Q03HH1_PEDPA/168-308------------------------------------------LWQI.FGVL-VGG-------------------------
Q03HH1_PEDPA/2-142------------------------------------------GLLM.LGLV-AGA-------------------------
A6VKF2_ACTSZ/4-143------------------------------------------PYFL.LALV-AGA-------------------------
A0L1U7_SHESA/3-135------------------------------------------LMVL.IALL-NGG-------------------------
A4WAQ0_ENT38/5-143------------------------------------------LTLV.FLVA-AGI-------------------------
Q03Y21_LEUMM/166-301------------------------------------------LNRL.WAFG-AGI-------------------------
B1YHB6_EXIS2/3-139------------------------------------------LGIV.LALF-GGM-------------------------
A1ACJ4_ECOK1/10-155------------------------------------------LWML.ATIL-AGM-------------------------
Q3A9B8_CARHZ/6-140------------------------------------------LAYM.IAAL-AGM-------------------------
A8MKQ0_ALKOO/2-138------------------------------------------LGII.FSIL-AGI-------------------------
B1YEL8_EXIS2/4-140------------------------------------------IYYL.LALL-AGI-------------------------
Q8YKX2_NOSS1/5-144------------------------------------------LALL.GAGS-AGG-------------------------
Q12R75_SHEDO/9-146------------------------------------------FYGL.LMCA-AGI-------------------------
Q99VZ6_STAAM/3-144------------------------------------------LFYI.IGVL-VGM-------------------------
Q9RVB6_DEIRA/8-144------------------------------------------LVLL.GTLG-AGL-------------------------
A1A0P8_BIFAA/203-343------------------------------------------LWSC.AGIA-FGM-------------------------
Q1IEL2_PSEE4/9-148------------------------------------------LPLL.VALL-AGA-------------------------
Q749R3_GEOSL/5-141------------------------------------------VLFL.LMMC-GGV-------------------------
A6M3J1_CLOB8/2-138------------------------------------------FGII.CAII-SGI-------------------------
A1ZMZ7_9BACT/5-145------------------------------------------ILST.LAFT-GGV-------------------------
Q02XB9_LACLS/3-143------------------------------------------IYLA.FALV-GGF-------------------------
Q65J95_BACLD/5-146------------------------------------------LILI.AGIL-AGM-------------------------
Q28TA8_JANSC/7-146------------------------------------------LVIA.LVVA-VGA-------------------------
Q12K32_SHEDO/8-147------------------------------------------LLLP.FSIL-VGF-------------------------
A9VF55_BACWK/2-138------------------------------------------KGIL.LSVF-GGV-------------------------
Q9RVB7_DEIRA/19-157------------------------------------------GPLL.LLIA-AGA-------------------------
A3QFA8_SHELP/3-133------------------------------------------TLLL.LALL-NGV-------------------------
A5G8U5_GEOUR/6-141------------------------------------------LFF..LMFC-GGF-------------------------
A8M2W9_SALAI/175-312------------------------------------------TLAV.LPLL-AGF-------------------------
Q0FHQ8_9RHOB/5-139------------------------------------------VTLL.LLAT-AGT-------------------------
Q8YKX1_NOSS1/33-172------------------------------------------LYVL.LALL-NGA-------------------------
Q3K9Q1_PSEPF/5-141------------------------------------------ILLA.VVVL-AGA-------------------------
A9KHN5_CLOPH/2-140------------------------------------------IGWI.VALI-SGA-------------------------
Q8FQJ9_COREF/99-239------------------------------------------LWRG.LGLL-MGA-------------------------
B1YGF5_EXIS2/14-153------------------------------------------LAII.IGLI-IGI-------------------------
Q6D0D7_ERWCT/13-152------------------------------------------LPLG.IAVL-AGS-------------------------
A8LKG3_DINSH/5-143------------------------------------------LAIG.AIAL-GGA-------------------------
A9VMR7_BACWK/2-136------------------------------------------LYIC.IAIL-AGV-------------------------
Q1QB43_PSYCK/5-141------------------------------------------LMIV.LAII-GGA-------------------------
Q28R25_JANSC/3-140------------------------------------------TQAL.IMVL-AGI-------------------------
Q4L439_STAHJ/163-304------------------------------------------VWLI.IGFI-FGF-------------------------
Q316U3_DESDG/4-143------------------------------------------LLFV.MALL-AGA-------------------------
B1YGF5_EXIS2/179-317------------------------------------------GWRI.MGVV-MGM-------------------------
Q4L439_STAHJ/3-144------------------------------------------FLFI.LGIV-AGM-------------------------
Q65QN9_MANSM/39-179------------------------------------------PYIL.IALI-AGT-------------------------
B1YIK4_EXIS2/3-139------------------------------------------LGMF.CAIV-AGM-------------------------
Q04FL6_OENOB/173-313------------------------------------------FWRI.GGIV-TGM-------------------------
Q31P27_SYNE7/5-144------------------------------------------IALL.GAGS-GGG-------------------------
Q5R178_IDILO/5-143------------------------------------------ILVI.LAIA-AGM-------------------------
A9BWW9_DELAS/11-150------------------------------------------APVA.LALL-AGA-------------------------
A0PXE0_CLONN/7-143------------------------------------------LGFI.YSVV-AGI-------------------------
Q8XG26_SALTI/5-143------------------------------------------LTLI.FLIA-AGV-------------------------
A0L1U8_SHESA/9-158------------------------------------------LFMSFVALC-SGV-------------------------
Q6FEY6_ACIAD/10-149------------------------------------------LLLP.LALG-IGI-------------------------
Q02XB9_LACLS/164-303------------------------------------------GWRI.WAVI-AGA-------------------------
Q03UQ1_LEUMM/173-314------------------------------------------PWQF.LGFV-TGM-------------------------
Q02QF4_PSEAB/5-144------------------------------------------LMVL.MAVS-VGG-------------------------
Q97DD1_CLOAB/2-138------------------------------------------IGII.SSII-SGI-------------------------
Q5Z3K6_NOCFA/3-148------------------------------------------LGLV.FGFC-IGA-------------------------
Q67KE9_SYMTH/5-146------------------------------------------LFWL.IIIL-GGV-------------------------
Q4V1I7_BACCZ/4-142------------------------------------------LFLI.FAFL-AGL-------------------------
Q2RM98_MOOTA/3-140------------------------------------------LALL.IALV-SGI-------------------------
Q65J96_BACLD/10-156------------------------------------------LFMM.LGLF-AGM-------------------------
Q6SF41_9BACT/5-142------------------------------------------TYAV.IMLA-AGL-------------------------
Q1LCM1_RALME/14-153------------------------------------------MPLG.VALL-AGA-------------------------
A4W7U3_ENT38/4-140------------------------------------------IMII.LAVI-GGA-------------------------
Q4VSJ2_BURGL/11-150------------------------------------------TLAG.AALV-AGA-------------------------
Q02FK6_PSEAB/7-145------------------------------------------WLFV.LPLL-AGA-------------------------
Q7NSE3_CHRVO/15-151------------------------------------------GLSA.LALL-AGA-------------------------
Q1ZWQ0_PHOAS/6-148------------------------------------------FHLS.LAMA-GGV-------------------------
A6LU86_CLOB8/2-134------------------------------------------FFVL.ISIA-AGA-------------------------
Q9CJV1_PASMU/4-144------------------------------------------FYTI.IALV-AGV-------------------------
Q53WI3_THET8/6-144------------------------------------------AWVL.LALL-AGA-------------------------
A9CIC3_AGRT5/3-135------------------------------------------VWIA.MAFA-GGV-------------------------
Q0BSA2_GRABC/6-144------------------------------------------LYPL.I.LI-AGA-------------------------
Q99VZ6_STAAM/163-305------------------------------------------FWLL.LGFI-FGF-------------------------
B8G001_DESHD/7-144------------------------------------------LPAV.IAAI-SGI-------------------------
B1YHB4_EXIS2/2-138------------------------------------------RGIL.FAIS-GGF-------------------------
Q3HKF8_RHOS4/5-144------------------------------------------VLSC.LALV-SGA-------------------------
Q18BT7_CLOD6/5-139------------------------------------------WAII.FALL-AGG-------------------------
A0AHV3_LISW6/11-151------------------------------------------LFMA.MGLV-SGL-------------------------
Q3K9Q0_PSEPF/22-158------------------------------------------LLLP.LVIL-AGM-------------------------
B1YIK3_EXIS2/2-138------------------------------------------KGIV.FALF-SGL-------------------------
A1HTC3_9FIRM/8-146------------------------------------------LALL.LALI-SGV-------------------------
A0B2B3_BURCH/5-144------------------------------------------LSYL.LVVA-AGI-------------------------
Q1QZC9_CHRSD/5-141------------------------------------------FIFL.VLLV-GGA-------------------------
A4W7U4_ENT38/4-140------------------------------------------VFIL.MVIA-GGM-------------------------
Q7NSE2_CHRVO/2-129------------------------------------------FFMT.LAIA-NGL-------------------------
Q1ZWP9_PHOAS/4-134------------------------------------------LVIC.LALL-NGC-------------------------
Q5HRB7_STAEQ/151-293------------------------------------------FWLL.IGFV-FGF-------------------------
A5D651_PELTS/6-144------------------------------------------LPLA.IAAL-SGI-------------------------
Q7P1D2_CHRVO/22-162------------------------------------------IFPL.LAFL-VGV-------------------------
Q3KGP6_PSEPF/8-147------------------------------------------GWLL.LAVF-AGA-------------------------
A4J0N8_DESRM/6-144------------------------------------------LALI.IAAI-SGL-------------------------
A4XQ88_PSEMY/7-145------------------------------------------WLLA.LPFI-AGA-------------------------
Q03UQ1_LEUMM/2-142------------------------------------------PLFI.LGLV-IGF-------------------------
Q168E1_ROSDO/6-143------------------------------------------QYAF.TMVL-AGI-------------------------
Q1WV36_LACS1/3-143------------------------------------------LLAL.IPVF-MGS-------------------------
A1A0P8_BIFAA/19-158------------------------------------------LQGL.LGIF-SGL-------------------------
Q03Y21_LEUMM/4-142------------------------------------------IYIA.LAIG-AGL-------------------------
Q98M54_RHILO/5-145------------------------------------------VWSL.LGIL-SGA-------------------------
Q899N2_CLOTE/13-149------------------------------------------LGII.FSII-AGI-------------------------
Q6M695_CORGL/2-142------------------------------------------LAVL.FGVV-AGA-------------------------
Q04FL6_OENOB/2-142------------------------------------------FAVI.IGLS-IGI-------------------------
B1YEL9_EXIS2/4-140------------------------------------------ALLG.MTLL-GGI-------------------------
Q2KZA1_BORA1/11-150------------------------------------------LPML.IALL-AGA-------------------------

PF06800

GLCU_STAXY/16-280VVLINVLV.GGGPYNQIRGTTFGALIIGIILLLTGNAKFDD.LTIIIVGLI-SGA-------------------------
RBSU_LACSS/19-290FPVIVGKI.GGKPASQILGTTFGTLILAIVVAIFRGTPIP.ETKTFIFCLI-SGA-------------------------
GLCU_STAES/19-283VVIINVFV.GGGPYNQIRGTTLGTLFIGFSLLATGHAAFD.NLTVIIVGLV-SGA-------------------------
Y169_LISMO/16-280MPLVVSKI.GGKPRQQIIGTTFGALAFAIGVFIFTNPEYTA..TIIIASFV-SGA-------------------------
Y2594_LACPL/16-279NPLLVGKI.NGHSENEMFGMGIGDGLIALIFWLFSQPTVTISGVTFGLAMI-SGA-------------------------
RBSU_STAAW/19-289FPTVASKF.GGKPVHQIIGATVGTLIFAIILAVVTSSGFP.TGTNLLFALL-SGA-------------------------
Y2503_LACPL/16-280IGLISGRM.GGTARQQTLGMTMGALVFGLALWAVEQPTLTS..KIWLIGIV-SGL-------------------------
GLCU_BACSU/16-280IVLFNVKL.GGGPYSQTLGTTIGALIVSIVIYFFVQPVLSL..RIFIVGIV-SGL-------------------------
Y424_LISMO/17-281MPIIANLR.KSTPEEQLLGTSISALLFALILFWILSPEI..TVLSFIVSFI-SGI-------------------------
RBSU_STAES/19-289FPTIASKF.GGRPVNQIFGATVGTLIFAIVLALFKGIGLP.GGMALVFSLI-SGA-------------------------
RBSU_LACPL/19-291YPTIASKI.GGRPVNQILGSTIGTLIFALIYAWVQGIAFP.SGMNLWFSIL-SGI-------------------------
Y176_LISMO/16-280VPLIITKF.GGSTRQQTMGMTLGALTFAVIVFFFTDPVY..TLKTVGISFI-TGC-------------------------
GLCU_BACME/16-281IVLFNVKL.GGGPYSQTLGTTLGALIFSIGIYIFVHPTFTP..LIFGVGVV-SGL-------------------------
Y2157_STRA5/17-282IGFVSNKI.GGRPNQQTFGMTLGALLFAIIVWLFKQPEMTA..SLWIFGIL-GGI-------------------------
YXFA_LACLA/17-288IGFVANKF.GGDAKQQTLGMTLGAFVFALIVFLFRMPTLTW..QIFLIGFI-GGL-------------------------
Y2205_STRP1/17-282IGFVSNKI.GGKPSQQTLGMTFGALLFSLAVWLIVRPEMTL..QLWLFGIL-GGF-------------------------
YSUP_LACHE/16-280FSLIAGKIKNSHPANELMGLGTGALIIGIITAIIHPASS..NITIFSLSLI-SGM-------------------------

PF02694

Y2672_MYCBO/2-109-------------------------------------------------VV-RSI-------------------------
YFJF_BACSU/2-109-------------------------------------------------ML-ITI-------------------------
YNFA_ECOLI/1-108-------------------------------------------------MI-KTT-------------------------
Y793_SYNY3/2-108-------------------------------------------------IL-RSL-------------------------

PF07857

Q9U3C0_CAEEL/17-268----------------------------------------GYVALLLSCCA-FGT-------------------------
O01810_CAEEL/6-270----------------------------------------GLAACAVSSVF-FGS-------------------------
TM144_HUMAN/11-263----------------------------------------GYISCFVAILL-FGS-------------------------
TM144_CAEEL/6-264----------------------------------------GLSACALSSVL-FGS-------------------------
Q20583_CAEEL/8-246----------------------------------------GIVCAVVSAIT-FGS-------------------------
Q95QA2_CAEEL/4-261----------------------------------------GILACLTATFT-LGS-------------------------

PF04342

Q9I3E0_PSEAE/5-112-------------------------------------------------LQ-TAL-------------------------
Q9PG53_XYLFA/9-115-------------------------------------------------LY-PVL-------------------------
Q9KRR2_VIBCH/16-123-------------------------------------------------VV-SVG-------------------------
Q9RW58_DEIRA/5-112-------------------------------------------------LR-TAL-------------------------

PF02535

S39A1_MOUSE/27-320-------------------------------------L.EVKLGALVLLLL-LTL-------------------------
P91348_CAEEL/4-439-------------------------------------A.ILKLVLMFVMFS-LTV-------------------------
IRT1_ARATH/49-344-------------------------------------L.PLKVIAIFVILI-ASM-------------------------
S39A2_HUMAN/5-306-------------------------------------L.GIKLGCLFALLA-LTL-------------------------
S39A6_HUMAN/322-743-------------------------------------Q.IAWVGGFIAISI-ISF-------------------------
Q9VFA2_DROME/25-359-------------------------------------D.LEKVLAMLVLGL-GSL-------------------------
S39A8_MOUSE/126-453-------------------------------------S.EVWGYGFLSVTI-INL-------------------------
Q17996_CAEEL/106-349-------------------------------------S.ATWIYALIGCSL-VVS-------------------------
S39AA_HUMAN/404-819-------------------------------------A.SAWICGIISITV-ISL-------------------------
Q9VUI9_DROME/187-506-------------------------------------W.YAWIYASITMLI-LSA-------------------------
Q9XWH3_CAEEL/4-315-------------------------------------E.LLKWIMLGVMAL-MTI-------------------------
FOI_DROME/258-684-------------------------------------F.YVWIYAFISVFA-CGI-------------------------
S39A5_MOUSE/208-522-------------------------------------L.SALLHSGLAVLF-LSL-------------------------
YKE4_YEAST/63-344-------------------------------------L.GPRYNAIVAILI-IQL-------------------------
ZUPT_ECOLI/5-248-------------------------------------L.ILTILAGAATFI-GAF-------------------------
Y1036_METJA/5-231-------------------------------------V.EVPIFIAILSFI-VMC-------------------------
ZRT2_YEAST/24-419-------------------------------------A.GLRILAVFIILI-SSG-------------------------
ATX2_YEAST/4-307-------------------------------------L.GVILLASFLLIA-TFL-------------------------
ZIP1_ARATH/48-352-------------------------------------T.KLKLGSIALLLV-AGG-------------------------
Q09957_CAEEL/4-356-------------------------------------F.LFMTTSAFAVFI-LLL-------------------------
CSUP_DROME/129-446-------------------------------------S.TIWLHSIGSTLL-ISA-------------------------
Q9XVR4_CAEEL/9-352-------------------------------------F.DTVLYGVISVTV-VSL-------------------------
ZRT1_SCHPO/60-405-------------------------------------L.GYRIGAIFVILA-TSL-------------------------
IRT2_ARATH/44-347-------------------------------------L.PLKIVAIVAILT-TSL-------------------------
YQF9_SCHPO/12-413-------------------------------------LSKEFYDCCGLFLL-TFF-------------------------
ZIP3_ARATH/51-336-------------------------------------R.KYKIAAIPTVLI-AGI-------------------------
O62192_CAEEL/30-311-------------------------------------D.ALRAVLLIVLFA-LTF-------------------------
ZIP10_ARATH/49-361-------------------------------------L.DLKLLSIFSILI-TSL-------------------------
Q9VEX1_DROME/53-407-------------------------------------L.VAKVTAMVVLFC-ASA-------------------------
Q9X260_THEMA/2-241-------------------------------------VLKGILYSTIAGMA-TSL-------------------------
HKE42_CAEEL/155-459-------------------------------------T.RLWVYAISATLL-ISA-------------------------
Q9XVJ5_CAEEL/4-376-------------------------------------V.SFLLVLSSAMFF-GSY-------------------------
ZIP4_ARATH/25-371-------------------------------------F.LLKFVAIASILL-AGA-------------------------
O65348_PEA/44-345-------------------------------------L.SLKIIAIFSILV-TSM-------------------------
ZIP2_ARATH/61-350-------------------------------------V.LVKIYCIIILFF-STF-------------------------
Q9UYU8_PYRAB/5-250-------------------------------------LILAFKLGLFVAFM-TSL-------------------------
Y816_DROME/33-350-------------------------------------Y.TPWVFSLLGSVV-IGL-------------------------
ZIP6_ARATH/24-338-------------------------------------S.HLKIVAVFAIFL-TSV-------------------------
S39A7_MOUSE/140-473-------------------------------------V.TLWAYALGATVL-ISA-------------------------
ZRT1_YEAST/47-373-------------------------------------L.GARISSVFVILF-VST-------------------------

PF01545

Q4W9Q0_ASPFU/1-325-----------------------------------------MVIGISSC...FFL-------------------------
B2JR72_BURP8/9-303-----------------------------------------IFYALAANLG.IAV-------------------------
B3EFZ2_CHLL2/11-292-----------------------------------------QKIIAITGVL.LLV-------------------------
A9A444_NITMS/9-285-----------------------------------------LQISLLAIFS.AFL-------------------------
B4U5R2_HYDS0/7-282-----------------------------------------SIISIFLMLL.LAI-------------------------
A8FV11_SHESH/28-339-----------------------------------------TRYVLYLTLI.TMI-------------------------
Q65T10_MANSM/16-294-----------------------------------------SFISIFTNII.LVA-------------------------
FIEF_ECOL5/13-291-----------------------------------------AIAATAMASL.LLL-------------------------
Q08QG5_STIAD/1-275-----------------------------------------ML...AANWA.VAL-------------------------
A4LN99_BURPE/21-300-----------------------------------------TFVSIVLNVI.LAT-------------------------
A5LNT3_STRPN/7-278-----------------------------------------VWVAFFLNLT.YAI-------------------------
MSC2_YEAST/388-670-----------------------------------------IFSFLLLNTA.FMF-------------------------
A7IA62_METB6/22-308-----------------------------------------VVLSLLCDIG.LWL-------------------------
A6UNW8_METVS/10-301-----------------------------------------LLIGAAANIF.MAV-------------------------
A3ETR2_9BACT/43-321-----------------------------------------LTIALALLLA.FMA-------------------------
A0NZQ3_9RHOB/35-315-----------------------------------------AFLSIVFGVI.VLG-------------------------
A3GJI2_VIBCL/32-314-----------------------------------------LTLSALIASG.FAG-------------------------
A7A5K5_BIFAD/30-336-----------------------------------------VKAALGANIG.VAI-------------------------
A0XY03_9GAMM/14-295-----------------------------------------LLIALAITCS.FMI-------------------------
Q0YRH2_9CHLB/11-289-----------------------------------------AISSVVASLL.LTA-------------------------
A1AQF0_PELPD/18-298-----------------------------------------ALIATLLTLL.LAI-------------------------
A4RUF7_OSTLU/97-375-----------------------------------------LQVSFYANIV.LLG-------------------------
Q6K961_ORYSJ/46-276-----------------------------------------LPLPLIHCCL.YSA-------------------------
Q13DW9_RHOPS/90-361-----------------------------------------A.LGIGLNIA.FVI-------------------------
A1SH46_NOCSJ/27-308-----------------------------------------LKISVGVYLG.ILA-------------------------
Q8ZUM0_PYRAE/5-272-----------------------------------------LIAAAALAWG.ATA-------------------------
Q5V738_HALMA/27-300-----------------------------------------LALVAVVNFF.GFV-------------------------
Q4DHZ0_TRYCC/34-411-----------------------------------------LIRAVIFCTI.MMC-------------------------
Q1Q6L8_9BACT/11-292-----------------------------------------SVLGIIINTA.LAI-------------------------
A2D920_TRIVA/179-434-----------------------------------------LIVSFTMNIY....-------------------------
A2F1G7_TRIVA/41-340-----------------------------------------IFIISVFLFA.FFS-------------------------
A2VJD3_MYCTU/44-322-----------------------------------------VKISLLVLGL.TAL-------------------------
A1SW56_PSYIN/15-292-----------------------------------------LFITIVLNII.ITL-------------------------
A2DBH6_TRIVA/225-492-----------------------------------------LIVVFAMIFV.SFY-------------------------
A4EAI9_9ACTN/33-311-----------------------------------------SLICIGLNIT.LCL-------------------------
Q2W8P3_MAGSA/19-298-----------------------------------------AWLDMFTALA.LAV-------------------------
A6CUL7_9VIBR/10-299-----------------------------------------LIYSAVGAGL.LAL-------------------------
Q31DJ2_THICR/19-307-----------------------------------------IKLVMFGDVI.MAV-------------------------
A4WLV6_PYRAR/14-285-----------------------------------------LFIMGTVSLS.YTL-------------------------
A2QMS3_ASPNC/132-444-----------------------------------------TRLGLLANLA.MAI-------------------------
O28143_ARCFU/1-279-----------------------------------------MRDILFIYLL.TLG-------------------------
ZNT9_PONAB/241-535-----------------------------------------VMVAICINGL.NCF-------------------------
Q97K27_CLOAB/7-286-----------------------------------------AVLSIASNSM.LII-------------------------
A7M130_BACOV/11-292-----------------------------------------SWISTIGNAI.LSV-------------------------
Q8KB34_CHLTE/15-289-----------------------------------------LFFSTLLNAT.LAV-------------------------
Q3IUM9_NATPD/8-306-----------------------------------------VVVSLVASAA.IAV-------------------------
Q0G003_9RHIZ/16-306-----------------------------------------LLAAMWGNLV.MGV-------------------------
A1T9A2_MYCVP/17-323-----------------------------------------LYTYMVTMLG.LAV-------------------------
Q6CFY3_YARLI/239-555-----------------------------------------GVHLLAAFVI.FSL-------------------------
Q8PXZ0_METMA/14-302-----------------------------------------SYKALFFSFA.LTL-------------------------
A3Z0I3_9SYNE/9-302-----------------------------------------LQFAVGINLI.MAL-------------------------
A2ECG5_TRIVA/140-412-----------------------------------------SIIYIIIQFV.LNF-------------------------
Q9EWS3_STRCO/33-324-----------------------------------------VLVALAANLV.IAA-------------------------
Y9332_DICDI/204-487-----------------------------------------LAAWISVMLV.FTI-------------------------
A7IN85_XANP2/15-300-----------------------------------------VLLAVLLDLG.LFL-------------------------
A5UNR6_METS3/17-288-----------------------------------------LLFVFILNIT.FNV-------------------------
Q8SQT3_ENCCU/27-307-----------------------------------------VLLIILM....FMF-------------------------
A7Z109_BACA2/13-297-----------------------------------------ALIALIANLI.LMA-------------------------
Q03V14_LEUMM/11-303-----------------------------------------LVIGCIWLFA.MGV-------------------------
Q2LWF9_SYNAS/31-312-----------------------------------------ALYAFLLNLG.LAA-------------------------
Q49MG4_CYPCA/10-409-----------------------------------------LLCMLSLTFG.FFI-------------------------
A0DMX0_PARTE/42-364-----------------------------------------LRREVFNDSI.QLP-------------------------
Q0IB23_SYNS3/16-314-----------------------------------------LRIGVYASAC.MAV-------------------------
A8BD19_GIAIC/28-389-----------------------------------------LIAMLVMVFF.YML-------------------------
A2BMQ3_HYPBU/7-274-----------------------------------------LHVAVAGAVA.GAI-------------------------
A4J438_DESRM/9-311-----------------------------------------IKAALLANGV.IAL-------------------------
Q1WV85_LACS1/33-332-----------------------------------------LILNVLAYLS.ISI-------------------------
A3SIX9_9RHOB/27-305-----------------------------------------GWL........VSI-------------------------
A1S0U9_THEPD/11-292-----------------------------------------VTTSLLVTLL.ILS-------------------------
A0L9W4_MAGSM/14-292-----------------------------------------GWAGLLVNLI.LSA-------------------------
A8ES46_ARCB4/12-311-----------------------------------------LRISIFSTIL.LAG-------------------------
Q8G7G4_BIFLO/52-342-----------------------------------------LIVGIVINVL.QVL-------------------------
Q96YR3_SULTO/2-266-----------------------------------------MRRAVIIYWM.IFV-------------------------
Q97PQ1_STRPN/15-292-----------------------------------------AIISISTYLI.LSA-------------------------
Q3IQA7_NATPD/24-302-----------------------------------------SLVNVAGNAV.KIL-------------------------
Q5PQX4_RAT/114-418-----------------------------------------LTIAAVLYLL.FMI-------------------------
Q4P2L6_USTMA/506-793-----------------------------------------ININLIINIL.LLG-------------------------
Q97WI8_SULSO/13-280-----------------------------------------IFLFSSISLIPIFL-------------------------
Q4Q592_LEIMA/36-364-----------------------------------------IFFTISTSFL.IAS-------------------------
A4VU47_STRSY/11-289-----------------------------------------LTVSSVVNGL.SGL-------------------------
ZRG17_SCHPO/101-382-----------------------------------------SILFFLVAVG.VLL-------------------------
ZNT6_XENTR/34-341-----------------------------------------ILLFGAINVV.CTG-------------------------
O27240_METTH/16-296-----------------------------------------SKYSVIINMI.LVV-------------------------
Q4KJ37_PSEF5/10-296-----------------------------------------LKQSTVLMFA.VAI-------------------------
A6CGW2_9PLAN/47-330-----------------------------------------AWLGISVRLF.VIV-------------------------
Q9YBI3_AERPE/52-332-----------------------------------------IYASAIVSAL.MAA-------------------------
A8FUZ8_SHESH/13-304-----------------------------------------ISIGIVANLV.MAL-------------------------
Q3ZAG2_DEHE1/21-297-----------------------------------------LKLGILFSGI.ILL-------------------------
A4YF73_METS5/3-267-----------------------------------------SLLGFWSTTAFLLV-------------------------

PF08627

CRTP1_DICDI/6-124-----------------------------------------KEKQPLLSSINNED-------------------------
CRTP2_DICDI/3-132-----------------------------------------EEKLPLLSPLNEND-------------------------
CRTP3_DICDI/4-127-----------------------------------------DERKPLLS.INDGD-------------------------

PF03151

Q7QFK8_ANOGA/152-294---------------------------------------------GLVSALI.AT-------------------------
PT504_ARATH/159-303---------------------------------------------GFIMCIS.AT-------------------------
PT106_ARATH/226-374---------------------------------------------GFVFVML.AA-------------------------
GPT2_ARATH/240-385---------------------------------------------GFMGAMI.SN-------------------------
PT311_ARATH/158-302---------------------------------------------GFIMCIA.AT-------------------------
PT148_ARATH/161-301---------------------------------------------GTVYQVM.GI-------------------------
XPT_ARATH/254-401---------------------------------------------GLSGAMI.SN-------------------------
PUP8_ARATH/210-359---------------------------------------------GIICTIG.AS-------------------------
PUP5_ARATH/196-345---------------------------------------------GFFWDIM.GS-------------------------
S35E1_HUMAN/190-334---------------------------------------------GLVSALA.AT-------------------------
PUP6_ARATH/204-353---------------------------------------------GYICAVG.SS-------------------------
S352B_HUMAN/224-369---------------------------------------------GFSAALS.TN-------------------------
Q7SCZ0_NEUCR/409-557---------------------------------------------GFLLVIS.AS-------------------------
Q9SVB8_ARATH/157-309---------------------------------------------GFLAAAI.AV-------------------------
PUP2_ARATH/172-332---------------------------------------------GFIMTLG.AA-------------------------
Q9MSB5_MESCR/257-406---------------------------------------------GFTSAMA.SN-------------------------
Q7XN26_ORYSJ/199-348---------------------------------------------GFALTLA.AS-------------------------
Q7RSG8_PLAYO/187-340---------------------------------------------AFVCALI.SN-------------------------
TPT2_BRAOB/245-391---------------------------------------------GFLSAMA.SN-------------------------
Q8S2F4_ORYSJ/180-320---------------------------------------------GVALQLA.AV-------------------------
PUP18_ARATH/209-368---------------------------------------------QAWLTFA.AS-------------------------
PUP1_ARATH/176-326---------------------------------------------GFLMTVV.AA-------------------------
Q9AV45_ORYSJ/156-298---------------------------------------------GSIIAVL.TI-------------------------
Q9FDZ5_ARATH/156-299---------------------------------------------GFVAAFV.AV-------------------------
PUP14_ARATH/223-383---------------------------------------------GSWAALF.AG-------------------------
Q7XJ66_CHLRE/235-385---------------------------------------------GFLSAIF.SN-------------------------
PUP16_ARATH/200-360---------------------------------------------KAWLILIFPT-------------------------
PUP12_ARATH/191-340---------------------------------------------GCFCAVF.AS-------------------------
YMD8_YEAST/171-375---------------------------------------------GSFLVLA.SS-------------------------
Q84XB7_PHATR/229-376---------------------------------------------ALIAACI.AN-------------------------
Q9N3S9_CAEEL/227-376---------------------------------------------GLMLVEL.AA-------------------------
Q9P5R8_NEUCS/290-459---------------------------------------------GILYALI.AT-------------------------
Q7S227_NEUCR/183-326---------------------------------------------GFLLTFL.GV-------------------------
Q960F0_DROME/234-384---------------------------------------------GFFFILF.AS-------------------------
PUP3_ARATH/170-319---------------------------------------------GFLITVA.AA-------------------------
S35E1_DROME/159-301---------------------------------------------GLISALI.ST-------------------------
Q8I420_PLAF7/190-341---------------------------------------------AFWCATL.SN-------------------------
Q802Y0_DANRE/160-304---------------------------------------------GLISALA.AT-------------------------
Q872T4_NEUCS/188-328---------------------------------------------GVILQIA.GV-------------------------
A2YZJ5_ORYSI/251-397---------------------------------------------GFWSAMA.SN-------------------------
PUP20_ARATH/215-369---------------------------------------------GAWCSFF.GT-------------------------
Q8W0S5_SORBI/236-377---------------------------------------------GVVYQMG.GV-------------------------
PUP4_ARATH/188-336---------------------------------------------GYVSTIG.AG-------------------------
Q7ZW48_DANRE/162-312---------------------------------------------GFIMVLL.AS-------------------------
Q84XW3_CHLRE/228-382---------------------------------------------GFLSAMG.SN-------------------------
Q871P2_NEUCS/171-311---------------------------------------------GFLFQLG.GI-------------------------
PUP15_ARATH/211-372---------------------------------------------GIINVAFGAA-------------------------
Q8H7P2_ORYSJ/208-365---------------------------------------------GFCEAIG.AA-------------------------
Q9AS84_ORYSJ/154-296---------------------------------------------GSVLSLL.AI-------------------------
YJT3_YEAST/205-388---------------------------------------------GVICAMI.SM-------------------------
PT112_ARATH/206-350---------------------------------------------GFLICVA.ST-------------------------
S35C2_MOUSE/165-315---------------------------------------------GFALVLG.AS-------------------------
PT314_ARATH/165-306---------------------------------------------GVVYQMG.GV-------------------------
S35E3_HUMAN/155-296---------------------------------------------GMVFAAL.GV-------------------------
TPT_SPIOL/245-389---------------------------------------------GFISAMI.SN-------------------------
Q9FIH5_ARATH/159-301---------------------------------------------GFICACV.AI-------------------------
Q84NE7_ORYSA/156-299---------------------------------------------GLLAAVI.AV-------------------------
PPT2_ARATH/222-370---------------------------------------------GFCSAMA.SN-------------------------
YG1B_SCHPO/151-297---------------------------------------------GLLYALI.ST-------------------------
YDB1_SCHPO/205-350---------------------------------------------GFLLVMA.SS-------------------------
PUP11_ARATH/205-354---------------------------------------------GFVCTLA.AS-------------------------
Q9LPU2_ARATH/159-301---------------------------------------------GFICACT.AV-------------------------

PF08449

UTR2_ARATH/23-316---------------------------------------------FLICTSG-FF-------------------------
UTR5B_ARATH/19-325---------------------------------------------GVFAVSG-IM-------------------------
S35B4_DICDI/8-332---------------------------------------------SLIPISM-IM-------------------------
S35B4_DANRE/3-318---------------------------------------------TLFAVTL-VF-------------------------
S35B4_DROME/7-329---------------------------------------------ALLGMLF-VF-------------------------
Q9VAN9_DROME/7-322---------------------------------------------AISAICG-VF-------------------------
Q8IIM9_PLAF7/27-336---------------------------------------------GLFCIGG-IY-------------------------
Q9BHL2_CAEEL/24-325---------------------------------------------FLICAGG-IL-------------------------
Q9P3N3_NEUCS/80-412---------------------------------------------IGVMLSL-IF-------------------------
YEA4_SCHPO/2-308---------------------------------------------IASALSF-IF-------------------------
S35B1_DROME/9-317---------------------------------------------FVIYAVG-IF-------------------------
S35B4_MOUSE/3-318---------------------------------------------PAFAVGL-VF-------------------------
O44166_CAEEL/4-314---------------------------------------------AVAPIFG-VL-------------------------
HUT1_YEAST/8-332---------------------------------------------LVICAIG-IY-------------------------
HUT1_SCHPO/8-313---------------------------------------------LFVCMIG-IY-------------------------
S35B3_DROME/62-368---------------------------------------------FLLSCAG-VF-------------------------
Q7ZXL4_XENLA/120-424---------------------------------------------LLFCTAG-LQ-------------------------
S35B3_CAEEL/42-336---------------------------------------------FVLLSLA-IF-------------------------
YEA4_YEAST/4-331---------------------------------------------SLKAFAL-VF-------------------------
UTR1_ARATH/14-322---------------------------------------------LALCISG-IW-------------------------
YEA4_KLULA/3-325---------------------------------------------FVLILSL-VF-------------------------
Q8JFZ3_XENLA/77-371---------------------------------------------FFICVSG-VF-------------------------
S35B2_DROME/145-450---------------------------------------------LLWCFGG-LM-------------------------

PF06027

S35F1_MOUSE/50-385-----------------------------------------QRIRKV.LNRE-ML-------------------------
Q948Q8_ARATH/4-331-----------------------------------------FNFNEM.KTKK-TL-------------------------
S35F2_HUMAN/28-364-----------------------------------------RRIKGKLFTWN-IL-------------------------
Q948Q7_ARATH/5-333-----------------------------------------FDFNEMNKTKK-TL-------------------------
YCN8_SCHPO/131-459-----------------------------------------KPL.YFLLDKR-FW-------------------------

PF07168

Q6S9Z3_PHAVU/14-350---------------------------------------------MFLALFFLGTWPAL-----LTMLERRGRLPQHTYL
A2ZKU3_ORYSI/14-359---------------------------------------------MVASLLFLGTWPAL-----LTLLERRGRLPQHTYL
UPS4_ARATH/14-351---------------------------------------------MILSLCCLGSWPAI-----LTLLERRGRLPQHTFL
Q058M8_ARATH/14-340---------------------------------------------MLLALLFLGTWPAI-----MTLTERRGRLPQHTYL

PF06379

RHAT_SALCH/1-344---------------------------------------------MSNAITMGIFWHLIGAASAACFYAPFKQVKQWSWE
RHAT_YERPE/1-344---------------------------------------------MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWE

PF02537

CRCB2_BRUME/5-120----------------------------------------------IILVVIGGA-------------------------
Q4Q5Z9_LEIMA/275-384----------------------------------------------VLA.....P-------------------------
A0NJX0_OENOE/3-115----------------------------------------------YFLMIILGV-------------------------
CRCB2_BACSK/1-111----------------------------------------------MMYVIIGGA-------------------------
CRCB_IGNH4/4-116----------------------------------------------LVWVAVGGA-------------------------
CRCB2_LACAC/3-119----------------------------------------------FLLAGIGAS-------------------------
A8FBH6_BACP2/4-115----------------------------------------------YLAVFIGGL-------------------------
CRCB_XANAC/10-125----------------------------------------------LLLAMTGGA-------------------------
CRCB2_LEIXX/16-132----------------------------------------------MLLVFVGGA-------------------------
CRCB2_STAHJ/3-115----------------------------------------------YLFVFIGGL-------------------------
CRCB_LEGPC/6-121----------------------------------------------YLAVAIGGS-------------------------
CRCB1_LEIXX/6-120----------------------------------------------VLAVAIAGG-------------------------
A2F7Z4_TRIVA/3-117----------------------------------------------VILMAAGGV-------------------------
CRCB3_BRUSU/6-123----------------------------------------------SILVLVGGF-------------------------
A5CXX2_VESOH/7-122----------------------------------------------IFVIGIGAT-------------------------
Q03ZU6_LEUMM/3-107----------------------------------------------ILGVAIGSA-------------------------
Q07MP6_RHOP5/15-134----------------------------------------------YGYIAAGSV-------------------------
A1A1D2_BIFAA/42-158----------------------------------------------ICVVFLGGC-------------------------
YP279_YEAST/241-362----------------------------------------------WTLPCLFGI-------------------------
Q5KAE8_CRYNJ/257-375----------------------------------------------VVFPLLMSP-------------------------
A3IRG4_9CHRO/6-120----------------------------------------------WLMVFLGGG-------------------------
CRCB_CAMHC/5-120----------------------------------------------ILCVGTGGF-------------------------
CRCB2_RUBXD/26-142----------------------------------------------LGWIFAGGA-------------------------
CRCB2_PROMA/11-126----------------------------------------------FFLVAFGAV-------------------------
A6W0D0_MARMS/3-118----------------------------------------------YFMIAVGGA-------------------------
CRCB2_CORJK/7-137----------------------------------------------VALVFLGGA-------------------------
A1EMW2_VIBCL/6-121----------------------------------------------LGFIALGGA-------------------------
A7A346_BIFAD/88-207----------------------------------------------YLVVFVGGF-------------------------
CRCB1_STAS1/4-116----------------------------------------------CILVMLGGG-------------------------
A5KTD5_9BACT/57-174----------------------------------------------ITVVGAGAF-------------------------
Q4PD24_USTMA/375-497----------------------------------------------VTFSLVLAP-------------------------
YI7B_SCHPO/187-299----------------------------------------------IGFSLIFSP-------------------------
CRCB2_CARHZ/3-115----------------------------------------------YFAVALGGF-------------------------
A4QGU1_CORGB/7-93----------------------------------------------GIGVGAGAA-------------------------
CRCB_SILPO/8-117----------------------------------------------YLAVFAGGA-------------------------
Q03UF6_LEUMM/13-124----------------------------------------------CLVVFFGGS-------------------------
A0CCJ9_PARTE/6-114----------------------------------------------FLYLSLGAY-------------------------
A9BD76_PROM4/12-109----------------------------------------------FFFVGSGAV-------------------------
CRCB_NITMS/6-118----------------------------------------------FVFLAAGSV-------------------------
Q23G77_TETTS/32-131----------------------------------------------VITVIAFCL-------------------------
A4AFW6_9ACTN/6-118----------------------------------------------VFAILAAGA-------------------------
A8FBH5_BACP2/3-115----------------------------------------------VLYTAIAGG-------------------------
A3UD64_9RHOB/4-120----------------------------------------------VLLIALGGA-------------------------
A9BD77_PROM4/11-126----------------------------------------------LFLVALGSI-------------------------
CRCB1_BACSK/7-119----------------------------------------------YVAVALGGA-------------------------
Q2J3P8_RHOP2/15-132----------------------------------------------CTAVALGSA-------------------------
CRCB2_METAC/11-116----------------------------------------------IFLIGAGGF-------------------------
A7BBA9_9ACTO/6-120----------------------------------------------FLFVALAGG-------------------------
Q26C06_FLABB/5-117----------------------------------------------LLFVFIGGG-------------------------
CRCB_DICNV/4-117----------------------------------------------FFTIFIGGG-------------------------
A7JDJ3_FRATL/5-123----------------------------------------------LLLVGIGGG-------------------------
CRCB_THEP1/6-121----------------------------------------------YLTIAFGGA-------------------------
Q6CGB9_YARLI/187-303----------------------------------------------WTYLGLFGI-------------------------
CRCB1_CORJK/10-136----------------------------------------------LLAVALGGG-------------------------
Q03ZU7_LEUMM/11-122----------------------------------------------LLVTGLGGA-------------------------
Q5AFH3_CANAL/261-381----------------------------------------------WTFSMLFAP-------------------------
A2EQG0_TRIVA/5-119----------------------------------------------VLYIAIGGA-------------------------
CRCB3_METBF/4-118----------------------------------------------ILLVGIGGF-------------------------
CRCB_SYNY3/8-123----------------------------------------------PLAIILGAI-------------------------
CRCB1_NOCFA/25-135----------------------------------------------IALVLLGGM-------------------------
CRCB2_LACPL/4-116----------------------------------------------IIAITGFAM-------------------------
Q83WT7_BACTA/176-286----------------------------------------------ALLVAIGGF-------------------------
CRCB_PSEU5/5-120----------------------------------------------AFAVACGGV-------------------------
A7Z2X1_BACA2/3-115----------------------------------------------IVLMLIAAG-------------------------
CRCB1_PROMA/15-112----------------------------------------------IFLLIVGSI-------------------------
Q18FV1_HALWD/24-129----------------------------------------------PVLVGVGGG-------------------------
A4BDQ7_9GAMM/9-125----------------------------------------------WAVIGFGGS-------------------------
A1SKX4_NOCSJ/28-142----------------------------------------------LPAIALGGM-------------------------
Q6C7Z3_YARLI/215-333----------------------------------------------WMYLGLWAL-------------------------
CRCB_AROAE/10-124----------------------------------------------FLAVGAGAA-------------------------
CRCB1_PROMT/10-107----------------------------------------------FFLISLGAF-------------------------
CRCB_SILST/5-119----------------------------------------------VLNVALGGA-------------------------
CRCB2_PROMT/4-120----------------------------------------------ILFVSIGAI-------------------------
A7I6T8_METB6/10-116----------------------------------------------FAAVAIGGF-------------------------
CRCB1_BIFLO/2-123----------------------------------------------MWMICLFGG-------------------------
CRCB2_HALSA/12-118----------------------------------------------TALVAVGGA-------------------------
B8G951_CHLAD/4-119----------------------------------------------ILAIAIGAA-------------------------
A5GI10_SYNPW/9-127----------------------------------------------ALLVGLGAV-------------------------
A5N506_CLOK5/4-119----------------------------------------------YIFISIGGI-------------------------
CRCB1_LACSS/6-119----------------------------------------------SLAVGSFAF-------------------------
A0NJX1_OENOE/4-115----------------------------------------------IFSVALGAA-------------------------
A4J4K8_DESRM/3-118----------------------------------------------YIAVGLGGM-------------------------
CRCB_HAEDU/4-113----------------------------------------------MLLVSLGAV-------------------------
A6VGL6_METM7/4-116----------------------------------------------ILLIGLGGF-------------------------
A5FV99_ACICJ/73-188----------------------------------------------LAAIAFFGS-------------------------
A0JYB9_ARTS2/3-119----------------------------------------------ALLVGIFGV-------------------------
CRCB_PROM5/6-103----------------------------------------------FFKILLFAY-------------------------
A0JYB8_ARTS2/12-126----------------------------------------------WAAVAVGAL-------------------------
B3XPY6_LACRE/7-123----------------------------------------------LLVIGCGCF-------------------------
A3TIL1_9MICO/4-113----------------------------------------------WLLVALGAS-------------------------
CRCB_CLONN/7-122----------------------------------------------AIIVGCGGF-------------------------
Q4Q5Z9_LEIMA/95-201----------------------------------------------CLIVAAAGL-------------------------
CRCB_NEIG1/5-113----------------------------------------------ILPLSIGAI-------------------------
A2BTL4_PROMS/6-116----------------------------------------------ISIILLGST-------------------------
Q23G77_TETTS/193-301----------------------------------------------YLYEILFGP-------------------------
CRCB1_LACAC/8-116----------------------------------------------YISIAIFAF-------------------------
A6GBU2_9DELT/14-125----------------------------------------------MIGVFLAGG-------------------------
CRCB2_CORGL/3-107----------------------------------------------FLYAALGGF-------------------------
C1AGI8_MYCBT/9-123----------------------------------------------LAAVFAGGA-------------------------
A7BBA8_9ACTO/9-133----------------------------------------------WLAVFVGGV-------------------------
CRCB_RHOBA/7-139----------------------------------------------LFAIALGGS-------------------------
A5VRB9_BRUO2/6-123----------------------------------------------VMWVGLGGG-------------------------
CRCB_NITOC/5-120----------------------------------------------LAWIALAGA-------------------------
A4XHA8_CALS8/3-113----------------------------------------------LLVVGLGGV-------------------------
B3EI10_CHLL2/10-124----------------------------------------------VLLVGAGGF-------------------------
CRCB_PELPD/4-119----------------------------------------------ALTIALFCA-------------------------

PF13536

B8J0H9_DESDA/85-197--------------------------------------------------------------------------------
Q30W64_DESDG/78-190--------------------------------------------------------------------------------
B2TJQ9_CLOBB/79-191--------------------------------------------------------------------------------
B1KVC8_CLOBM/79-191--------------------------------------------------------------------------------
Q6AM78_DESPS/78-190--------------------------------------------------------------------------------
A8MJF3_ALKOO/79-191--------------------------------------------------------------------------------
A6TUT9_ALKMQ/87-199--------------------------------------------------------------------------------
B6W8K1_9FIRM/81-193--------------------------------------------------------------------------------
Q14LA4_SPICI/73-193--------------------------------------------------------------------------------
C4L5N6_EXISA/35-152--------------------------------------------------------------------------------
C1EC76_MICSR/42-154--------------------------------------------------------------------------------
Q9KE50_BACHD/35-155--------------------------------------------------------------------------------
Q6ANG8_DESPS/36-150--------------------------------------------------------------------------------
Q0G3H6_9RHIZ/48-151--------------------------------------------------------------------------------
C6C7K8_DICDC/40-153--------------------------------------------------------------------------------
B1YFT7_EXIS2/35-146--------------------------------------------------------------------------------
D7VRB0_9SPHI/41-156--------------------------------------------------------------------------------
C3LF25_BACAC/35-151--------------------------------------------------------------------------------
A1SUW4_PSYIN/36-150--------------------------------------------------------------------------------
Q4MHH3_BACCE/35-151--------------------------------------------------------------------------------
Q4FTR9_PSYA2/36-150--------------------------------------------------------------------------------
A0RFB5_BACAH/35-151--------------------------------------------------------------------------------
Q29AX3_DROPS/271-397--------------------------------------------------------------------------------
B0W9C1_CULQU/259-385--------------------------------------------------------------------------------
B1HZ47_LYSSC/43-163--------------------------------------------------------------------------------
A5WDV4_PSYWF/36-149--------------------------------------------------------------------------------
C2MRF9_BACCE/12-136--------------------------------------------------------------------------------
B2ZC64_9GAMM/12-126--------------------------------------------------------------------------------
C2P113_BACCE/12-136--------------------------------------------------------------------------------
D5WE59_BURSC/39-154--------------------------------------------------------------------------------
C2WCR1_BACCE/35-159--------------------------------------------------------------------------------
B8BX33_THAPS/230-337--------------------------------------------------------------------------------
Q4CM94_TRYCC/68-183--------------------------------------------------------------------------------
Q4SHD3_TETNG/80-186--------------------------------------------------------------------------------
B0CPS2_LACBS/61-181--------------------------------------------------------------------------------
A7Z3M1_BACA2/35-159--------------------------------------------------------------------------------
B0B9E1_CHLT2/32-143--------------------------------------------------------------------------------
C2KU03_9ACTO/27-127--------------------------------------------------------------------------------
A5WEC6_PSYWF/36-151--------------------------------------------------------------------------------
C6JKK4_FUSVA/36-156--------------------------------------------------------------------------------
Q13J39_BURXL/39-154--------------------------------------------------------------------------------
E8WPA4_GEOS8/36-150--------------------------------------------------------------------------------
E6VZC7_DESAO/35-148--------------------------------------------------------------------------------
D1AJ88_SEBTE/34-147--------------------------------------------------------------------------------
B5ZTE1_RHILW/38-151--------------------------------------------------------------------------------
C4LLH4_CORK4/10-124--------------------------------------------------------------------------------
C0QIH1_DESAH/36-150--------------------------------------------------------------------------------
C6E0G2_GEOSM/36-150--------------------------------------------------------------------------------
C7PA25_CHIPD/42-158--------------------------------------------------------------------------------
A6CI48_9BACI/35-159--------------------------------------------------------------------------------
C6R7K6_9CORY/19-136--------------------------------------------------------------------------------
A1R4E7_ARTAT/168-283--------------------------------------------------------------------------------

PF00892

YCXC_BACSU/18-142----SFLFVKIALQT...--------------------------------------------------------------
YHBE_SHIFL/169-292----YGVAQKVLLRR...--------------------------------------------------------------
YBFH_BACSU/18-141----TFISTKVLLAD...--------------------------------------------------------------
Y1552_ARCFU/19-133----VSVFVRNVGG....--------------------------------------------------------------
YD3A_METJA/13-135----GTFFAKIVCE....--------------------------------------------------------------
YYAM_BACSU/15-140----TFNLAKYTVGY...--------------------------------------------------------------
YXXF_BACSU/166-292----FYAFTTLLGKG...--------------------------------------------------------------
O58666_PYRHO/13-134----LYGLEPVVIS....--------------------------------------------------------------
Y355_SYNY3/182-308----GTVLIPFVSRR...--------------------------------------------------------------
O58347_PYRHO/160-285----AIVIMDWLSNF...--------------------------------------------------------------
Y510_ARCFU/159-285----YTVLGSKMLLK...--------------------------------------------------------------
Y355_SYNY3/22-146----AMVAMKGVLAD...--------------------------------------------------------------
O80521_ARATH/206-335----WFIIQTKMSET...--------------------------------------------------------------
Y1533_ARCFU/154-274----AILTLDFLTD....--------------------------------------------------------------
O59388_PYRHO/20-144----TSVLSKVSMRR...--------------------------------------------------------------
O50525_STRCO/162-288----QAFCMRKAALV...--------------------------------------------------------------
YDFC_BACSU/17-140----AFPGIRAGLEG...--------------------------------------------------------------
O68125_RHOCA/19-144----NFIVARASRGE...--------------------------------------------------------------
SAM_RICPR/160-281----LDIINKKFVVK...--------------------------------------------------------------
Q9Z6F0_MYCSM/162-288----GYAEGGLLARE...--------------------------------------------------------------
YXXF_BACSU/24-147----IGFFSEHTNL....--------------------------------------------------------------
Q9Z6F0_MYCSM/18-141----TVIFTRVALGG...--------------------------------------------------------------
O86204_ECOLX/16-139----AIVMSKKGVEE...--------------------------------------------------------------
YTR1_BUCSC/162-288----IYLYSKEKYSN...--------------------------------------------------------------
Y1552_ARCFU/150-269----VFVLSKEARKK...--------------------------------------------------------------
Q9ZAR1_ENTAG/155-287----GAVVSQKIVTV...--------------------------------------------------------------
O85844_SPHAR/180-306----YATFLRRAPA....--------------------------------------------------------------
YVBV_BACSU/18-141----NWPLSKAALAY...--------------------------------------------------------------
YDED_BACSU/171-296----YTLYAVGLLNK...--------------------------------------------------------------
O59158_PYRHO/33-155----VASAFKLTLSR...--------------------------------------------------------------
Q9Z799_CHLPN/11-135----SFALSKLVMNA...--------------------------------------------------------------
YIJE_ECOLI/20-142----SWIFMKQVTSY...--------------------------------------------------------------
YCBK_BACSU/173-303----YLVLSGHLVHQ...--------------------------------------------------------------
SAM_RICPR/20-142----NDVMSKYLGTR...--------------------------------------------------------------
O66073_BACLI/169-302----YSVLARKMTRTFNS--------------------------------------------------------------
Y1533_ARCFU/12-136----NGIAYRKGVKD...--------------------------------------------------------------
YETK_BACSU/187-314----FTLMAKLLSPH...--------------------------------------------------------------
O57793_PYRHO/12-137----LGIFAKFLYRY...--------------------------------------------------------------
Y266_ARCFU/12-133----AFTAIKYSVRF...--------------------------------------------------------------
Q9ZF46_BACME/165-289----YTLQPKRLLAK...--------------------------------------------------------------
Y510_ARCFU/14-136----SFIFIKIGLKE...--------------------------------------------------------------
Y878_HAEIN/166-289----YGMAQKLMLRK...--------------------------------------------------------------
YSO2_ACIAM/116-237----FTVYFRKLRG....--------------------------------------------------------------
Y1164_SYNY3/191-319----TTILSKQQLQS...--------------------------------------------------------------
YDED_BACSU/18-149----GGTVAKKLFQEY..--------------------------------------------------------------
Y976A_HAEIN/35-161----VLRWTQRVVAK...--------------------------------------------------------------
O68125_RHOCA/168-295----YTMGLKTFPAE...--------------------------------------------------------------
Y788_ARCFU/178-306----FFGAEIAMISHYS.--------------------------------------------------------------
PECM_DICD3/12-130----TYFVTTQFLPA...--------------------------------------------------------------
O58983_PYRHO/16-140----VPIFGKIGLKD...--------------------------------------------------------------
YEDA_ECOLI/160-285----GSVYGSRITLP...--------------------------------------------------------------
Y1164_SYNY3/39-164----TYEINGRNPIS...--------------------------------------------------------------
Y878_HAEIN/17-142----LPIALKQVLSV...--------------------------------------------------------------
YTR1_BUCSC/16-140----TFIAIRIASDT...--------------------------------------------------------------
YWFM_BACSU/15-138----TGTVQALAPES...--------------------------------------------------------------
O85844_SPHAR/31-156----NPIVGRAAKDL...--------------------------------------------------------------
Y266_ARCFU/150-274----YTTFGKSLLSK...--------------------------------------------------------------
O57793_PYRHO/155-274----YGVFAKMAVS....--------------------------------------------------------------
YVBV_BACSU/161-287----GTVYMKKTGSR...--------------------------------------------------------------
YHBE_SHIFL/17-144----LPIAMKQVLEV...--------------------------------------------------------------
YICL_ECOLI/16-145----SGVCAQYIMEQS..--------------------------------------------------------------
PAGO_SALTY/161-287----IYTQCKKRSCT...--------------------------------------------------------------
O66073_BACLI/23-147----SFFFVKLALTA...--------------------------------------------------------------
Y270_BUCAP/15-139----TWIAMKIAVET...--------------------------------------------------------------
O59388_PYRHO/165-290----AILITDWLVSN...--------------------------------------------------------------
RHTA_ECOLI/158-281----YILSGQRAGA....--------------------------------------------------------------
YIJE_ECOLI/162-290----SAIVAKRLYARH..--------------------------------------------------------------
O50525_STRCO/20-140----FSSEPNSRYG....--------------------------------------------------------------
Q56929_YEREN/17-141----TWLAMKLTVET...--------------------------------------------------------------
O67627_AQUAE/15-141----APIFFKLGMKG...--------------------------------------------------------------
Y841_METTH/216-340----DTVLSKFLSRK...--------------------------------------------------------------
Y788_ARCFU/52-166----TFPVVKIALDS...--------------------------------------------------------------
SAMHT_CHLTR/34-158----SFALSKSAMEA...--------------------------------------------------------------
Y1234_HELPY/17-141----MSAFVKITADY...--------------------------------------------------------------
YOAV_BACSU/13-137----TWVAMKVGIHD...--------------------------------------------------------------
O85268_YEREN/163-289----VYVQCKKRSCS...--------------------------------------------------------------
Q9ZF46_BACME/15-143----SGTVAQYLFQHK..--------------------------------------------------------------
YEDA_ECOLI/18-141----TYFVIRIGVES...--------------------------------------------------------------
YETK_BACSU/38-163----SVVVGKLMVER...--------------------------------------------------------------
O58347_PYRHO/13-140----SSVLIKVGLRG...--------------------------------------------------------------
YRDR_BACSU/175-300----GQIFREWSTLR...--------------------------------------------------------------
YDFC_BACSU/160-285----YFVFQARYIKK...--------------------------------------------------------------
YCB6_PSEDE/14-140----TAVFAKVGVAQ...--------------------------------------------------------------
Y841_METTH/55-192----SATLDKIMLSS...--------------------------------------------------------------
YICL_ECOLI/167-291----YTTYPSTLIAR...--------------------------------------------------------------
Q9ZAR1_ENTAG/14-139----SFPVSKIAINV...--------------------------------------------------------------
O59158_PYRHO/178-298----YWILNLRDPR....--------------------------------------------------------------
Y270_BUCAP/161-287----IYVECQKKSCN...--------------------------------------------------------------
PAGO_SALTY/15-139----TWLAMRIAVET...--------------------------------------------------------------
YOAV_BACSU/159-285----ANVFSKLQFKH...--------------------------------------------------------------
SAMHT_CHLTR/185-314----WTLLRKLGRRCE..--------------------------------------------------------------
O86204_ECOLX/162-286----YVVISSRLIKS...--------------------------------------------------------------
YRDR_BACSU/18-146----MFPVADHALEF...--------------------------------------------------------------
Y3017_CLOK5/166-292----YTVISKKRIEI...--------------------------------------------------------------
Y1319_SYNY3/191-316----YTVFAQRSFQR...--------------------------------------------------------------
YWFM_BACSU/158-282----YTLISKAMMK....--------------------------------------------------------------
YYAM_BACSU/164-290----YGVLGRRFVKD...--------------------------------------------------------------
O58324_PYRHO/19-137----TFPVMKIGIKD...--------------------------------------------------------------

PF04142

S35A5_HUMAN/78-366----LYFLDNLIVFYVLS--------------------------------------------------------------
O76865_DROME/83-334----VYIVQNNLLYVSAS--------------------------------------------------------------
GMS1_SCHPO/79-315----LYTCQNNLQYVAAG--------------------------------------------------------------
S35A2_HUMAN/96-331----IYTLQNNLQYVAIS--------------------------------------------------------------
UGTP1_CAEEL/104-343----AYALQNNLDFVGLS--------------------------------------------------------------
S35A1_HUMAN/72-306----VYAVQNNMAFLALS--------------------------------------------------------------
O02345_CAEEL/69-352----IYTVQNFLLYVAVD--------------------------------------------------------------
S35A3_CANFA/68-306----IYTLQNNLLYVALS--------------------------------------------------------------
O16658_CAEEL/74-318----MYVIQNNLLFFALK--------------------------------------------------------------
O01879_CAEEL/71-306----IYTLQNNLYYIALS--------------------------------------------------------------

PF05653

Q90YI4_TAKRU/4-304----SFILKKRGLLRLARK--------------------------------GSMRAGQGGHAYLKEWLWWAGLIS-----
NIPA2_HUMAN/6-306----SFILKKKGLLRLARK--------------------------------GSMRAGQGGHAYLKEWLWWAGLLS-----
Q9VK62_DROME/41-342----SFIIKKKALIRLSRY--------------------------------GEVRASAGGFGYLREWIWWAGLLT-----
Q9SST0_ARATH/15-267----SFIVKKKGLKKAGA.--------------------------------SGLRAGSGGYSYLLEPLWWIGMIT-----
Q8LA45_ARATH/1-300----SFIIKKKGLKKAGV.--------------------------------SGARAGEGGYGYLYEPWWWAGMIT-----
Q9SKQ1_ARATH/1-295----SFILKKKGLKRAGA.--------------------------------IGTRADCN.....NKIISNFKFCL-----
NPAL2_MOUSE/43-336----SLNIQKYSHLHLAQ.--------------------------------....K.EHPKPYFKSVLWLSGVLL-----

PF10639

Q4TT81_CAEEL/12-122----TNPLLRAASKD-----------------------------------------------------------------
Q4V4P6_DROME/6-122----TNPFIRLGSQG-----------------------------------------------------------------
A0C2W3_PARTE/7-116----TNPFMESGVGN-----------------------------------------------------------------
Q4D1L3_TRYCC/4-115----TNPLLKRYSSG-----------------------------------------------------------------
Q22BW6_TETTS/16-127----TNPLMEMGSKT-----------------------------------------------------------------
Q4RMD0_TETNG/95-210----SNPLLKRGTQG-----------------------------------------------------------------
TM234_ANOGA/20-135----TNPFIKRGSIG-----------------------------------------------------------------
TM234_PONAB/11-126----TQPLLKRASAA-----------------------------------------------------------------
Q0U0B5_PHANO/22-148----TTPFMRRAAMN-----------------------------------------------------------------
A4I0H4_LEIIN/5-115----TNPLLKHYSRG-----------------------------------------------------------------
TM234_DICDI/9-124----TNPLIKRGSEG-----------------------------------------------------------------
A4FVN3_DANRE/1-116----TNPFLKKGTEG-----------------------------------------------------------------
A7SF34_NEMVE/12-127----TNPFIKKGSAG-----------------------------------------------------------------
Q57W61_TRYB2/4-115----TNPLLKRYSGG-----------------------------------------------------------------
Q5B4G5_EMENI/114-201----VN.........-----------------------------------------------------------------
Q179X3_AEDAE/11-126----TNPFIRRGSLG-----------------------------------------------------------------

PF00893

QACC_STAAU/1-93----..YLIIAISTE-----------------------------------------------------------------
MMR_MYCTU/1-94----..YLLCAIFAE-----------------------------------------------------------------
EMRE_ECOLI/2-94----..YLGGAILAE-----------------------------------------------------------------
YVAE_BACSU/1-93----..FLCLAILFE-----------------------------------------------------------------
P96460_STAAU/1-93----..YLLIAIITE-----------------------------------------------------------------
MDTI_ECOLI/4-99----AAWLALAIVLE-----------------------------------------------------------------
Q7B1Y7_SALEN/2-94----..FLVIAIVGE-----------------------------------------------------------------
YVDS_BACSU/1-89----..LVFIAGLLE-----------------------------------------------------------------
EBRB_BACSU/2-94----..YLALAIVSE-----------------------------------------------------------------
YKKD_BACSU/2-94----..SLLCAGCLE-----------------------------------------------------------------
EBRA_BACSU/3-95----..FLTIAICSE-----------------------------------------------------------------
YVDR_BACSU/1-93----..LLVIAGIEE-----------------------------------------------------------------
MDTJ_SHIFL/3-95----..LLGLAIATE-----------------------------------------------------------------
Y4NH_RHISN/1-106----IILVFAAGLNS-----------------------------------------------------------------
YKKC_BACSU/1-90----..LVVLAAVFE-----------------------------------------------------------------
SUGE_SHIFL/1-93----..ILVIAGLLE-----------------------------------------------------------------
SUGE_PROVU/1-93----..ILFVAGLLE-----------------------------------------------------------------

PF04657

Q21DH8_SACD2/19-159----AIAVQASLNAK----------------------------------------------------------LG-----
Q8CTN3_STAES/3-144----LLPIQTSINSR----------------------------------------------------------LS-----
Q39SB9_GEOMG/5-141----AVALQPSINAR----------------------------------------------------------LA-----
A6TN22_ALKMQ/4-138----SLVFARMVNAS----------------------------------------------------------LA-----
A3QFA9_SHELP/30-170----ALAVMIALNSE----------------------------------------------------------LA-----
A6VSJ3_MARMS/9-148----LVPFQAGSNAE----------------------------------------------------------LG-----
Q6M695_CORGL/164-304----CQATQVAVNGY----------------------------------------------------------LG-----
B8FYQ2_DESHD/4-140----VMGIQTPINGA----------------------------------------------------------LG-----
Q1GQL8_SPHAL/9-147----GIPILAALNGG----------------------------------------------------------LG-----
Q1Z706_PHOPR/6-152----LLALMIKLNSA----------------------------------------------------------LA-----
Q1QZC8_CHRSD/5-140----GLSMEAGLLGP----------------------------------------------------------LG-----
A5W524_PSEP1/11-150----VLPFQAAGNAA----------------------------------------------------------VG-----
Q1QB44_PSYCK/4-140----GLSVEAGLLGP----------------------------------------------------------LG-----
Q394M9_BURS3/11-150----LVPLQGGSNAA----------------------------------------------------------LG-----
Q2RGM8_MOOTA/15-156----IWALQPVINAG----------------------------------------------------------LA-----
Q0AXV4_SYNWW/5-143----AMALQGTFNAA----------------------------------------------------------LG-----
Q390H3_BURS3/7-143----AVALQGQFMGV----------------------------------------------------------MS-----
Q7N4X7_PHOLL/3-137----FIAATRTINGQ----------------------------------------------------------LS-----
Q49VG4_STAS1/3-144----VVPFQTSINSR----------------------------------------------------------LS-----
Q03TA8_LACBA/2-142----IISCQTAINSR----------------------------------------------------------LR-----
A6LU87_CLOB8/1-136----LITIMIAFNAK----------------------------------------------------------LS-----
A0SZ10_9BURK/18-157----VVPLQAGANAA----------------------------------------------------------LG-----
Q03TA8_LACBA/164-305----LGAVQTTINGH----------------------------------------------------------LG-----
Q11NT1_CYTH3/6-142----AVAFQAGVNGA----------------------------------------------------------LG-----
A0RGL9_BACAH/9-144----LIAVMLPLNGI----------------------------------------------------------LS-----
A0PSE0_MYCUA/6-144----LQTCGAAMNGQ----------------------------------------------------------LY-----
A4FZS2_METM5/5-144----VASLQPIVNSK----------------------------------------------------------LG-----
Q0SPU1_CLOPS/2-138----AMSIQGVFNTR----------------------------------------------------------VS-----
A1VA83_DESVV/4-141----VLPTQAGINAM----------------------------------------------------------LT-----
Q0FRW8_9RHOB/3-140----GVPVLAALNAR----------------------------------------------------------LG-----
A0AHV4_LISW6/4-145----VLPVQTAINTR----------------------------------------------------------LS-----
Q0KF63_CUPNH/16-155----AIPFQAGANAT----------------------------------------------------------LG-----
A1AK06_PELPD/5-141----AIAVQPSINAR----------------------------------------------------------LA-----
Q1M5R3_RHIL3/11-151----LLTFMVHLNGE----------------------------------------------------------LA-----
Q5KZC7_GEOKA/4-140----AVSVQAGVNGG----------------------------------------------------------LG-----
A9VF57_BACWK/2-138----LISLQSVFNTK----------------------------------------------------------VN-----
Q0I1U4_HAES1/4-144----ALAAQAAINTQ----------------------------------------------------------LA-----
Q4KHW5_PSEF5/5-144----AVPLQAGTNSR----------------------------------------------------------LG-----
Q49VG4_STAS1/163-305----CPPIQTAINSA----------------------------------------------------------LG-----
A0JUK3_ARTS2/163-299----LMSFQQAMNGT----------------------------------------------------------AT-----
Q7UTT1_RHOBA/5-133----ALPLQGGVNAK----------------------------------------------------------LG-----
Q03HH1_PEDPA/168-308----MLAIQAALNGR----------------------------------------------------------LG-----
Q03HH1_PEDPA/2-142----VVPFQTAVNSR----------------------------------------------------------LR-----
A6VKF2_ACTSZ/4-143----ALASQAAINSR----------------------------------------------------------LA-----
A0L1U7_SHESA/3-135----LIALSRTFNGA----------------------------------------------------------LA-----
A4WAQ0_ENT38/5-143----GLVVQNTLMVR----------------------------------------------------------IT-----
Q03Y21_LEUMM/166-301----LCTVQSTFNGQ----------------------------------------------------------LG-----
B1YHB6_EXIS2/3-139----MVCIQNTFNAK----------------------------------------------------------VK-----
A1ACJ4_ECOK1/10-155----LSPMQSAVNGQ----------------------------------------------------------LG-----
Q3A9B8_CARHZ/6-140----AMAIQGSMNSA----------------------------------------------------------LS-----
A8MKQ0_ALKOO/2-138----FVSLQSVFNTR----------------------------------------------------------VS-----
B1YEL8_EXIS2/4-140----ALSIEGAIYGE----------------------------------------------------------LG-----
Q8YKX2_NOSS1/5-144----FSTIGAAANAQ----------------------------------------------------------LK-----
Q12R75_SHEDO/9-146----GIPVMAALNAG----------------------------------------------------------LG-----
Q99VZ6_STAAM/3-144----LIPIQTSVNSR----------------------------------------------------------LS-----
Q9RVB6_DEIRA/8-144----GLSAGGAFNLR----------------------------------------------------------LL-----
A1A0P8_BIFAA/203-343----CSAVQTALLGK----------------------------------------------------------LG-----
Q1IEL2_PSEE4/9-148----AVPFQAGSNAA----------------------------------------------------------LG-----
Q749R3_GEOSL/5-141----FIAVQPSINAR----------------------------------------------------------LA-----
A6M3J1_CLOB8/2-138----AMSIQGVFNTR----------------------------------------------------------LG-----
A1ZMZ7_9BACT/5-145----FLAVQGGLNAQ----------------------------------------------------------LS-----
Q02XB9_LACLS/3-143----LLANQNPINAD----------------------------------------------------------LR-----
Q65J95_BACLD/5-146----AIPVQTSINSR----------------------------------------------------------LG-----
Q28TA8_JANSC/7-146----ALAMQAPINAA----------------------------------------------------------LA-----
Q12K32_SHEDO/8-147----SFASQAGINAQ----------------------------------------------------------LR-----
A9VF55_BACWK/2-138----FITLQGTFNAK----------------------------------------------------------LS-----
Q9RVB7_DEIRA/19-157----LLPGQFAVNTA----------------------------------------------------------LA-----
A3QFA8_SHELP/3-133----CIGLCRILNGR----------------------------------------------------------LG-----
A5G8U5_GEOUR/6-141----AVALQPSINGR----------------------------------------------------------LA-----
A8M2W9_SALAI/175-312----AVAWQQAVNGL----------------------------------------------------------VA-----
Q0FHQ8_9RHOB/5-139----ALVLQNALMLE----------------------------------------------------------AR-----
Q8YKX1_NOSS1/33-172----ILPIQSNLNAQ----------------------------------------------------------LA-----
Q3K9Q1_PSEPF/5-141----VLSVQAAINGR----------------------------------------------------------LG-----
A9KHN5_CLOPH/2-140----LMSIQGVFNTG----------------------------------------------------------VT-----
Q8FQJ9_COREF/99-239----CAAMQVSVNGQ----------------------------------------------------------LG-----
B1YGF5_EXIS2/14-153----LVPVQTSVNTR----------------------------------------------------------LR-----
Q6D0D7_ERWCT/13-152----IVPFQAASNAA----------------------------------------------------------LG-----
A8LKG3_DINSH/5-143----GIALQAPINAQ----------------------------------------------------------LA-----
A9VMR7_BACWK/2-136----SIVVARIINAN----------------------------------------------------------LA-----
Q1QB43_PSYCK/5-141----ALSVQAALNGR----------------------------------------------------------LG-----
Q28R25_JANSC/3-140----GIPILAALNAR----------------------------------------------------------LG-----
Q4L439_STAHJ/163-304----APPLQTTINSG----------------------------------------------------------LA-----
Q316U3_DESDG/4-143----TLPTQAGINSG----------------------------------------------------------LQ-----
B1YGF5_EXIS2/179-317----MSAAQAAINGH----------------------------------------------------------LG-----
Q4L439_STAHJ/3-144----MVPIQTSINSR----------------------------------------------------------LG-----
Q65QN9_MANSM/39-179----ALASQAAINSK----------------------------------------------------------LA-----
B1YIK4_EXIS2/3-139----MISLQTVLNAR----------------------------------------------------------MS-----
Q04FL6_OENOB/173-313----FSASQTAINGH----------------------------------------------------------LG-----
Q31P27_SYNE7/5-144----LLSIGAAANAR----------------------------------------------------------LK-----
Q5R178_IDILO/5-143----SISIQASINAM----------------------------------------------------------MG-----
A9BWW9_DELAS/11-150----ILPFQAASNAL----------------------------------------------------------VG-----
A0PXE0_CLONN/7-143----FMSIQGVFNTR----------------------------------------------------------LG-----
Q8XG26_SALTI/5-143----GLVVQNSIMVR----------------------------------------------------------IT-----
A0L1U8_SHESA/9-158----LLALMIKLNSQ----------------------------------------------------------LA-----
Q6FEY6_ACIAD/10-149----AMSVQTALNTQ----------------------------------------------------------LR-----
Q02XB9_LACLS/164-303----MSAAQQAINGR----------------------------------------------------------LG-----
Q03UQ1_LEUMM/173-314----LSALQTAINGH----------------------------------------------------------LG-----
Q02QF4_PSEAB/5-144----MVVLQAGSNAL----------------------------------------------------------LG-----
Q97DD1_CLOAB/2-138----CMSLQGVFNTR----------------------------------------------------------LS-----
Q5Z3K6_NOCFA/3-148----GVAVQARINGA----------------------------------------------------------LG-----
Q67KE9_SYMTH/5-146----AGAVQAPVNAT----------------------------------------------------------LA-----
Q4V1I7_BACCZ/4-142----ALPIQFSINAQ----------------------------------------------------------LR-----
Q2RM98_MOOTA/3-140----AMAFQGSLNSA----------------------------------------------------------LA-----
Q65J96_BACLD/10-156----ASPIQTSINSE----------------------------------------------------------LR-----
Q6SF41_9BACT/5-142----GIPVMAALNAA----------------------------------------------------------LG-----
Q1LCM1_RALME/14-153----MIPFQAGSNAT----------------------------------------------------------LG-----
A4W7U3_ENT38/4-140----TLSIQAAINGQ----------------------------------------------------------LG-----
Q4VSJ2_BURGL/11-150----LVPLQAGSNAA----------------------------------------------------------LG-----
Q02FK6_PSEAB/7-145----CLPLQAGINGQ----------------------------------------------------------LA-----
Q7NSE3_CHRVO/15-151----LLALMIHCNSR----------------------------------------------------------LA-----
Q1ZWQ0_PHOAS/6-148----TLASMIALNSH----------------------------------------------------------MA-----
A6LU86_CLOB8/2-134----IVVISRILNTR----------------------------------------------------------LS-----
Q9CJV1_PASMU/4-144----ALASQAAINSQ----------------------------------------------------------LA-----
Q53WI3_THET8/6-144----VLPLQAGVNAE----------------------------------------------------------LA-----
A9CIC3_AGRT5/3-135----FVSLSRQINGR----------------------------------------------------------LS-----
Q0BSA2_GRABC/6-144----LQAWGPPMNGA----------------------------------------------------------LR-----
Q99VZ6_STAAM/163-305----FPPIQTTINSA----------------------------------------------------------LA-----
B8G001_DESHD/7-144----TMAIQGTLNSQ----------------------------------------------------------LY-----
B1YHB4_EXIS2/2-138----FLTLQSVANAR----------------------------------------------------------IS-----
Q3HKF8_RHOS4/5-144----LVPLQGGANAA----------------------------------------------------------LG-----
Q18BT7_CLOD6/5-139----STALEAFINGE----------------------------------------------------------LG-----
A0AHV3_LISW6/11-151----LSPIQTSINSQ----------------------------------------------------------LR-----
Q3K9Q0_PSEPF/22-158----GLSVEAGLLGP----------------------------------------------------------LG-----
B1YIK3_EXIS2/2-138----FIALQGIFNAR----------------------------------------------------------LG-----
A1HTC3_9FIRM/8-146----LMAIQGSLNAA----------------------------------------------------------LS-----
A0B2B3_BURCH/5-144----SVALQQVLNAN----------------------------------------------------------LR-----
Q1QZC9_CHRSD/5-141----ALAAQSSINGR----------------------------------------------------------LG-----
A4W7U4_ENT38/4-140----GLSVEAGLLGP----------------------------------------------------------LG-----
Q7NSE2_CHRVO/2-129----CIGGSRSINGK----------------------------------------------------------LA-----
Q1ZWP9_PHOAS/4-134----CISFCRVLNGR----------------------------------------------------------LS-----
Q5HRB7_STAEQ/151-293----APPIQTTINST----------------------------------------------------------LA-----
A5D651_PELTS/6-144----AMAVQGSLNSA----------------------------------------------------------LG-----
Q7P1D2_CHRVO/22-162----VVPLQAAVNNQ----------------------------------------------------------LR-----
Q3KGP6_PSEPF/8-147----VVPFQSAININ----------------------------------------------------------LA-----
A4J0N8_DESRM/6-144----TMALQGTMNSA----------------------------------------------------------LG-----
A4XQ88_PSEMY/7-145----VLPLQAGINGQ----------------------------------------------------------LA-----
Q03UQ1_LEUMM/2-142----GLPIQTAVNSK----------------------------------------------------------LR-----
Q168E1_ROSDO/6-143----GIPVLAALNAA----------------------------------------------------------LG-----
Q1WV36_LACS1/3-143----GLAIQTAINSR----------------------------------------------------------LG-----
A1A0P8_BIFAA/19-158----ITPVQTAVNTR----------------------------------------------------------LG-----
Q03Y21_LEUMM/4-142----ILAAQNAVNAQ----------------------------------------------------------LS-----
Q98M54_RHILO/5-145----FIAIQAPINSQ----------------------------------------------------------LA-----
Q899N2_CLOTE/13-149----SMSFQGVFNTR----------------------------------------------------------LS-----
Q6M695_CORGL/2-142----IMPFQTSVNNR----------------------------------------------------------LR-----
Q04FL6_OENOB/2-142----GLPMQTAINSR----------------------------------------------------------LR-----
B1YEL9_EXIS2/4-140----LLSAQSSINGA----------------------------------------------------------FG-----
Q2KZA1_BORA1/11-150----AVPFQGAGNAA----------------------------------------------------------LG-----

PF06800

GLCU_STAXY/16-280----FWALGQGYQLK-----------------------------------------SVSLIGVSKTMPISTGLQL-----
RBSU_LACSS/19-290----CWALAQIITFH-----------------------------------------VFETMGVSRTMPITTGFQL-----
GLCU_STAES/19-283----LWAFGQGNQLK-----------------------------------------SVHLIGVSKTMPISTGMQL-----
Y169_LISMO/16-280----FWSLGQMNQFR-----------------------------------------AFTQVGVSKTMPLSTGMQL-----
Y2594_LACPL/16-279----AWAIGQLGQYI-----------------------------------------SYRLLGVSKTMPISTALQL-----
RBSU_STAAW/19-289----GWGFGQIITFK-----------------------------------------AFELVGSSRAMPVTTAFQL-----
Y2503_LACPL/16-280----FWSIGQGQQFT-----------------------------------------SMKAVGISRTTPISTGMQL-----
GLCU_BACSU/16-280----FWSLGQANQLK-----------------------------------------SIQLMGVSKTMPISTGMQL-----
Y424_LISMO/17-281----FWSFGQLLQFK-----------------------------------------GIAASSVAKAMPISNGTQL-----
RBSU_STAES/19-289----GWAFGQIITFK-----------------------------------------AFELVGSSRAMPITTAFQL-----
RBSU_LACPL/19-291----GWASAQIVTFK-----------------------------------------VFTMVGSSRAMPITTAFQL-----
Y176_LISMO/16-280----LWTVGQMFQLQ-----------------------------------------AFKIIGVSKAMPISTGMQL-----
GLCU_BACME/16-281----FWAVGQSNQLK-----------------------------------------SIDLIGVSKTMPISTGLQL-----
Y2157_STRA5/17-282----LWSVGQNGQFQ-----------------------------------------AMKYMGVSVANPLSSGAQL-----
YXFA_LACLA/17-288----LWAIGQFGQFN-----------------------------------------SMKYMGVSVASPLSSGSQL-----
Y2205_STRP1/17-282----IWSIGQTGQFH-----------------------------------------AMQYMGVSVANPLSSGSQL-----
YSUP_LACHE/16-280----FCALGQSGQFI-----------------------------------------SMRNIGISKTMPLSTGFQL-----

PF02694

Y2672_MYCBO/2-109----LLFVLAAVAE------------------------------------------------------------------
YFJF_BACSU/2-109----LLFLAAGLAE------------------------------------------------------------------
YNFA_ECOLI/1-108----LLFFATALCE------------------------------------------------------------------
Y793_SYNY3/2-108----LYFVMAGLCE------------------------------------------------------------------

PF07857

Q9U3C0_CAEEL/17-268----MFVPLRRRNCK---------------------------------------------DGFFVQWIECGVVFI-----
O01810_CAEEL/6-270----MFVPIKSYDSR---------------------------------------------DGIFAQWMMSIAILL-----
TM144_HUMAN/11-263----NFVPLKKFDTG---------------------------------------------DGMFLQWVLCAAIWL-----
TM144_CAEEL/6-264----MFVPVKKCHSG---------------------------------------------NGIFVQWIMSTAILL-----
Q20583_CAEEL/8-246----TYVPLKWFHKG---------------------------------------------DGLYFQWVQSLGQLL-----
Q95QA2_CAEEL/4-261----VFAPIKRFPSS---------------------------------------------DGFMVQFFMSLGGFI-----

PF04342

Q9I3E0_PSEAE/5-112----LLACSNLFMTF-----------------------------------------------------------------
Q9PG53_XYLFA/9-115----LLIGSNVFMTF-----------------------------------------------------------------
Q9KRR2_VIBCH/16-123----LLICSNVFMTF-----------------------------------------------------------------
Q9RW58_DEIRA/5-112----LLTLSNVFMTF-----------------------------------------------------------------

PF02535

S39A1_MOUSE/27-320----ICSLVPVCVLRRSGA--------------------------------NH......................-----
P91348_CAEEL/4-439----IVGLSPLKVLHKLRH--------------------------------EAATA................QSS-----
IRT1_ARATH/49-344----IGVGAPLFSRNVSFL--------------------------------........................-----
S39A2_HUMAN/5-306----GCGLTPICFKWFQID--------------------------------A.......................-----
S39A6_HUMAN/322-743----LSLLGVILVPLMNR.--------------------------------........................-----
Q9VFA2_DROME/25-359----LFGLLPAFISERNR.--------------------------------........................-----
S39A8_MOUSE/126-453----ASLLGLILTPLIKK.--------------------------------........................-----
Q17996_CAEEL/106-349----TGILPAFLLPANIHV--------------------------------LL......................-----
S39AA_HUMAN/404-819----LSLLGVILVPIINQ.--------------------------------........................-----
Q9VUI9_DROME/187-506----CGLLGILLVPLMKS.--------------------------------........................-----
Q9XWH3_CAEEL/4-315----IFGLLPIKVISYLNT--------------------------------TKS.....................-----
FOI_DROME/258-684----LGLVGVAIIPFMGS.--------------------------------........................-----
S39A5_MOUSE/208-522----PAPLSLLLLRLLGP.--------------------------------........................-----
YKE4_YEAST/63-344----MPCLFVLFVPGLRKN--------------------------------........................-----
ZUPT_ECOLI/5-248----LGVLGQ.........--------------------------------........................-----
Y1036_METJA/5-231----IGELLAYY.......--------------------------------........................-----
ZRT2_YEAST/24-419----LGVYFPILSSRYSFI--------------------------------R.......................-----
ATX2_YEAST/4-307----IGLIPLYYIDKQKSS--------------------------------IVTNQEGADSISDFTTNADTQTIN-----
ZIP1_ARATH/48-352----VGVSLPLIGKRIPAL--------------------------------Q.......................-----
Q09957_CAEEL/4-356----ISTSIPYTFLRTCCV--------------------------------N.......................-----
CSUP_DROME/129-446----APFVLLYIIPLDNS.--------------------------------........................-----
Q9XVR4_CAEEL/9-352----LSLGGACIGPLMTK.--------------------------------........................-----
ZRT1_SCHPO/60-405----IGMNLPLVLSKITKN--------------------------------R.......................-----
IRT2_ARATH/44-347----IGVTSPLFSRYISFL--------------------------------R.......................-----
YQF9_SCHPO/12-413----LLTTCQLRILSLSIN--------------------------------AFCVFGASGIYLDKLVNKWFGYEV-----
ZIP3_ARATH/51-336----IGVLFPLLGKVFPSL--------------------------------R.......................-----
O62192_CAEEL/30-311----AAGMIATFLKGE...--------------------------------........................-----
ZIP10_ARATH/49-361----IGVCLPFFARSIPAF--------------------------------Q.......................-----
Q9VEX1_DROME/53-407----ICGSIPFLLNRCYRW--------------------------------TEN.....................-----
Q9X260_THEMA/2-241----GALPFLFLKPH....--------------------------------........................-----
HKE42_CAEEL/155-459----APCFILMFIPIQANT--------------------------------........................-----
Q9XVJ5_CAEEL/4-376----MAGSIPLMF......--------------------------------........................-----
ZIP4_ARATH/25-371----AGVAIPLIGRNRRFL--------------------------------Q.......................-----
O65348_PEA/44-345----IGVCLPLVSRSVPAL--------------------------------S.......................-----
ZIP2_ARATH/61-350----LAGVSPYFY......--------------------------------........................-----
Q9UYU8_PYRAB/5-250----GSLLALFSH......--------------------------------........................-----
Y816_DROME/33-350----SGIFPLIIIPTEEKM--------------------------------AKE....................G-----
ZIP6_ARATH/24-338----FGVWGPVLLAKYFHG--------------------------------K.......................-----
S39A7_MOUSE/140-473----APFFVLFLIPVESNS--------------------------------........................-----
ZRT1_YEAST/47-373----FFTMFPLISTKVKRL--------------------------------R.......................-----

PF01545

Q4W9Q0_ASPFU/1-325----TEISFGLYT.HSLAL--------------------------------VADAFHYLTDLIGLVVALLALKLS.....
B2JR72_BURP8/9-303----CKFAAAAFT.GSGSM--------------------------------FAEAIHSTADCGNQVLLLFGLKQA.....
B3EFZ2_CHLL2/11-292----VKFAAWYMT.RSVAI--------------------------------LTDALESIVNVTSGFIGLYSLYIS.....
A9A444_NITMS/9-285----VELVFGLVS.NSLAL--------------------------------ITDSIHALLDSVVTLVLLLAARMA.....
B4U5R2_HYDS0/7-282----IKLGVGFLS.KSVAL--------------------------------KAEGIHSLSDSLASFIGFISIYMS.....
A8FV11_SHESH/28-339----AEIAAGTIY.GSMAL--------------------------------LADGWHMGTHAAAFMITLFAYRYA.....
Q65T10_MANSM/16-294----VKVTIGFFT.NSLAV--------------------------------MLDALNNLSDSLSSLVTIVGTKLA.....
FIEF_ECOL5/13-291----IKIFAWWYT.GSVSI--------------------------------LAALVDSLVDIGASLTNLLVVRYS.....
Q08QG5_STIAD/1-275----AKLGFGLLN.RSASV--------------------------------TADGMHSFIDGSSNILGLVAMTAA.....
A4LN99_BURPE/21-300----LQVVVGVIA.HSQAL--------------------------------IADGVHSLSDLVSDFVVLLANRHS.....
A5LNT3_STRPN/7-278----VEFIAGGVF.GSSAV--------------------------------LADSVHDLGDAIAIGISAFLETIS.....
MSC2_YEAST/388-670----VQLLYSFRS.KSLGL--------------------------------LSDSLHMALDCTSLLLGLIAGVLT.....
A7IA62_METB6/22-308----PEIAAVVLS.GSVTL--------------------------------FADVMKDGNEILATVFALAILLKM.....
A6UNW8_METVS/10-301----LAWFTVYYS.NSEAI--------------------------------LLDGNYSFIMFLGVLVALKIVA.V.....
A3ETR2_9BACT/43-321----VEVVAGLKA.SSLAL--------------------------------ISDAGHMLTDAGAIAMSLAVMRLA.....
A0NZQ3_9RHOB/35-315----LKIGAYLLT.GSIAL--------------------------------YSDALETIVNIASAIATLAAVWFA.....
A3GJI2_VIBCL/32-314----SGLLVGLLV.GSMVI--------------------------------VFDGVYSLVSLLLTLLSLAVSRFI.....
A7A5K5_BIFAD/30-336----AKLLAAFFT.GSSAM--------------------------------LSESVHSIADCSNEIVLMVGGRFS.....
A0XY03_9GAMM/14-295----IQVIGAYYA.NSLAV--------------------------------LADAGHLFVHNSSLFIALIASSFA.....
Q0YRH2_9CHLB/11-289----MKLIVGVLT.GSIGI--------------------------------ISEAAHSALDFGAASLTWYAVRMS.....
A1AQF0_PELPD/18-298----VKGIVGHWF.ESPLL--------------------------------VADAVHSAGDVVTIAASGFGLWLA.....
A4RUF7_OSTLU/97-375----VKLFAAISS.GSLSI--------------------------------ITSALDSFLDLVSGLILFMTDKTI.....
Q6K961_ORYSJ/46-276----IKDWRSLLP....LQ--------------------------------MPQLF..........LLFLSFSLA.....
Q13DW9_RHOPS/90-361----TEAAFGWLG.NSMAL--------------------------------LADAGHNLSDVLGLAVAWIAAELS.....
A1SH46_NOCSJ/27-308----MKLAAYLVT.GVMAL--------------------------------FAEAMHTLSDLFVSGFLLVAVYVA.....
Q8ZUM0_PYRAE/5-272----VSALGYVFS.NSVVV--------------------------------LGDFLHGVADALGITLAVLAAWLV.....
Q5V738_HALMA/27-300----IELAGGLLF.GSVAL--------------------------------ISDALHMLFDMLAYAMAFGASYTA.....
Q4DHZ0_TRYCC/34-411----VEGICGFIA.NSLAV--------------------------------LSDAVHMLADVFALSISLFAVYAS.....
Q1Q6L8_9BACT/11-292----IKIITGIIG.HSYAL--------------------------------IADGIESTTDVISSVIVWSGLRIA.....
A2D920_TRIVA/179-434----.GIMSGIKL.GAGPL--------------------------------IISSELSLYNTISLMIVLFGEIIA.....
A2F1G7_TRIVA/41-340----VLLAQSILT.KSTVF--------------------------------VQIAFIQLLHFALYAIILLTDYYT.....
A2VJD3_MYCTU/44-322----IQIVIVVMS.GSVAL--------------------------------AADTIHNFADALTAVPLWIAFALG.....
A1SW56_PSYIN/15-292----SQIVGGILS.GSLAL--------------------------------LSDAMHNLSDVVALLIAYWANKIS.....
A2DBH6_TRIVA/225-492----YEYRQGVIL.ESYNI--------------------------------TFDSLYMVPILISLFVTYLALVFT.....
A4EAI9_9ACTN/33-311----AKGIAGLLA.GSVSL--------------------------------IADAFNNLSDASSNIVSLLGFRLA.....
Q2W8P3_MAGSA/19-298----FKTALGVLS.GSMAL--------------------------------QAHSLHSFGDFLTKGINLASVKLS.....
A6CUL7_9VIBR/10-299----WGGLMAMIS.GSSAI--------------------------------LLDASFNLLSAVVSFASLRIAKLT.....
Q31DJ2_THICR/19-307----LGLVFFYLT.NSQAI--------------------------------LMDGVYPFIDLVAGLLTLRVVGLM.....
A4WLV6_PYRAR/14-285----VELLLGWMY.QSLLV--------------------------------ISDAFHGFMDAAVAYIAGFGLYYA.....
A2QMS3_ASPNC/132-444----GKFIGGYVF.HSQAL--------------------------------IADAYHALTDLVSDFLTLGTVAWS.....
O28143_ARCFU/1-279----IKLYAYFLS.GFTAI--------------------------------LADAFHSVIDITMILILLLSERYA.....
ZNT9_PONAB/241-535----FKFLAWIYT.GSASM--------------------------------FSEAIHSLSDTCNQGLLALGISKS.....
Q97K27_CLOAB/7-286----FKLTAGITM.NSISV--------------------------------LSEGVHSSIDLIASLIAFFSIKKS.....
A7M130_BACOV/11-292----SKIIIGLFA.GSLAV--------------------------------VGDGIDSATDVVISIVMIFTARLI.....
Q8KB34_CHLTE/15-289----AKLGWGWMM.GSTLV--------------------------------VADGIHSISDVFGALLIFLALFFA.....
Q3IUM9_NATPD/8-306----AKFIAWLAT.GNASM--------------------------------LSQVYYSLSDVGNQLLFLLGFRLS.....
Q0G003_9RHIZ/16-306----LGVAAAILS.NSSAV--------------------------------LLDGLFSLIGFASALLARRIIRRV.....
A1T9A2_MYCVP/17-323----VGFAVYAVT.KVSAT--------------------------------QLDGVISLINAGAAFIAARLSVAS.....
Q6CFY3_YARLI/239-555----SSHDYTALAALAHLV--------------------------------LYDALGATLTAAVDILGNFEVWKK.....
Q8PXZ0_METMA/14-302----IKLLAGFLG.NSTAL--------------------------------IADSIRSFSELINELKKLLEVFIA.....
A3Z0I3_9SYNE/9-302----TGAIASWIC.SAQAL--------------------------------ALDGLVSGLNALMILVAARLSSQL.....
A2ECG5_TRIVA/140-412----YTLYYSMTH.HALTL--------------------------------MADALSSLANNIAFVGAIVSDVAT.....
Q9EWS3_STRCO/33-324----AKAVGGFVA.GSPAL--------------------------------LSEAAHSVADSMNEIFLLAALRRS.....
Y9332_DICDI/204-487----YEIFYGAYL.ESLGL--------------------------------VSDGFHALFDCIGMGIALLAMLVG.....
A7IN85_XANP2/15-300----PYAVTTAYT.GSLAM--------------------------------LAEILRGGLLLLVEGTAYMALRAV.....
A5UNR6_METS3/17-288----IVILGGLIT.NSVAI--------------------------------LADCLHDLSDTISIGLAGVLEHVS.....
Q8SQT3_ENCCU/27-307----LELWGHWKT.NSLSL--------------------------------LADSLHLLVDIFGFIVSLLSLSWA.....
A7Z109_BACA2/13-297----GKIFFGLIG.DSEAV--------------------------------FADGIHSAADVVASIAVLAVIGIS.....
Q03V14_LEUMM/11-303----AALTAYFST.RLEAL--------------------------------FVDAYFTLITLTTGLLSIVISKIS.....
Q2LWF9_SYNAS/31-312----MKGVLAFWS.DSLAV--------------------------------TAGAIDSATDSAASLVLYGGLKLS.....
Q49MG4_CYPCA/10-409----VEVVVSRIT.SSLAM--------------------------------LSDSFHMLSDVIALVVALVAVRFA.....
A0DMX0_PARTE/42-364----IKFAAYYIT.NQQTF--------------------------------WAELTRSMIDASNHVILFATQIIL.....
Q0IB23_SYNS3/16-314----AGIGVHLLS.GSYAL--------------------------------LLDGLYSAVMVGSGLVASRISRNV.....
A8BD19_GIAIC/28-389----AELIVGIVG.NSLTL--------------------------------VGDAFHMLSDLLSLVIGLISLVLG.....
A2BMQ3_HYPBU/7-274----VKIAGVAY..GSRAL--------------------------------LVDAATCIANLVALAGVLAYYWAS.....
A4J438_DESRM/9-311----MKLVGAILS.GSASM--------------------------------MAEFKHSVGDWANGFFLLIGIRQS.....
Q1WV85_LACS1/33-332----IEYFLAEIS.NSQTL--------------------------------RADAFNNISGIVSTMLLMIGIHIARDIDD
A3SIX9_9RHOB/27-305----VAVMALVMG.SSQAM--------------------------------QAAWIEDMLSLLPPILFLLAAHFE.....
A1S0U9_THEPD/11-292----LRLAVYALT.NSLAV--------------------------------LADAFHSLVDILGNVFAVAAVAVS.....
A0L9W4_MAGSM/14-292----MKIFVGIIS.GSHAL--------------------------------LADALYSSKDVITSALIIVGLKVS.....
A8ES46_ARCB4/12-311----IGIIFGLLA.SSSTI--------------------------------IFDSIYAMIDAVMTTLALIVARLI.....
Q8G7G4_BIFLO/52-342----AGMAVFFMT.GLKAM--------------------------------FLDFSFTAISVLSGMVAVYLSSRT.....
Q96YR3_SULTO/2-266----AFLIPFILG.KNVIA--------------------------------LAESFHDLIDALTITFSYYVTRIV.....
Q97PQ1_STRPN/15-292----AKLAAGHLL.HSSSL--------------------------------VADGFNNVSDIIGNVALLIGIRMA.....
Q3IQA7_NATPD/24-302----VEGAVGLAF.GSVAL--------------------------------LADAAHSVADLVASAVVLVWGRSV.....
Q5PQX4_RAT/114-418----GELVGGYMA.NSLAI--------------------------------MTDALHMLTDLSAIILTLLALWLS.....
Q4P2L6_USTMA/506-793----GKGVAVLSS.NSVSL--------------------------------IASFVDSALDLLSTIIIFATSKAI.....
Q97WI8_SULSO/13-280----SELIAGILF.KSYVL--------------------------------MADSYHTLIDFLMSFIFYFTLIKI.....
Q4Q592_LEIMA/36-364----MQALVLLNT......--------------------------------..........AASLTAAIVAQSLC.....
A4VU47_STRSY/11-289----AGIAVYIMT.DLNAL--------------------------------LLDGVFSLIAFISSLVAVYISKNS.....
ZRG17_SCHPO/101-382----SGDATILLT.LSCSL--------------------------------IVEGVLIIINVWRETLDSFLVWRH.....
ZNT6_XENTR/34-341----FLLTWCSST.NSMAL--------------------------------TAYTYLTIFDLFSLITCLISYWVM.....
O27240_METTH/16-296----IKGFTGYLS.GNIAL--------------------------------IADAIHSFADVFSSAAVFIGLKLS.....
Q4KJ37_PSEF5/10-296----AGIVTGFVS.GAQSI--------------------------------LFDGFFSLIATFIKVLMLITAKLI.....
A6CGW2_9PLAN/47-330----MELVGLWFL.GHSVL--------------------------------LVDALASSADVLTSLAILFAIRLA.....
Q9YBI3_AERPE/52-332----AGVTLYLLVFPSSVV--------------------------------LVEAFVWFVEAITFFSLAVAFNIA.....
A8FUZ8_SHESH/13-304----SGWATFYLS.GSQAL--------------------------------LLDGNMSFILFLSSIVALKISKIK.....
Q3ZAG2_DEHE1/21-297----AEFIGALVS.NSLAL--------------------------------LSDAGHVLTDVLALSLSYFALMQA.....
A4YF73_METS5/3-267----LSFVG.....RSATL--------------------------------GSESLHSVLDAIVVTLTWMASRVL.....

PF08627

CRTP1_DICDI/6-124----D..NGATINIV-----------------------------------------------------------------
CRTP2_DICDI/3-132----IENDYKDENLK-----------------------------------------------------------------
CRTP3_DICDI/4-127----DDFNHQDVSTK-----------------------------------------------------------------

PF03151

Q7QFK8_ANOGA/152-294----MGFSLQNIFSKKVLKE....-------------------------------------------------.......
PT504_ARATH/159-303----AARAFKSVLQGILLSSE...-------------------------------------------------.......
PT106_ARATH/226-374----VMSGFRWCMTQVLLQKE...-------------------------------------------------.......
GPT2_ARATH/240-385----LAFVFRNIFSKKGMKG....-------------------------------------------------.......
PT311_ARATH/158-302----AARALKSVLQGILLSSE...-------------------------------------------------.......
PT148_ARATH/161-301----FAEALRLVLTQVLLQKK...-------------------------------------------------.......
XPT_ARATH/254-401----VGFVLRNIYSKRSLQSF...-------------------------------------------------.......
PUP8_ARATH/210-359----AGIGLLLSLVQLILRKVL..-------------------------------------------------.......
PUP5_ARATH/196-345----ALHGLIFALSELLFVKLL..-------------------------------------------------.......
S35E1_HUMAN/190-334----LCFSLQNIFSKKVLRD....-------------------------------------------------.......
PUP6_ARATH/204-353----AGYSLVLSLTDYAFEKIL..-------------------------------------------------.......
S352B_HUMAN/224-369----IMDCLQNVFSKKLLSGD...-------------------------------------------------.......
Q7SCZ0_NEUCR/409-557----FFSGFRWGLTQILLLRN...-------------------------------------------------.......
Q9SVB8_ARATH/157-309----WSTALQQYYVHYLQRK....-------------------------------------------------.......
PUP2_ARATH/172-332----LLYGFILPLVELSYKKSG..-------------------------------------------------.......
Q9MSB5_MESCR/257-406----VTNQSRNVLSKKLMVKKD..-------------------------------------------------.......
Q7XN26_ORYSJ/199-348----AVFALILSLFEATFEKVV..-------------------------------------------------.......
Q7RSG8_PLAYO/187-340----LGSSLRSIYAKKMMINKS..-------------------------------------------------.......
TPT2_BRAOB/245-391----LTNQSRNVLSKKVMVKK...-------------------------------------------------.......
Q8S2F4_ORYSJ/180-320----AFEATRLVLIQILLTSK...-------------------------------------------------.......
PUP18_ARATH/209-368----VAFALSLCLFQLCFEKVLVK-------------------------------------------------T......
PUP1_ARATH/176-326----LLYAFILPLVELTYKKAR..-------------------------------------------------.......
Q9AV45_ORYSJ/156-298----AATCVSQILTNQIQRR....-------------------------------------------------.......
Q9FDZ5_ARATH/156-299----WSTALQQYYVHYLQRK....-------------------------------------------------.......
PUP14_ARATH/223-383----ICFALLLCNIQNVFDSYIFK-------------------------------------------------RT.....
Q7XJ66_CHLRE/235-385----MTFQSRNVLSKKLMIKK...-------------------------------------------------.......
PUP16_ARATH/200-360----LAFSLSLCLMQLGFDKVLVK-------------------------------------------------T......
PUP12_ARATH/191-340----LIYSLQLSLMQFSFEKVL..-------------------------------------------------.......
YMD8_YEAST/171-375----CLSGLRWVYTQLMLRNNPIQ-------------------------------------------------TNTAAAV
Q84XB7_PHATR/229-376----MFAAVRGNENKKLMETPG..-------------------------------------------------.......
Q9N3S9_CAEEL/227-376----ACTGIRWTVSQMVMQRD...-------------------------------------------------.......
Q9P5R8_NEUCS/290-459----IIFVTQNIFSKRLFNEAARA-------------------------------------------------EQE....
Q7S227_NEUCR/183-326----ILAVVKTVATNRIMTGA...-------------------------------------------------.......
Q960F0_DROME/234-384----LSSGLRWSFAQFIMQKS...-------------------------------------------------.......
PUP3_ARATH/170-319----VMYAFILPLVELAYQKAK..-------------------------------------------------.......
S35E1_DROME/159-301----MGFSMQNIFSKKVLKD....-------------------------------------------------.......
Q8I420_PLAF7/190-341----FGSSIRSIYAKKMMTQKS..-------------------------------------------------.......
Q802Y0_DANRE/160-304----LCFSLQNIFSKKVLRD....-------------------------------------------------.......
Q872T4_NEUCS/188-328----AFEALRLTMVQRLLSSA...-------------------------------------------------.......
A2YZJ5_ORYSI/251-397----VTFQSRNVLSKKLMVKK...-------------------------------------------------.......
PUP20_ARATH/215-369----VAFSLSLCIMQLGFQKVIP.-------------------------------------------------.......
Q8W0S5_SORBI/236-377----VAEALRLIFIEIFLKKK...-------------------------------------------------.......
PUP4_ARATH/188-336----LLFALYLPVTEKLYRTV...-------------------------------------------------.......
Q7ZW48_DANRE/162-312----FIGGIRWTLTQLLMQKA...-------------------------------------------------.......
Q84XW3_CHLRE/228-382----LTFQSRNVLSKKLMLKKKDK-------------------------------------------------.......
Q871P2_NEUCS/171-311----VFEAMRLIMIQVLLKGD...-------------------------------------------------.......
PUP15_ARATH/211-372----IFFSLLLCIIRKVFEELISF-------------------------------------------------CN.....
Q8H7P2_ORYSJ/208-365----ALAGLVIPLVEVATARYGRR-------------------------------------------------TG.....
Q9AS84_ORYSJ/154-296----ITTCIAQIMTNTIQKK....-------------------------------------------------.......
YJT3_YEAST/205-388----FIFVLQNIYGKTVFTYRSQT-------------------------------------------------DESQSNS
PT112_ARATH/206-350----AGRALKSVVQGIILTSE...-------------------------------------------------.......
S35C2_MOUSE/165-315----FIGGIRWTLTQILLQKA...-------------------------------------------------.......
PT314_ARATH/165-306----VGEALRLIFMELLVKRK...-------------------------------------------------.......
S35E3_HUMAN/155-296----LVTSLYQVWVGAKQHE....-------------------------------------------------.......
TPT_SPIOL/245-389----VSFTYRSLYSKKAMTD....-------------------------------------------------.......
Q9FIH5_ARATH/159-301----FSSSLQQILIGSLQKK....-------------------------------------------------.......
Q84NE7_ORYSA/156-299----WSTALQQHYVHHLQKK....-------------------------------------------------.......
PPT2_ARATH/222-370----VTNQSRNVLSKKFMVGK...-------------------------------------------------.......
YG1B_SCHPO/151-297----CIFVSQNIFGSKIFMEAKSH-------------------------------------------------.......
YDB1_SCHPO/205-350----VLSGLRWALTQKLLLDH...-------------------------------------------------.......
PUP11_ARATH/205-354----ALYSLLLSLMQFSFEKIL..-------------------------------------------------.......
Q9LPU2_ARATH/159-301----FSTSLQQISIGSLQKK....-------------------------------------------------.......

PF08449

UTR2_ARATH/23-316----FGYLVNGVCEEYVYNRLQFS.............FGWYFTFIQGFVYLFLIYLQGFTTK..............HIVN
UTR5B_ARATH/19-325----STLVIYGVLQEKIMRVPYGVNK.......EFFKHSLFLVFCNRLTTSAVSAGALLASK...........KVLDPVA
S35B4_DICDI/8-332----VGCCSNVISLELIMKQSQSH..............AILVTFFQFATVAFISFFVNIRWKQVFSI.FWIPIGLRERKI
S35B4_DANRE/3-318----VGCCSNVVFLELLVRDFPGC..............GNIVTFAQFAFIALEGFIFETNFG............RKKPQI
S35B4_DROME/7-329----IGCCSNVVFLELIIQIDPGA..............GNLITFAQFLFIALEGLVFTSKFF............TVRPKI
Q9VAN9_DROME/7-322----LGCCSGVVFLELLVKLDPGA..............GNLITGAQFAFIALEGFIFTSKFG............LAQRVI
Q8IIM9_PLAF7/27-336----FFFIIFGYYQEKLPQLGRGSD.........RFYYNIFLICVLCLSNSLCSLSAIFFKSRLNNENVMSSLKKNVDKY
Q9BHL2_CAEEL/24-325----ICYFVFGIQQERIVQGKYELPDES....IEKFTFTQALVFFLCTANTIYAFLIRKKTE..............IDNV
Q9P3N3_NEUCS/80-412----GGCCSNVFALESIIKVEPGA..............GTLLTFVQFLFVALVGLPSQIDWSRP.......PFFLKKNQV
YEA4_SCHPO/2-308----GGCCSNAYALEALVREFPSS..............GILITFSQFILITIEGLIYFLLNDV.........QSLKHPKV
S35B1_DROME/9-317----VCYFLYGIVQEKLTRGRYGEEVQTDGSVGERFTYALALVWVQCLCNYVFAKVLLTIRP............QKEDTT
S35B4_MOUSE/3-318----AGCCSNVIFLELLARTHPGC..............GNIVTFAQFLFIAVEGFLFEANLG............RKPPAI
O44166_CAEEL/4-314----GSCMGCMVFVENIAKQEPSA..............MNLMTFSTFLFISTVGLVSTSKFF............TVKNQI
HUT1_YEAST/8-332----ATFLTWALVQEPLATRTWPNSM.......GKFQFPNVISLIQASVAMMMGYLYLNWKKVE.......YPPRKMIKD
HUT1_SCHPO/8-313----GSFLSWAVMQEKIITRPYDGE.........RFSSPALLSLAQSFMTVLCGLLWNWFHGV........SARGLLEPK
S35B3_DROME/62-368----FLYILYGYLQELIFTVEGFK............PYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCI
Q7ZXL4_XENLA/120-424----VSYLTWGVLQERVMTRTYGSEEGG...PGERFRDSQFLVFMNRILALTVAGLYCSVTK............QPRHGA
S35B3_CAEEL/42-336----ILYIGYGYMQELIFKLPGMK............PFGWTLTLIQFLIYSGCGYTECIIWH............NTKRMI
YEA4_YEAST/4-331----GGCCSNVITFETLMSNETGS.............INNLITFCQFLFVTCQGLPEFLDVHQP.......FPYFKPLKT
UTR1_ARATH/14-322----SAYIYQGVLQETLSTKRFGPDE.......KRFEHLAFLNLAQSVVCLIWSYIMIKLWS...........NAGNGGA
YEA4_KLULA/3-325----GGCCSNVISFEHMVQGSNIN.............LGNIVTFTQFVSVTLIQLPNALDFSHF.......PFRLRPRHI
Q8JFZ3_XENLA/77-371----VFYLIYGYLQELIFSVEGFK............PFGWYLTLVQFGYYSAFGLVELQLTQ............DKRRRI
S35B2_DROME/145-450----ISYLTWGVLQEKIMTQNYLNFTGE....SAKFKDSQFLVFSNRLLAFLVALAYLQWQP...........SPVRHRA

PF06027

S35F1_MOUSE/50-385----ISVALGQVLSLLVCGIGLTSKYLAEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEEN----------LLAILRR
Q948Q8_ARATH/4-331----IGLGLGQIISLLSTLIASIASEIARK.GISAPTSQTFLGYVSLAIVYGGIMLYRRSA..----------....IKV
S35F2_HUMAN/28-364----KTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDN----------LLVILKR
Q948Q7_ARATH/5-333----IGLGLGQILSLLCTSNAFTSSELARK.GINAPTSQTFLSYTLLAVVYGGIMLYRRPT..----------....IKG
YCN8_SCHPO/131-459----IVFFLGQVLSLCITATNTFNGYMSGI..SNIPAFQTFLVYALLTLVYTPYTVFRMGFKK----------YFEMIFR

PF07168

Q6S9Z3_PHAVU/14-350D-YSITNFFAALLIAFTFG-------------------------------------------------------------
A2ZKU3_ORYSI/14-359D-YSVTNLLAAAVIAIAFG-------------------------------------------------------------
UPS4_ARATH/14-351D-FATANLLAAIVIAFSLG-------------------------------------------------------------
Q058M8_ARATH/14-340D-YTLTNLLAAVIIALTLG-------------------------------------------------------------

PF06379

RHAT_SALCH/1-344TMWSVGGIVSWLILPWTIS-------------------------------------------------------------
RHAT_YERPE/1-344TMWSIGGLVSWLILPWTVS-------------------------------------------------------------

PF02537

CRCB2_BRUME/5-120----FGAMTREFIMLMVPP.....--------------------------------------------------------
Q4Q5Z9_LEIMA/275-384----AGAVTRFMLSVYLNK.....--------------------------------------------------------
A0NJX0_OENOE/3-115----LGAESRFAIELTIDN.....--------------------------------------------------------
CRCB2_BACSK/1-111----VGACLRFAVSECWLK.....--------------------------------------------------------
CRCB_IGNH4/4-116----LGAIVRYFFYKFVPQ.....--------------------------------------------------------
CRCB2_LACAC/3-119----IGAMLRYAITNYGKK.....--------------------------------------------------------
A8FBH6_BACP2/4-115----IGTLCRYELSQSVVS.....--------------------------------------------------------
CRCB_XANAC/10-125----LGSGLRFAIGASLIQ.....--------------------------------------------------------
CRCB2_LEIXX/16-132----LGTAARALLSAAAPT.....--------------------------------------------------------
CRCB2_STAHJ/3-115----FGALLRYVLSTLNVD.....--------------------------------------------------------
CRCB_LEGPC/6-121----LGAMSRYLVTIM.AQ.....--------------------------------------------------------
CRCB1_LEIXX/6-120----LGAVARLVLDGVLRS.....--------------------------------------------------------
A2F7Z4_TRIVA/3-117----VGTLLRYGIFVGIKK.....--------------------------------------------------------
CRCB3_BRUSU/6-123----IGGVMRFFLSGYVGR.....--------------------------------------------------------
A5CXX2_VESOH/7-122----IGASMRYYLTQL.MN.....--------------------------------------------------------
Q03ZU6_LEUMM/3-107----LGTMLRYIVLNTWPA.....--------------------------------------------------------
Q07MP6_RHOP5/15-134----IGGWARYLVSVV........--------------------------------------------------------
A1A1D2_BIFAA/42-158----IGTALRYACSVIPDC.....--------------------------------------------------------
YP279_YEAST/241-362----FAGFLRYWLAEMFNK.....--------------------------------------------------------
Q5KAE8_CRYNJ/257-375----PGAILRFSLSNINIR.....--------------------------------------------------------
A3IRG4_9CHRO/6-120----LGSCGRYLISKIINE.....--------------------------------------------------------
CRCB_CAMHC/5-120----VGAILRFLFYFGFAQ.....--------------------------------------------------------
CRCB2_RUBXD/26-142----LGAAARLAVEGAARR.....--------------------------------------------------------
CRCB2_PROMA/11-126----PGAICRMKISDNLFR.....--------------------------------------------------------
A6W0D0_MARMS/3-118----FGALSRYGMTKW.IN.....--------------------------------------------------------
CRCB2_CORJK/7-137----LGAIIRWTLTVWIPALGDPT--------------------------------------------------------
A1EMW2_VIBCL/6-121----VGACARFLVSEICVT.....--------------------------------------------------------
A7A346_BIFAD/88-207----VGVGFRRATDLLLPS.....--------------------------------------------------------
CRCB1_STAS1/4-116----IGAVIRGFVTDVFNQ.....--------------------------------------------------------
A5KTD5_9BACT/57-174----FGTLLRYEIGLWIPN.....--------------------------------------------------------
Q4PD24_USTMA/375-497----AGTVARWYLSRLNTH.....--------------------------------------------------------
YI7B_SCHPO/187-299----FAALTRLYLARFLNS.....--------------------------------------------------------
CRCB2_CARHZ/3-115----FGAIAREITGRALGT.....--------------------------------------------------------
A4QGU1_CORGB/7-93----LGVCVRLVLTLWLGD.....--------------------------------------------------------
CRCB_SILPO/8-117----IGSVLRELLGFQ........--------------------------------------------------------
Q03UF6_LEUMM/13-124----LGSLFRLLITEIPHI.....--------------------------------------------------------
A0CCJ9_PARTE/6-114----IGVSMRLEIVSIVGN.....--------------------------------------------------------
A9BD76_PROM4/12-109----PGALIRWLLNND........--------------------------------------------------------
CRCB_NITMS/6-118----LGAFLRYKITESPLI.....--------------------------------------------------------
Q23G77_TETTS/32-131----PGVLVRLLLSNLTK......--------------------------------------------------------
A4AFW6_9ACTN/6-118----VGAILRYLTSRAFAA.....--------------------------------------------------------
A8FBH5_BACP2/3-115----IGSALRFFISQLMQK.....--------------------------------------------------------
A3UD64_9RHOB/4-120----LGAVSRHFVNQAGLR.....--------------------------------------------------------
A9BD77_PROM4/11-126----LGAFLRFEILNTFNY.....--------------------------------------------------------
CRCB1_BACSK/7-119----LGGAFRFILTII........--------------------------------------------------------
Q2J3P8_RHOP2/15-132----VGALSRFGSASIIAD.....--------------------------------------------------------
CRCB2_METAC/11-116----LGAVCRFLLCELVEG.....--------------------------------------------------------
A7BBA9_9ACTO/6-120----VGACARFWLDRGTQR.....--------------------------------------------------------
Q26C06_FLABB/5-117----FGCVLRFLFSIWMNT.....--------------------------------------------------------
CRCB_DICNV/4-117----LGAVSRHYLSVYLMR.....--------------------------------------------------------
A7JDJ3_FRATL/5-123----FGAMARFALTQATAS.....--------------------------------------------------------
CRCB_THEP1/6-121----IGAVLRYLVSRTINS.....--------------------------------------------------------
Q6CGB9_YARLI/187-303----PGALLRWQLSKLNGK.....--------------------------------------------------------
CRCB1_CORJK/10-136----TGAAARYVLDTHLKS.....--------------------------------------------------------
Q03ZU7_LEUMM/11-122----IGGATRYLLGLVPII.....--------------------------------------------------------
Q5AFH3_CANAL/261-381----FGALLRYYLSKFLNN.....--------------------------------------------------------
A2EQG0_TRIVA/5-119----IGAVFRGVICILFDK.....--------------------------------------------------------
CRCB3_METBF/4-118----IGATLRYVFGGWIQN.....--------------------------------------------------------
CRCB_SYNY3/8-123----PGALARYYATIFLAG.....--------------------------------------------------------
CRCB1_NOCFA/25-135----LGAPVRYLIDRAVTA.....--------------------------------------------------------
CRCB2_LACPL/4-116----LGGGLREGLSLLVT......--------------------------------------------------------
Q83WT7_BACTA/176-286----CGAITRFGISNWFKK.....--------------------------------------------------------
CRCB_PSEU5/5-120----IGTLLRFALATWVSA.....--------------------------------------------------------
A7Z2X1_BACA2/3-115----IGAVLRSLLGKTISE.....--------------------------------------------------------
CRCB1_PROMA/15-112----LGAILRWKLNNY........--------------------------------------------------------
Q18FV1_HALWD/24-129----IGAICRFSVDMIFDD.....--------------------------------------------------------
A4BDQ7_9GAMM/9-125----LGAMARFGVVSW.LN.....--------------------------------------------------------
A1SKX4_NOCSJ/28-142----LGASARY......AA.....--------------------------------------------------------
Q6C7Z3_YARLI/215-333----AGANFRFQFSRMNRL.....--------------------------------------------------------
CRCB_AROAE/10-124----LGAWLRWALGLL.LN.....--------------------------------------------------------
CRCB1_PROMT/10-107----LGALFRWQIDEI........--------------------------------------------------------
CRCB_SILST/5-119----IGASCRYLIGVG.VL.....--------------------------------------------------------
CRCB2_PROMT/4-120----LGANIRFQIHHKLGN.....--------------------------------------------------------
A7I6T8_METB6/10-116----IGAVLRYLTDTVLV......--------------------------------------------------------
CRCB1_BIFLO/2-123----LGAMARYVLDVSIQR.....--------------------------------------------------------
CRCB2_HALSA/12-118----VGAVLRYTVAQAIAG.....--------------------------------------------------------
B8G951_CHLAD/4-119----IGANLRYGIGLWAAQ.....--------------------------------------------------------
A5GI10_SYNPW/9-127----PGAWLRLRVVNHFEP.....--------------------------------------------------------
A5N506_CLOK5/4-119----LGAILRYVIRNI.PI.....--------------------------------------------------------
CRCB1_LACSS/6-119----FGGILRYLIGLV.LN.....--------------------------------------------------------
A0NJX1_OENOE/4-115----LGVLGRYQITNSIKK.....--------------------------------------------------------
A4J4K8_DESRM/3-118----VGALARYMLGLV.IT.....--------------------------------------------------------
CRCB_HAEDU/4-113----AGAILRWQLAVWFNP.....--------------------------------------------------------
A6VGL6_METM7/4-116----FGAILRYFVSGIIPV.....--------------------------------------------------------
A5FV99_ACICJ/73-188----LGCWARYGQTIF.MQ.....--------------------------------------------------------
A0JYB9_ARTS2/3-119----AGGLLRFAIDTWFAH.....--------------------------------------------------------
CRCB_PROM5/6-103----LASFLRFFLNNN........--------------------------------------------------------
A0JYB8_ARTS2/12-126----AGTELRYGLGVLFPD.....--------------------------------------------------------
B3XPY6_LACRE/7-123----FGGVLRYACELVSDL.....--------------------------------------------------------
A3TIL1_9MICO/4-113----VGAPLRYAVTQGLRD.....--------------------------------------------------------
CRCB_CLONN/7-122----IGAALRYLISEN.TS.....--------------------------------------------------------
Q4Q5Z9_LEIMA/95-201----GGSAARVALQKCFEK.....--------------------------------------------------------
CRCB_NEIG1/5-113----FGTTARWLLNLAVPA.....--------------------------------------------------------
A2BTL4_PROMS/6-116----FGLILRIFIQNNFKK.....--------------------------------------------------------
Q23G77_TETTS/193-301----IGALPRYILSTKLNY.....--------------------------------------------------------
CRCB1_LACAC/8-116----FGGIARAWLNSSFG......--------------------------------------------------------
A6GBU2_9DELT/14-125----TGALLRVLLSAQIEQ.....--------------------------------------------------------
CRCB2_CORGL/3-107----FGGFLRWSLAQLFPG.....--------------------------------------------------------
C1AGI8_MYCBT/9-123----LGALARAALSALAIP.....--------------------------------------------------------
A7BBA8_9ACTO/9-133----VGTAARAGLDEVSKA.....--------------------------------------------------------
CRCB_RHOBA/7-139----IGAVLRYLITLTVVS.....--------------------------------------------------------
A5VRB9_BRUO2/6-123----VGSLGRWWIGRIVGE.....--------------------------------------------------------
CRCB_NITOC/5-120----GGTLSRYALSGL.VQ.....--------------------------------------------------------
A4XHA8_CALS8/3-113----VGAVLRYIISKI.FK.....--------------------------------------------------------
B3EI10_CHLL2/10-124----LGSAARYLVALAM.......--------------------------------------------------------
CRCB_PELPD/4-119----GGGLARYYLSGWVY......--------------------------------------------------------

PF13536

B8J0H9_DESDA/85-197----------------------------------AAVT...DA..CSAFW------------------------------
Q30W64_DESDG/78-190----------------------------------AATT...DS..SSALW------------------------------
B2TJQ9_CLOBB/79-191----------------------------------SAVN...DT..CSAVW------------------------------
B1KVC8_CLOBM/79-191----------------------------------NAIN...DT..CSAVW------------------------------
Q6AM78_DESPS/78-190----------------------------------AATT...DT..CSALW------------------------------
A8MJF3_ALKOO/79-191----------------------------------SAVN...DS..VSGIW------------------------------
A6TUT9_ALKMQ/87-199----------------------------------TAVN...DI..CSAIW------------------------------
B6W8K1_9FIRM/81-193----------------------------------TGIN...DL..TSAIW------------------------------
Q14LA4_SPICI/73-193----------------------------------VTVQ...EI..MATFL------------------------------
C4L5N6_EXISA/35-152----------------------------------ASLR...FL..WMIPL------------------------------
C1EC76_MICSR/42-154----------------------------------ASWR...MQ..ATALL------------------------------
Q9KE50_BACHD/35-155----------------------------------ASLR...FF..FMLPF------------------------------
Q6ANG8_DESPS/36-150----------------------------------ASLR...YL..FMIIF------------------------------
Q0G3H6_9RHIZ/48-151----------------------------------SLAI...VA..SAAVL------------------------------
C6C7K8_DICDC/40-153----------------------------------IVYC...FI..LSMAF------------------------------
B1YFT7_EXIS2/35-146----------------------------------AALR...FY..LMLPL------------------------------
D7VRB0_9SPHI/41-156----------------------------------AALR...FV..WMLPL------------------------------
C3LF25_BACAC/35-151----------------------------------ASLR...YY..FMVPM------------------------------
A1SUW4_PSYIN/36-150----------------------------------ASLR...YL..FMVIF------------------------------
Q4MHH3_BACCE/35-151----------------------------------ASLR...YY..FMVPM------------------------------
Q4FTR9_PSYA2/36-150----------------------------------ASLR...YL..FMWLI------------------------------
A0RFB5_BACAH/35-151----------------------------------ASLR...YY..FMVPM------------------------------
Q29AX3_DROPS/271-397----------------------------------AWFF...TN..FSLLF------------------------------
B0W9C1_CULQU/259-385----------------------------------SWFC...TN..FAILF------------------------------
B1HZ47_LYSSC/43-163----------------------------------ASLR...YF..FMLPF------------------------------
A5WDV4_PSYWF/36-149----------------------------------ASLR...YL..FTLLI------------------------------
C2MRF9_BACCE/12-136----------------------------------ASFR...FL..FALPI------------------------------
B2ZC64_9GAMM/12-126----------------------------------ASLR...YL..YMFLL------------------------------
C2P113_BACCE/12-136----------------------------------ASLR...FI..FMLPF------------------------------
D5WE59_BURSC/39-154----------------------------------FAWR...IV..WTVPG------------------------------
C2WCR1_BACCE/35-159----------------------------------ASFR...FL..FALPI------------------------------
B8BX33_THAPS/230-337----------------------------------AADR...FF..LAALV------------------------------
Q4CM94_TRYCC/68-183----------------------------------WVFL...FV..VSTIV------------------------------
Q4SHD3_TETNG/80-186----------------------------------VALC...WA..MQLLS------------------------------
B0CPS2_LACBS/61-181----------------------------------LITTTKYSA..TSILE------------------------------
A7Z3M1_BACA2/35-159----------------------------------SSLR...FL..FMVPF------------------------------
B0B9E1_CHLT2/32-143----------------------------------VLTR...YS..VFGIC------------------------------
C2KU03_9ACTO/27-127----------------------------------AWLR...SV..IAGVI------------------------------
A5WEC6_PSYWF/36-151----------------------------------ASLR...YV..FMLLL------------------------------
C6JKK4_FUSVA/36-156----------------------------------SSLR...YL..FMLPI------------------------------
Q13J39_BURXL/39-154----------------------------------FAWR...IV..WTVPG------------------------------
E8WPA4_GEOS8/36-150----------------------------------ASLR...YF..YMFFM------------------------------
E6VZC7_DESAO/35-148----------------------------------ASLR...YFWMLALLV------------------------------
D1AJ88_SEBTE/34-147----------------------------------AILR...HF..FIFIF------------------------------
B5ZTE1_RHILW/38-151----------------------------------ALIR...HV..VSGLV------------------------------
C4LLH4_CORK4/10-124----------------------------------AAIA...YG..GATIL------------------------------
C0QIH1_DESAH/36-150----------------------------------ASLR...YF..FMILI------------------------------
C6E0G2_GEOSM/36-150----------------------------------AGLR...YL..YMFVM------------------------------
C7PA25_CHIPD/42-158----------------------------------AALR...SL..FLIPI------------------------------
A6CI48_9BACI/35-159----------------------------------SSLR...FF..FMVPF------------------------------
C6R7K6_9CORY/19-136----------------------------------AIFF...AL..ASALT------------------------------
A1R4E7_ARTAT/168-283----------------------------------HPLG...VL..SRALW------------------------------

PF00892

YCXC_BACSU/18-142-----------------..AEPF-------DI--LAHR---FT--IAF..------------------------------
YHBE_SHIFL/169-292-----------------..LASP-------QI--LFLL---YT--LCT..------------------------------
YBFH_BACSU/18-141-----------------..FSPM-------EI--LFYR---FL--MGF..------------------------------
Y1552_ARCFU/19-133-----------------...DTL-------SV--TFLR---LF--FGF..------------------------------
YD3A_METJA/13-135-----------------...KNP-------LF--QWIV---VN--IVG..------------------------------
YYAM_BACSU/15-140-----------------..FSPS-------SS--AAWR---FG--LAAAV------------------------------
YXXF_BACSU/166-292-----------------..IHNL-------SP--YTTT---FL--QTGLG------------------------------
O58666_PYRHO/13-134-----------------..YNPV-------NP--ISFA---FF--SAF..------------------------------
Y355_SYNY3/182-308-----------------..VDPV-------VA--TGWH---MI--IGGLP------------------------------
O58347_PYRHO/160-285-----------------..ISSL-------TL--AGLR---II--YAAVG------------------------------
Y510_ARCFU/159-285-----------------..YDHE-------TL--TAYA---FA--LGTIF------------------------------
Y355_SYNY3/22-146-----------------..TTPF-------FV--ATVR---LI--PAG..------------------------------
O80521_ARATH/206-335-----------------.FAAPY-------TS--TLLM---CL--MGSIQ------------------------------
Y1533_ARCFU/154-274-----------------..RLPV-------SI--VAFV---RL--LLC..------------------------------
O59388_PYRHO/20-144-----------------..VSPL-------TL--NFLR---LV--IASGF------------------------------
O50525_STRCO/162-288-----------------.GVNDA-------TT--FGWM---TI--SGLLL------------------------------
YDFC_BACSU/17-140-----------------..YTPE-------HL--ALFR---LL--IGS.M------------------------------
O68125_RHOCA/19-144-----------------..WPPV-------AL--SFGR---WS--IALIA------------------------------
SAM_RICPR/160-281-----------------..ESML-------SM--LFYS---AI--VTA..------------------------------
Q9Z6F0_MYCSM/162-288-----------------..LGSW-------QT--VSWA---LV--VAAPV------------------------------
YXXF_BACSU/24-147-----------------...PSF-------EL--VFVR---CL--CATLF------------------------------
Q9Z6F0_MYCSM/18-141-----------------..LSPL-------FI--GAGR---AV--VAAAL------------------------------
O86204_ECOLX/16-139-----------------..LDAG-------GV--FFWQ---IC--SAVIL------------------------------
YTR1_BUCSC/162-288-----------------..ISIL-------TF--NALP---SL--LSG..------------------------------
Y1552_ARCFU/150-269-----------------..HSPW-------RI--TFYN---LG--LGS..------------------------------
Q9ZAR1_ENTAG/155-287-----------------..TPFK-------AR--LFWQ---IL--VSTIL------------------------------
O85844_SPHAR/180-306-----------------..MHHL-------SL--LVVL---FG--VGIAA------------------------------
YVBV_BACSU/18-141-----------------..SPPL-------LF--AGIR---TL--IGG..------------------------------
YDED_BACSU/171-296-----------------..FDSL-------VV--VGWA---MI--IGG..------------------------------
O59158_PYRHO/33-155-----------------..LDTI-------SM--LFYS---SL--TST..------------------------------
Q9Z799_CHLPN/11-135-----------------..SAPI-------FA--TGAR---MV--IAGA.------------------------------
YIJE_ECOLI/20-142-----------------..IGAF-------DF--TALR---CI--FGA..------------------------------
YCBK_BACSU/173-303-----------------..IGGI-------RL--NAYG---MT--AAGAA------------------------------
SAM_RICPR/20-142-----------------..LHSF-------EV--AFFR---FF--FSS..------------------------------
O66073_BACLI/169-302-----------------LELTYV-------TT--GAGF---LF--FNGIA------------------------------
Y1533_ARCFU/12-136-----------------..VSAF-------TA--NFHR---TL--FATVY------------------------------
YETK_BACSU/187-314-----------------..ISAL-------AI--STFV---SL--FGFL.------------------------------
O57793_PYRHO/12-137-----------------.NLSTY-------TI--VFYR---VI--FALIF------------------------------
Y266_ARCFU/12-133-----------------..LSPI-------AI--ASLR---FA--IAN..------------------------------
Q9ZF46_BACME/165-289-----------------..WSSI-------EV--VGWG---MV--IGG..------------------------------
Y510_ARCFU/14-136-----------------..LDPF-------NL--AFYR---FL--LAS..------------------------------
Y878_HAEIN/166-289-----------------..FNSQ-------QI--LLMM---YL--GCA..------------------------------
YSO2_ACIAM/116-237-----------------..FDAT-------SV--NAVQ---LL--LGS..------------------------------
Y1164_SYNY3/191-319-----------------..IPVG-------IF--TVYR---SL--LGTFV------------------------------
YDED_BACSU/18-149-----------------.QIDVN-------WL--VTTR---LL--TAGML------------------------------
Y976A_HAEIN/35-161-----------------..VSTQ-------AY--TSVS---IV--LGT..------------------------------
O68125_RHOCA/168-295-----------------..VNRI-------GL--LAVQ---IA--LALP.------------------------------
Y788_ARCFU/178-306-----------------RLSNPT-------ML--AFWQ---SF--AIFIL------------------------------
PECM_DICD3/12-130-----------------..DKPL-------LA--ALIR---AL--PAG..------------------------------
O58983_PYRHO/16-140-----------------..VDPT-------MA--TTIR---AI--IMA..------------------------------
YEDA_ECOLI/160-285-----------------..VGMM-------AG--AIEM---LA--AGVVL------------------------------
Y1164_SYNY3/39-164-----------------..FCNV-------LF--VGNL---CA--LGLMI------------------------------
Y878_HAEIN/17-142-----------------..MNAQ-------TI--VWYR---FI--IAAVS------------------------------
YTR1_BUCSC/16-140-----------------..IPPL-------CI--TGMR---FL--LASF.------------------------------
YWFM_BACSU/15-138-----------------..ATPL-------AF--GAFR---LL--IGG..------------------------------
O85844_SPHAR/31-156-----------------..LSPV-------TL--AFWR---WV--VALVF------------------------------
Y266_ARCFU/150-274-----------------..YNPI-------TL--TSNA---MV--LGS..------------------------------
O57793_PYRHO/155-274-----------------..KEEP-------ER--VLFN---VL--LIG..------------------------------
YVBV_BACSU/161-287-----------------..VDSI-------WM--VALQ---LT--IGS..------------------------------
YHBE_SHIFL/17-144-----------------..MEPP-------TI--VFYR---FL--MASIG------------------------------
YICL_ECOLI/16-145-----------------.QMSSQ-------FL--TMTR---LI--FAG..------------------------------
PAGO_SALTY/161-287-----------------..VSVI-------TF--NALP---CL--LAG..------------------------------
O66073_BACLI/23-147-----------------..ANPV-------DI--LAHR---FT--VAFL.------------------------------
Y270_BUCAP/15-139-----------------..IPPF-------FA--TGIR---FL--AASP.------------------------------
O59388_PYRHO/165-290-----------------..EPPV-------LI--AALR---IS--SGILG------------------------------
RHTA_ECOLI/158-281-----------------..EHGP-------AT--VAIG---SL--IAA..------------------------------
YIJE_ECOLI/162-290-----------------PRVDLL-------SL--TSWQ---ML--YAALV------------------------------
O50525_STRCO/20-140-----------------...YPN-------EM--IYII---WA--FTM..------------------------------
Q56929_YEREN/17-141-----------------..IPPI-------FA--TGIR---FM--FAAP.------------------------------
O67627_AQUAE/15-141-----------------.EMPTL-------AG--IFVH---NL--TATSL------------------------------
Y841_METTH/216-340-----------------..RDLI-------FI--SGVK---SS--VGGFV------------------------------
Y788_ARCFU/52-166-----------------..MSPF-------AF--NTVR---FF--IAC..------------------------------
SAMHT_CHLTR/34-158-----------------..AAPL-------FV--TGSR---MV--LAGV.------------------------------
Y1234_HELPY/17-141-----------------..FSPM-------EN--VFYR---SI--TMT..------------------------------
YOAV_BACSU/13-137-----------------..IPPL-------LF--SGLR---LF--IGAVP------------------------------
O85268_YEREN/163-289-----------------..VSVL-------TF--NAIP---SL--VAG..------------------------------
Q9ZF46_BACME/15-143-----------------.SFNAE-------WL--VVVR---ML--VSG..------------------------------
YEDA_ECOLI/18-141-----------------..WPPL-------MM--AGVR---FL--AAG..------------------------------
YETK_BACSU/38-163-----------------..IPVF-------LS--SGLR---FL--IAS..------------------------------
O58347_PYRHO/13-140-----------------..KSPV-------SA--NLIR---LY--FSS..------------------------------
YRDR_BACSU/175-300-----------------..YSTL-------TC--LFGT---AI--TGIMT------------------------------
YDFC_BACSU/160-285-----------------..YGFI-------PF--VTFT---IW--GGT..------------------------------
YCB6_PSEDE/14-140-----------------..INSD-------FA--TLIR---TV--VILCV------------------------------
Y841_METTH/55-192-----------------..MHPV-------TI--GAYT---YI--IAGIF------------------------------
YICL_ECOLI/167-291-----------------..YGTL-------PV--VGWS---ML--IGG..------------------------------
Q9ZAR1_ENTAG/14-139-----------------..IGPY-------AF--RMAG---SL--VSCG.------------------------------
O59158_PYRHO/178-298-----------------...KAE-------VK--MMWN---FI--FGF..------------------------------
Y270_BUCAP/161-287-----------------..VSVI-------TF--NALP---SL--ISG..------------------------------
PAGO_SALTY/15-139-----------------..IPPV-------FA--TGMR---FM--FAAP.------------------------------
YOAV_BACSU/159-285-----------------..IDII-------HM--NAWH---LM--MGAVM------------------------------
SAMHT_CHLTR/185-314-----------------.SLSMT-------AI--NAYA---MV--IAGVL------------------------------
O86204_ECOLX/162-286-----------------..FEPI-------TL--LSGQ---LT--FSLIL------------------------------
YRDR_BACSU/18-146-----------------..VDPF-------YF--SFIR---YG--VVTIM------------------------------
Y3017_CLOK5/166-292-----------------..YGGY-------VF--NCIS---FF--FGV..------------------------------
Y1319_SYNY3/191-316-----------------..LHPV-------PF--TWIS---FA--TTLIL------------------------------
YWFM_BACSU/158-282-----------------..TQPP-------RA--TSAV---VF--MIS..------------------------------
YYAM_BACSU/164-290-----------------..GTPL-------ST--TTYT---MV--IGAVS------------------------------
O58324_PYRHO/19-137-----------------..FPPV-------SF--IAFR---FF--LAS..------------------------------

PF04142

S35A5_HUMAN/78-366-----------------YLQPAM-------AV--IFSN---FS--IITTA------------------------------
O76865_DROME/83-334-----------------HLDAAT-------YQ--VTYQ---LK--ILTTA------------------------------
GMS1_SCHPO/79-315-----------------NLTAAS-------FQ--VTYQ---LK--ILTTA------------------------------
S35A2_HUMAN/96-331-----------------NLPAAT-------FQ--VTYQ---LK--ILTTA------------------------------
UGTP1_CAEEL/104-343-----------------NLDAGL-------YQ--VTTQ---LK--VVSTA------------------------------
S35A1_HUMAN/72-306-----------------NLDAAV-------YQ--VTYQ---LK--IPCTA------------------------------
O02345_CAEEL/69-352-----------------NLPAAT-------YM--VTYQ---LK--ILTTA------------------------------
S35A3_CANFA/68-306-----------------NLDAAT-------YQ--VTYQ---LK--ILTTA------------------------------
O16658_CAEEL/74-318-----------------KLDAAT-------YQ--VTYQ---LK--ILTTA------------------------------
O01879_CAEEL/71-306-----------------HLEATT-------FC--ISYQ---MK--IFTTA------------------------------

PF05653

Q90YI4_TAKRU/4-304--------------MGTGEAANF-------AA--YAFAPATLVTPLGALS------------------------------
NIPA2_HUMAN/6-306--------------MGAGEVANF-------AA--YAFAPATLVTPLGALS------------------------------
Q9VK62_DROME/41-342--------------MGVGEAANF-------AA--YAFAPASLVTPLGALS------------------------------
Q9SST0_ARATH/15-267--------------MIVGEIANF-------AA--YAFAPAILVTPLGALS------------------------------
Q8LA45_ARATH/1-300--------------MIVGEIANF-------AA--YAFAPAILVTPLGALS------------------------------
Q9SKQ1_ARATH/1-295--------------VIVGEAANF-------VA--YIYAPAVLVTPLGALS------------------------------
NPAL2_MOUSE/43-336--------------TALGETGNF-------AA--YGVAPITLIAPLGCMS------------------------------

PF10639

Q4TT81_CAEEL/12-122-------------------LENK-------KN--G.......I--ILGFL------------------------------
Q4V4P6_DROME/6-122-------------------IESV-------GD--TGSKW.RNF--VQEAR------------------------------
A0C2W3_PARTE/7-116-------------------KQQD-------..--.........--LFGFK------------------------------
Q4D1L3_TRYCC/4-115-------------------MAVS-------SS--S.......F--LEDLR------------------------------
Q22BW6_TETTS/16-127-------------------QNLE-------Q.--........F--DISLK------------------------------
Q4RMD0_TETNG/95-210-------------------LETV-------AE--TSRVS.Q.L--FAEIK------------------------------
TM234_ANOGA/20-135-------------------YNEL-------KA--DSKLG.Q.L--WLEVR------------------------------
TM234_PONAB/11-126-------------------LQRV-------RE--P..TWVRQL--LQEMQ------------------------------
Q0U0B5_PHANO/22-148-------------------YTPI-------PR--PSLTDPSNS--WLKKK------------------------------
A4I0H4_LEIIN/5-115-------------------MASS-------GS--........A--KDDAL------------------------------
TM234_DICDI/9-124-------------------VSKV-------KK--DNFLS.Q.I--IYEFV------------------------------
A4FVN3_DANRE/1-116-------------------IEEV-------QK--KNKLL.Q.F--LAELK------------------------------
A7SF34_NEMVE/12-127-------------------IEDV-------KG--KGAI..RQF--LAEIR------------------------------
Q57W61_TRYB2/4-115-------------------MSVD-------SS--S.......F--LEDLR------------------------------
Q5B4G5_EMENI/114-201-------------------....-------..--.........--.....------------------------------
Q179X3_AEDAE/11-126-------------------YNNL-------KA--PTKCG.Q.L--WLEVK------------------------------

PF00893

QACC_STAAU/1-93---------------------------------------------VIGSA------------------------------
MMR_MYCTU/1-94---------------------------------------------VVATS------------------------------
EMRE_ECOLI/2-94---------------------------------------------VIGTT------------------------------
YVAE_BACSU/1-93---------------------------------------------VAGTV------------------------------
P96460_STAAU/1-93---------------------------------------------IIGTS------------------------------
MDTI_ECOLI/4-99---------------------------------------------IVANV------------------------------
Q7B1Y7_SALEN/2-94---------------------------------------------VIATS------------------------------
YVDS_BACSU/1-89---------------------------------------------VVWAS------------------------------
EBRB_BACSU/2-94---------------------------------------------VFGST------------------------------
YKKD_BACSU/2-94---------------------------------------------MAGVA------------------------------
EBRA_BACSU/3-95---------------------------------------------SIGAA------------------------------
YVDR_BACSU/1-93---------------------------------------------IIAAI------------------------------
MDTJ_SHIFL/3-95---------------------------------------------ITGTL------------------------------
Y4NH_RHISN/1-106---------------------------------------------CIGNI------------------------------
YKKC_BACSU/1-90---------------------------------------------VVWVI------------------------------
SUGE_SHIFL/1-93---------------------------------------------VVWAV------------------------------
SUGE_PROVU/1-93---------------------------------------------IVWAV------------------------------

PF04657

Q21DH8_SACD2/19-159--------------VL.IH.HPL-------IA--TSVA---FS--CAALC------------------------------
Q8CTN3_STAES/3-144--------------QF.TR.SSF-------YA--STIS---FA--VGTIC------------------------------
Q39SB9_GEOMG/5-141--------------QK.IG..VI-------ES--SFVS---FT--VGALV------------------------------
A6TN22_ALKMQ/4-138--------------KE.VG..LL-------TG--TFYN---YV--VGLFV------------------------------
A3QFA9_SHELP/30-170--------------KY..G.SPL-------LA--SWVA---HG--VGTLV------------------------------
A6VSJ3_MARMS/9-148--------------RA.LG.HPL-------WA--TLVS---LI--VSILV------------------------------
Q6M695_CORGL/164-304--------------TV.LG.SPI-------ES--ALVS---FA--VGTTA------------------------------
B8FYQ2_DESHD/4-140--------------KR.IG..GI-------EG--ALIS---FA--VGLLC------------------------------
Q1GQL8_SPHAL/9-147--------------AR.LG.SPM-------AA--SMIL---FG--LAFLI------------------------------
Q1Z706_PHOPR/6-152--------------FF.TS..PV-------AA--SWAA---HL--VGTII------------------------------
Q1QZC8_CHRSD/5-140--------------ED.IG..HF-------SA--TLSI---FL--VGGLL------------------------------
A5W524_PSEP1/11-150--------------RA.LG.HWL-------WG--AFTS---LT--VSMLV------------------------------
Q1QB44_PSYCK/4-140--------------SQ.VG..EL-------WA--TLSI---FG--VGAAL------------------------------
Q394M9_BURS3/11-150--------------RA.LG.HPL-------WA--SVAS---LT--VSLLV------------------------------
Q2RGM8_MOOTA/15-156--------------RS.TG..PL-------MA--STIS---FL--IGSLL------------------------------
Q0AXV4_SYNWW/5-143--------------KV.VG..IW-------ES--TLIV---HL--VGTIT------------------------------
Q390H3_BURS3/7-143--------------KS.IG..TT-------GG--IFVN---YI--SGALV------------------------------
Q7N4X7_PHOLL/3-137--------------VS.IG..SF-------GA--SLWN---HI--GGFFL------------------------------
Q49VG4_STAS1/3-144--------------LY.TK.SSF-------YA--STIS---FA--TGTIF------------------------------
Q03TA8_LACBA/2-142--------------AF.IG.SPY-------QA--SFVS---FT--IGTLF------------------------------
A6LU87_CLOB8/1-136--------------DG.LG..NY-------SS--LIVI---HF--VGLII------------------------------
A0SZ10_9BURK/18-157--------------RN.LG.HPL-------WA--TIAS---LA--VSAVL------------------------------
Q03TA8_LACBA/164-305--------------VV.LN.SAV-------HA--SFIS---FL--IGAMT------------------------------
Q11NT1_CYTH3/6-142--------------KQ.IG..TI-------EA--AFTS---FF--TGTIV------------------------------
A0RGL9_BACAH/9-144--------------EL.IG..KY-------TA--SVVI---HL--VGLIA------------------------------
A0PSE0_MYCUA/6-144--------------KH.MI.NPW-------LA--SAIS---FA--LITIF------------------------------
A4FZS2_METM5/5-144--------------QN.IG..SK-------NA--VFVN---FL--IGLFL------------------------------
Q0SPU1_CLOPS/2-138--------------EK.IG..VW-------ET--NTIV---QG--SAFVL------------------------------
A1VA83_DESVV/4-141--------------EQWAR.NPV-------LT--ACAS---FA--VGTVA------------------------------
Q0FRW8_9RHOB/3-140--------------AH.IG.SPA-------AA--AFIL---FC--VALTA------------------------------
A0AHV4_LISW6/4-145--------------TY.TK.SPF-------LA--SWVS---FM--VGTTV------------------------------
Q0KF63_CUPNH/16-155--------------RT.LG.HPL-------SA--TLVS---LL--VSLAA------------------------------
A1AK06_PELPD/5-141--------------QK.IG..PL-------ES--SMVS---FG--VGTLA------------------------------
Q1M5R3_RHIL3/11-151--------------RY..G.NPL-------FS--SWTA---HG--TGIIA------------------------------
Q5KZC7_GEOKA/4-140--------------KR.IG..VL-------EG--AFVS---FL--IGTIV------------------------------
A9VF57_BACWK/2-138--------------EI.VG..QW-------LT--TACV---LG--IGLIS------------------------------
Q0I1U4_HAES1/4-144--------------QS.LSGQPV-------FA--AFVS---FA--MGTIA------------------------------
Q4KHW5_PSEF5/5-144--------------HL.LG.HPL-------WA--TGVS---LL--VSLLA------------------------------
Q49VG4_STAS1/163-305--------------QQ.IH.SSV-------MA--SLIS---FA--VGTIV------------------------------
A0JUK3_ARTS2/163-299--------------VH.YG.TPI-------AA--TLVN---FI--SGATV------------------------------
Q7UTT1_RHOBA/5-133--------------KA..GASSA-------HA--AFIS---FA--VGTVA------------------------------
Q03HH1_PEDPA/168-308--------------GL.LQ.API-------HA--ALIS---FF--IGTIM------------------------------
Q03HH1_PEDPA/2-142--------------TY.VI.SPF-------VS--SLIS---FM--VGTIF------------------------------
A6VKF2_ACTSZ/4-143--------------QAVLG.QPL-------IS--ALVS---FA--SGTVA------------------------------
A0L1U7_SHESA/3-135--------------KH.SH..AL-------IA--SCCN---HI--VGFVV------------------------------
A4WAQ0_ENT38/5-143--------------QS.SS.TIL-------IA--MLLN---SL--VGIVL------------------------------
Q03Y21_LEUMM/166-301--------------HY.IQ.SPT-------VS--ALWA---FI--IGLIV------------------------------
B1YHB6_EXIS2/3-139--------------EQ.VG..AW-------AT--TTLV---LG--LGFLA------------------------------
A1ACJ4_ECOK1/10-155--------------HW.LQ.DGN-------AC--AVIS---FA--SGLVV------------------------------
Q3A9B8_CARHZ/6-140--------------KS.IG..LA-------KT--TFIV---HI--VGAIG------------------------------
A8MKQ0_ALKOO/2-138--------------DK.VG..LF-------ET--TVIV---HA--TGLIV------------------------------
B1YEL8_EXIS2/4-140--------------NS.IG..KL-------ES--SFYN---FF--AGTII------------------------------
Q8YKX2_NOSS1/5-144--------------TI.LD.SPI-------AS--ATIN---FV--VGFSI------------------------------
Q12R75_SHEDO/9-146--------------TK.LN.SPA-------LA--TSIL---FM--VGGTV------------------------------
Q99VZ6_STAAM/3-144--------------LY.TK.SPF-------YT--SFIS---FS--VGTIC------------------------------
Q9RVB6_DEIRA/8-144--------------RG.LR.VPL-------AA--SLVN---FL--VGTTV------------------------------
A1A0P8_BIFAA/203-343--------------VA.LG.SPV-------KA--SLAS---FV--VGLIS------------------------------
Q1IEL2_PSEE4/9-148--------------RL.LG.HPL-------WA--AGVS---LL--VSLLM------------------------------
Q749R3_GEOSL/5-141--------------QK.TG..VI-------ES--STVS---FA--VGALA------------------------------
A6M3J1_CLOB8/2-138--------------EK.IG..VW-------ET--TLLV---QI--IALVL------------------------------
A1ZMZ7_9BACT/5-145--------------VL.LK.HPL-------LG--ALVA---FF--GSAVF------------------------------
Q02XB9_LACLS/3-143--------------KI.VG.SPF-------LA--SGIS---NF--VGSIF------------------------------
Q65J95_BACLD/5-146--------------MK.IG.SPY-------GA--AAIS---FF--VGTLL------------------------------
Q28TA8_JANSC/7-146--------------RE.VG.DPT-------AA--AAIS---FA--IGFVV------------------------------
Q12K32_SHEDO/8-147--------------LG.LS.NPI-------QA--AFIS---FL--VGTII------------------------------
A9VF55_BACWK/2-138--------------SD.IG..IW-------ST--SIMT---HL--IGFLI------------------------------
Q9RVB7_DEIRA/19-157--------------RQ.VG.SVV-------LA--GTVS---YG--VGSLL------------------------------
A3QFA8_SHELP/3-133--------------QA.SD..AY-------YA--SLWN---HG--VGFIF------------------------------
A5G8U5_GEOUR/6-141--------------QK.VG..II-------ES--SCIS---FA--VGTVA------------------------------
A8M2W9_SALAI/175-312--------------RA.AG.NAL-------TA--TLVN---FT--VGTLA------------------------------
Q0FHQ8_9RHOB/5-139--------------TV.SG.SIW-------VA--LWLN---SA--VGLVV------------------------------
Q8YKX1_NOSS1/33-172--------------RS.LN.SVP-------LA--ADIS---YL--VGSIA------------------------------
Q3K9Q1_PSEPF/5-141--------------ET.VG..VL-------RS--SLLT---FV--VGAVS------------------------------
A9KHN5_CLOPH/2-140--------------KQ.TS..VW-------VA--SSFV---QF--SALIV------------------------------
Q8FQJ9_COREF/99-239--------------VV.LG.APV-------EA--ALVS---FT--VGTLT------------------------------
B1YGF5_EXIS2/14-153--------------GI.VG.SPF-------LA--SLLS---FS--IGTVF------------------------------
Q6D0D7_ERWCT/13-152--------------RS.LG.HPL-------WA--TLVS---LL--VSICV------------------------------
A8LKG3_DINSH/5-143--------------RA.SG.DPV-------VA--AAIS---FG--VGFVV------------------------------
A9VMR7_BACWK/2-136--------------KE.IG..NW-------EG--TFFN---YI--TGLFF------------------------------
Q1QB43_PSYCK/5-141--------------GN.VG..VF-------KS--AFLT---FS--VGAVV------------------------------
Q28R25_JANSC/3-140--------------AN.IG.SPA-------AA--ATVL---FI--VAFVS------------------------------
Q4L439_STAHJ/163-304--------------QQ.MH.NSL-------FA--ALVS---FT--VGTLA------------------------------
Q316U3_DESDG/4-143--------------AHWAG.SPV-------LA--SLVS---FS--VGTAA------------------------------
B1YGF5_EXIS2/179-317--------------VV.LD.SAI-------KA--ALIS---FV--VGTVT------------------------------
Q4L439_STAHJ/3-144--------------RY.TE.SSF-------YA--STIS---FF--VGTLF------------------------------
Q65QN9_MANSM/39-179--------------QAMLG.QPL-------VS--AFIS---FA--SGTIA------------------------------
B1YIK4_EXIS2/3-139--------------HA.FG..AW-------AT--TTLV---FF--VGLLG------------------------------
Q04FL6_OENOB/173-313--------------TV.LN.SAV-------KA--AFVS---FL--IGSIA------------------------------
Q31P27_SYNE7/5-144--------------QT.LR.SPI-------AA--TAIN---FI--VGSST------------------------------
Q5R178_IDILO/5-143--------------QL.AH.NTF-------LS--LTIA---FT--ISALF------------------------------
A9BWW9_DELAS/11-150--------------RL.LG.HPL-------WG--ALVS---LA--VSVMV------------------------------
A0PXE0_CLONN/7-143--------------EK.IG..LW-------ET--NTLV---QG--IGFII------------------------------
Q8XG26_SALTI/5-143--------------QT.SS.TIL-------IA--MLLN---SL--VGIVL------------------------------
A0L1U8_SHESA/9-158--------------MY..S.SPL-------LA--SWMA---HG--IGAIT------------------------------
Q6FEY6_ACIAD/10-149--------------DY.LD.SPL-------QA--AFFS---FL--IGTIV------------------------------
Q02XB9_LACLS/164-303--------------VL.LE.NTA-------QA--AFVS---FL--IGFLA------------------------------
Q03UQ1_LEUMM/173-314--------------KV.IN.SSL-------KA--ALIS---FL--VGFVT------------------------------
Q02QF4_PSEAB/5-144--------------RL.LG.HPL-------SA--SLTS---LG--VSLGA------------------------------
Q97DD1_CLOAB/2-138--------------EK.IG..LW-------ET--NAWV---QG--TALLV------------------------------
Q5Z3K6_NOCFA/3-148--------------MR.LH.DGI-------AA--ATVS---FG--TGLVV------------------------------
Q67KE9_SYMTH/5-146--------------QH.I..RPI-------PA--SLVS---FI--VGGTA------------------------------
Q4V1I7_BACCZ/4-142--------------TV.VG.SPL-------VA--ATIS---FI--VGAIT------------------------------
Q2RM98_MOOTA/3-140--------------KI.TG..LL-------QA--TLVV---HL--TATLA------------------------------
Q65J96_BACLD/10-156--------------NA.IH.SPF-------IA--SLIS---FL--VGMLV------------------------------
Q6SF41_9BACT/5-142--------------KI.IG.NPA-------GA--VVML---LL--VAIIA------------------------------
Q1LCM1_RALME/14-153--------------RA.LG.HPL-------WA--TVIS---LV--ISLVA------------------------------
A4W7U3_ENT38/4-140--------------SR.VG..VF-------KS--AFLT---FS--VGALI------------------------------
Q4VSJ2_BURGL/11-150--------------RA.LG.HPL-------WA--TVAS---LL--VSLLC------------------------------
Q02FK6_PSEAB/7-145--------------KQ.VS.SVL-------AA--ALIS---FF--VGTLG------------------------------
Q7NSE3_CHRVO/15-151--------------AY..G.NPL-------TA--SWLA---HA--IGMLA------------------------------
Q1ZWQ0_PHOAS/6-148--------------FF..S.SPL-------LA--SWVA---HG--IGAVV------------------------------
A6LU86_CLOB8/2-134--------------EK.VG..LV-------QS--SFFN---YI--TGLVA------------------------------
Q9CJV1_PASMU/4-144--------------KA.MGNEPL-------VA--TFIS---FG--TGTFL------------------------------
Q53WI3_THET8/6-144--------------RV.VG.GPV-------RS--ALVS---FA--VGTLA------------------------------
A9CIC3_AGRT5/3-135--------------LS.NS..PL-------IA--SFWN---HI--VGFTV------------------------------
Q0BSA2_GRABC/6-144--------------VS.LI.NPW-------LA--SIVS---FL--PILAA------------------------------
Q99VZ6_STAAM/163-305--------------SH.TH.SPA-------FA--SLVS---FT--IGSIT------------------------------
B8G001_DESHD/7-144--------------QK.TS..IL-------AA--TLVV---HI--IGTVI------------------------------
B1YHB4_EXIS2/2-138--------------NG.IG..TW-------QA--ATLT---QM--TGFVV------------------------------
Q3HKF8_RHOS4/5-144--------------RA.LG.HPL-------WA--AVAS---LL--VSLIC------------------------------
Q18BT7_CLOD6/5-139--------------KS.TT..AL-------VA--TFIS---LT--VGAIF------------------------------
A0AHV3_LISW6/11-151--------------LT.VG.SPF-------VA--SFIS---FL--VGTLL------------------------------
Q3K9Q0_PSEPF/22-158--------------EQ.VG..HL-------WA--TLSI---FG--VGSAI------------------------------
B1YIK3_EXIS2/2-138--------------DA.VG..PW-------IS--VTIV---HF--VGLIG------------------------------
A1HTC3_9FIRM/8-146--------------KV.IG..LL-------EA--TFIV---HV--TGTII------------------------------
A0B2B3_BURCH/5-144--------------AQ.IG.SPW-------WA--GSVS---YL--VGLAA------------------------------
Q1QZC9_CHRSD/5-141--------------AN.VG..VL-------ES--AWLT---FA--SGALV------------------------------
A4W7U4_ENT38/4-140--------------GE.VG..DL-------WA--TFSV---FG--VGAAL------------------------------
Q7NSE2_CHRVO/2-129--------------QH.DG..AL-------AA--SFWN---HL--GGFLF------------------------------
Q1ZWP9_PHOAS/4-134--------------QD.TS..AF-------YA--SFWN---HV--VGFIF------------------------------
Q5HRB7_STAEQ/151-293--------------QH.TH.SSI-------FA--SLIS---FS--VGTIA------------------------------
A5D651_PELTS/6-144--------------KV.VG..LW-------ET--TFIV---HV--TGLVL------------------------------
Q7P1D2_CHRVO/22-162--------------LL.LGNSTL-------LA--ALVS---FG--TGCLT------------------------------
Q3KGP6_PSEPF/8-147--------------RG.LG.HPL-------WA--TFTS---LV--VSVLV------------------------------
A4J0N8_DESRM/6-144--------------KV.VG..LW-------ET--TFIV---HA--VGTVV------------------------------
A4XQ88_PSEMY/7-145--------------RH.LA.SVL-------AA--ALIS---FS--VGGLA------------------------------
Q03UQ1_LEUMM/2-142--------------SV.LG.SAF-------NS--SLVS---FG--VGTLF------------------------------
Q168E1_ROSDO/6-143--------------AK.IG.SPA-------AA--ATVL---FT--VAFIS------------------------------
Q1WV36_LACS1/3-143--------------SV.SG.SSF-------LA--SMVS---FV--VGAIF------------------------------
A1A0P8_BIFAA/19-158--------------RS.IG.SPL-------RA--SLVS---FS--IGLIA------------------------------
Q03Y21_LEUMM/4-142--------------FL.LK.SPL-------VA--CFMA---YI--VGSFL------------------------------
Q98M54_RHILO/5-145--------------RG.LG.LPV-------AA--AAFS---FL--SGAIV------------------------------
Q899N2_CLOTE/13-149--------------DK.VG..LW-------EA--NFLV---QS--IGAIL------------------------------
Q6M695_CORGL/2-142--------------QS.VG.APL-------LA--SFIS---FL--VGTFS------------------------------
Q04FL6_OENOB/2-142--------------NA.FS.SPL-------LS--SMTS---FT--IGTIF------------------------------
B1YEL9_EXIS2/4-140--------------QK.AG..AL-------ES--TFLT---FF--TGMLL------------------------------
Q2KZA1_BORA1/11-150--------------RA.LG.HPL-------WA--TLAS---LA--VSVLV------------------------------

PF06800

GLCU_STAXY/16-280--------------VGTTLFSAI-------FL--GEWSTGVQV--TLGLV------------------------------
RBSU_LACSS/19-290--------------VGASLWGVF-------VL--GNWSSSQSK--LIGFT------------------------------
GLCU_STAES/19-283--------------VGTTLFSAI-------FL--GEWSTIVQV--VMGLI------------------------------
Y169_LISMO/16-280--------------VGTSLFGVF-------AF--HEWGTTSKL--VLGFS------------------------------
Y2594_LACPL/16-279--------------VGTSLIGVL-------MF--GEWGSSNQK--ILGLL------------------------------
RBSU_STAAW/19-289--------------LGASLWGVF-------AL--GNWPGIGHK--IIGFT------------------------------
Y2503_LACPL/16-280--------------VANALAGVL-------LF--NEWHGNMYW--I.GSA------------------------------
GLCU_BACSU/16-280--------------VSTSLFGVI-------VF--REWSTPIAI--TLGVL------------------------------
Y424_LISMO/17-281--------------VGATLFAVL-------VF--REWQTVTAV--IIGVV------------------------------
RBSU_STAES/19-289--------------LGASLWGVF-------AL--GNWPGITNK--IIGFL------------------------------
RBSU_LACPL/19-291--------------LGASLWGVF-------AL--GDWPGAMDK--VLGGL------------------------------
Y176_LISMO/16-280--------------VGTTLCGVI-------LF--HEWDTTLRI--ILGFI------------------------------
GLCU_BACME/16-281--------------VSTSLFGVI-------VF--HEWSTKTSI--ILGVL------------------------------
Y2157_STRA5/17-282--------------VGGSLVGAL-------VF--HEWTKPIQF--ILGLT------------------------------
YXFA_LACLA/17-288--------------VIGGLIGVF-------AF--HEWTKQIQF--ILGFI------------------------------
Y2205_STRP1/17-282--------------VLGSLIGVL-------VF--HEWTRPMQF--VVGSL------------------------------
YSUP_LACHE/16-280--------------IGNTLIGAI-------IF--GEWTSSSQY--LIGTL------------------------------

PF02694

Y2672_MYCBO/2-109---------------------------------------------IGGAW------------------------------
YFJF_BACSU/2-109---------------------------------------------IGGGY------------------------------
YNFA_ECOLI/1-108---------------------------------------------IIGCF------------------------------
Y793_SYNY3/2-108---------------------------------------------IGGGY------------------------------

PF07857

Q9U3C0_CAEEL/17-268--------------VGCIFYAAR-------GF--PKFEPIACI--GGFLY------------------------------
O01810_CAEEL/6-270--------------VGFIVFATT-------GF--PGFYPLAML--GGASW------------------------------
TM144_HUMAN/11-263--------------VALVVNLIL-------HC--PKFWPFAML--GGCIW------------------------------
TM144_CAEEL/6-264--------------VGIVVYSTQ-------GF--PEFEPLAML--GGMFW------------------------------
Q20583_CAEEL/8-246--------------VGVAVAMTT-------AP--APIHPIAML--SGMFY------------------------------
Q95QA2_CAEEL/4-261--------------TSLAIHALL-------GF--PPIYPLAML--GGALW------------------------------

PF04342

Q9I3E0_PSEAE/5-112----------------------------------AWYG---HLKTLNSKP------------------------------
Q9PG53_XYLFA/9-115----------------------------------AWYG---HLKYKSVS.------------------------------
Q9KRR2_VIBCH/16-123----------------------------------AWYA---HLKELNNKP------------------------------
Q9RW58_DEIRA/5-112----------------------------------AWYG---LLGKMAARP------------------------------

PF02535

S39A1_MOUSE/27-320--------------EASASGQKA-------LS--LVSC---FA--GGVFL------------------------------
P91348_CAEEL/4-439--------------SKHKHVSLV-------LC--LLTC---FS--GGVFL------------------------------
IRT1_ARATH/49-344--------------...QPDGNI-------FT--IIKC---FA--SGIIL------------------------------
S39A2_HUMAN/5-306--------------.ARGHHRLV-------LR--LLGC---IS--AGVFL------------------------------
S39A6_HUMAN/322-743--------------...VFFKFL-------LS--FLVA---LA--VGTLS------------------------------
Q9VFA2_DROME/25-359--------------...RRFPLT-------AS--LLLC---FG--AGILL------------------------------
S39A8_MOUSE/126-453--------------...SYFPKI-------LT--YFVG---LA--IGTLF------------------------------
Q17996_CAEEL/106-349--------------.SSSQGQRR-------LN--LLLG---FA--IGSLL------------------------------
S39AA_HUMAN/404-819--------------...GCFKFL-------LT--FLVA---LA--VGTMS------------------------------
Q9VUI9_DROME/187-506--------------...AAYQEI-------LK--FLVS---IA--VGTLA------------------------------
Q9XWH3_CAEEL/4-315--------------AIHQHSSLI-------LS--LFSC---FA--GGVFL------------------------------
FOI_DROME/258-684--------------...RYYKYI-------IQ--YLVA---LA--VGTMT------------------------------
S39A5_MOUSE/208-522--------------...RLLRPV-------LG--FLGA---LA--VGTLC------------------------------
YKE4_YEAST/63-344--------------...DRASLT-------LS--LLVS---FS--LGTLL------------------------------
ZUPT_ECOLI/5-248--------------...KPSNRL-------LA--FSLG---FA--AGIML------------------------------
Y1036_METJA/5-231--------------...SVSLKY-------KY--EFEA---IS--FGFIF------------------------------
ZRT2_YEAST/24-419--------------.LP...NWC-------FF--IAKF---FG--SGVIV------------------------------
ATX2_YEAST/4-307--------------DDVSSYRVK-------IA--VLSQ---FG--IGMLL------------------------------
ZIP1_ARATH/48-352--------------.PE...NDI-------FF--MVKA---FA--AGVIL------------------------------
Q09957_CAEEL/4-356--------------.AS...KTS-------IS--FLGC---AS--CGVFI------------------------------
CSUP_DROME/129-446--------------...EAMKPR-------LK--VLLA---FA--SGGLL------------------------------
Q9XVR4_CAEEL/9-352--------------...DAKHRW-------LH--FFLA---MA--VSTLS------------------------------
ZRT1_SCHPO/60-405--------------.PNVYIEYL-------YL--FARY---FG--SGVIL------------------------------
IRT2_ARATH/44-347--------------.PD...GNG-------FM--IVKC---FS--SGIIL------------------------------
YQF9_SCHPO/12-413--------------LDLANSDNA-------LV--TGLA---TS--SGILL------------------------------
ZIP3_ARATH/51-336--------------.PE...TCF-------FF--VTKA---FA--AGVIL------------------------------
O62192_CAEEL/30-311--------------...WARSHI-------LS--FISC---IG--GGVFL------------------------------
ZIP10_ARATH/49-361--------------.PE...KSH-------FL--IVKS---FA--SGIIL------------------------------
Q9VEX1_DROME/53-407--------------QTNARSAIV-------VK--CLLY---FG--GGVLL------------------------------
Q9X260_THEMA/2-241--------------...HTSDKV-------ID--SFLG---FA--AGVML------------------------------
HKE42_CAEEL/155-459--------------...SESGPL-------LK--VLLA---FG--SGGLL------------------------------
Q9XVJ5_CAEEL/4-376--------------...SLSESR-------IR--LVSI---FG--AGLLV------------------------------
ZIP4_ARATH/25-371--------------.TE...GNL-------FV--AAKA---FA--AGVIL------------------------------
O65348_PEA/44-345--------------.PD...GNL-------FV--IVKC---FA--AGIIL------------------------------
ZIP2_ARATH/61-350--------------...RWNESF-------LL--LGTQ---FS--GGIFL------------------------------
Q9UYU8_PYRAB/5-250--------------...RMPSWG-------VD--FSLA---FA--AGVMI------------------------------
Y816_DROME/33-350--------------YKDPADSKL-------LR--VLLS---FA--VGGLL------------------------------
ZIP6_ARATH/24-338--------------.PL..YDKA-------IL--VIKC---FA--AGVIL------------------------------
S39A7_MOUSE/140-473--------------...PRHRSL-------LQ--ILLS---FA--SGGLL------------------------------
ZRT1_YEAST/47-373--------------.IP...LYV-------YL--FAKY---FG--SGVIV------------------------------

PF01545

Q4W9Q0_ASPFU/1-325..............EIDDPPKIL.......AF..GWQRAPVLGAFFNGAL------------------------------
B2JR72_BURP8/9-303..............RR.PASLLH.......PL..GAGRVIYFYSLIVALL------------------------------
B3EFZ2_CHLL2/11-292..............AK.PRDTSH.......PY..GHGKAEFISSAIEGTL------------------------------
A9A444_NITMS/9-285..............IK.PPDAEH.......TY..GHGKIESLGGLIGGIA------------------------------
B4U5R2_HYDS0/7-282..............EK..KHEKF.......PY..GLYKLENIGAMFISFF------------------------------
A8FV11_SHESH/28-339..............KKHANNPNF.......TF..GTGKVSVLGGFTSAIA------------------------------
Q65T10_MANSM/16-294..............TR.APDKKH.......PY..GYGRIEYITAIVIGAI------------------------------
FIEF_ECOL5/13-291..............LQ.PADDNH.......SF..GHGKAESLAALAQSMF------------------------------
Q08QG5_STIAD/1-275..............AR.PADEDH.......PY..GHGKFEAIASLGIGAM------------------------------
A4LN99_BURPE/21-300..............GA.KPDADH.......NY..GHSRYETVASFFLGAI------------------------------
A5LNT3_STRPN/7-278..............NR.EEDNQY.......TL..GYKRFSLLGALVTAVI------------------------------
MSC2_YEAST/388-670..............KK.PASDKF.......PF..GLNYLGTLAGFTNGVL------------------------------
A7IA62_METB6/22-308..............KK.GGEFKY.......DY..GMGKFETFTRSATGVV------------------------------
A6UNW8_METVS/10-301..............RA.NRTKTF.......PF..GKFYYESLYGFIKGLM------------------------------
A3ETR2_9BACT/43-321..............QR.PAGGRF.......TF..GFKRAEIFSAQINGLT------------------------------
A0NZQ3_9RHOB/35-315..............AK.PADSNH.......PY..GHDKVEYFAAVLVGVM------------------------------
A3GJI2_VIBCL/32-314..............QK.PSDARF.......PF..GRAVLEPLVIAIKGLV------------------------------
A7A5K5_BIFAD/30-336..............KR.KTDGDH.......PF..GLYRAKYLASFVVATL------------------------------
A0XY03_9GAMM/14-295..............IH....LAK.......TFNDGYQRAELMGGLINGIL------------------------------
Q0YRH2_9CHLB/11-289..............GK.PADSKH.......HY..GHAKVESVSALIETGL------------------------------
A1AQF0_PELPD/18-298..............AR.KKSEQF.......PY..GLYKAETLAGLFIGVV------------------------------
A4RUF7_OSTLU/97-375..............RK...QNKY.......LYPIGKSRMQPLGIIVFSCI------------------------------
Q6K961_ORYSJ/46-276..............VE....ALH.......AF..MQDESEHKHYLIVS..------------------------------
Q13DW9_RHOPS/90-361..............KR.PPSQRY.......TY..GLRGSSILAALFNAVF------------------------------
A1SH46_NOCSJ/27-308..............GR.VPDREH.......RF..GHGRAENVAALVAATL------------------------------
Q8ZUM0_PYRAE/5-272..............AR.DPGGVF.......TY..GYHRAESLAIFTNAVM------------------------------
Q5V738_HALMA/27-300..............ERFEGGEAW.......SY..GLHRLEPVAAFLNGVL------------------------------
Q4DHZ0_TRYCC/34-411..............SW.SATTIN.......TY..GWGRVEVVGALCSILT------------------------------
Q1Q6L8_9BACT/11-292..............SE.PPDEKH.......PY..GHGKADSIAGLFVSML------------------------------
A2D920_TRIVA/179-434..............RE.PISKEF.......SY..GKGRIKYVFQLTSSII------------------------------
A2F1G7_TRIVA/41-340..............TL.PPDECH.......TY..GYARSMIVCCFSVSLT------------------------------
A2VJD3_MYCTU/44-322..............AK.PATRRY.......TY..GFGRVEDLAGSFVVAM------------------------------
A1SW56_PSYIN/15-292..............SK.PKNNQK.......TF..GYKRAEIIAALFNASA------------------------------
A2DBH6_TRIVA/225-492..............NK.EYSKQY.......RY..GFSNTLNIFSLVDSIF------------------------------
A4EAI9_9ACTN/33-311..............SR.PADEGH.......PY..GHGRYEYLAGLFVAVL------------------------------
Q2W8P3_MAGSA/19-298..............SR.PANSAF.......PY..GYGKVQFLSANFIGIS------------------------------
A6CUL7_9VIBR/10-299..............ES.GTSRNY.......PM..GFFAFEPLIVVIKGIT------------------------------
Q31DJ2_THICR/19-307..............AK.QASQSQ.......PF..GYAIFEPVLNFIKGIL------------------------------
A4WLV6_PYRAR/14-285..............SRRG..KSF.......PW..DLYRLESLLTLLLVLA------------------------------
A2QMS3_ASPNC/132-444..............LK.PPSERF.......PN..GYGKIESIGALGVSGL------------------------------
O28143_ARCFU/1-279..............EK.EADYQH.......PF..GHEMARNVASLAVGVG------------------------------
ZNT9_PONAB/241-535..............VQ.TPDPSH.......PY..GFSNMRYISSLISGVG------------------------------
Q97K27_CLOAB/7-286..............SL.KEDDDH.......PF..GHGKYENVSGFVEAIL------------------------------
A7M130_BACOV/11-292..............NR.PPSKKY.......VF..GYEKAEGIATKILSLV------------------------------
Q8KB34_CHLTE/15-289..............AHKS..ERF.......PY..GLHKLEDMAAVLGGLG------------------------------
Q3IUM9_NATPD/8-306..............DA.GASRKH.......PF..GRGKEQYVFAFVVTML------------------------------
Q0G003_9RHIZ/16-306..............DA.GPDRIR.......PY..GYAADEAIFSTFRALS------------------------------
A1T9A2_MYCVP/17-323..............SR.PPDAEN.......PY..GRLALENLYALFRSLM------------------------------
Q6CFY3_YARLI/239-555..............SS....IHH.......PF..GLQRAEVLAGFALSVA------------------------------
Q8PXZ0_METMA/14-302..............SK.PEDWSH.......NY..GHGKVATLFTGAGACI------------------------------
A3Z0I3_9SYNE/9-302..............LR.PPNRRY.......PF..GYWALETLYTGSRSLL------------------------------
A2ECG5_TRIVA/140-412..............RM.NNTKTF.......SF..GFVSCKPVTDLSAAIL------------------------------
Q9EWS3_STRCO/33-324..............RR.PADRRH.......PF..GYGKERFFWSLLAAVG------------------------------
Y9332_DICDI/204-487..............KRGISNQEY.......TY..GYDRWEVLGTFSNGCF------------------------------
A7IN85_XANP2/15-300..............HR.GQVHFY.......DF..GVGKLERMFSIVIGAL------------------------------
A5UNR6_METS3/17-288..............QK.NPNENY.......TY..GYQRFSILGAVITSIF------------------------------
Q8SQT3_ENCCU/27-307..............KK.PSNKRM.......TF..GYHRIEIIGSMVSIGL------------------------------
A7Z109_BACA2/13-297..............NK.PPDQDH.......PF..GHGKAEVISEAIVGII------------------------------
Q03V14_LEUMM/11-303..............TQ..VSKRF.......PN..GLFVLEPLYAFFQSLL------------------------------
Q2LWF9_SYNAS/31-312..............TR....KTP.......SFPEGLYKIENVLSVFVALS------------------------------
Q49MG4_CYPCA/10-409..............EQTQSTNKN.......TF..GWIRAEVMGALVNAVF------------------------------
A0DMX0_PARTE/42-364..............IM.GPNKQF.......PY..GIEKVKHLVALIPSAL------------------------------
Q0IB23_SYNS3/16-314..............VR.PPDRAY.......PY..GYDGQEVLYVLFRSLV------------------------------
A8BD19_GIAIC/28-389..............RK.QASAQA.......TF..GYKRSETIGGFFNASF------------------------------
A2BMQ3_HYPBU/7-274..............KK.PPDVDH.......PY..GHVRLKYGGTLFSLLA------------------------------
A4J438_DESRM/9-311..............QR.PIDDRY.......QF..GHGKRLFFWSFVASLG------------------------------
Q1WV85_LACS1/33-332DDIAGMAPLPKLNMSQRENDQRV.......QF..TRFRYETVFTLVTGVV------------------------------
A3SIX9_9RHOB/27-305..............GK.PASPAY.......PF..GLDRLGSLCFLLAAGA------------------------------
A1S0U9_THEPD/11-292..............SK.GPDADH.......SY..GHEKAESLGTLFVAGL------------------------------
A0L9W4_MAGSM/14-292..............NK.PIDEKH.......PF..GHGKIEFLLSLVVSFV------------------------------
A8ES46_ARCB4/12-311..............TS.STSKDFIHNKLEKHFTMGFWHLEPIVLGVNGIL------------------------------
Q8G7G4_BIFLO/52-342..............VR..TTERF.......PN..GMFALEPIYAICKAIF------------------------------
Q96YR3_SULTO/2-266..............NN..SSSVY.......TY..GLHRLEVLSAVINLMI------------------------------
Q97PQ1_STRPN/15-292..............RQ.PADRDH.......RF..GHWKIEDLASLITSII------------------------------
Q3IQA7_NATPD/24-302..............YT.DPDENH.......PH..GHQRVEPLAALFVGSL------------------------------
Q5PQX4_RAT/114-418..............SK.SPTRRF.......TF..GFHRLEVLSAMISVML------------------------------
Q4P2L6_USTMA/506-793..............AYRSWRTMY.......KYPVGKQRLEPLGVVIFSVL------------------------------
Q97WI8_SULSO/13-280..............NT..RSKRF.......PW..GLYNLESLVVLTASIF------------------------------
Q4Q592_LEIMA/36-364..............SRAGTQQNY.......PFGFGLYRLSVVVRLGSTVF------------------------------
A4VU47_STRSY/11-289..............HR..KTETF.......PQ..GLYFLEPLYAIMKSLA------------------------------
ZRG17_SCHPO/101-382..............TC....LRY.......PF..GMQQMELLVDFSFSIL------------------------------
ZNT6_XENTR/34-341..............MK.KPSPTY.......SF..GFERFEVLSVFASTVL------------------------------
O27240_METTH/16-296..............QR.KPDELF.......PY..GYHRIETLVSLLVSVL------------------------------
Q4KJ37_PSEF5/10-296..............AK.ESNHRF.......QF..GFWHLEPMVLLIEGSF------------------------------
A6CGW2_9PLAN/47-330..............EQ.PPDDDH.......PF..GHGRYEPLAGFQLGIL------------------------------
Q9YBI3_AERPE/52-332..............ASRTVYYKA.......RF..EILRIESLMALHSALV------------------------------
A8FUZ8_SHESH/13-304..............TIRS..EKF.......PF..GLYVTEALYSLMKGLL------------------------------
Q3ZAG2_DEHE1/21-297..............KR.PSNFKM.......TF..GYHRIGVLVAILNSIS------------------------------
A4YF73_METS5/3-267..............DR..RDNIY.......TY..GMHRLEVLYSLLNVIT------------------------------

PF08627

CRTP1_DICDI/6-124--------------EPVPWYSNI-------PQK.........I--KNSMS------------------------------
CRTP2_DICDI/3-132--------------SDLDKLSNV-------KKQSIIQRFKDYL--KNSIS------------------------------
CRTP3_DICDI/4-127--------------TP.....PI-------KKESLSNKFKSFL--KKSMT------------------------------

PF03151

Q7QFK8_ANOGA/152-294..................................TGVHHLRLLHILGRLA------------------------------
PT504_ARATH/159-303.................................GEKLNSMNLMLYMSPIA------------------------------
PT106_ARATH/226-374................................TFGLKNPFIFMSCVAPVM------------------------------
GPT2_ARATH/240-385..................................KSVSGMNYYACLSMMS------------------------------
PT311_ARATH/158-302.................................GEKLNSMNLLLYMAPIA------------------------------
PT148_ARATH/161-301.................................GLTLNPVTSLYYIAPCS------------------------------
XPT_ARATH/254-401..................................KEIDGLNLYGCISILS------------------------------
PUP8_ARATH/210-359...............................KKQTFSTVTDLVAYQSLVA------------------------------
PUP5_ARATH/196-345...............................GRRSFHVALEQQVMVSLTA------------------------------
S35E1_HUMAN/190-334..................................SRIHHLRLLNILGCHA------------------------------
PUP6_ARATH/204-353...............................KKYTFKAILDMATYPSMVA------------------------------
S352B_HUMAN/224-369.................................KYRFSAPELQFYTSAAA------------------------------
Q7SCZ0_NEUCR/409-557.................................PATSNPFSSIFFLAPVM------------------------------
Q9SVB8_ARATH/157-309..................................YSLGSFNLLAHTAPVQ------------------------------
PUP2_ARATH/172-332...............................QRITYTLALEFQMVLCFAA------------------------------
Q9MSB5_MESCR/257-406...............................VDQESMDNITLFSIITVMS------------------------------
Q7XN26_ORYSJ/199-348...............................RTRTLRWVLRAQLWTNVVA------------------------------
Q7RSG8_PLAYO/187-340...............................SIGDNLTGSNIYAFITIFS------------------------------
TPT2_BRAOB/245-391.................................DDSLDNITLFSIITLMS------------------------------
Q8S2F4_ORYSJ/180-320.................................GISLNPITSLYYVAPCC------------------------------
PUP18_ARATH/209-368...........................KRYGNKKVFRMVIEMQICVSFVA------------------------------
PUP1_ARATH/176-326...............................QEITFPLVLEIQMVMCLAA------------------------------
Q9AV45_ORYSJ/156-298..................................LKVSSTQLLYQSSPYQ------------------------------
Q9FDZ5_ARATH/156-299..................................YSLNSFNLLGHTAPAQ------------------------------
PUP14_ARATH/223-383...........................ESTNQKPSFASVFEVIIFSSLVA------------------------------
Q7XJ66_CHLRE/235-385..................................GAVDNMNLFQIITIMS------------------------------
PUP16_ARATH/200-360...........................KRYGNKKVFRMVLEMQICVSFIA------------------------------
PUP12_ARATH/191-340...............................KSETLSMVLEMQIYTSLVA------------------------------
YMD8_YEAST/171-375EESDGALFTENEDNVDNEPVVNLANNKMLENFGESKPHPIHTIHQLAPIM------------------------------
Q84XB7_PHATR/229-376...............................LKDRIGTVGNQFAITTVLG------------------------------
Q9N3S9_CAEEL/227-376................................DSAVRHPLDMVAHVQPWM------------------------------
Q9P5R8_NEUCS/290-459.........................DGHSNGHRSKKLDKLNLLCYSSGMA------------------------------
Q7S227_NEUCR/183-326..................................LALSPLETLLRMSPLA------------------------------
Q960F0_DROME/234-384................................KLGLHNPIDMIYYMQPWM------------------------------
PUP3_ARATH/170-319...............................QTMSYTLVLEFQLILCLLA------------------------------
S35E1_DROME/159-301..................................TNIHHLRLLHLLGKLS------------------------------
Q8I420_PLAF7/190-341...............................LIGENLNASNIYAFITIIS------------------------------
Q802Y0_DANRE/160-304..................................TRIHHLHLLNILGFNA------------------------------
Q872T4_NEUCS/188-328.................................EFKMDPLVSLYYFAPIC------------------------------
A2YZJ5_ORYSI/251-397.................................EESLDNITLFSIITVMS------------------------------
PUP20_ARATH/215-369..............................KTESRVSAVMLMQTNASMIA------------------------------
Q8W0S5_SORBI/236-377.................................GVKLNLISMMYYVSPCS------------------------------
PUP4_ARATH/188-336.................................YCYAMVMEVQLVMEFAA------------------------------
Q7ZW48_DANRE/162-312................................ELGLQNPIDTMYHLQPLM------------------------------
Q84XW3_CHLRE/228-382.............................DGNAEAPLDNMALFSVITLLS------------------------------
Q871P2_NEUCS/171-311.................................GQKMDPLVSLYYFAPVC------------------------------
PUP15_ARATH/211-372..........................TSTNRKQPSFVVVLEMIIFLSLVV------------------------------
Q8H7P2_ORYSJ/208-365...........................PAARVPPPYATVMQMQAVMGAAG------------------------------
Q9AS84_ORYSJ/154-296..................................FKVSSTQLLYQSCPYQ------------------------------
YJT3_YEAST/205-388GFSRQE.........SPLPLYEKLDEKLVAKKKPKSYDKLTLMIYISLVG------------------------------
PT112_ARATH/206-350.................................SEKLHSMNLLLYMAPMA------------------------------
S35C2_MOUSE/165-315................................DLGLQNPIDTMFHLQPLM------------------------------
PT314_ARATH/165-306.................................GIKLNPISLMYYVSPCS------------------------------
S35E3_HUMAN/155-296..................................LQVNSMQLLYYQAPMS------------------------------
TPT_SPIOL/245-389....................................MDSTNIYAYISIIA------------------------------
Q9FIH5_ARATH/159-301..................................YSIGSFELLSKTAPIQ------------------------------
Q84NE7_ORYSA/156-299..................................YSLGSFNLLGHTAPAQ------------------------------
PPT2_ARATH/222-370..................................DALDNINLFSIITIIS------------------------------
YG1B_SCHPO/151-297.............................STHTKKHYNKLNLLLYSSGVA------------------------------
YDB1_SCHPO/205-350.................................PWTSNPFTSLFALTPLM------------------------------
PUP11_ARATH/205-354...............................KRETFSVVLEMQIYTSLVA------------------------------
Q9LPU2_ARATH/159-301..................................YSIGSFELLSKTAPIQ------------------------------

PF08449

UTR2_ARATH/23-316PMRTYVKLSAVLMGSHGLTKGSLAY.LNYPAQIMFKSTKVLPVMIMGAFIPGLRRKYPVHEYISAFLLVLGLILFTLADA
UTR5B_ARATH/19-325PVYKYCLISVTNILTTTCQYEALKY.VSFPVQTLAKCAKMIPVMVWGTLI..MQKKYKGFDYLVAFLVTLGCSVFILFPA
S35B4_DICDI/8-332PLKTYFLMVSIFFILSVLNNKALDCDIPIPFHMIFRSSSLLSTIVIGSIF..YRKSYSKQQILSLIMVTLGIIFATFSSM
S35B4_DANRE/3-318PLSNYVIMVTMFFTVSVINNYALDFNIAMPLHMIFRSGSLIANMILGIII..LKNRYSMSKYLSIVLVSVGIFICTIMSA
S35B4_DROME/7-329ALKDYVILVALFFGANVCNNYAFNFNIPMPLHMIFRSGSLMANMIMGIVL..LKKRYNLRQYSSVAMITAGIILCTLVSS
Q9VAN9_DROME/7-322SLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMIIRGGSLISNMCLCTLI..LKRSYRLSQYISVLMISVGIFVCTYFSS
Q8IIM9_PLAF7/27-336FIKQIMLISITYSIAMIATNYSLSH.VNFPTQVLVKSGKMIPIVVGGYFF..FGKKYPYYDYISVFLITSSLVLFNLLRT
Q9BHL2_CAEEL/24-325PTKMYAASAASYLLAMVASNQALQY.LPYPTQVLAKSCKPIPVMIFGVLF..AHKSYHWRKYCYVLMIVVGVAMFLYKNK
Q9P3N3_NEUCS/80-412PIKRWLINIALFFAINVLNNHAFSYDISVPVHIILRSGGSITTMIAG.AL..WGKRYSRIQIVAVLLLTVGVITAAWSDA
YEA4_SCHPO/2-308PRKRWFVVVVMFFAINVLNNVALGFDISVPVHIILRSSGPLTTMAVGRIL..AGKRYSSLQIGSVFILTIGVIIATLGNA
S35B1_DROME/9-317NAGSYVACSLTYLLAMVSTNMAMRW.VPYPTAVVGKSAKPIPVMILGVLI..GRKSYSWTRYACVLTIVLGVILFMYKEG
S35B4_MOUSE/3-318PIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIII..LKKRYSMFKYTSIALVSAGIFICTFMSA
O44166_CAEEL/4-314PLKGYFKTVTMFFIVNVVNNQALNFHVPVPLHIIFRSGSLLATLILSVVM..VGKSYSARKYISVFAITIGIVICTLATS
HUT1_YEAST/8-332HWKQLMLISFTQSSSGPLATTSLKH.VDYLTYMLAKSCKMIPVLLVHLLL..YRTPIASQKKVVALLVSLGVTIFTIGGN
HUT1_SCHPO/8-313FLGYFSSIAISASLSSYFGYASMFH.LSYPTVILGKSCKLLPVIALHVFV..YKRKFPPHKYLIVTMITAGVSIFSYFQN
S35B3_DROME/62-368PMRTYLILAALTLGTMGLSNSSLGY.LNYPTQVIFKCCKLIPVLVGSILI..QGKRYGLLDFAAATCMCIGLAWFTLADS
Q7ZXL4_XENLA/120-424PMYKYSFASLSNILSSWCQYEALKF.ISFPTQVLAKASKVIPVMLMGKLV..SHKSYEYWEYLTAVLISVGVSMFLLSNG
S35B3_CAEEL/42-336PWRIYGVIAFFTVATMGLSNASVGY.LNYPTQVIFKCCKLIPVLIGGILI..QGKRYGWIDIGAAMLMSLGIIMFTLADN
YEA4_YEAST/4-331PLHVYVITVVLFYISSTTNNNVFKYNISIPIHIVFRCFGTVITMFTCWLL..NGRKYTKIQILSTLFLTIGAIIASLFKD
UTR1_ARATH/14-322PWWTYWSAGITNTIGPAMGIEALKY.ISYPAQVLAKSSKMIPVMLMGTLV..YGIRYTFPEYMCTFLVAGGVSIFALLKT
YEA4_KLULA/3-325PLKIHMLAVFLFFTSSVANNSVFKFDISVPIHIIIRCSGTTLTMIIGWAV..CNKRYSKLQVQSAIIMTLGAIVASLYRD
Q8JFZ3_XENLA/77-371PAKTYMIIAFLTEATMGLSNTSLGY.LNYPTHVIFKCCKLIPVMIGGIFI..QGKRYNVADVAAAVCMSLGLIWFTLADS
S35B2_DROME/145-450PLYKYSYASFSNIMSAWFQYEALKF.VNFPTQVLAKSCKIIPVMLMGKIM..SKAKYESYEYVTALLISLGMIFFMSGSS

PF06027

S35F1_MOUSE/50-385RWWKYMILGLIDLEANYLVVKAYQY-TTLTSVQLLDCFVIPVVILLSWFF--LLIRYKAVHFIGIVVCILGMGCMVGADV
Q948Q8_ARATH/4-331KWYHYFLLAVVDVEANFLVVKAFQN-TSMTSIMLLDCWAIPCVLVLTWVF--LKTRYRLMKISGVVICIVGVVMVVFSDV
S35F2_HUMAN/28-364KWWKYILLGLADVEANYVIVRAYQY-TTLTSVQLLDCFGIPVLMALSWFI--LHARYRVIHFIAVAVCLLGVGTMVGADI
Q948Q7_ARATH/5-333KWYHYFLLALVDVEGNFLVVKANQY-TSITSIMLLDCWAIPCVLVLTWMF--LKTKYRLMKISGVFICIAGVVMVLFSDV
YCN8_SCHPO/131-459HGWKYIIFAFFDVEGNYFVVLAYQY-TNMLSASLLDSWATVAVVILSFIF--LKVRYHWSQILGVVACIGGLVLLVVSDV

PF07168

Q6S9Z3_PHAVU/14-350---------------------EIGKGKPDEPNFLAQLAQDNWPSVLFAMG------------------------------
A2ZKU3_ORYSI/14-359---------------------QLGGTSPGMPSFFTQLTQDNWPSVLFAMA------------------------------
UPS4_ARATH/14-351---------------------EIGKSTFLKPDFTTQLPQDNWPSVLLAVA------------------------------
Q058M8_ARATH/14-340---------------------EIG...PSRPNFFTQLSQDNWQSVMFAMA------------------------------

PF06379

RHAT_SALCH/1-344---------------------AL-----LLPDFWAYYGQFNLSTLLPVFL------------------------------
RHAT_YERPE/1-344---------------------YL-----LLPDFWQYYGSFSIATLLPVFL------------------------------

PF02537

CRCB2_BRUME/5-120-----------------LTDGF.............PLDIL.VANVVACFL------------------------------
Q4Q5Z9_LEIMA/275-384-----------------KACAAQF...........PLGTL.AANLLGVLL------------------------------
A0NJX0_OENOE/3-115-----------------..........SAYP....Y.GTL.IINMIGCFL------------------------------
CRCB2_BACSK/1-111-----------------FGKNAQL...........MTAVF.VINISGCAM------------------------------
CRCB_IGNH4/4-116-----------------.........VYDFP....L.ATF.LVNVVASFL------------------------------
CRCB2_LACAC/3-119-----------------HWEWIGNKFSNL......PTPTL.FINLTGAFI------------------------------
A8FBH6_BACP2/4-115-----------------..QT........FP....Y.ATL.IENVAGSLL------------------------------
CRCB_XANAC/10-125-----------------.......RFGNVFP....W.GTL.TVNLLGSFV------------------------------
CRCB2_LEIXX/16-132-----------------VAVISV..............ITF.VINVIGAFV------------------------------
CRCB2_STAHJ/3-115-----------------..........SGLP....L.GTL.IANIVGAFL------------------------------
CRCB_LEGPC/6-121-----------------..NAWGIK....FP....Y.GTL.LVNTLGSFL------------------------------
CRCB1_LEIXX/6-120-----------------RAPVSF............PLGTT.AINVTGSFV------------------------------
A2F7Z4_TRIVA/3-117-----------------TYHEYFDL............ATL.IANYVGCFF------------------------------
CRCB3_BRUSU/6-123-----------------RIGETF............PWGTF.VVNVSGAFV------------------------------
A5CXX2_VESOH/7-122-----------------..ATLISD....FP....Y.STL.AVNILGSFL------------------------------
Q03ZU6_LEUMM/3-107-----------------KSKY..............FTAVF.IVNMVGSFA------------------------------
Q07MP6_RHOP5/15-134-----------------..QTAWLGPGLGFP....W.ATL.FVNVTGSFV------------------------------
A1A1D2_BIFAA/42-158-----------------GAF...............HIGTF.AANMAACFV------------------------------
YP279_YEAST/241-362-----------------TNKKF.............PLGTF.LANVFATLL------------------------------
Q5KAE8_CRYNJ/257-375-----------------HPFINRF...........PLGTF.ISNMVATLL------------------------------
A3IRG4_9CHRO/6-120-----------------QIDIM.......FP....W.GTL.TVNLIGCLV------------------------------
CRCB_CAMHC/5-120-----------------..FFSQKY....IF....I.ATI.CVNIIGSFI------------------------------
CRCB2_RUBXD/26-142-----------------LAPAAYEAF.........PWGTL.AANAAGSFL------------------------------
CRCB2_PROMA/11-126-----------------NKHN..............LWGIL.LVNSSACLL------------------------------
A6W0D0_MARMS/3-118-----------------..TYWNHH....FP....F.ATM.AINVLGCVL------------------------------
CRCB2_CORJK/7-137-----------------RVLGAATPLNIIGGIPLGDIALL.VVNVLGALL------------------------------
A1EMW2_VIBCL/6-121-----------------.......LFGRGFP....I.GTL.TVNVVGSFI------------------------------
A7A346_BIFAD/88-207-----------------VNGSPF............VVGTF.VSNMLACFL------------------------------
CRCB1_STAS1/4-116-----------------KFNTSL............PIPTL.LINVVGSFC------------------------------
A5KTD5_9BACT/57-174-----------------GVNGWSA.............ATL.FVNVVGAFL------------------------------
Q4PD24_USTMA/375-497-----------------ALSRRFSL..........PLGTL.AANLLATAL------------------------------
YI7B_SCHPO/187-299-----------------PQYFI.............PYGTL.CANVFATLL------------------------------
CRCB2_CARHZ/3-115-----------------...............SIFPVGTL.AINLSGSFL------------------------------
A4QGU1_CORGB/7-93-----------------S.................AWPIL.AINVLGAFL------------------------------
CRCB_SILPO/8-117-----------------............LPGLSFLTATF.GINIAACFL------------------------------
Q03UF6_LEUMM/13-124-----------------GSS...............PWVIV.VINVLGSFF------------------------------
A0CCJ9_PARTE/6-114-----------------FLRDQTIP............IDI.FDNFIGSFV------------------------------
A9BD76_PROM4/12-109-----------------......................L.AVNLLGTLV------------------------------
CRCB_NITMS/6-118-----------------FNTL..............PLNVL.IVNVIGAFI------------------------------
Q23G77_TETTS/32-131-----------------......................F.LPNSVGSFV------------------------------
A4AFW6_9ACTN/6-118-----------------............QPGF..PWAVL.IVNVAGSAL------------------------------
A8FBH5_BACP2/3-115-----------------TKSHARF...........PYSII.LINLLGAAG------------------------------
A3UD64_9RHOB/4-120-----------------LIGPE.......WP....Y.GTF.TVNVLGCLM------------------------------
A9BD77_PROM4/11-126-----------------KKISK.............HWLIF.TINIISCFL------------------------------
CRCB1_BACSK/7-119-----------------............FPFHNWPWGIF.TANLGGCFL------------------------------
Q2J3P8_RHOP2/15-132-----------------LWGAGD............LVATA.FVNIVGSFV------------------------------
CRCB2_METAC/11-116-----------------..................QLGIL.SVNVIGSFM------------------------------
A7BBA9_9ACTO/6-120-----------------ALSSWGEPAGAKL.......GIL.VVNVIGCFL------------------------------
Q26C06_FLABB/5-117-----------------DQIK..............WIPTL.VVNVLGCFI------------------------------
CRCB_DICNV/4-117-----------------MTAIN.......AP....W.AIL.LINLLGCLG------------------------------
A7JDJ3_FRATL/5-123-----------------........ISKQIP....L.GIL.LCNIIGSLI------------------------------
CRCB_THEP1/6-121-----------------..LLPFSY....IP....L.GTI.IVNSVGSFF------------------------------
Q6CGB9_YARLI/187-303-----------------L.................PLGTF.SANILACIV------------------------------
CRCB1_CORJK/10-136-----------------KHGWA.............PLWSLAVVNLLGTVV------------------------------
Q03ZU7_LEUMM/11-122-----------------...............GPMPVMTM.LINWLGTLL------------------------------
Q5AFH3_CANAL/261-381-----------------KVSNF.............PLGTF.TANFLGTLL------------------------------
A2EQG0_TRIVA/5-119-----------------.......CYKKKFP....L.AVF.IINITCCFL------------------------------
CRCB3_METBF/4-118-----------------..SFVN......FP....V.GTL.TINTIGSFF------------------------------
CRCB_SYNY3/8-123-----------------LFGNDLPY............ATF.LINFSGCVG------------------------------
CRCB1_NOCFA/25-135-----------------RIDSP.......LP....L.GTL.TVNIVGSAV------------------------------
CRCB2_LACPL/4-116-----------------............WPQH..FWITC.LINIVGAFV------------------------------
Q83WT7_BACTA/176-286-----------------.......RNKTSFP....M.ATF.IINITGAFL------------------------------
CRCB_PSEU5/5-120-----------------..QW.........PRHFYL.ATV.AVNLLGCLL------------------------------
A7Z2X1_BACA2/3-115-----------------RTKGFPM...........PLGMA.AVNLLGSFG------------------------------
CRCB1_PROMA/15-112-----------------......................F.WVNISGAAL------------------------------
Q18FV1_HALWD/24-129-----------------..................GRQSLITINIVGSTA------------------------------
A4BDQ7_9GAMM/9-125-----------------..RLHGSA....FP....W.GTF.AVNVLGSFI------------------------------
A1SKX4_NOCSJ/28-142-----------------..ARVWPTPEAGVP....W.TTL.GVNAVGCLL------------------------------
Q6C7Z3_YARLI/215-333-----------------GSGKN.............PWGTF.TSNMIGTII------------------------------
CRCB_AROAE/10-124-----------------..PIFLT.....IP....F.GTL.AANLLGGLL------------------------------
CRCB1_PROMT/10-107-----------------......................F.IVNLIGCFL------------------------------
CRCB_SILST/5-119-----------------..RALGPT...GFP....V.GVL.GVNILGSAL------------------------------
CRCB2_PROMT/4-120-----------------LNLDK.............GFLIL.IINTFASFG------------------------------
A7I6T8_METB6/10-116-----------------............FP....LAGTL.AVNTIGCFF------------------------------
CRCB1_BIFLO/2-123-----------------GWNRENRRTNRNFP....L.STL.VINGVASLC------------------------------
CRCB2_HALSA/12-118-----------------..................PLGTL.AANAAGSLA------------------------------
B8G951_CHLAD/4-119-----------------RLGTT.......WP....Y.GTF.IINLLGCLL------------------------------
A5GI10_SYNPW/9-127-----------------MVPRK.............HWGTF.LVNLVAAFA------------------------------
A5N506_CLOK5/4-119-----------------..VHYHEN....IP....L.NTL.IINITGSFI------------------------------
CRCB1_LACSS/6-119-----------------..QPT..G....FP....Y.GTL.CVNLIGAFC------------------------------
A0NJX1_OENOE/4-115-----------------..KWLNMI....YP....W.PTF.LINFLGCLL------------------------------
A4J4K8_DESRM/3-118-----------------..NFAFST....FP....Y.GTL.FVNLTGSYF------------------------------
CRCB_HAEDU/4-113-----------------FLTQF.............AFGTL.FVNLCGCFL------------------------------
A6VGL6_METM7/4-116-----------------KFGI..............PTGTL.IVNLLGSFI------------------------------
A5FV99_ACICJ/73-188-----------------..NLFGRG....FP....V.AVL.SINVLGSFL------------------------------
A0JYB9_ARTS2/3-119-----------------RAGTRRHW..........PWATL.VVNVTGSLV------------------------------
CRCB_PROM5/6-103-----------------......................L.LVGVIGSFV------------------------------
A0JYB8_ARTS2/12-126-----------------AAGAI.............PWTTL.AINVCGSFV------------------------------
B3XPY6_LACRE/7-123-----------------..........WINPPFADPLAVL.IVNAVGCFI------------------------------
A3TIL1_9MICO/4-113-----------------RGATTHA.............GTL.VVNVVGSLI------------------------------
CRCB_CLONN/7-122-----------------..KMFNGN....FP....Y.GTL.IVNIVGAII------------------------------
Q4Q5Z9_LEIMA/95-201-----------------N............PFFPKY.TYI.GPNSLGSFL------------------------------
CRCB_NEIG1/5-113-----------------..........SLSP....ATGNL.FANWTGALL------------------------------
A2BTL4_PROMS/6-116-----------------SIGFD.............IQNTS.IVNFLSSFF------------------------------
Q23G77_TETTS/193-301-----------------LFSCF.............QLGTL.LSNWFGTVI------------------------------
CRCB1_LACAC/8-116-----------------..................FYGTF.WGNIIGCFL------------------------------
A6GBU2_9DELT/14-125-----------------ACSERLP...........FIGVL.AVNLAGCLL------------------------------
CRCB2_CORGL/3-107-----------------..................KRATL.AANTLACLA------------------------------
C1AGI8_MYCBT/9-123-----------------..DPA..R....WP....W.PTF.TVNVVGAFL------------------------------
A7BBA8_9ACTO/9-133-----------------SPVRGLFL..........SWSTL.MVNAVGAFL------------------------------
CRCB_RHOBA/7-139-----------------APLSGWLTLHGSV.......GTT.LANLLGCCA------------------------------
A5VRB9_BRUO2/6-123-----------------YHHGAF............PLGTF.LINISGAFV------------------------------
CRCB_NITOC/5-120-----------------..NLCGAS....FP....W.GTW.VVNGLGCFL------------------------------
A4XHA8_CALS8/3-113-----------------..EVMERE....HP....I.STL.FINVAGCFF------------------------------
B3EI10_CHLL2/10-124-----------------..PFAGTG....FP....L.ATF.AVNMLGSFL------------------------------
CRCB_PELPD/4-119-----------------..GLLGRA....FP....F.GTL.AVNLIGAYC------------------------------

PF13536

B8J0H9_DESDA/85-197----------------------------A----V-LIAI...G...KG..K...LG..----------------------
Q30W64_DESDG/78-190----------------------------A----M-GIAG...I...RG..R...FG..----------------------
B2TJQ9_CLOBB/79-191----------------------------A----M-IYAT...A...RG..K...IG..----------------------
B1KVC8_CLOBM/79-191----------------------------A----L-LYAG...V...KG..K...FR..----------------------
Q6AM78_DESPS/78-190----------------------------A----V-SFAV...L...RG..R...FG..----------------------
A8MJF3_ALKOO/79-191----------------------------A----L-ANAG...I...KG..K...LG..----------------------
A6TUT9_ALKMQ/87-199----------------------------A----L-LNNG...I...KG..K...LG..----------------------
B6W8K1_9FIRM/81-193----------------------------A----L-ANSI...I...KG..K...FG..----------------------
Q14LA4_SPICI/73-193----------------------------M----F-I.FY...K...PK..N...FI..----------------------
C4L5N6_EXISA/35-152----------------------------L----L-VVVA...F...RG..G...LK..----------------------
C1EC76_MICSR/42-154----------------------------L----A-VGAA...S...EW..R...VA..----------------------
Q9KE50_BACHD/35-155----------------------------L----F-LIVL...F...RR..N...VR..----------------------
Q6ANG8_DESPS/36-150----------------------------L----S-AILF...S...QG..G...LR..----------------------
Q0G3H6_9RHIZ/48-151----------------------------L----L-PLAV...M...RR..E...R...----------------------
C6C7K8_DICDC/40-153----------------------------F----I-TLSV...V...KN..R...QG..----------------------
B1YFT7_EXIS2/35-146----------------------------L----V-VIVA...Y...RR..R...LG..----------------------
D7VRB0_9SPHI/41-156----------------------------L----M-IIVG...F...RN..G...LK..----------------------
C3LF25_BACAC/35-151----------------------------L----L-LIVM...Y...RG..N...LK..----------------------
A1SUW4_PSYIN/36-150----------------------------L----L-IIAL...L...SD..G...IK..----------------------
Q4MHH3_BACCE/35-151----------------------------L----L-LIVM...Y...RG..N...LK..----------------------
Q4FTR9_PSYA2/36-150----------------------------I----T-ILIA...M...QH..G...FG..----------------------
A0RFB5_BACAH/35-151----------------------------L----L-LIVL...Y...RG..N...LK..----------------------
Q29AX3_DROPS/271-397----------------------------F----P-IYIL...G...LV..S...TRKC----------------------
B0W9C1_CULQU/259-385----------------------------F----P-IYIL...G...RV..A...IKKC----------------------
B1HZ47_LYSSC/43-163----------------------------L----L-IIVF...Y...RK..G...FS..----------------------
A5WDV4_PSYWF/36-149----------------------------L----T-LVIA...AQHGMR..R...IG..----------------------
C2MRF9_BACCE/12-136----------------------------L----F-LIVL...F...RK..N...LR..----------------------
B2ZC64_9GAMM/12-126----------------------------I----T-AIIM...F...QY..G...FD..----------------------
C2P113_BACCE/12-136----------------------------L----L-LLVM...S...RK..K...LK..----------------------
D5WE59_BURSC/39-154----------------------------A----L-LLVA...V...RK..R...LP..----------------------
C2WCR1_BACCE/35-159----------------------------L----F-LIVL...F...RK..N...LG..----------------------
B8BX33_THAPS/230-337----------------------------L----F-PYAL...R...L...........----------------------
Q4CM94_TRYCC/68-183----------------------------L----R-IISW...K...SG..R...NE..----------------------
Q4SHD3_TETNG/80-186----------------------------T----F-CPGI...I.......D...FP..----------------------
B0CPS2_LACBS/61-181----------------------------G----L-GIAI...S..SHL..S...SR..----------------------
A7Z3M1_BACA2/35-159----------------------------L----F-LIVY...V...KG..K...WG..----------------------
B0B9E1_CHLT2/32-143----------------------------S----L-ITIL...Y.......K...RS..----------------------
C2KU03_9ACTO/27-127----------------------------L----V-A......W...RR..P...WG..----------------------
A5WEC6_PSYWF/36-151----------------------------V----S-AIIIAQHG...MG..R...LK..----------------------
C6JKK4_FUSVA/36-156----------------------------L----F-FIVT...A...KK..Q...LF..----------------------
Q13J39_BURXL/39-154----------------------------A----L-LLIA...L...RK..R...LPI.----------------------
E8WPA4_GEOS8/36-150----------------------------L----S-LWLV...LAGKSR..L...LK..----------------------
E6VZC7_DESAO/35-148----------------------------A----G-LLAF...R...RP..L...LV..----------------------
D1AJ88_SEBTE/34-147----------------------------F----F-VWLG...I...KK..E...IK..----------------------
B5ZTE1_RHILW/38-151----------------------------G----L-YILF...S...EK..R...V...----------------------
C4LLH4_CORK4/10-124----------------------------Q----A-IAVG...R...LA..A...LP..----------------------
C0QIH1_DESAH/36-150----------------------------L----T-TLIS...L..FKGTAT...TR..----------------------
C6E0G2_GEOSM/36-150----------------------------L----S-AWLL...L...TG..KSRLLR..----------------------
C7PA25_CHIPD/42-158----------------------------L----G-LVVF...L...AG..Q...LK..----------------------
A6CI48_9BACI/35-159----------------------------L----F-LIVL...A...RK..N...LK..----------------------
C6R7K6_9CORY/19-136----------------------------V----A-WGTV...I...RH..R...IALD----------------------
A1R4E7_ARTAT/168-283----------------------------V----A-FLVI...L...AG..Q...FL..----------------------

PF00892

YCXC_BACSU/18-142----------------------------A----A-ATVP---I---LF--G---WV..----------------------
YHBE_SHIFL/169-292----------------------------.----I-ALFP---L---AK--P---GV..----------------------
YBFH_BACSU/18-141----------------------------.----I-ALIL---V---RP--N---MI..----------------------
Y1552_ARCFU/19-133----------------------------.----L-AVLP---F---CL--R---D...----------------------
YD3A_METJA/13-135----------------------------I----I-LCLI---I---LL--K---YK..----------------------
YYAM_BACSU/15-140----------------------------M----L-IILI---F---TE--G---IK..----------------------
YXXF_BACSU/166-292----------------------------V----I-ILIP---F---IH--F---GA..----------------------
O58666_PYRHO/13-134----------------------------.----L-ASLI---L---LP--F---AN..----------------------
Y355_SYNY3/182-308----------------------------L----L-AIAL---V---QD--S---EP..----------------------
O58347_PYRHO/160-285----------------------------V----T-FISG---K---FI--G---EI..----------------------
Y510_ARCFU/159-285----------------------------L----I-PFAL---M---SG--F---AN..----------------------
Y355_SYNY3/22-146----------------------------.----.-ILVL---L---WA--M---GQK.----------------------
O80521_ARATH/206-335----------------------------C----G-AIAL---I---SD--H---TIS.----------------------
Y1533_ARCFU/154-274----------------------------.----L-ILLS---F---TA--K---KD..----------------------
O59388_PYRHO/20-144----------------------------Y----L-PLII---Y---LN--L---IP..----------------------
O50525_STRCO/162-288----------------------------V----P-VAFA---I---MG--G---FP..----------------------
YDFC_BACSU/17-140----------------------------A----L-LLFA---V---LT--Q---MR..----------------------
O68125_RHOCA/19-144----------------------------L----L-PFAW---P---WL--R---RD..----------------------
SAM_RICPR/160-281----------------------------.----M-VSLP---V---AM--Q---Y...----------------------
Q9Z6F0_MYCSM/162-288----------------------------M----V-ALTA---A---AV--V---DR..----------------------
YXXF_BACSU/24-147----------------------------L----G-FCWL---A---SG--Q---YK..----------------------
Q9Z6F0_MYCSM/18-141----------------------------A----A-AALT---F---TR--A---A...----------------------
O86204_ECOLX/16-139----------------------------S----W-IVLF---I---KR--K---K...----------------------
YTR1_BUCSC/162-288----------------------------L----F-FLVI---S---NI--L---EHP.----------------------
Y1552_ARCFU/150-269----------------------------.----A-ALLP---Y---FL--M---FG..----------------------
Q9ZAR1_ENTAG/155-287----------------------------V----S-ITYP---F---FQ--S---GPLL----------------------
O85844_SPHAR/180-306----------------------------L----S-VPYA---W---HL--W---WAG.----------------------
YVBV_BACSU/18-141----------------------------L----L-LVIV---A---LP--R---IH..----------------------
YDED_BACSU/171-296----------------------------.----F-ALGF---I---HP--P---WQL.----------------------
O59158_PYRHO/33-155----------------------------V----I-FLLA---N---LK--D---IK..----------------------
Q9Z799_CHLPN/11-135----------------------------I----L-ALAA---W---FR--G---GF..----------------------
YIJE_ECOLI/20-142----------------------------.----L-VLFI---V---LL--L---RG..----------------------
YCBK_BACSU/173-303----------------------------M----M-LYTG---I---KS--A---AGMN----------------------
SAM_RICPR/20-142----------------------------.----I-VLLP---F---VV--Y---YG..----------------------
O66073_BACLI/169-302----------------------------G----I-SHMA---D---GT--L---SGF.----------------------
Y1533_ARCFU/12-136----------------------------F----L-PLAL---R---DF--P---G...----------------------
YETK_BACSU/187-314----------------------------F----F-LPFA---L---FE--A---SSF.----------------------
O57793_PYRHO/12-137----------------------------L----F-IYLK---I---KK--I---P...----------------------
Y266_ARCFU/12-133----------------------------.----T-LFAV---I---II--L---G...----------------------
Q9ZF46_BACME/165-289----------------------------.----A-SFSF---I---HP--P---WHI.----------------------
Y510_ARCFU/14-136----------------------------.----.-PLLM---A---WV--F---WKR.----------------------
Y878_HAEIN/166-289----------------------------.----I-AFMP---M---AD--F---SQ..----------------------
YSO2_ACIAM/116-237----------------------------.----L-IFFT---L---SP--I---QF..----------------------
Y1164_SYNY3/191-319----------------------------F----F-WIAV---I---IY--G---FDH.----------------------
YDED_BACSU/18-149----------------------------L----L-MLQL---F---RK--D---RSQ.----------------------
Y976A_HAEIN/35-161----------------------------I----T-TLPF---T---LL--L---TEN.----------------------
O68125_RHOCA/168-295----------------------------I----L-APFL---V---WE--I---SSG.----------------------
Y788_ARCFU/178-306----------------------------S----A-PFAV---F---TT--T---K...----------------------
PECM_DICD3/12-130----------------------------.----.-IILI---L---GK--N---LP..----------------------
O58983_PYRHO/16-140----------------------------.----I-FLVT---V---TF--F---VKP.----------------------
YEDA_ECOLI/160-285----------------------------M----I-ASMI---A---GE--K---LT..----------------------
Y1164_SYNY3/39-164----------------------------L----I-FHPD---W---QL--H---KL..----------------------
Y878_HAEIN/17-142----------------------------L----L-ALLA---Y---KK--Q---LP..----------------------
YTR1_BUCSC/16-140----------------------------F----L-IFLC---F---YT--K---TP..----------------------
YWFM_BACSU/15-138----------------------------S----A-MLLA---V---WI--S---R...----------------------
O85844_SPHAR/31-156----------------------------V----L-PFAW---R---HL--R---DD..----------------------
Y266_ARCFU/150-274----------------------------.----I-PLYP---F---LP--D---SIR.----------------------
O57793_PYRHO/155-274----------------------------A----I-FLIP---F---TD--F---K...----------------------
YVBV_BACSU/161-287----------------------------V----F-LLIS---G---FW--T---ESF.----------------------
YHBE_SHIFL/17-144----------------------------L----G-AILA---V---KK--R---LP..----------------------
YICL_ECOLI/16-145----------------------------L----I-LLTL---S---FV--H---GDK.----------------------
PAGO_SALTY/161-287----------------------------L----I-LSAT---G---WF--F---ERP.----------------------
O66073_BACLI/23-147----------------------------A----A-LFPL---L---LG--W---VK..----------------------
Y270_BUCAP/15-139----------------------------L----L-IILS---Y---LT--K---KP..----------------------
O59388_PYRHO/165-290----------------------------G----L-PFLP---K---MW--R---EI..----------------------
RHTA_ECOLI/158-281----------------------------L----I-FVPI---G---AL--Q---AG..----------------------
YIJE_ECOLI/162-290----------------------------M----S-VVAL---L---VP--Q---RE..----------------------
O50525_STRCO/20-140----------------------------.----L-IPAY---F---AM--R---GN..----------------------
Q56929_YEREN/17-141----------------------------V----L-ILIS---V---LT--K---TR..----------------------
O67627_AQUAE/15-141----------------------------A----F-IGLL---L---LR--E---NP..----------------------
Y841_METTH/216-340----------------------------L----L-IIML---I---LG--I---N...----------------------
Y788_ARCFU/52-166----------------------------.----L-FFLP---F---LK--G---WD..----------------------
SAMHT_CHLTR/34-158----------------------------V----L-FGLL---L---CK--R---ES..----------------------
Y1234_HELPY/17-141----------------------------.----L-LLLL---I---YP--F---KPY.----------------------
YOAV_BACSU/13-137----------------------------L----F-LILF---I---QR--K---K...----------------------
O85268_YEREN/163-289----------------------------I----L-LCIV---G---WI--A---EQP.----------------------
Q9ZF46_BACME/15-143----------------------------L----L-LLAI---A---SK--Q---RNI.----------------------
YEDA_ECOLI/18-141----------------------------.----I-LLLA---F---LL--L---RG..----------------------
YETK_BACSU/38-163----------------------------.----V-VLLM---L---LF--C---IEK.----------------------
O58347_PYRHO/13-140----------------------------I----L-YFLI---F---YF--G---GNYK----------------------
YRDR_BACSU/175-300----------------------------A----I-LTAQ---G---YV--S---VP..----------------------
YDFC_BACSU/160-285----------------------------.----I-PMLV---F---LP--G---LGE.----------------------
YCB6_PSEDE/14-140----------------------------I----A-AIVA---A---TG--Q---WQK.----------------------
Y841_METTH/55-192----------------------------L----F-FIRE---T---PL--R---EHVL----------------------
YICL_ECOLI/167-291----------------------------.----L-ILLP---F---YA--R---QGT.----------------------
Q9ZAR1_ENTAG/14-139----------------------------.----I-VFLI---F---NK--S---IRE.----------------------
O59158_PYRHO/178-298----------------------------.----L-YISI---L---GV--I---EG..----------------------
Y270_BUCAP/161-287----------------------------I----F-LSII---S---WF--I---ESP.----------------------
PAGO_SALTY/15-139----------------------------F----L-IIIA---W---LR--K---KT..----------------------
YOAV_BACSU/159-285----------------------------L----L-VFSF---I---FE--A---VP..----------------------
SAMHT_CHLTR/185-314----------------------------S----L-IHSA---V---TE--V---WNP.----------------------
O86204_ECOLX/162-286----------------------------S----S-LFIF---I---SK--S---S...----------------------
YRDR_BACSU/18-146----------------------------L----V-ILLL---V---RE--G---KK..----------------------
Y3017_CLOK5/166-292----------------------------I----A-LLIL---L---VV--T---GRP.----------------------
Y1319_SYNY3/191-316----------------------------S----I-LCLI---I---WQ--P---HE..----------------------
YWFM_BACSU/158-282----------------------------.----A-ILLT---P---LL--W---QLD.----------------------
YYAM_BACSU/164-290----------------------------L----I-VVSL---F---TS--K---PVS.----------------------
O58324_PYRHO/19-137----------------------------.----I-ILAI---V---LK--D---K...----------------------

PF04142

S35A5_HUMAN/78-366----------------------------L----L-FRIV---LKRRLNWIQ---WASL----------------------
O76865_DROME/83-334----------------------------M----F-AVVI---LRRKLLNTQ---WGAL----------------------
GMS1_SCHPO/79-315----------------------------I----F-SILL---LHRRLGPMK---WFSL----------------------
S35A2_HUMAN/96-331----------------------------L----F-SVLM---LNRSLSRLQ---WASL----------------------
UGTP1_CAEEL/104-343----------------------------F----F-MMLF---LGRKFSTRR---WMAI----------------------
S35A1_HUMAN/72-306----------------------------L----C-TVLM---LNRTLSKLQ---WVSV----------------------
O02345_CAEEL/69-352----------------------------A----F-TVLV---LHRRLTIQQ---WISL----------------------
S35A3_CANFA/68-306----------------------------L----F-SVSM---LSKKLGVYQ---WLSL----------------------
O16658_CAEEL/74-318----------------------------I----F-SVTM---LGKSLHRYN---WMAL----------------------
O01879_CAEEL/71-306----------------------------I----F-MYFF---LGKKLSTKQ---WWAL----------------------

PF05653

Q90YI4_TAKRU/4-304----------------------------V----L-VSAVLSSYFLNERLNIHGKVGCL----------------------
NIPA2_HUMAN/6-306----------------------------V----L-VSAILSSYFLNERLNLHGKIGCL----------------------
Q9VK62_DROME/41-342----------------------------V----I-ISAVMASRFLNEKLNLLGKIGCF----------------------
Q9SST0_ARATH/15-267----------------------------I----I-IRCEQT.....QKLHTFGILGCA----------------------
Q8LA45_ARATH/1-300----------------------------I----I-FSAVLAHFILEEKLHMFGILGCV----------------------
Q9SKQ1_ARATH/1-295----------------------------I----I-ISAVLAHFLLKEKLKKMGVLGCV----------------------
NPAL2_MOUSE/43-336----------------------------V----T-GSAIISVLFLKENLRASDLLGMT----------------------

PF10639

Q4TT81_CAEEL/12-122----------------------------K----.-........-------------------------------------
Q4V4P6_DROME/6-122----------------------------T----.-........-------------------------------------
A0C2W3_PARTE/7-116----------------------------S----F-IQ......-------------------------------------
Q4D1L3_TRYCC/4-115----------------------------F----.-........-------------------------------------
Q22BW6_TETTS/16-127----------------------------F----F-LS......-------------------------------------
Q4RMD0_TETNG/95-210----------------------------F----.-........-------------------------------------
TM234_ANOGA/20-135----------------------------F----.-........-------------------------------------
TM234_PONAB/11-126----------------------------T----.-........-------------------------------------
Q0U0B5_PHANO/22-148----------------------------V----L-GIWYAVSG-------------------------------------
A4I0H4_LEIIN/5-115----------------------------F----.-........-------------------------------------
TM234_DICDI/9-124----------------------------Y----.-........-------------------------------------
A4FVN3_DANRE/1-116----------------------------F----.-........-------------------------------------
A7SF34_NEMVE/12-127----------------------------Y----.-........-------------------------------------
Q57W61_TRYB2/4-115----------------------------F----.-........-------------------------------------
Q5B4G5_EMENI/114-201----------------------------.----.-........-------------------------------------
Q179X3_AEDAE/11-126----------------------------F----.-........-------------------------------------

PF00893

QACC_STAAU/1-93----------------------------F----L-KS..---.....S--E-----------------------------
MMR_MYCTU/1-94----------------------------L----L-KS..---.....T--E-----------------------------
EMRE_ECOLI/2-94----------------------------L----M-KF..---.....S--E-----------------------------
YVAE_BACSU/1-93----------------------------S----M-KL..---.....S--S-----------------------------
P96460_STAAU/1-93----------------------------F----L-KS..---.....A--E-----------------------------
MDTI_ECOLI/4-99----------------------------F----L-KF..---.....S--D-----------------------------
Q7B1Y7_SALEN/2-94----------------------------A----L-KS..---.....S--E-----------------------------
YVDS_BACSU/1-89----------------------------S----L-K...---......--H-----------------------------
EBRB_BACSU/2-94----------------------------M----L-KL..---.....S--E-----------------------------
YKKD_BACSU/2-94----------------------------L----M-NQ..---.....Y--A-----------------------------
EBRA_BACSU/3-95----------------------------M----L-KV..---.....S--D-----------------------------
YVDR_BACSU/1-93----------------------------A----M-KY..---.....I--D-----------------------------
MDTJ_SHIFL/3-95----------------------------S----M-KW..---.....A--S-----------------------------
Y4NH_RHISN/1-106----------------------------L----L-KWGR---ASLPPS--A-----------------------------
YKKC_BACSU/1-90----------------------------G----L-K...---......--H-----------------------------
SUGE_SHIFL/1-93----------------------------G----L-KY..---.....T--H-----------------------------
SUGE_PROVU/1-93----------------------------G----L-KY..---.....T--H-----------------------------

PF04657

Q21DH8_SACD2/19-159----------------------------A....V-AMVL---I-------TT...R..----------------------
Q8CTN3_STAES/3-144----------------------------L....L-VLNL---I-------VH..PQVL----------------------
Q39SB9_GEOMG/5-141----------------------------L....A-VAVS---F-------WG...R..----------------------
A6TN22_ALKMQ/4-138----------------------------S....L-LFLV---F-------SK...E..----------------------
A3QFA9_SHELP/30-170----------------------------A....L-LLLG---A-------VR...L..----------------------
A6VSJ3_MARMS/9-148----------------------------V....I-PIVL---A-------MQ...A..----------------------
Q6M695_CORGL/164-304----------------------------L....F-ILLL---V-------TR...T..----------------------
B8FYQ2_DESHD/4-140----------------------------L....S-LAVL---F-------LG...K..----------------------
Q1GQL8_SPHAL/9-147----------------------------A....A-AGAL---M-------TG...S..----------------------
Q1Z706_PHOPR/6-152----------------------------A....L-LLMA---I-------VS...KTI----------------------
Q1QZC8_CHRSD/5-140----------------------------L....T-LALI---F-------AR......----------------------
A5W524_PSEP1/11-150----------------------------V....I-AALL---I-------IR...V..----------------------
Q1QB44_PSYCK/4-140----------------------------T....F-FLML---F-------FS...P..----------------------
Q394M9_BURS3/11-150----------------------------V....L-PVLL---A-------TR...A..----------------------
Q2RGM8_MOOTA/15-156----------------------------LIISVV-ITQW---L-------TK...D..----------------------
Q0AXV4_SYNWW/5-143----------------------------V....L-LIML---S-------LS...T..----------------------
Q390H3_BURS3/7-143----------------------------A....I-VLLA---A-------QH...G..----------------------
Q7N4X7_PHOLL/3-137----------------------------L....T-VILT---L-------LS...S..----------------------
Q49VG4_STAS1/3-144----------------------------L....I-LINL---I-------TN..PH.V----------------------
Q03TA8_LACBA/2-142----------------------------L....A-LVTL---A-------SH...Q..----------------------
A6LU87_CLOB8/1-136----------------------------V....I-GIVI---F-------KK...I..----------------------
A0SZ10_9BURK/18-157----------------------------A....S-LVML---A-------WR...V..----------------------
Q03TA8_LACBA/164-305----------------------------L....L-VIVF---V-------VD...R..----------------------
Q11NT1_CYTH3/6-142----------------------------L....F-ITLL---I-------MR...K..----------------------
A0RGL9_BACAH/9-144----------------------------V....I-FILI---V-------NK...N..----------------------
A0PSE0_MYCUA/6-144----------------------------F....V-GAFL---I-------MP...N..----------------------
A4FZS2_METM5/5-144----------------------------I....G-LIIL---I-------SD...P..----------------------
Q0SPU1_CLOPS/2-138----------------------------A....L-FIML---M-------LR...N..----------------------
A1VA83_DESVV/4-141----------------------------L....A-GWVF---V-------AR...L..----------------------
Q0FRW8_9RHOB/3-140----------------------------A....T-VVMF---A-------TD...P..----------------------
A0AHV4_LISW6/4-145----------------------------L....L-IVCL---F-------TQ..KS.W----------------------
Q0KF63_CUPNH/16-155----------------------------L....L-PVLW---L-------MR...V..----------------------
A1AK06_PELPD/5-141----------------------------L....L-MVVL---V-------TG...R..----------------------
Q1M5R3_RHIL3/11-151----------------------------A....V-ILLL---V-------VH...R..----------------------
Q5KZC7_GEOKA/4-140----------------------------L....F-LVQL---F-------LG...K..----------------------
A9VF57_BACWK/2-138----------------------------S....V-LFHI---I-------TE...K..----------------------
Q0I1U4_HAES1/4-144----------------------------L....F-FICW---W-------KM...D..----------------------
Q4KHW5_PSEF5/5-144----------------------------L....I-AVII---F-------IK...V..----------------------
Q49VG4_STAS1/163-305----------------------------L....F-ILTL---I-------FN...R..----------------------
A0JUK3_ARTS2/163-299----------------------------L....W-LAWL---I-------KL...A..----------------------
Q7UTT1_RHOBA/5-133----------------------------L....L-SYIL---L-------TR...Q..----------------------
Q03HH1_PEDPA/168-308----------------------------L....F-LVAV---F-------QG.TLK..----------------------
Q03HH1_PEDPA/2-142----------------------------L....I-VIIV---L-------SG...G..----------------------
A6VKF2_ACTSZ/4-143----------------------------L....L-IFCF---W-------KT..DL..----------------------
A0L1U7_SHESA/3-135----------------------------L..SAW-IICL---E-------SG..AN..----------------------
A4WAQ0_ENT38/5-143----------------------------F....V-SILL---I-------KN...G..----------------------
Q03Y21_LEUMM/166-301----------------------------L.....-..AF---L-------KN...N..----------------------
B1YHB6_EXIS2/3-139----------------------------S....L-TIGL---L-------VE...G..----------------------
A1ACJ4_ECOK1/10-155----------------------------M....F-FIIM---A-------RK...E..----------------------
Q3A9B8_CARHZ/6-140----------------------------A....A-LFVL---F-------SK......----------------------
A8MKQ0_ALKOO/2-138----------------------------A....I-AAMV---L-------WS...D..----------------------
B1YEL8_EXIS2/4-140----------------------------I....G-IITL---F-------FG...K..----------------------
Q8YKX2_NOSS1/5-144----------------------------L....T-LLLV---L-------GI...F..----------------------
Q12R75_SHEDO/9-146----------------------------S....L-IYLL---I-------TG......----------------------
Q99VZ6_STAAM/3-144----------------------------L....I-ILNI---I-------IN..PE.V----------------------
Q9RVB6_DEIRA/8-144----------------------------L....G-VLWL---L-------GV..DG..----------------------
A1A0P8_BIFAA/203-343----------------------------L....A-IVVA---F-------VD..RT..----------------------
Q1IEL2_PSEE4/9-148----------------------------L....V-PALL---L-------MR...A..----------------------
Q749R3_GEOSL/5-141----------------------------L....L-IVSI---L-------VG...R..----------------------
A6M3J1_CLOB8/2-138----------------------------S....L-IIFL---F-------LG...D..----------------------
A1ZMZ7_9BACT/5-145----------------------------A....L-LFVT---L-------GV...R..----------------------
Q02XB9_LACLS/3-143----------------------------L....G-IITL---V-------TT...Q..----------------------
Q65J95_BACLD/5-146----------------------------L....L-IVAL---V-------TE..RH.F----------------------
Q28TA8_JANSC/7-146----------------------------L....A-AIAW---Y-------RG...S..----------------------
Q12K32_SHEDO/8-147----------------------------L....G-IIAF---I-------QG...G..----------------------
A9VF55_BACWK/2-138----------------------------A....T-TIFL---L-------KK...E..----------------------
Q9RVB7_DEIRA/19-157----------------------------L....L-LLLG---L-------GR...A..----------------------
A3QFA8_SHELP/3-133----------------------------L....S-LLLV---S-------MP......----------------------
A5G8U5_GEOUR/6-141----------------------------L....F-FVVL---A-------SG...R..----------------------
A8M2W9_SALAI/175-312----------------------------L....L-AVFA---V-------DV...A..----------------------
Q0FHQ8_9RHOB/5-139----------------------------L....S-VTAL---A-------VD...G..----------------------
Q8YKX1_NOSS1/33-172----------------------------L..ISL-LCTG---W-------FG...H..----------------------
Q3K9Q1_PSEPF/5-141----------------------------T....G-LLIL---F-------FE...P..----------------------
A9KHN5_CLOPH/2-140----------------------------C....L-AAYF---I-------TG...R..----------------------
Q8FQJ9_COREF/99-239----------------------------L....L-VLLV---A-------TR...T..----------------------
B1YGF5_EXIS2/14-153----------------------------L....I-VLTL---F-------VE...Q..----------------------
Q6D0D7_ERWCT/13-152----------------------------L....L-PILF---A-------AR...V..----------------------
A8LKG3_DINSH/5-143----------------------------L....C-SIVA---V-------RG......----------------------
A9VMR7_BACWK/2-136----------------------------S....M-LFLI---F-------SS...D..----------------------
Q1QB43_PSYCK/5-141----------------------------T....A-LLIF---F-------FE...P..----------------------
Q28R25_JANSC/3-140----------------------------A....A-MIMI---V-------TG...P..----------------------
Q4L439_STAHJ/163-304----------------------------L....F-ILTL---I-------FN...R..----------------------
Q316U3_DESDG/4-143----------------------------L....V-CWCL---V-------TR...T..----------------------
B1YGF5_EXIS2/179-317----------------------------L....L-LVNL---I-------VR...T..----------------------
Q4L439_STAHJ/3-144----------------------------L....F-ILNM---I-------FN..PK.L----------------------
Q65QN9_MANSM/39-179----------------------------L....L-LLCL---W-------KA...D..----------------------
B1YIK4_EXIS2/3-139----------------------------S....L-LALI---F-------FR...G..----------------------
Q04FL6_OENOB/173-313----------------------------L....W-IIVA---V-------VE...H..----------------------
Q31P27_SYNE7/5-144----------------------------L....S-LLLV---L-------GV...F..----------------------
Q5R178_IDILO/5-143----------------------------S....A-LALW---G-------FS...E..----------------------
A9BWW9_DELAS/11-150----------------------------V....V-PALW---V-------LR...A..----------------------
A0PXE0_CLONN/7-143----------------------------T....L-IIML---F-------AG...E..----------------------
Q8XG26_SALTI/5-143----------------------------F....V-TILW---F-------KQ...G..----------------------
A0L1U8_SHESA/9-158----------------------------V....L-LMLF---L-------LR...K..----------------------
Q6FEY6_ACIAD/10-149----------------------------L....G-VFVM---F-------QD...A..----------------------
Q02XB9_LACLS/164-303----------------------------I....F-IVSL---F-------VD.RRL..----------------------
Q03UQ1_LEUMM/173-314----------------------------L....L-IIVL---I-------NH...Y..----------------------
Q02QF4_PSEAB/5-144----------------------------V....C-LGLL---L-------VR...V..----------------------
Q97DD1_CLOAB/2-138----------------------------T....L-VICF---I-------YG...N..----------------------
Q5Z3K6_NOCFA/3-148----------------------------L....A-AAFA---A-------SG...R..----------------------
Q67KE9_SYMTH/5-146----------------------------L....L-ALTL---F-------TL...R..----------------------
Q4V1I7_BACCZ/4-142----------------------------L....F-TVSL---F-------KA..GF..----------------------
Q2RM98_MOOTA/3-140----------------------------V....G-VLLF---F-------PLSDG...----------------------
Q65J96_BACLD/10-156----------------------------L....L-FLTS---F-------IE..HR.R----------------------
Q6SF41_9BACT/5-142----------------------------A....G-TICA---I-------SG..SL..----------------------
Q1LCM1_RALME/14-153----------------------------V....V-PVLL---A-------LR...A..----------------------
A4W7U3_ENT38/4-140----------------------------T....G-LLIF---F-------FE...S..----------------------
Q4VSJ2_BURGL/11-150----------------------------V....L-PALF---V-------FH...A..----------------------
Q02FK6_PSEAB/7-145----------------------------L....L-ALTL---S-------QR...E..----------------------
Q7NSE3_CHRVO/15-151----------------------------A....L-LLWK---T-------QR...R..----------------------
Q1ZWQ0_PHOAS/6-148----------------------------S....L-IVLM---I-------AS...I..----------------------
A6LU86_CLOB8/2-134----------------------------S....I-LLFI---I-------IK..DK..----------------------
Q9CJV1_PASMU/4-144----------------------------L....L-VISL---L-------KT...D..----------------------
Q53WI3_THET8/6-144----------------------------L....F-LLAL---L-------LT...G..----------------------
A9CIC3_AGRT5/3-135----------------------------L....T-VIGL---I-------VG...G..----------------------
Q0BSA2_GRABC/6-144----------------------------L....L-VLWL---C-------MP...R..----------------------
Q99VZ6_STAAM/163-305----------------------------L....L-ILTA---I-------FN...S..----------------------
B8G001_DESHD/7-144----------------------------A....L-IAVM---V-------AR...V..----------------------
B1YHB4_EXIS2/2-138----------------------------A....L-LITL---I-------LR...D..----------------------
Q3HKF8_RHOS4/5-144----------------------------I....L-PVLL---A-------MR...V..----------------------
Q18BT7_CLOD6/5-139----------------------------F....L-ASII---V-------TG.DLK..----------------------
A0AHV3_LISW6/11-151----------------------------L....T-LVCL---I-------VE..RR.L----------------------
Q3K9Q0_PSEPF/22-158----------------------------L....F-LLLL---F-------AG...P..----------------------
B1YIK3_EXIS2/2-138----------------------------C....L-LIYG---F-------VR...D..----------------------
A1HTC3_9FIRM/8-146----------------------------L....L-ALLF---L-------FR.LGK..----------------------
A0B2B3_BURCH/5-144----------------------------M....L-AVAL---L-------SP...H..----------------------
Q1QZC9_CHRSD/5-141----------------------------T....F-LLMF---F-------FE...P..----------------------
A4W7U4_ENT38/4-140----------------------------T....F-LLML---F-------FS...P..----------------------
Q7NSE2_CHRVO/2-129----------------------------L....S-LLLA---S-------GA......----------------------
Q1ZWP9_PHOAS/4-134----------------------------L....S-FVVY---F-------SS...I..----------------------
Q5HRB7_STAEQ/151-293----------------------------L....F-ILTL---V-------FN...R..----------------------
A5D651_PELTS/6-144----------------------------V....S-LLLL---V-------CR.DGD..----------------------
Q7P1D2_CHRVO/22-162----------------------------L....A-LLSL---A-------TG...Q..----------------------
Q3KGP6_PSEPF/8-147----------------------------L....L-PVIV---A-------LR...L..----------------------
A4J0N8_DESRM/6-144----------------------------V....G-ILVF---V-------CR.LGA..----------------------
A4XQ88_PSEMY/7-145----------------------------L....L-LMTL---S-------QR...E..----------------------
Q03UQ1_LEUMM/2-142----------------------------L....I-AVTL---V-------TT...H..----------------------
Q168E1_ROSDO/6-143----------------------------C....A-CVVV---T-------TG...P..----------------------
Q1WV36_LACS1/3-143----------------------------L....N-VLLI---L-------TG...T..----------------------
A1A0P8_BIFAA/19-158----------------------------M....L-TLTL---L-------LG...P..----------------------
Q03Y21_LEUMM/4-142----------------------------L....L-ILTV---I-------LG...D..----------------------
Q98M54_RHILO/5-145----------------------------LGIIAV-TVVK---L-------QG..IS..----------------------
Q899N2_CLOTE/13-149----------------------------T....L-IALL---L-------LG...D..----------------------
Q6M695_CORGL/2-142----------------------------L....L-VATW---I-------TS...G..----------------------
Q04FL6_OENOB/2-142----------------------------L....A-LVAL---L-------IT...H..----------------------
B1YEL9_EXIS2/4-140----------------------------L....A-LAVL---F-------FG...Q..----------------------
Q2KZA1_BORA1/11-150----------------------------L....L-PMLF---A-------MR...V..----------------------

PF06800

GLCU_STAXY/16-280----------------------------A----M-VLLV---IGIALTSIKGKNEA..----------------------
RBSU_LACSS/19-290----------------------------A----I-ALII---IGVYLTAWSEDKSSAS----------------------
GLCU_STAES/19-283----------------------------A----M-ILLV---VGISLTSLKAKSEGKS----------------------
Y169_LISMO/16-280----------------------------A----L-ALII---IGIFLTSYQQHKDE..----------------------
Y2594_LACPL/16-279----------------------------A----I-MLIV---AGSALSAGTSDGRKKG----------------------
RBSU_STAAW/19-289----------------------------A----L-VVIL---IGARMTVWSERKEA..----------------------
Y2503_LACPL/16-280----------------------------S----V-IVLI---AGAVLTSLTDKTDPN.----------------------
GLCU_BACSU/16-280----------------------------A----L-IFII---VGIILTSLEDKNDKKE----------------------
Y424_LISMO/17-281----------------------------A----V-ILIL---IGVVMTGFQKRGNHIT----------------------
RBSU_STAES/19-289----------------------------A----L-LVIL---IGARMTVWTETKQQ..----------------------
RBSU_LACPL/19-291----------------------------A----L-VGII---IGAWLTVWSEHKDA..----------------------
Y176_LISMO/16-280----------------------------A----L-ALIV---GGIFLTSYAEKEEDGT----------------------
GLCU_BACME/16-281----------------------------A----L-IFII---VGIVLASLQSKEEKEA----------------------
Y2157_STRA5/17-282----------------------------A----L-TLLV---IGFYFSSKRDVSEQAL----------------------
YXFA_LACLA/17-288----------------------------A----M-AVLV---VGFYFSAKRDPENAVV----------------------
Y2205_STRP1/17-282----------------------------A----L-LLLI---VGFYFSSKQDDANAQV----------------------
YSUP_LACHE/16-280----------------------------A----L-ILII---VGVSLTAISKDKSAKL----------------------

PF02694

Y2672_MYCBO/2-109----------------------------L----V-WQGV-----------------------------------------
YFJF_BACSU/2-109----------------------------L----V-WLWL-----------------------------------------
YNFA_ECOLI/1-108----------------------------L----P-WLWL-----------------------------------------
Y793_SYNY3/2-108----------------------------L----V-WLWI-----------------------------------------

PF07857

Q9U3C0_CAEEL/17-268----------------------------ATGNVF-SVPI---VEGIGMGVGFLIWTSL----------------------
O01810_CAEEL/6-270----------------------------CIGNAT-AIPI---ISRLGLAVSILVWNTS----------------------
TM144_HUMAN/11-263----------------------------ATGNIA-VVPI---IKTIGLGLGILIWGSF----------------------
TM144_CAEEL/6-264----------------------------ALGNAT-AVPI---MNTIGIGMGMLVWGTT----------------------
Q20583_CAEEL/8-246----------------------------SVGNSL-TVFI---MDGIGLAIGYLLWNTV----------------------
Q95QA2_CAEEL/4-261----------------------------CAANAF-AFLI---MNRLGLAVPILIWSTV----------------------

PF04342

Q9I3E0_PSEAE/5-112----------------------------W----I-IAAL---I-------------------------------------
Q9PG53_XYLFA/9-115----------------------------L----V-TVIF---V-------------------------------------
Q9KRR2_VIBCH/16-123----------------------------W----I-IAAL---V-------------------------------------
Q9RW58_DEIRA/5-112----------------------------L----L-LAVL---A-------------------------------------

PF02535

S39A1_MOUSE/27-320----------------------------A----T-CLLD---LLPDYLAAIDEALEAL...H.VTLQF............
P91348_CAEEL/4-439----------------------------A----T-CFLH---LFPELRENLETLDTVH...N.FRIDY............
IRT1_ARATH/49-344----------------------------G----T-GFMH---VLPDSFEML.SSICLE...E..NPWHK...........
S39A2_HUMAN/5-306----------------------------G----A-GFMH---MTAEALEEIESQIQKF...MVQNRSASERNSSGD....
S39A6_HUMAN/322-743----------------------------G----D-AFLH---LLPHSHASHHHSHSHE...EPAMEMKRGPLFSHLSS..
Q9VFA2_DROME/25-359----------------------------A----T-ALVH---ILPEVREQMDS...........................
S39A8_MOUSE/126-453----------------------------S----N-AIFQ---LIPEAFGFNPKIDNY.......................
Q17996_CAEEL/106-349----------------------------A----D-VFLH---LLPEAYESNENH..........................
S39AA_HUMAN/404-819----------------------------G----D-ALLH---LLPHSQGGHDHSHQHA...HGHGHSHGHESNK......
Q9VUI9_DROME/187-506----------------------------G----D-ALMH---LLPHALFKEEKHEEEV...TGINPLESDHKH.......
Q9XWH3_CAEEL/4-315----------------------------S----V-CFLD---MLPDCLEAWESVQTDT...N.YTSDY............
FOI_DROME/258-684----------------------------G----D-ALLH---LLPHSLAGQDERGM........................
S39A5_MOUSE/208-522----------------------------G----D-ALLH---LLPHAQGGRHTGPSEQ...SEED...............
YKE4_YEAST/63-344----------------------------G----D-ILLH---VIPESLSGVTDV..........................
ZUPT_ECOLI/5-248----------------------------L----I-SLME---MLPAALAAEGMSP.........................
Y1036_METJA/5-231----------------------------G----V-ATLI---LIPKSYS...............................
ZRT2_YEAST/24-419----------------------------A----T-AFVH---LLQPAAEAL.GDECLG......GTFAE...........
ATX2_YEAST/4-307----------------------------G----T-SFML---VIPEGIKACVEHD.........................
ZIP1_ARATH/48-352----------------------------C----T-GFVH---ILPDAFERL.SSPCLE...D..TTAGK...........
Q09957_CAEEL/4-356----------------------------A----T-CFLG---LVPHVRHQEMHLRGNQ...T.IVDSYG...........
CSUP_DROME/129-446----------------------------G----D-AFLH---LIPHATHPHSHGEHGHDHGHDHHHHHDGEEHE......
Q9XVR4_CAEEL/9-352----------------------------S----D-AILH---IIPQVVGVHDHGHNHG...HSHEHHHEHTDLENGTSGH
ZRT1_SCHPO/60-405----------------------------A----T-AFIH---LLAPACNKL.YDPCLD...DLFGGY.............
IRT2_ARATH/44-347----------------------------G----T-GFMH---VLPDSFEML.SSKCLS...D..NPWHK...........
YQF9_SCHPO/12-413----------------------------Y----S-SWAS---VMQESFHFLEKISMFD...TFLVR..............
ZIP3_ARATH/51-336----------------------------A----T-GFMH---VLPEAYEML.NSPCLT...S..EAW.E...........
O62192_CAEEL/30-311----------------------------G----A-CLLD---LLPDSIESFEKTKIAT...E.F................
ZIP10_ARATH/49-361----------------------------S----T-GFMH---VLPDSFEML.SSPCLN...D..NPWHK...........
Q9VEX1_DROME/53-407----------------------------A----T-TFLH---LLPEVQEVVEELQECG...II