Sequence alignment for CL0184

PF03151

S35E1_DROME/12-300--------------------------------------------------------------------------------
Q7XJ66_CHLRE/90-384--------------------------------------------------------------------------------
XPT_ARATH/110-400--------------------------------------------------------------------------------
S352B_HUMAN/73-368--------------------------------------------------------------------------------
Q7QFK8_ANOGA/5-293--------------------------------------------------------------------------------
PPT2_ARATH/77-369--------------------------------------------------------------------------------
Q84XW3_CHLRE/83-381--------------------------------------------------------------------------------
Q8I420_PLAF7/43-340--------------------------------------------------------------------------------
Q802Y0_DANRE/14-303--------------------------------------------------------------------------------
Q7RSG8_PLAYO/40-339--------------------------------------------------------------------------------
GPT2_ARATH/95-384--------------------------------------------------------------------------------
B7FPD9_PHATC/80-375--------------------------------------------------------------------------------
D7TJE0_VITVI/103-390--------------------------------------------------------------------------------
M4FCY2_BRARP/103-393--------------------------------------------------------------------------------
PPT1_ORYSJ/106-396--------------------------------------------------------------------------------

PF00892

D6EP20_STRLI/151-288--------------------------------------------------------------------------------
L8ANE0_BACIU/7-146--------------------------------------------------------------------------------
I0ZKJ3_HELPX/6-141--------------------------------------------------------------------------------
D5AVZ9_RICPP/9-142--------------------------------------------------------------------------------
O86204_ECOLX/151-286--------------------------------------------------------------------------------
Y1533_ARCFU/1-136--------------------------------------------------------------------------------
O86204_ECOLX/5-139--------------------------------------------------------------------------------
B9E5E1_CLOK1/155-292--------------------------------------------------------------------------------
YTR1_BUCSC/151-288--------------------------------------------------------------------------------
Y270_BUCAP/150-287--------------------------------------------------------------------------------
A0A017QUD2_SALET/150-287--------------------------------------------------------------------------------
O85268_YEREN/152-289--------------------------------------------------------------------------------
O57793_PYRHO/1-137--------------------------------------------------------------------------------
Y1552_ARCFU/8-133--------------------------------------------------------------------------------
D5AUW8_RHOCB/5-144--------------------------------------------------------------------------------
A4XDY4_NOVAD/20-156--------------------------------------------------------------------------------
A0A017HZK6_ECOLX/5-145--------------------------------------------------------------------------------
J7JRE9_BACIU/7-149--------------------------------------------------------------------------------
Q9ZF46_BACME/4-143--------------------------------------------------------------------------------
F7UPD3_SYNYG/16-164--------------------------------------------------------------------------------
A0A017HZK6_ECOLX/156-291--------------------------------------------------------------------------------
Q9ZF46_BACME/154-289--------------------------------------------------------------------------------
J7JRE9_BACIU/160-296--------------------------------------------------------------------------------
G4EPI0_BACIU/13-147--------------------------------------------------------------------------------
F7URF2_SYNYG/11-146--------------------------------------------------------------------------------
J7JS06_BACIU/27-163--------------------------------------------------------------------------------
YTR1_BUCSC/5-140--------------------------------------------------------------------------------
Q56929_YEREN/6-141--------------------------------------------------------------------------------
Y270_BUCAP/4-139--------------------------------------------------------------------------------
A0A017QUD2_SALET/4-139--------------------------------------------------------------------------------
J7JNU4_BACIU/3-140--------------------------------------------------------------------------------
Y266_ARCFU/2-133--------------------------------------------------------------------------------
C4PN91_CHLTZ/23-158--------------------------------------------------------------------------------
Q9Z799_CHLPN/1-135--------------------------------------------------------------------------------
J7JZ94_BACIU/4-141--------------------------------------------------------------------------------
J7JVD8_BACIU/2-137--------------------------------------------------------------------------------
O58666_PYRHO/6-134--------------------------------------------------------------------------------
Q9ZAR1_ENTAG/3-139--------------------------------------------------------------------------------
J7JUX2_BACIU/4-140--------------------------------------------------------------------------------
O66073_BACLI/12-147--------------------------------------------------------------------------------
J7JS00_BACIU/7-142--------------------------------------------------------------------------------
Y510_ARCFU/3-136--------------------------------------------------------------------------------
O58324_PYRHO/8-137--------------------------------------------------------------------------------
Y788_ARCFU/41-166--------------------------------------------------------------------------------
J7JU04_BACIU/4-138--------------------------------------------------------------------------------
Q9Z6F0_MYCSM/151-288--------------------------------------------------------------------------------
D5AVZ9_RICPP/149-281--------------------------------------------------------------------------------
O59158_PYRHO/22-155--------------------------------------------------------------------------------
A0A009E7X9_ECOLX/158-292--------------------------------------------------------------------------------
C9MFS0_HAEIF/155-289--------------------------------------------------------------------------------
D6EP20_STRLI/5-140--------------------------------------------------------------------------------
Y841_METTH/44-192--------------------------------------------------------------------------------
F7UTM7_SYNYG/180-316--------------------------------------------------------------------------------
YD3A_METJA/2-135--------------------------------------------------------------------------------
C4PN91_CHLTZ/173-314--------------------------------------------------------------------------------
Q9Z6F0_MYCSM/7-141--------------------------------------------------------------------------------
A0A009EIR4_ECOLX/9-142--------------------------------------------------------------------------------
F7UPD3_SYNYG/180-319--------------------------------------------------------------------------------
Y788_ARCFU/171-306--------------------------------------------------------------------------------
Q9ZAR1_ENTAG/144-287--------------------------------------------------------------------------------
A0A009EIR4_ECOLX/151-290--------------------------------------------------------------------------------
PECM_DICD3/1-130--------------------------------------------------------------------------------
J7JS06_BACIU/176-314--------------------------------------------------------------------------------
Y841_METTH/205-340--------------------------------------------------------------------------------
O66073_BACLI/158-302--------------------------------------------------------------------------------
A0A017JYW9_ECOLX/147-281--------------------------------------------------------------------------------
J7JU04_BACIU/147-282--------------------------------------------------------------------------------
Y510_ARCFU/148-285--------------------------------------------------------------------------------
Y976A_HAEIN/24-161--------------------------------------------------------------------------------
L8ANE0_BACIU/160-300--------------------------------------------------------------------------------
J7JUX2_BACIU/153-290--------------------------------------------------------------------------------
A4XDY4_NOVAD/169-306--------------------------------------------------------------------------------
Y266_ARCFU/139-274--------------------------------------------------------------------------------
D5AUW8_RHOCB/157-295--------------------------------------------------------------------------------
WTR2_ARATH/184-324--------------------------------------------------------------------------------
O59388_PYRHO/154-290--------------------------------------------------------------------------------
O58347_PYRHO/149-285--------------------------------------------------------------------------------
YSO2_ACIAM/105-237--------------------------------------------------------------------------------
J7JNU4_BACIU/149-285--------------------------------------------------------------------------------
O59158_PYRHO/167-298--------------------------------------------------------------------------------
F7URF2_SYNYG/171-308--------------------------------------------------------------------------------
J7JVD8_BACIU/148-285--------------------------------------------------------------------------------
J7JZ94_BACIU/150-287--------------------------------------------------------------------------------
YCB6_PSEDE/3-140--------------------------------------------------------------------------------
O58983_PYRHO/5-140--------------------------------------------------------------------------------
Y1533_ARCFU/143-274--------------------------------------------------------------------------------
A0A009DPG9_ECOLX/149-285--------------------------------------------------------------------------------
G4EPI0_BACIU/159-292--------------------------------------------------------------------------------
O59388_PYRHO/9-144--------------------------------------------------------------------------------
O58347_PYRHO/2-140--------------------------------------------------------------------------------
J7JN80_BACIU/162-303--------------------------------------------------------------------------------
A0A009DPG9_ECOLX/9-141--------------------------------------------------------------------------------
C9MFS0_HAEIF/6-142--------------------------------------------------------------------------------
A0A009E7X9_ECOLX/6-144--------------------------------------------------------------------------------
O67627_AQUAE/4-141--------------------------------------------------------------------------------
G4F0I2_BACIU/7-141--------------------------------------------------------------------------------
Y1552_ARCFU/139-269--------------------------------------------------------------------------------
O57793_PYRHO/144-274--------------------------------------------------------------------------------

PF08449

S35B4_MOUSE/2-314---------------------------------------------RPAFAVGLVFAGCCSNVIFLELLARTHP.GC.G..
O44166_CAEEL/6-310---------------------------------------------APIFGVLGSCMGC...MVFVENIAKQEP.SA.M..
Q9VAN9_DROME/6-318---------------------------------------------RAISAICGVFLGCCSGVVFLELLVKLDP.GA.G..
YEA4_KLULA/2-321---------------------------------------------SFVLILSLVFGGCCSNVISFEHMVQGSN.INLG..
YEA4_SCHPO/1-304---------------------------------------------MIASALSFIFGGCCSNAYALEALVREFP.SS.G..
S35B4_DICDI/7-328---------------------------------------------ISLIPISMIMVGCCSNVISLELIMKQSQ.SH.A..
S35B3_DROME/61-364---------------------------------------------QFLLSCAGVFFLYILYGYLQELIFTVEGFKPYG..
UTR5B_ARATH/18-321---------------------------------------------KGVFAVSGIMSTLVIYGVLQEKIMR....VPYGVN
YEA4_YEAST/3-327---------------------------------------------NSLKAFALVFGGCCSNVITFETLMSNET.GSIN..
UTR1_ARATH/13-318---------------------------------------------LLALCISGIWSAYIYQGVLQETLST....KRFGPD
S35B4_DROME/6-325---------------------------------------------KALLGMLFVFIGCCSNVVFLELIIQIDP.GA.G..
S35B3_CAEEL/41-332---------------------------------------------QFVLLSLAIFILYIGYGYMQELIFKLPGMKPFG..
UTR2_ARATH/22-312---------------------------------------------QFLICTSGFFFGYLVNGVCEEYVYNRLQ.FSFG..
S35B4_DANRE/2-314---------------------------------------------NTLFAVTLVFVGCCSNVVFLELLVRDFP.GC.G..
F1P4W7_CHICK/48-339---------------------------------------------QFFICVSGVFMFYLIYGYLQELIFSVEGFKPFG..
F7D3M1_XENTR/123-422---------------------------------------------.LLFCAAGLQVSYLTWGVLQERVMTRTYGSEEGSP
Q1K947_NEUCR/81-406---------------------------------------------..GVMLSLIFGGCCSNVFALESIIKVEP.GA.G..

PF06027

S35F1_MOUSE/56-355LNREMLISVALGQVLSLLVCGIGLTSKYLAEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEENLLAILRRRWWKYMIL
Q948Q8_ARATH/10-301KTKKTLIGLGLGQIISLLSTLIASIASEIARK.GISAPTSQTFLGYVSLAIVYGGIMLYRRSA......IKVKWYHYFLL
S35F2_HUMAN/35-334FTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILL
Q948Q7_ARATH/12-303KTKKTLIGLGLGQILSLLCTSNAFTSSELARK.GINAPTSQTFLSYTLLAVVYGGIMLYRRPT......IKGKWYHYFLL
YCN8_SCHPO/137-433LDKRFWIVFFLGQVLSLCITATNTFNGYMSGI..SNIPAFQTFLVYALLTLVYTPYTVFRMGFKKYFEMIFRHGWKYIIF

PF08627

D3B5S8_POLPA/52-390-----------------VLIYSVCYVISGVINSILLKLTMNSFQNYGFFLNQLTNYGFIPIFGAVVAYKIMFTND.IPQE
H3GRN7_PHYRM/13-337-----------------LLVSFVAMVFVGLGNKIFQKLQTIPMHNYPTFLNLLTTFVYIPISFAYILPMIKYGSA.ITWD
Q5CIN3_CRYHO/46-383-----------------LIVCMMSLLISSVFNSVFFKKMTSAMPNHVWFLTQLTSALYIPLFGLVLL.IFYFRGE.LSRD
CRTP2_DICDI/60-403-----------------VLVYVVLYILSGVINSLLLKKVMNVFTNYGFFLNQLTNYGYVPIFGAIVLYKILFTND.IPKD
CRTP1_DICDI/52-397-----------------ILIYVVLYVTSGVINSVLLKKVMNKFTNYAFFLSQLTNFGYVPIFGAVTAYKIFFTKD.IPQE
B6AJI0_CRYMR/52-389-----------------LIFCMLGLLLSSVVNSVYFKKMTNAMPNHVWFLTQLISGLYVPFFGIIVL.ILYLKNN.ISDE
CRTP3_DICDI/55-397-----------------ILIYVLLYIISGVINVVLLKKLMIKFVNYGFFLSQITNYGYLPIFLVAMWYKMYCTSD.VPKE
D7G582_ECTSI/57-381-----------------LLLSFTAMVFVSLANKVFQKLETIPMYNYPNFLNLFTTFVYIPFSFAYIIPMMRYGDT.ITPE
F0VNJ4_NEOCL/328-662-----------------VVTYAFLLLVTSTGNTICFKKMIDKLPNYSPFLTQVTTVAFVPVFFALSFYTDYA.GG.LPQE
F4Q0G1_DICFS/42-373-----------------IIIYTLCYIVSGVINSILLKLTMNSFQNYGFFLNQLTNYGYIPIFGAVVAYKLYFTND.IPEE
F0Z9W2_DICPU/55-406-----------------ILLYVVLYISAGVVNSILLKKVMNVFSNYAFFLNQLTNYGYVPIFFSVVLFKFIFTND.IPKE
CRT_PLAF7/61-391-----------------IYILSIIYLSVCVMNKIFAKRTLNKIGNYSFVTSETHNFICMIMFFI..VYSLFGNKKGNSKE

PF05653

NPAL2_MOUSE/45-332---------------------------------------------------------QIHLFGVLLAILGNLVISISLNI
Q9VK62_DROME/43-338---------------------------------------------------------TDFYIGVGLAISSCFFIGSSFII
NIPA2_HUMAN/8-302---------------------------------------------------------YDFYIGLGLAMSSSIFIGGSFIL
B3LFA3_ARATH/7-299---------------------------------------------------------.DNIHGVILAVSSSIFIGSSFII
H2U3Z2_TAKRU/23-316---------------------------------------------------------.DFYIGLSLAVSSSAFIGASFIL
Q8GWX2_ARATH/3-295---------------------------------------------------------TDNGKGLILAVASSVFIGSSFIL

PF16913

PUP2_ARATH/6-340-------------------------------------------------VLVIINCIFLAIGNCGGPLMMRLYFQNGGER
PUP11_ARATH/44-362-------------------------------------------------VLVSVNIFFLIGGQAASVLLGRFYYDEGGNS
PUP20_ARATH/46-377-------------------------------------------------ICIFVCSGFVVTGRVLSTLLLNYYFIQTGRD
PUP6_ARATH/36-361-------------------------------------------------LRVSLYVTLLLAGETIATLLGRLYYEKGGKS
Q8H7P2_ORYSJ/48-373-------------------------------------------------LLVIFSACLVLLG.AGGPLLLRVYFVHGGTR
PUP12_ARATH/30-348-------------------------------------------------ILVFISIFFLISAQAISVLLGRFYYNEGGNS
PUP1_ARATH/4-334-------------------------------------------------GLIIINCIILTIGTCGGPLLTRLYFTNGGKR
PUP3_ARATH/4-327-------------------------------------------------ALVIINCIILAIGNCGGPLIMRLYFNNGGKR
PUP15_ARATH/45-380-------------------------------------------------VTIIICTILAVTGQCIARLLENYYFLHKNLS
PUP5_ARATH/38-353-------------------------------------------------ILLFFSGAAMLIAFPASSLLSRLYFSNGGKS
PUP18_ARATH/39-376-------------------------------------------------ISVSLCIFLVLLGDSLVMLLLNFFYVQDNRE
PUP14_ARATH/47-391-------------------------------------------------PTITISIIFVIIGQSIAKLLENFYYDKTNRS
PUP4_ARATH/26-344-------------------------------------------------TLLIVTYFFLFFGSIASSLLAKYYFVYGGSS
PUP8_ARATH/46-367-------------------------------------------------LRISIYVFFVLACQALSTILGRVYYENGGKS
PUP16_ARATH/30-368-------------------------------------------------ISVFICGFLIFAGDSLVMLLLNFFYVQDNRS
Q7XN26_ORYSJ/40-356-------------------------------------------------LSVAADMFMVLCGQTVATLLGRLYYNSGGNS

PF04657

Q21DH8_SACD2/19-159--------------------------------------------------------------------------------
Q39SB9_GEOMG/5-141--------------------------------------------------------------------------------
A6TN22_ALKMQ/4-138--------------------------------------------------------------------------------
A3QFA9_SHELP/30-170--------------------------------------------------------------------------------
A6VSJ3_MARMS/9-148--------------------------------------------------------------------------------
Q1GQL8_SPHAL/9-147--------------------------------------------------------------------------------
Q1QZC8_CHRSD/5-140--------------------------------------------------------------------------------
Q2RGM8_MOOTA/15-156--------------------------------------------------------------------------------
Q0AXV4_SYNWW/5-143--------------------------------------------------------------------------------
Q7N4X7_PHOLL/3-137--------------------------------------------------------------------------------
Q03TA8_LACBA/2-142--------------------------------------------------------------------------------
A6LU87_CLOB8/1-136--------------------------------------------------------------------------------
Q03TA8_LACBA/164-305--------------------------------------------------------------------------------
Q11NT1_CYTH3/6-142--------------------------------------------------------------------------------
Q0KF63_CUPNH/16-155--------------------------------------------------------------------------------
A1AK06_PELPD/5-141--------------------------------------------------------------------------------
Q5KZC7_GEOKA/4-140--------------------------------------------------------------------------------
Q4KHW5_PSEF5/5-144--------------------------------------------------------------------------------
A0JUK3_ARTS2/163-299--------------------------------------------------------------------------------
Q7UTT1_RHOBA/5-133--------------------------------------------------------------------------------
Q03HH1_PEDPA/168-308--------------------------------------------------------------------------------
Q03HH1_PEDPA/2-142--------------------------------------------------------------------------------
A6VKF2_ACTSZ/4-143--------------------------------------------------------------------------------
Q03Y21_LEUMM/166-301--------------------------------------------------------------------------------
B1YHB6_EXIS2/3-139--------------------------------------------------------------------------------
Q3A9B8_CARHZ/6-140--------------------------------------------------------------------------------
A8MKQ0_ALKOO/2-138--------------------------------------------------------------------------------
B1YEL8_EXIS2/4-140--------------------------------------------------------------------------------
Q8YKX2_NOSS1/5-144--------------------------------------------------------------------------------
Q12R75_SHEDO/9-146--------------------------------------------------------------------------------
Q9RVB6_DEIRA/8-144--------------------------------------------------------------------------------
A1A0P8_BIFAA/203-343--------------------------------------------------------------------------------
Q749R3_GEOSL/5-141--------------------------------------------------------------------------------
A6M3J1_CLOB8/2-138--------------------------------------------------------------------------------
Q65J95_BACLD/5-146--------------------------------------------------------------------------------
Q28TA8_JANSC/7-146--------------------------------------------------------------------------------
Q12K32_SHEDO/8-147--------------------------------------------------------------------------------
Q9RVB7_DEIRA/19-157--------------------------------------------------------------------------------
A3QFA8_SHELP/3-133--------------------------------------------------------------------------------
A5G8U5_GEOUR/6-141--------------------------------------------------------------------------------
Q8YKX1_NOSS1/33-172--------------------------------------------------------------------------------
A9KHN5_CLOPH/2-140--------------------------------------------------------------------------------
Q8FQJ9_COREF/99-239--------------------------------------------------------------------------------
B1YGF5_EXIS2/14-153--------------------------------------------------------------------------------
Q6D0D7_PECAS/13-152--------------------------------------------------------------------------------
A8LKG3_DINSH/5-143--------------------------------------------------------------------------------
Q28R25_JANSC/3-140--------------------------------------------------------------------------------
Q316U3_DESAG/4-143--------------------------------------------------------------------------------
B1YGF5_EXIS2/179-317--------------------------------------------------------------------------------
Q65QN9_MANSM/39-179--------------------------------------------------------------------------------
B1YIK4_EXIS2/3-139--------------------------------------------------------------------------------
Q04FL6_OENOB/173-313--------------------------------------------------------------------------------
Q31P27_SYNE7/5-144--------------------------------------------------------------------------------
Q5R178_IDILO/5-143--------------------------------------------------------------------------------
A9BWW9_DELAS/11-150--------------------------------------------------------------------------------
A0PXE0_CLONN/7-143--------------------------------------------------------------------------------
Q6FEY6_ACIAD/10-149--------------------------------------------------------------------------------
Q03UQ1_LEUMM/173-314--------------------------------------------------------------------------------
Q97DD1_CLOAB/2-138--------------------------------------------------------------------------------
Q5Z3K6_NOCFA/3-148--------------------------------------------------------------------------------
Q67KE9_SYMTH/5-146--------------------------------------------------------------------------------
Q2RM98_MOOTA/3-140--------------------------------------------------------------------------------
Q65J96_BACLD/10-156--------------------------------------------------------------------------------
Q1LCM1_RALME/14-153--------------------------------------------------------------------------------
Q7NSE3_CHRVO/15-151--------------------------------------------------------------------------------
A6LU86_CLOB8/2-134--------------------------------------------------------------------------------
Q9CJV1_PASMU/4-144--------------------------------------------------------------------------------
Q53WI3_THET8/6-144--------------------------------------------------------------------------------
A9CIC3_AGRT5/3-135--------------------------------------------------------------------------------
Q0BSA2_GRABC/6-144--------------------------------------------------------------------------------
B1YHB4_EXIS2/2-138--------------------------------------------------------------------------------
Q3HKF8_RHOS4/5-144--------------------------------------------------------------------------------
Q18BT7_PEPD6/5-139--------------------------------------------------------------------------------
B1YIK3_EXIS2/2-138--------------------------------------------------------------------------------
Q1QZC9_CHRSD/5-141--------------------------------------------------------------------------------
Q7NSE2_CHRVO/2-129--------------------------------------------------------------------------------
Q5HRB7_STAEQ/151-293--------------------------------------------------------------------------------
A5D651_PELTS/6-144--------------------------------------------------------------------------------
Q7P1D2_CHRVO/22-162--------------------------------------------------------------------------------
A4J0N8_DESRM/6-144--------------------------------------------------------------------------------
A4XQ88_PSEMY/7-145--------------------------------------------------------------------------------
Q03UQ1_LEUMM/2-142--------------------------------------------------------------------------------
Q168E1_ROSDO/6-143--------------------------------------------------------------------------------
Q1WV36_LACS1/3-143--------------------------------------------------------------------------------
A1A0P8_BIFAA/19-158--------------------------------------------------------------------------------
Q03Y21_LEUMM/4-142--------------------------------------------------------------------------------
Q98M54_RHILO/5-145--------------------------------------------------------------------------------
Q899N2_CLOTE/13-149--------------------------------------------------------------------------------
Q04FL6_OENOB/2-142--------------------------------------------------------------------------------
B1YEL9_EXIS2/4-140--------------------------------------------------------------------------------
Q2KZA1_BORA1/11-150--------------------------------------------------------------------------------
B0UV26_HISS2/5-138--------------------------------------------------------------------------------
B2HD53_MYCMM/9-144--------------------------------------------------------------------------------
B4EH13_BURCJ/7-144--------------------------------------------------------------------------------
C5AMM3_BURGB/15-150--------------------------------------------------------------------------------
D5C835_ENTCC/6-143--------------------------------------------------------------------------------
Q24WC2_DESHY/8-142--------------------------------------------------------------------------------
Q24WK5_DESHY/6-141--------------------------------------------------------------------------------
Q2G2U7_STAA8/151-293--------------------------------------------------------------------------------
Q4FVN5_PSYA2/4-139--------------------------------------------------------------------------------
Q4FVN6_PSYA2/5-140--------------------------------------------------------------------------------
Q6M0K5_METMP/6-143--------------------------------------------------------------------------------
Q726Q6_DESVH/5-141--------------------------------------------------------------------------------
Q7CQI5_SALTY/6-143--------------------------------------------------------------------------------
Q813A7_BACCR/2-135--------------------------------------------------------------------------------
Q813A8_BACCR/2-136--------------------------------------------------------------------------------
Q88GV8_PSEPK/16-154--------------------------------------------------------------------------------
Q8EJT6_SHEON/3-135--------------------------------------------------------------------------------
Q8EJT7_SHEON/11-158--------------------------------------------------------------------------------
Q8NRH8_CORGL/57-196--------------------------------------------------------------------------------
Q8XH76_CLOPE/3-138--------------------------------------------------------------------------------
Q8Y7R1_LISMO/4-145--------------------------------------------------------------------------------
Q8ZLF8_SALTY/10-154--------------------------------------------------------------------------------
Q92CJ8_LISMO/11-151--------------------------------------------------------------------------------
Q9CES9_LACLA/4-142--------------------------------------------------------------------------------
Q9HUZ5_PSEAE/8-145--------------------------------------------------------------------------------
Q9HYS5_PSEAE/5-144--------------------------------------------------------------------------------

PF10639

Q4TT81_CAEEL/12-122--------------------------------------------------------------------------------
A0C2W3_PARTE/7-116--------------------------------------------------------------------------------
Q4D1L3_TRYCC/4-115--------------------------------------------------------------------------------
Q22BW6_TETTS/16-127--------------------------------------------------------------------------------
TM234_ANOGA/20-135--------------------------------------------------------------------------------
TM234_PONAB/11-126--------------------------------------------------------------------------------
Q0U0B5_PHANO/22-148--------------------------------------------------------------------------------
A4I0H4_LEIIN/5-115--------------------------------------------------------------------------------
TM234_DICDI/9-124--------------------------------------------------------------------------------
A7SF34_NEMVE/12-127--------------------------------------------------------------------------------
Q57W61_TRYB2/4-115--------------------------------------------------------------------------------
Q179X3_AEDAE/11-126--------------------------------------------------------------------------------
A1Z7W3_DROME/8-123--------------------------------------------------------------------------------
B8A4M2_DANRE/10-125--------------------------------------------------------------------------------
H3DIR9_TETNG/11-126--------------------------------------------------------------------------------

PF00893

EMRE_ECOLI/2-94--------------------------------------------------------------------------------
YVAE_BACSU/1-93--------------------------------------------------------------------------------
MDTI_ECOLI/4-99--------------------------------------------------------------------------------
YVDS_BACSU/1-89--------------------------------------------------------------------------------
EBRB_BACSU/2-94--------------------------------------------------------------------------------
YKKD_BACSU/2-94--------------------------------------------------------------------------------
EBRA_BACSU/3-95--------------------------------------------------------------------------------
YVDR_BACSU/1-93--------------------------------------------------------------------------------
Y4NH_RHISN/1-106--------------------------------------------------------------------------------
YKKC_BACSU/1-90--------------------------------------------------------------------------------
B4EWY3_PROMH/1-93--------------------------------------------------------------------------------
E6W493_DESIS/3-94--------------------------------------------------------------------------------
SUGE_ECOLI/1-93--------------------------------------------------------------------------------
MMR_MYCTU/1-94--------------------------------------------------------------------------------
MDTJ_SHIDS/4-94--------------------------------------------------------------------------------

PF04142

GMS1_SCHPO/11-323-----------------------------------KGIPMKYIALVLLTVQNSALILTLNYSRIMPGYDDKRYFTSTAVL
O01879_CAEEL/6-314-----------------------------------NDSKFKYFGILLLTIQQASMPLMARYSRAR..EDSNVFFTTVNVF
O76865_DROME/18-342-----------------------------------NANTLKYISLLTLTLQNAILGLSMRYARTR...PGDIFLSSTAVL
S35A1_HUMAN/8-314-----------------------------------VTLLFKLYCLAVMTLMAAVYTIALRYTRTS...DKELYFSTTAVC
S35A2_HUMAN/31-339-----------------------------------AHRRLKYISLAVLVVQNASLILSIRYARTL...PGDRFFATTAVV
S35A3_CANFA/1-314-----------------------------------MSTNLKYLSLGILVFQTTSLVLTMRYSRTL.KEEGPRYLSSTAVV
UGTP1_CAEEL/37-351-----------------------------------PSFVFKCYVIASMTFIWTAYTLTIKYTRST.VNPDMMYSSTSVVL
O16658_CAEEL/7-326-----------------------------------TSSNLKLISLVVLIVQTTALVLTLRYSQTQ.KSEGPRYLSSTAVV
O02345_CAEEL/5-360-----------------------------------KAETIKYSSLVVLVVQNCSLVLFMRYAMTK...DRPKFLKTITVL

PF06800

GLCU_BACSU/4-283--------------------------------------------------------------------------------
Y176_LISMO/4-283--------------------------------------------------------------------------------
Y2157_STRA5/5-285--------------------------------------------------------------------------------
RBSU_LACPL/7-294--------------------------------------------------------------------------------
Y2503_LACPL/4-283--------------------------------------------------------------------------------
RBSU_LACSS/7-293--------------------------------------------------------------------------------
Y169_LISMO/4-283--------------------------------------------------------------------------------
YXFA_LACLA/5-291--------------------------------------------------------------------------------
Y2594_LACPL/4-282--------------------------------------------------------------------------------
Y2205_STRP1/5-285--------------------------------------------------------------------------------
Y424_LISMO/5-284--------------------------------------------------------------------------------
Q2G1A4_STAA8/7-292--------------------------------------------------------------------------------
RBSU_STAEQ/7-292--------------------------------------------------------------------------------
GLCU_STAEQ/7-284--------------------------------------------------------------------------------

PF07857

Q20583_CAEEL/6-327--------------------------------------------------------------------------------
TM144_CAEEL/4-345--------------------------------------------------------------------------------
Q9U3C0_CAEEL/15-349--------------------------------------------------------------------------------
TM144_HUMAN/9-344--------------------------------------------------------------------------------
Q95QA2_CAEEL/2-342--------------------------------------------------------------------------------
O01810_CAEEL/4-351--------------------------------------------------------------------------------

PF04342

W0A9J2_9SPHN/8-113--------------------------------------------------------------------------------
W0ESB8_9PORP/6-120--------------------------------------------------------------------------------
R7J057_9BACT/7-121--------------------------------------------------------------------------------
R5GE85_9BACT/6-120--------------------------------------------------------------------------------
C9RMH7_FIBSS/7-121--------------------------------------------------------------------------------
C1EGV5_MICSR/11-116--------------------------------------------------------------------------------
R6M9N1_9BACE/6-121--------------------------------------------------------------------------------
M4VF68_9DELT/12-111--------------------------------------------------------------------------------
R7KRF0_9BURK/11-114--------------------------------------------------------------------------------
B3DXJ3_METI4/19-122--------------------------------------------------------------------------------
R5GGI4_9PORP/6-121--------------------------------------------------------------------------------
C0QW78_BRAHW/6-120--------------------------------------------------------------------------------
J7TKX6_MORMO/7-110--------------------------------------------------------------------------------
R6XLL0_9BACT/6-120--------------------------------------------------------------------------------
R5VDD3_9PORP/6-120--------------------------------------------------------------------------------
R7P7Y5_9BACT/6-120--------------------------------------------------------------------------------
M4S3A7_9SPHN/3-107--------------------------------------------------------------------------------
W8F6G8_9BACT/6-120--------------------------------------------------------------------------------
C6W5H8_DYAFD/6-120--------------------------------------------------------------------------------
V5SCV2_9RHIZ/12-115--------------------------------------------------------------------------------
Q9I3E0_PSEAE/7-111--------------------------------------------------------------------------------
F0P098_WEEVC/6-120--------------------------------------------------------------------------------
E3I3M7_RHOVT/8-111--------------------------------------------------------------------------------
C7PV02_CHIPD/3-107--------------------------------------------------------------------------------
Q3J4E4_RHOS4/10-113--------------------------------------------------------------------------------
W0RE32_9BACT/7-111--------------------------------------------------------------------------------
Q2G7E2_NOVAD/8-111--------------------------------------------------------------------------------
R6PI70_9CLOT/7-110--------------------------------------------------------------------------------
Q11HS8_CHESB/8-111--------------------------------------------------------------------------------
B7K215_CYAP8/8-111--------------------------------------------------------------------------------
D4Z3P0_SPHJU/3-108--------------------------------------------------------------------------------
Q6D027_PECAS/7-111--------------------------------------------------------------------------------
E1QGJ6_DESB2/5-109--------------------------------------------------------------------------------
B2ULU2_AKKM8/6-114--------------------------------------------------------------------------------
A5EXJ2_DICNV/6-112--------------------------------------------------------------------------------
D5MKV2_9BACT/7-111--------------------------------------------------------------------------------
D0MEU5_RHOM4/7-111--------------------------------------------------------------------------------
Q9PG53_XYLFA/11-114--------------------------------------------------------------------------------
E6VQT5_DESAO/7-111--------------------------------------------------------------------------------
Q1GTV7_SPHAL/7-110--------------------------------------------------------------------------------
D8PAT6_9BACT/3-106--------------------------------------------------------------------------------
Q6LXR9_METMP/6-109--------------------------------------------------------------------------------
D2R2M8_PIRSD/9-124--------------------------------------------------------------------------------
R7LE15_9BACT/6-120--------------------------------------------------------------------------------
H2FYV5_OCESG/7-111--------------------------------------------------------------------------------
C4KAD8_THASP/17-121--------------------------------------------------------------------------------
E4T2Z8_PALPW/6-120--------------------------------------------------------------------------------
E6W367_DESIS/7-111--------------------------------------------------------------------------------
E8RR36_ASTEC/10-113--------------------------------------------------------------------------------
F4HE45_GALAU/7-112--------------------------------------------------------------------------------
G7UQB0_PSEUP/7-110--------------------------------------------------------------------------------
B0T7W2_CAUSK/11-112--------------------------------------------------------------------------------
C3MDJ4_RHISN/36-139--------------------------------------------------------------------------------
W6R971_9RHIZ/97-200--------------------------------------------------------------------------------
Q0C0V6_HYPNA/7-110--------------------------------------------------------------------------------
H8KNB8_SOLCM/6-120--------------------------------------------------------------------------------
R5PS28_9BURK/8-121--------------------------------------------------------------------------------
G8M1P8_CLOCD/3-106--------------------------------------------------------------------------------
A7HZ37_PARL1/9-112--------------------------------------------------------------------------------
R6T071_9BACE/7-121--------------------------------------------------------------------------------
E1VMC8_9GAMM/8-112--------------------------------------------------------------------------------
R5W8P9_9BACT/6-120--------------------------------------------------------------------------------
D4H7Q5_DENA2/6-110--------------------------------------------------------------------------------
B4F097_PROMH/10-113--------------------------------------------------------------------------------
F4C648_SPHS2/17-130--------------------------------------------------------------------------------
G4REH9_PELHB/16-119--------------------------------------------------------------------------------
C4LDN3_TOLAT/7-111--------------------------------------------------------------------------------
C7LWT9_DESBD/7-111--------------------------------------------------------------------------------
A6LDS9_PARD8/6-121--------------------------------------------------------------------------------
G2IKI7_9SPHN/3-108--------------------------------------------------------------------------------
D2QPF2_SPILD/6-120--------------------------------------------------------------------------------
B3QYF9_CHLT3/7-111--------------------------------------------------------------------------------
R7BWA0_9BURK/14-118--------------------------------------------------------------------------------
A6WZG9_OCHA4/38-141--------------------------------------------------------------------------------
C1D6W6_LARHH/7-111--------------------------------------------------------------------------------
R5B7P2_9BACE/7-121--------------------------------------------------------------------------------
R5H459_9SPIR/13-116--------------------------------------------------------------------------------
R7JJ48_9BACT/7-119--------------------------------------------------------------------------------
Q74DP1_GEOSL/3-107--------------------------------------------------------------------------------
R5Q2I4_9PROT/6-109--------------------------------------------------------------------------------
A3N0G8_ACTP2/6-112--------------------------------------------------------------------------------
A4G8C4_HERAR/9-113--------------------------------------------------------------------------------
U5Q7E4_9BACT/7-121--------------------------------------------------------------------------------
E6SWV4_BACT6/6-120--------------------------------------------------------------------------------
K0HPY2_9BURK/13-117--------------------------------------------------------------------------------
R7JGE6_9FUSO/7-110--------------------------------------------------------------------------------
R6XHS7_9BACT/6-120--------------------------------------------------------------------------------
I0DPA6_PROSM/18-121--------------------------------------------------------------------------------
A1BAJ0_PARDP/9-112--------------------------------------------------------------------------------
Q8EH57_SHEON/7-111--------------------------------------------------------------------------------
G2LIQ0_CHLTF/3-106--------------------------------------------------------------------------------
E3F3V7_KETVY/10-113--------------------------------------------------------------------------------
X5DDK4_9BACT/6-120--------------------------------------------------------------------------------
I2EZ99_EMTOG/16-119--------------------------------------------------------------------------------
F8EEI4_RUNSL/3-106--------------------------------------------------------------------------------
F3ZRC2_9BACE/7-121--------------------------------------------------------------------------------
Q6F6M6_ACIAD/9-112--------------------------------------------------------------------------------
R6WBV4_9BACT/6-120--------------------------------------------------------------------------------
R5D1K2_9BACT/6-120--------------------------------------------------------------------------------
R7EWS2_9BACT/2-113--------------------------------------------------------------------------------
B0SL45_LEPBP/3-109--------------------------------------------------------------------------------
F4L194_HALH1/6-120--------------------------------------------------------------------------------
R6CXW8_9BACE/8-122--------------------------------------------------------------------------------
F2J1T6_POLGS/12-115--------------------------------------------------------------------------------
A4T0J4_POLSQ/14-117--------------------------------------------------------------------------------
A8ZVV9_DESOH/7-111--------------------------------------------------------------------------------
Q11YS2_CYTH3/6-121--------------------------------------------------------------------------------
Q3SFJ6_THIDA/7-111--------------------------------------------------------------------------------
D9SI46_GALCS/11-115--------------------------------------------------------------------------------
W0IXH8_9BACT/3-110--------------------------------------------------------------------------------
F8JCJ2_HYPSM/8-111--------------------------------------------------------------------------------
D8IXX1_HERSS/7-110--------------------------------------------------------------------------------
G2KSB6_MICAA/11-114--------------------------------------------------------------------------------
R5Y439_9BACE/6-120--------------------------------------------------------------------------------
R5NJ85_9BACT/38-152--------------------------------------------------------------------------------
W5X038_BDEBC/6-110--------------------------------------------------------------------------------
Q1QIE8_NITHX/17-120--------------------------------------------------------------------------------
S5XKS1_PARAH/9-112--------------------------------------------------------------------------------
C1AE72_GEMAT/11-115--------------------------------------------------------------------------------
G0A505_METMM/7-111--------------------------------------------------------------------------------
A7I2P3_CAMHC/6-120--------------------------------------------------------------------------------
R7L6H2_9BACT/6-109--------------------------------------------------------------------------------
E8QX61_ISOPI/7-111--------------------------------------------------------------------------------
D5AQ83_RHOCB/9-112--------------------------------------------------------------------------------
R5Y910_9PROT/6-109--------------------------------------------------------------------------------
A7IIY9_XANP2/18-121--------------------------------------------------------------------------------
D5EUK7_PRER2/7-121--------------------------------------------------------------------------------
E4RUT4_LEAB4/6-120--------------------------------------------------------------------------------
B8IYE0_DESDA/90-193--------------------------------------------------------------------------------
R5AYY1_9BACT/8-123--------------------------------------------------------------------------------
R5BPJ3_9BACE/6-120--------------------------------------------------------------------------------
F8BRI1_OLICO/10-113--------------------------------------------------------------------------------
I4B782_TURPD/8-122--------------------------------------------------------------------------------
B6ITG6_RHOCS/9-111--------------------------------------------------------------------------------
Q7MLC2_VIBVY/7-111--------------------------------------------------------------------------------
H8XSK5_FLAIG/6-120--------------------------------------------------------------------------------
F9Z5C1_ODOSD/6-120--------------------------------------------------------------------------------
Q9RW58_DEIRA/7-111--------------------------------------------------------------------------------
B4R8J2_PHEZH/10-113--------------------------------------------------------------------------------
G8T6T5_NIAKG/3-107--------------------------------------------------------------------------------
W0EYH8_9SPHI/5-109--------------------------------------------------------------------------------
R5EED1_9BURK/17-121--------------------------------------------------------------------------------
C6WUJ2_METML/7-111--------------------------------------------------------------------------------
T2G873_DESGI/9-113--------------------------------------------------------------------------------
E8UXU2_TERSS/9-110--------------------------------------------------------------------------------
D5SY52_PLAL2/48-153--------------------------------------------------------------------------------
F2IAM6_FLUTR/6-121--------------------------------------------------------------------------------
R6IPE3_9PROT/6-109--------------------------------------------------------------------------------
R5HYR9_9BACT/6-120--------------------------------------------------------------------------------
D9QGJ5_BRESC/9-112--------------------------------------------------------------------------------
B8DLP8_DESVM/13-116--------------------------------------------------------------------------------
Q2W577_MAGSA/8-111--------------------------------------------------------------------------------
R6A733_9BACT/7-121--------------------------------------------------------------------------------
B8FCH3_DESAA/5-109--------------------------------------------------------------------------------
B1MFP9_MYCA9/9-111--------------------------------------------------------------------------------
A5VEJ7_SPHWW/9-113--------------------------------------------------------------------------------

PF13536

Q03V04_LEUMM/46-308--------------------------------------------------------------------------------
E3EHL7_PAEPS/38-305--------------------------------------------------------------------------------
D3FXX0_BACPE/38-305--------------------------------------------------------------------------------
A6LSV6_CLOB8/39-306--------------------------------------------------------------------------------
Q5KZD5_GEOKA/38-305--------------------------------------------------------------------------------
I0I5E6_CALAS/39-305--------------------------------------------------------------------------------
YJLA_BACSU/38-305--------------------------------------------------------------------------------
A1SUW4_PSYIN/39-305--------------------------------------------------------------------------------
C4L5N6_EXISA/38-295--------------------------------------------------------------------------------
C3AMC2_BACMY/38-297--------------------------------------------------------------------------------
M1LX20_9CLOT/39-306--------------------------------------------------------------------------------
U5MU36_CLOSA/39-306--------------------------------------------------------------------------------
D5QCP1_KOMHA/49-311--------------------------------------------------------------------------------
E3H778_ILYPC/15-282--------------------------------------------------------------------------------
Q65J98_BACLD/38-305--------------------------------------------------------------------------------
B1YFT7_EXIS2/38-292--------------------------------------------------------------------------------
K8E5D6_CARML/38-305--------------------------------------------------------------------------------
W6EPU7_SULMU/39-303--------------------------------------------------------------------------------
C0QIH1_DESAH/39-304--------------------------------------------------------------------------------
Q6ANG8_DESPS/39-305--------------------------------------------------------------------------------
H6NI93_9BACL/38-300--------------------------------------------------------------------------------
R5J4C6_9CLOT/39-299--------------------------------------------------------------------------------
K7SQ00_GLUOY/57-318--------------------------------------------------------------------------------
D1AJ88_SEBTE/37-293--------------------------------------------------------------------------------
D5DKL9_BACMD/38-296--------------------------------------------------------------------------------
F2F9M1_SOLSS/38-303--------------------------------------------------------------------------------
C7JCT5_ACEP3/62-324--------------------------------------------------------------------------------
Q9KE50_BACHD/38-301--------------------------------------------------------------------------------
G7MAH8_9CLOT/39-306--------------------------------------------------------------------------------
U5RPE5_9CLOT/54-321--------------------------------------------------------------------------------
B5EDY2_GEOBB/39-305--------------------------------------------------------------------------------
C7PA25_CHIPD/45-307--------------------------------------------------------------------------------
F0JIH0_DESDE/39-305--------------------------------------------------------------------------------
M4NIF9_9GAMM/43-304--------------------------------------------------------------------------------
C6BZX5_DESAD/38-303--------------------------------------------------------------------------------
Q6LY72_METMP/38-305--------------------------------------------------------------------------------
C8WR01_ALIAD/49-311--------------------------------------------------------------------------------
X2GJH8_9BACI/38-301--------------------------------------------------------------------------------
I4D678_DESAJ/38-305--------------------------------------------------------------------------------
A5WEC6_PSYWF/39-359--------------------------------------------------------------------------------
Q4FTR9_PSYA2/39-359--------------------------------------------------------------------------------
E1VGW5_9GAMM/39-307--------------------------------------------------------------------------------
C3ARA6_BACMY/38-305--------------------------------------------------------------------------------
C4XLI6_DESMR/39-305--------------------------------------------------------------------------------
D5V665_ARCNC/39-305--------------------------------------------------------------------------------
Q74GJ7_GEOSL/39-305--------------------------------------------------------------------------------
U5L9M7_9BACI/38-300--------------------------------------------------------------------------------
J7J0N8_DESMD/38-305--------------------------------------------------------------------------------
Q5WCC4_BACSK/44-307--------------------------------------------------------------------------------
N0ASW8_9BACI/38-305--------------------------------------------------------------------------------
R5FF82_9CLOT/39-293--------------------------------------------------------------------------------
E6VZC7_DESAO/38-303--------------------------------------------------------------------------------
X4ZGT8_9BACL/90-357--------------------------------------------------------------------------------
D5DEQ8_BACMD/38-305--------------------------------------------------------------------------------
A9B6H6_HERA2/38-299--------------------------------------------------------------------------------
F0SEG2_PEDSD/42-303--------------------------------------------------------------------------------
F4CEV5_SPHS2/37-299--------------------------------------------------------------------------------
K0AXA0_CLOA9/38-305--------------------------------------------------------------------------------
M1WNJ2_DESPC/39-305--------------------------------------------------------------------------------

PF02694

YFJF_BACSU/2-109--------------------------------------------------------------------------------
YNFA_ECOLI/1-108--------------------------------------------------------------------------------
Y793_SYNY3/2-108--------------------------------------------------------------------------------
Y2639_MYCTU/2-109--------------------------------------------------------------------------------

PF07168

A9T133_PHYPA/41-393----------------------------------------------------------TYLDYTFANYGVAVLFAFTLGD
K4ATM4_SOLLC/41-402----------------------------------------------------------TYLDYTLTNLLAAVIIAFTFGE
K4BXV4_SOLLC/41-401----------------------------------------------------------TYLDYTITNLLAAVIIALTIGQ
D7LQJ5_ARALL/41-385----------------------------------------------------------TYLDYTLTNLLAAVIIALTLGE
A9S1P5_PHYPA/41-386----------------------------------------------------------TYLDYSITNFLAGLLIALTLGQ
D8RRC9_SELML/41-386----------------------------------------------------------TYIDYAISTFAVAVIFALTLGQ
C5YNZ3_SORBI/41-417----------------------------------------------------------TFLDFSVTNFLAAVLVALTFGQ
D7LQI7_ARALL/41-397----------------------------------------------------------TYLDYSITNLLAAIIIAFTFGQ
D7LQI6_ARALL/41-402----------------------------------------------------------TLLDFATANLLAAIVIAFSLGE
K4BNE7_SOLLC/41-401----------------------------------------------------------TYLDYTITNLVAATLIAFTVGE
D8STK4_SELML/41-404----------------------------------------------------------TYLDYCITNYIAAIVIALTLGQ
M0SF12_MUSAM/41-412----------------------------------------------------------TYLDYSITNLLAAVIIALTLGQ
I1J5Z9_SOYBN/68-423----------------------------------------------------------TYLDYSITNFLSALLIAFTLGG
B9HIE2_POPTR/41-399----------------------------------------------------------TYLDYSITNLLAAVIIALTFGE
I1II69_BRADI/41-408----------------------------------------------------------TFLDFSLTNFLAAVLVGLTFGQ
I1II72_BRADI/41-402----------------------------------------------------------AYLDYSVSNLLAAVLIALTFGQ
I1R8V4_ORYGL/41-393----------------------------------------------------------TYLDYSVTNLLAAAVIAIAFGQ
Q2QQ90_ORYSJ/41-411----------------------------------------------------------TYLDYSITNFLAALLVAFTFGQ
UPS5_ARATH/49-404----------------------------------------------------------TYLDYSITNFLAAIFIAFVFGG

PF06379

A0A017QNF2_SALET/1-344----------------------------------------------------------------MSNAITMGIFWHLIGA
A0A014M1F6_YERPE/1-344----------------------------------------------------------------MNNAIILGIIWHLVGA

PF02535

Q17996_CAEEL/106-349--------------------------------------------------------------------------------
S39A8_MOUSE/126-453--------------------------------------------------------------------------------
ZIP1_ARATH/48-352--------------------------------------------------------------------------------
IRT1_ARATH/49-344--------------------------------------------------------------------------------
P91348_CAEEL/4-439--------------------------------------------------------------------------------
S39AD_DROME/33-350--------------------------------------------------------------------------------
Q9VFA2_DROME/25-359--------------------------------------------------------------------------------
IRT2_ARATH/44-347--------------------------------------------------------------------------------
S39A6_HUMAN/322-743--------------------------------------------------------------------------------
Q9VEX1_DROME/53-407--------------------------------------------------------------------------------
Y1036_METJA/5-231--------------------------------------------------------------------------------
O62192_CAEEL/30-311--------------------------------------------------------------------------------
S39A2_HUMAN/5-306--------------------------------------------------------------------------------
ZIP10_ARATH/49-361--------------------------------------------------------------------------------
S39AA_HUMAN/404-819--------------------------------------------------------------------------------
Q9XVJ5_CAEEL/4-376--------------------------------------------------------------------------------
ZIP3_ARATH/51-336--------------------------------------------------------------------------------
ZUPT_ECOLI/5-248--------------------------------------------------------------------------------
S39A5_MOUSE/208-522--------------------------------------------------------------------------------
Q9X260_THEMA/2-241--------------------------------------------------------------------------------
ATX2_YEAST/4-307--------------------------------------------------------------------------------
ZIP4_ARATH/25-371--------------------------------------------------------------------------------
Q9XWH3_CAEEL/4-315--------------------------------------------------------------------------------
ZRT2_YEAST/24-419--------------------------------------------------------------------------------
Q9XVR4_CAEEL/9-378--------------------------------------------------------------------------------
YKE4_YEAST/63-344--------------------------------------------------------------------------------
ZIP2_ARATH/61-350--------------------------------------------------------------------------------
FOI_DROME/258-684--------------------------------------------------------------------------------
ZRT1_SCHPO/60-405--------------------------------------------------------------------------------
ZRT1_YEAST/47-373--------------------------------------------------------------------------------
S39A7_MOUSE/140-473--------------------------------------------------------------------------------
ZIP6_ARATH/24-338--------------------------------------------------------------------------------
ZIP2_SCHPO/8-384--------------------------------------------------------------------------------
S39A1_MOUSE/27-320--------------------------------------------------------------------------------
HKE42_CAEEL/155-459--------------------------------------------------------------------------------
CSUP_DROME/129-446--------------------------------------------------------------------------------
Q09957_CAEEL/4-356--------------------------------------------------------------------------------

PF16965

C5DEG8_LACTC/3-369IA...LWLTAVLGYVVQIKCISHIYSTSVQGTLD.............................................V
I2H772_TETBL/1-419MPPVLIWVTTCISYVIQTRLLSKIQSKQFALHVAAITRDSSKIQT......................DHPSDDNGPNALT
G0VFG5_NAUCC/1-403MSSTALWFAVVLSYVIQTRGFSHIQSRTFLSNLKAPAKATAD...................AAAQAAQAAQESYGTKTLT
J7SAV7_KAZNA/1-372MSANILWFTVVSSYIVQTKCFSRILSRQKYSSYNNSDGAD...........................NSDGVSTPIQNLS
A7TJZ2_VANPO/1-355MTVRLYWFTAVMGYVVQTKFLSHVQSLNT......................................NKNNDNSTSDSIT
J7RRP8_KAZNA/1-406MLRRVAWFTAVIGYVIQTKGFSIIQSKKFMDVDPAKESSAKL.........................NGFSNEEMKRCMT
G8ZTN7_TORDC/1-379MDTRIYWFTAVAGYIIQTKCFSYLQTRDKH.....................................DNISDDNVHRGLM
G0WDU7_NAUDC/2-437MKAVALWFTIVLGYVIQTKGFSHIQSKRYPSNVQTPLHSNPNRDSYSNSTSAPTLHGRSNIPNATATTATGEPLNSHTLT
C5DPJ8_ZYGRC/1-375MDTRIYWFVAVFSYIIQTKCLSLLQSSAR......................................DSERPGIDHQGVA
H2AWT3_KAZAF/1-414MSVMYSWFIAVLGYVIQTKCVSLIQSQSFLSSIDGKSI.............................GITSKEQSTGLIT
E7K9R5_YEASA/1-403MSTTLLWFSSVIGYVIQTKCLSNIQSKKEISVGPNGTIATP..........................ETNGDNGNSSSLT
Q6FQN7_CANGA/1-416MSNSLLWFTGVIGYVIQTKCISTIQSRQVVATSASEQDAAGV.........................DTGNTSSGTYILT

PF02537

C6WWF8_METML/11-123--------------------------------------------------------------------------------
CRCB2_STAEQ/5-115--------------------------------------------------------------------------------
C9SP40_VERA1/254-364--------------------------------------------------------------------------------
A8FBH5_BACP2/4-113--------------------------------------------------------------------------------
CRCB2_PROAC/4-117--------------------------------------------------------------------------------
B3QV70_CHLT3/8-120--------------------------------------------------------------------------------
C1D9V8_LARHH/7-119--------------------------------------------------------------------------------
G0VL39_MEGEL/5-118--------------------------------------------------------------------------------
CRCB_METFK/5-119--------------------------------------------------------------------------------
D7C3E0_STRBB/34-146--------------------------------------------------------------------------------
CRCB_AGRT5/5-118--------------------------------------------------------------------------------
M3A446_MYCFI/449-566--------------------------------------------------------------------------------
R5ASY3_9BACT/6-119--------------------------------------------------------------------------------
L0GYQ4_9GAMM/6-118--------------------------------------------------------------------------------
K5WXB2_AGABU/250-360--------------------------------------------------------------------------------
R5M4P7_9BACE/6-118--------------------------------------------------------------------------------
R6IVI8_9PROT/5-112--------------------------------------------------------------------------------
CRCB_OCEIH/5-116--------------------------------------------------------------------------------
CRCB1_LEIXX/7-119--------------------------------------------------------------------------------
D2BDX8_STRRD/29-141--------------------------------------------------------------------------------
F0LQJ5_VIBFN/9-121--------------------------------------------------------------------------------
CRCB2_BACLD/5-113--------------------------------------------------------------------------------
CRCB2_SYMTH/3-115--------------------------------------------------------------------------------
C4KCX0_THASP/7-119--------------------------------------------------------------------------------
R5ETQ3_9BACE/7-118--------------------------------------------------------------------------------
R5XBL0_9CLOT/5-117--------------------------------------------------------------------------------
F8E4Q4_FLESM/4-117--------------------------------------------------------------------------------
R5CLX0_9BACT/6-119--------------------------------------------------------------------------------
CRCB_KORVE/7-117--------------------------------------------------------------------------------
C6X4K7_FLAB3/5-116--------------------------------------------------------------------------------
W6S7T4_9CLOT/5-115--------------------------------------------------------------------------------
CRCB_THET8/5-117--------------------------------------------------------------------------------
CRCB_CHLAA/5-118--------------------------------------------------------------------------------
E6K2D1_PARDN/8-130--------------------------------------------------------------------------------
CRCB_LEGPH/7-120--------------------------------------------------------------------------------
R5EGH4_9GAMM/6-118--------------------------------------------------------------------------------
E9DRD7_METAQ/373-482--------------------------------------------------------------------------------
C4XY25_CLAL4/192-311--------------------------------------------------------------------------------
CRCB2_MYCTU/13-121--------------------------------------------------------------------------------
E8R574_ISOPI/9-121--------------------------------------------------------------------------------
S3DSZ6_GLAL2/346-455--------------------------------------------------------------------------------
R4KGL0_9FIRM/4-114--------------------------------------------------------------------------------
B1MB99_MYCA9/26-141--------------------------------------------------------------------------------
D6XXI5_BACIE/10-121--------------------------------------------------------------------------------
C7M331_ACIFD/13-125--------------------------------------------------------------------------------
D7BPA4_ARCHD/2-113--------------------------------------------------------------------------------
M4RZG3_9SPHN/5-119--------------------------------------------------------------------------------
R6IXJ2_9CLOT/5-113--------------------------------------------------------------------------------
CRCB_SYNY3/9-121--------------------------------------------------------------------------------
B9GUE1_POPTR/148-267--------------------------------------------------------------------------------
G2PRJ4_MURRD/5-117--------------------------------------------------------------------------------
L2G8F8_COLGN/310-420--------------------------------------------------------------------------------
I7HE85_9HELI/6-120--------------------------------------------------------------------------------
A5E776_LODEL/317-433--------------------------------------------------------------------------------
CRCB_NITSB/7-117--------------------------------------------------------------------------------
CRCB1_PROAC/17-131--------------------------------------------------------------------------------
H3ZNJ0_THELN/7-118--------------------------------------------------------------------------------
G2TNF8_BACCO/4-117--------------------------------------------------------------------------------
CRCB_BACFN/5-119--------------------------------------------------------------------------------
CRCB1_METAC/5-116--------------------------------------------------------------------------------
C5D7E4_GEOSW/6-119--------------------------------------------------------------------------------
E4MZN3_KITSK/10-122--------------------------------------------------------------------------------
D3BAW9_POLPA/73-187--------------------------------------------------------------------------------
R5H7M2_9FIRM/6-118--------------------------------------------------------------------------------
CRCB1_BACSK/8-118--------------------------------------------------------------------------------
R5CN17_9BACT/6-120--------------------------------------------------------------------------------
G2QBD4_THIHA/273-388--------------------------------------------------------------------------------
M4YQP3_9EURY/10-117--------------------------------------------------------------------------------
C6XLD7_HIRBI/5-118--------------------------------------------------------------------------------
S0EVW8_CHTCT/9-120--------------------------------------------------------------------------------
CRCB_BORPD/11-121--------------------------------------------------------------------------------
G0L6H9_ZOBGA/5-117--------------------------------------------------------------------------------
F8B1R5_FRADG/37-148--------------------------------------------------------------------------------
CRCB2_DEIGD/5-121--------------------------------------------------------------------------------
CRCB_HYPNA/5-119--------------------------------------------------------------------------------
R6KNV6_9BACE/5-117--------------------------------------------------------------------------------
N0BF30_9EURY/5-116--------------------------------------------------------------------------------
R5CZJ3_9FIRM/5-115--------------------------------------------------------------------------------
CRCB_WOLSU/5-117--------------------------------------------------------------------------------
T0U590_9ENTE/4-110--------------------------------------------------------------------------------
I5AZX8_9DELT/5-119--------------------------------------------------------------------------------
CRCB1_BACSU/5-114--------------------------------------------------------------------------------
L0EDL6_THECK/5-117--------------------------------------------------------------------------------
C8W9R6_ATOPD/5-116--------------------------------------------------------------------------------
CRCB_HYDS0/4-116--------------------------------------------------------------------------------
CRCB1_DEIGD/7-120--------------------------------------------------------------------------------
R5CMS3_9FIRM/5-113--------------------------------------------------------------------------------
A8FBH6_BACP2/5-114--------------------------------------------------------------------------------
CRCB_PSYWF/4-116--------------------------------------------------------------------------------
F5YT39_MYCSD/33-144--------------------------------------------------------------------------------
D2W3G1_NAEGR/379-490--------------------------------------------------------------------------------
W8X514_CASDE/6-118--------------------------------------------------------------------------------
R0K2X2_SETT2/485-602--------------------------------------------------------------------------------
E8UC80_DEIML/3-114--------------------------------------------------------------------------------
CRCB2_LACSS/4-111--------------------------------------------------------------------------------
V4J700_9DELT/5-119--------------------------------------------------------------------------------
CRCB_NOSS1/36-150--------------------------------------------------------------------------------
CRCB_NOVAD/5-119--------------------------------------------------------------------------------
CRCB_PROA2/9-121--------------------------------------------------------------------------------
G0W4L0_NAUDC/237-356--------------------------------------------------------------------------------
M5DRR4_9GAMM/4-117--------------------------------------------------------------------------------
J7QR13_METSZ/4-117--------------------------------------------------------------------------------
C7M7A1_CAPOD/6-119--------------------------------------------------------------------------------
F6BEH8_METIK/5-114--------------------------------------------------------------------------------
J7LE55_NOCAA/58-169--------------------------------------------------------------------------------
K0CCV4_ALCDB/9-121--------------------------------------------------------------------------------
A1A1D2_BIFAA/43-157--------------------------------------------------------------------------------
D3PZ73_STANL/6-117--------------------------------------------------------------------------------
R6QEN7_9FIRM/5-117--------------------------------------------------------------------------------
R7HRQ9_9BACT/6-117--------------------------------------------------------------------------------
D3DI07_HYDTT/5-118--------------------------------------------------------------------------------
M4G634_MAGP6/261-375--------------------------------------------------------------------------------
R6Y3S9_9FIRM/5-114--------------------------------------------------------------------------------
M9RC40_9RHOB/6-116--------------------------------------------------------------------------------
F2KZA6_PREDF/6-120--------------------------------------------------------------------------------
CRCB_CAMHC/6-119--------------------------------------------------------------------------------
H6R9E5_NOCCG/16-128--------------------------------------------------------------------------------
A1VMF2_POLNA/5-116--------------------------------------------------------------------------------
CRCB1_CLOAB/5-118--------------------------------------------------------------------------------
K9Z4N8_CYAAP/12-122--------------------------------------------------------------------------------
B8NQY0_ASPFN/290-411--------------------------------------------------------------------------------
G4ST05_META2/6-120--------------------------------------------------------------------------------
D2S7W2_GEOOG/4-116--------------------------------------------------------------------------------
F2IKB4_FLUTR/4-118--------------------------------------------------------------------------------
CRCB_CAUCR/5-119--------------------------------------------------------------------------------
I2BBA6_SHIBC/6-118--------------------------------------------------------------------------------
R5RJJ6_9FIRM/5-115--------------------------------------------------------------------------------
I7ETE5_PHAIB/6-118--------------------------------------------------------------------------------
H6C454_EXODN/374-484--------------------------------------------------------------------------------
CRCB2_LEIXX/17-131--------------------------------------------------------------------------------
C5AXC1_METEA/6-118--------------------------------------------------------------------------------
CRCB3_BIFLO/7-119--------------------------------------------------------------------------------
K3WL52_PYTUL/283-404--------------------------------------------------------------------------------
C5ACE0_BURGB/6-118--------------------------------------------------------------------------------
CRCB2_YERPE/6-118--------------------------------------------------------------------------------
E0UEC0_CYAP2/11-125--------------------------------------------------------------------------------
A1R8I4_ARTAT/19-132--------------------------------------------------------------------------------
Q035E4_LACC3/13-122--------------------------------------------------------------------------------
V5UCX4_9BURK/6-118--------------------------------------------------------------------------------
CRCB_RHOBA/8-137--------------------------------------------------------------------------------
E1ZCW8_CHLVA/348-466--------------------------------------------------------------------------------
G4T5L1_PIRID/243-353--------------------------------------------------------------------------------
Q5KAE8_CRYNJ/258-374--------------------------------------------------------------------------------
E3GYY7_METFV/11-123--------------------------------------------------------------------------------
G0A435_METMM/5-118--------------------------------------------------------------------------------
B7GAP9_PHATC/378-490--------------------------------------------------------------------------------
U5MTZ5_CLOSA/5-116--------------------------------------------------------------------------------
D5BHQ3_ZUNPS/6-118--------------------------------------------------------------------------------
CRCB_TOLAT/6-118--------------------------------------------------------------------------------
D3VAF1_XENNA/6-117--------------------------------------------------------------------------------
E3Q272_COLGM/355-464--------------------------------------------------------------------------------
U7PUX1_SPOS1/392-505--------------------------------------------------------------------------------
A7TEG1_VANPO/253-372--------------------------------------------------------------------------------
A0KEF5_AERHH/18-131--------------------------------------------------------------------------------
R5D5F3_9FIRM/5-115--------------------------------------------------------------------------------
M9MIG9_PSEA3/340-458--------------------------------------------------------------------------------
A5N506_CLOK5/5-118--------------------------------------------------------------------------------
CRCB1_THEFY/4-112--------------------------------------------------------------------------------
D4H0T5_DENA2/4-117--------------------------------------------------------------------------------
C8XKP0_NAKMY/30-140--------------------------------------------------------------------------------
I4Y5T4_WALSC/195-308--------------------------------------------------------------------------------
C4L2E8_EXISA/4-117--------------------------------------------------------------------------------
R6ANW5_9BACT/1-111--------------------------------------------------------------------------------
B2GKQ2_KOCRD/11-124--------------------------------------------------------------------------------
D5GBZ0_TUBMM/232-341--------------------------------------------------------------------------------
D9SY00_MICAI/31-140--------------------------------------------------------------------------------
J3PZU4_PUCT1/267-383--------------------------------------------------------------------------------
R5X278_9BACT/7-116--------------------------------------------------------------------------------
W5X599_9BACT/8-120--------------------------------------------------------------------------------
H6BKG0_EXODN/235-345--------------------------------------------------------------------------------
Q7SB51_NEUCR/400-510--------------------------------------------------------------------------------
CRCB_NAUPA/7-120--------------------------------------------------------------------------------
R9T8D3_9EURY/6-115--------------------------------------------------------------------------------
A8IAM2_AZOC5/31-149--------------------------------------------------------------------------------
CRCB_THEMA/7-120--------------------------------------------------------------------------------
CRCB_BORPE/10-120--------------------------------------------------------------------------------
M0TIZ7_MUSAM/414-528--------------------------------------------------------------------------------
C5G6P1_AJEDR/432-565--------------------------------------------------------------------------------
CRCB_DICNV/5-117--------------------------------------------------------------------------------
CRCB2_NITHX/4-117--------------------------------------------------------------------------------
M4CKA5_BRARP/127-244--------------------------------------------------------------------------------
CRCB_METJA/6-116--------------------------------------------------------------------------------
C7N638_SLAHD/6-121--------------------------------------------------------------------------------
F8PP72_SERL3/170-280--------------------------------------------------------------------------------
H8GL89_METAL/5-118--------------------------------------------------------------------------------
F7V936_CLOSS/5-115--------------------------------------------------------------------------------
G1WYL7_ARTOA/302-412--------------------------------------------------------------------------------
A9TSK9_PHYPA/17-127--------------------------------------------------------------------------------
R7XRH6_9ACTO/3-115--------------------------------------------------------------------------------
D5AM26_RHOCB/6-117--------------------------------------------------------------------------------
C8W1M9_DESAS/5-115--------------------------------------------------------------------------------
J7S9K9_KAZNA/261-379--------------------------------------------------------------------------------
M4BCV8_HYAAE/316-434--------------------------------------------------------------------------------
H8XUS4_FLAIG/6-119--------------------------------------------------------------------------------
CRCB_LEPIN/8-121--------------------------------------------------------------------------------
D3PBW8_DEFDS/4-117--------------------------------------------------------------------------------
CRCB_MANSM/8-120--------------------------------------------------------------------------------
F2JWF0_MARM1/4-117--------------------------------------------------------------------------------
Q0TWS1_PHANO/407-524--------------------------------------------------------------------------------
CRCB_DESVH/5-118--------------------------------------------------------------------------------
K4IR73_BIFAP/14-126--------------------------------------------------------------------------------
CRCB_MAGSA/5-120--------------------------------------------------------------------------------
D6S5U3_9LACO/8-114--------------------------------------------------------------------------------
A4XUX5_PSEMY/7-120--------------------------------------------------------------------------------
E7KJR4_YEASA/242-361--------------------------------------------------------------------------------
M2NHH3_BAUCO/447-563--------------------------------------------------------------------------------
A1SVE3_PSYIN/9-122--------------------------------------------------------------------------------
CRCB2_BACCR/5-113--------------------------------------------------------------------------------
R7Z6B3_CONA1/475-594--------------------------------------------------------------------------------
I3YSC9_AEQSU/5-117--------------------------------------------------------------------------------
R6XGS9_9BACT/6-118--------------------------------------------------------------------------------
H6LFI8_ACEWD/5-122--------------------------------------------------------------------------------
E8V0J1_TERSS/5-118--------------------------------------------------------------------------------
A0CCJ9_PARTE/7-113--------------------------------------------------------------------------------
E1VK19_9GAMM/6-116--------------------------------------------------------------------------------
A6VLE2_ACTSZ/6-118--------------------------------------------------------------------------------
CRCB2_LISMO/4-114--------------------------------------------------------------------------------
C5ZY55_9HELI/7-132--------------------------------------------------------------------------------
C7NDH5_LEPBD/4-113--------------------------------------------------------------------------------
R6UNI6_9FIRM/5-115--------------------------------------------------------------------------------
CRCB_PSEHT/1-113--------------------------------------------------------------------------------
CRCB_SHEON/5-117--------------------------------------------------------------------------------
R7LGK9_9BACT/6-117--------------------------------------------------------------------------------
CRCB1_SYNPX/9-120--------------------------------------------------------------------------------
E4T0Z0_PALPW/5-118--------------------------------------------------------------------------------
CRCB_CAUSK/5-119--------------------------------------------------------------------------------
CRCB_DESAD/5-118--------------------------------------------------------------------------------
CRCB1_BACLD/5-114--------------------------------------------------------------------------------
CRCB_METMP/5-115--------------------------------------------------------------------------------
R6TCQ5_9BACE/6-117--------------------------------------------------------------------------------
D4Z191_SPHJU/5-120--------------------------------------------------------------------------------
A4FCL9_SACEN/27-138--------------------------------------------------------------------------------
F9YPS8_CAPCC/6-118--------------------------------------------------------------------------------
CRCB_AZOVD/6-119--------------------------------------------------------------------------------
I3YKA1_ALIFI/6-119--------------------------------------------------------------------------------
CRCB_GEOSL/5-118--------------------------------------------------------------------------------
CRCB_HAEIN/5-117--------------------------------------------------------------------------------
CRCB2_GEOKA/4-117--------------------------------------------------------------------------------
CRCB1_FRASC/4-121--------------------------------------------------------------------------------
Q4PD24_USTMA/175-285--------------------------------------------------------------------------------
F0RHR7_CELLC/5-117--------------------------------------------------------------------------------
A0JYB8_ARTS2/13-125--------------------------------------------------------------------------------
B1X047_CYAA5/9-121--------------------------------------------------------------------------------
R7BXD8_9BURK/14-126--------------------------------------------------------------------------------
V5SAX2_9RHIZ/5-118--------------------------------------------------------------------------------
I7A6W3_MELRP/5-117--------------------------------------------------------------------------------
F0XIJ5_GROCL/765-880--------------------------------------------------------------------------------
CRCB_BACTN/6-119--------------------------------------------------------------------------------
Q6BZJ5_DEBHA/257-375--------------------------------------------------------------------------------
D5UMQ9_TSUPD/4-113--------------------------------------------------------------------------------
B9GUE1_POPTR/334-451--------------------------------------------------------------------------------
CRCB_DESAH/6-119--------------------------------------------------------------------------------
B7K4M6_CYAP8/8-119--------------------------------------------------------------------------------
A7HWU1_PARL1/5-118--------------------------------------------------------------------------------
M4CKA5_BRARP/315-431--------------------------------------------------------------------------------
A1WYB7_HALHL/11-123--------------------------------------------------------------------------------
I3VSZ5_THESW/4-117--------------------------------------------------------------------------------
E3H2P9_ROTDC/4-128--------------------------------------------------------------------------------
B9RJ54_RICCO/284-401--------------------------------------------------------------------------------
R5C403_9FIRM/14-124--------------------------------------------------------------------------------
F6XSK1_CIOIN/104-215--------------------------------------------------------------------------------
C1D5Z9_LARHH/7-122--------------------------------------------------------------------------------
C6VYX9_DYAFD/5-118--------------------------------------------------------------------------------
CRCB_GRABC/5-117--------------------------------------------------------------------------------
R5YAN9_9FIRM/5-114--------------------------------------------------------------------------------
F0JEC8_DESDE/6-119--------------------------------------------------------------------------------
Q03TH0_LACBA/6-116--------------------------------------------------------------------------------
U4LGC1_PYROM/193-307--------------------------------------------------------------------------------
CRCB2_DESHY/6-111--------------------------------------------------------------------------------
F2F590_SOLSS/4-117--------------------------------------------------------------------------------
G2NNA3_9ACTO/46-157--------------------------------------------------------------------------------
F2IUX1_POLGS/5-118--------------------------------------------------------------------------------
R7BR51_9ACTN/32-142--------------------------------------------------------------------------------
CRCB_SERP5/6-118--------------------------------------------------------------------------------
S3CUB1_OPHP1/412-521--------------------------------------------------------------------------------
G0S6M1_CHATD/360-471--------------------------------------------------------------------------------
H6MYC3_GORPV/37-152--------------------------------------------------------------------------------
R7JBS3_9FUSO/5-118--------------------------------------------------------------------------------
CRCB_SYNJB/10-123--------------------------------------------------------------------------------
R5K2R2_9CLOT/5-115--------------------------------------------------------------------------------
CRCB_RALPJ/7-119--------------------------------------------------------------------------------
Q6CGB9_YARLI/188-302--------------------------------------------------------------------------------
CRCB2_PROMT/5-119--------------------------------------------------------------------------------
R7IYR4_9BACT/5-114--------------------------------------------------------------------------------
R5NYS9_9BACT/6-119--------------------------------------------------------------------------------
F6B6F1_DESCC/4-117--------------------------------------------------------------------------------
A4Z186_BRASO/14-127--------------------------------------------------------------------------------
R5Z2Y5_9FIRM/4-112--------------------------------------------------------------------------------
D1C4M3_SPHTD/5-118--------------------------------------------------------------------------------
R6VF31_9BACT/2-114--------------------------------------------------------------------------------
CRCB_HELPY/6-120--------------------------------------------------------------------------------
B0JNB3_MICAN/10-125--------------------------------------------------------------------------------
CRCB_SULDN/7-120--------------------------------------------------------------------------------
G8C0E3_TETPH/229-348--------------------------------------------------------------------------------
CRCB_SORC5/5-118--------------------------------------------------------------------------------
F0SNW9_PLABD/6-119--------------------------------------------------------------------------------
W6EHN9_SULMU/6-118--------------------------------------------------------------------------------
CRCB_METKA/10-120--------------------------------------------------------------------------------
CRCB_METRJ/7-121--------------------------------------------------------------------------------
CRCB_PHEZH/5-119--------------------------------------------------------------------------------
Q03UF6_LEUMM/14-122--------------------------------------------------------------------------------
W0AKR0_9SPHN/1-111--------------------------------------------------------------------------------
N1PYF2_MYCP1/240-357--------------------------------------------------------------------------------
CRCB1_STAEQ/4-114--------------------------------------------------------------------------------
B9L2H7_THERP/8-117--------------------------------------------------------------------------------
R5GLL4_9BACT/6-118--------------------------------------------------------------------------------
A0LYN3_GRAFK/7-118--------------------------------------------------------------------------------
F8KQZ6_HELBC/6-120--------------------------------------------------------------------------------
CRCB_PARD8/5-117--------------------------------------------------------------------------------
B2FK58_STRMK/8-122--------------------------------------------------------------------------------
D3SG20_THISK/10-124--------------------------------------------------------------------------------
D6ZE48_SEGRD/18-132--------------------------------------------------------------------------------
CRCB_PROMH/6-118--------------------------------------------------------------------------------
R6TF31_9FIRM/4-113--------------------------------------------------------------------------------
Q4PD24_USTMA/376-495--------------------------------------------------------------------------------
G7UWM0_PSEUP/11-124--------------------------------------------------------------------------------
C5WRE9_SORBI/367-479--------------------------------------------------------------------------------
E6TV03_BACCJ/9-118--------------------------------------------------------------------------------
D1BPN5_VEIPT/5-117--------------------------------------------------------------------------------
R5HK91_9SPIR/5-118--------------------------------------------------------------------------------
R5QQ50_9PROT/5-112--------------------------------------------------------------------------------
B8DVC3_BIFA0/101-223--------------------------------------------------------------------------------
G3JA95_CORMM/291-403--------------------------------------------------------------------------------
CRCB_CHRVO/6-118--------------------------------------------------------------------------------
CRCB_ALTMD/9-121--------------------------------------------------------------------------------
Q4CXK7_TRYCC/54-164--------------------------------------------------------------------------------
K7SGS5_PROA4/6-121--------------------------------------------------------------------------------
CRCB_ACIAC/6-117--------------------------------------------------------------------------------
CRCB_DECAR/13-125--------------------------------------------------------------------------------
C8WQX7_ALIAD/8-117--------------------------------------------------------------------------------
CRCB2_CORJK/8-136--------------------------------------------------------------------------------
R5QM20_9PROT/7-116--------------------------------------------------------------------------------
CRCB_SULNB/7-118--------------------------------------------------------------------------------
CRCB_SALTY/6-118--------------------------------------------------------------------------------
D7CY59_TRURR/21-133--------------------------------------------------------------------------------
CRCB2_CLOAB/4-111--------------------------------------------------------------------------------
K4IHE3_PSYTT/5-119--------------------------------------------------------------------------------
I1XG94_METNJ/5-118--------------------------------------------------------------------------------
R6I131_9PROT/4-111--------------------------------------------------------------------------------
CRCB_ERWT9/6-118--------------------------------------------------------------------------------
G8Y8E2_PICSO/247-364--------------------------------------------------------------------------------
CRCB2_MYCPA/8-116--------------------------------------------------------------------------------
C7LR69_DESBD/5-118--------------------------------------------------------------------------------
CRCB_RENSM/4-122--------------------------------------------------------------------------------
Q6CW46_KLULA/204-319--------------------------------------------------------------------------------
CRCB_MARAV/6-118--------------------------------------------------------------------------------
U5RPB7_9CLOT/5-117--------------------------------------------------------------------------------
W0E9P6_9FIRM/5-118--------------------------------------------------------------------------------
CRCB_SHEAM/5-117--------------------------------------------------------------------------------
CRCB_GEOBB/5-118--------------------------------------------------------------------------------
CRCB_NITWN/7-120--------------------------------------------------------------------------------
H6L1N4_SAPGL/4-114--------------------------------------------------------------------------------
A9TPH4_PHYPA/207-329--------------------------------------------------------------------------------
F4GUT6_PUSST/1-113--------------------------------------------------------------------------------
W0I074_9ENTR/7-118--------------------------------------------------------------------------------
D8RW03_SELML/170-287--------------------------------------------------------------------------------
V6K2X1_STRNV/39-151--------------------------------------------------------------------------------
CRCB_AGRVS/5-118--------------------------------------------------------------------------------
CRCB_META3/5-115--------------------------------------------------------------------------------
CRCB_PELPD/5-118--------------------------------------------------------------------------------
D7G2L8_ECTSI/252-367--------------------------------------------------------------------------------
U5NEL7_9BURK/2-114--------------------------------------------------------------------------------
CRCB_SACD2/14-125--------------------------------------------------------------------------------
S6BZ64_9GAMM/5-118--------------------------------------------------------------------------------
F9FY81_FUSOF/343-451--------------------------------------------------------------------------------
V5FBU9_BYSSN/386-500--------------------------------------------------------------------------------
M9X2S7_PASHA/5-112--------------------------------------------------------------------------------
I0JQ72_HALH3/11-117--------------------------------------------------------------------------------
E3HV70_ACHXA/13-123--------------------------------------------------------------------------------
R6PJ06_9CLOT/5-118--------------------------------------------------------------------------------
D2NQE6_ROTMD/5-129--------------------------------------------------------------------------------
CRCB_BURPS/6-118--------------------------------------------------------------------------------
CRCB_DEHM1/5-118--------------------------------------------------------------------------------
K9WKI7_9CYAN/34-148--------------------------------------------------------------------------------
E8RCU5_DESPD/6-118--------------------------------------------------------------------------------
CRCB_CYAP7/5-117--------------------------------------------------------------------------------
CRCB2_RUBXD/28-141--------------------------------------------------------------------------------
L0F682_DESDL/4-117--------------------------------------------------------------------------------
CRCB_PYRFU/7-118--------------------------------------------------------------------------------
E0S341_BUTPB/4-113--------------------------------------------------------------------------------
J9VXS3_LACBU/5-112--------------------------------------------------------------------------------
R5P3S6_9PORP/6-119--------------------------------------------------------------------------------
C5BIK3_TERTT/5-117--------------------------------------------------------------------------------
K7APB2_9ALTE/8-121--------------------------------------------------------------------------------
G7V718_THELD/10-123--------------------------------------------------------------------------------
E6W8T7_PANSA/6-118--------------------------------------------------------------------------------
G9P0K0_HYPAI/346-453--------------------------------------------------------------------------------
CRCB1_MOOTA/4-117--------------------------------------------------------------------------------
G8MBQ1_9BURK/6-118--------------------------------------------------------------------------------
R5JNY8_9BACE/5-119--------------------------------------------------------------------------------
F7QJT5_9BRAD/7-119--------------------------------------------------------------------------------
F8L5Q8_SIMNZ/6-120--------------------------------------------------------------------------------
B0TB34_HELMI/4-118--------------------------------------------------------------------------------
V5X8U7_MYCNE/35-150--------------------------------------------------------------------------------
R5IPR5_9PORP/5-118--------------------------------------------------------------------------------
E1VBH3_HALED/8-122--------------------------------------------------------------------------------
R7FEZ1_9FIRM/7-115--------------------------------------------------------------------------------
H5WWL3_9PSEU/11-123--------------------------------------------------------------------------------
A9H9I7_GLUDA/8-122--------------------------------------------------------------------------------
C7RB99_KANKD/7-119--------------------------------------------------------------------------------
A5DNP2_PICGU/290-406--------------------------------------------------------------------------------
W0RHG9_9BACT/5-116--------------------------------------------------------------------------------
U9UIL3_RHIID/251-359--------------------------------------------------------------------------------
CRCB2_CARHZ/4-114--------------------------------------------------------------------------------
J7U6G5_MORMO/5-117--------------------------------------------------------------------------------
CRCB_THICR/10-123--------------------------------------------------------------------------------
G9WG75_9LACT/6-114--------------------------------------------------------------------------------
R5QDH0_9BURK/7-120--------------------------------------------------------------------------------
R4K5H3_CLOPA/5-117--------------------------------------------------------------------------------
F9CZJ4_PREDD/6-119--------------------------------------------------------------------------------
Q12CN6_POLSJ/5-116--------------------------------------------------------------------------------
A1C7V8_ASPCL/303-428--------------------------------------------------------------------------------
CRCB2_LACAC/4-118--------------------------------------------------------------------------------
E0SET2_DICD3/6-118--------------------------------------------------------------------------------
E1QJH8_DESB2/6-119--------------------------------------------------------------------------------
R5Q419_9BACT/6-119--------------------------------------------------------------------------------
D6Y471_THEBD/35-145--------------------------------------------------------------------------------
F5XQW7_MICPN/39-152--------------------------------------------------------------------------------
Q6C7Z3_YARLI/216-332--------------------------------------------------------------------------------
CRCB_GEODF/5-118--------------------------------------------------------------------------------
D3BK38_POLPA/37-151--------------------------------------------------------------------------------
A1AV95_RUTMC/8-121--------------------------------------------------------------------------------
G8QMX7_AZOSU/7-119--------------------------------------------------------------------------------
I3YBU9_THIV6/7-119--------------------------------------------------------------------------------
B7FNU9_PHATC/760-870--------------------------------------------------------------------------------
C4R3B5_PICPG/194-305--------------------------------------------------------------------------------
E4TJQ8_CALNY/4-117--------------------------------------------------------------------------------
D3HM17_LEGLN/5-118--------------------------------------------------------------------------------
I1S625_GIBZE/360-470--------------------------------------------------------------------------------
A8AY05_STRGC/8-119--------------------------------------------------------------------------------
D3PMB8_MEIRD/5-117--------------------------------------------------------------------------------
E2SCN0_9ACTO/12-118--------------------------------------------------------------------------------
E4ZZ91_LEPMJ/466-583--------------------------------------------------------------------------------
A4G6Z5_HERAR/11-123--------------------------------------------------------------------------------
F6EJF8_AMYSD/4-116--------------------------------------------------------------------------------
G8SCM3_ACTS5/11-119--------------------------------------------------------------------------------
R5K2C1_9CLOT/5-115--------------------------------------------------------------------------------
J6EMU8_SACK1/217-335--------------------------------------------------------------------------------
L0IVY4_MYCSM/10-121--------------------------------------------------------------------------------
V9XIT4_9NOCA/24-139--------------------------------------------------------------------------------
CRCB_SULSY/5-118--------------------------------------------------------------------------------
D7BCB6_MEISD/13-125--------------------------------------------------------------------------------
R6WPF5_9PORP/5-117--------------------------------------------------------------------------------
Q0ANT1_MARMM/25-139--------------------------------------------------------------------------------
E3I3A3_RHOVT/7-122--------------------------------------------------------------------------------
R6HCB3_9ACTN/26-135--------------------------------------------------------------------------------
E7A8W5_HELFC/6-120--------------------------------------------------------------------------------
E4RXK0_LEAB4/5-113--------------------------------------------------------------------------------
A0QUA4_MYCS2/7-115--------------------------------------------------------------------------------
F4H414_CELFA/11-125--------------------------------------------------------------------------------
E8SJC6_STAPH/4-113--------------------------------------------------------------------------------
G7DUV6_MIXOS/246-354--------------------------------------------------------------------------------
G8BJM3_CANPC/268-385--------------------------------------------------------------------------------
K4KIN2_SIMAS/4-116--------------------------------------------------------------------------------
CRCB_RHILO/5-117--------------------------------------------------------------------------------
E6W087_DESIS/5-118--------------------------------------------------------------------------------
S7ZVM7_PENO1/345-461--------------------------------------------------------------------------------
R7DGN2_9PORP/5-117--------------------------------------------------------------------------------
CRCB1_BACHD/4-121--------------------------------------------------------------------------------
CRCB_PHOPR/9-121--------------------------------------------------------------------------------
D0MU45_PHYIT/2-120--------------------------------------------------------------------------------
U5VT02_9ACTO/11-119--------------------------------------------------------------------------------
CRCB_PSEAE/6-118--------------------------------------------------------------------------------
D0LRD6_HALO1/5-121--------------------------------------------------------------------------------
CRCB2_THEFY/7-117--------------------------------------------------------------------------------
W5TSX0_9NOCA/40-152--------------------------------------------------------------------------------
C1H7A3_PARBA/424-557--------------------------------------------------------------------------------
I0AFH5_IGNAJ/6-119--------------------------------------------------------------------------------
CRCB_ERYLH/11-129--------------------------------------------------------------------------------
E3E6H7_PAEPS/5-117--------------------------------------------------------------------------------
CRCB_NITMU/7-119--------------------------------------------------------------------------------
CRCB_COLP3/12-125--------------------------------------------------------------------------------
E4N1S6_KITSK/33-146--------------------------------------------------------------------------------
L0DZW0_THIND/6-121--------------------------------------------------------------------------------
CRCB1_STRAW/4-116--------------------------------------------------------------------------------
CRCB_PASMU/9-121--------------------------------------------------------------------------------
D7B6X0_NOCDD/20-130--------------------------------------------------------------------------------
CRCB_PELCD/4-117--------------------------------------------------------------------------------
CRCB_SOLUE/4-117--------------------------------------------------------------------------------
X2GU24_9BACI/5-112--------------------------------------------------------------------------------
CRCB_RUEPO/9-115--------------------------------------------------------------------------------
CRCB_CHRSD/6-118--------------------------------------------------------------------------------
D7DIK5_METV0/7-119--------------------------------------------------------------------------------
R6B5L2_9BACT/5-119--------------------------------------------------------------------------------
S5Y388_PARAH/6-116--------------------------------------------------------------------------------
CRCB_ACIF2/7-119--------------------------------------------------------------------------------
CRCB1_NOCFA/26-133--------------------------------------------------------------------------------
CRCB_CLOCE/8-120--------------------------------------------------------------------------------
I3WFR8_BIFBI/109-231--------------------------------------------------------------------------------
A4XHA7_CALS8/5-114--------------------------------------------------------------------------------
G9AP47_PANAN/7-119--------------------------------------------------------------------------------
K9P356_CYAGP/20-131--------------------------------------------------------------------------------
B6Q2S5_PENMQ/335-486--------------------------------------------------------------------------------
D6ZH23_MOBCV/4-144--------------------------------------------------------------------------------
G2RBC5_THITE/375-493--------------------------------------------------------------------------------
F2NE00_DESAR/47-161--------------------------------------------------------------------------------
CRCB_CAMFF/7-120--------------------------------------------------------------------------------
N4VR51_COLOR/350-459--------------------------------------------------------------------------------
CRCB_SALRD/5-117--------------------------------------------------------------------------------
D0MH17_RHOM4/4-116--------------------------------------------------------------------------------
F7AZ18_CIOIN/241-364--------------------------------------------------------------------------------
F6FW41_ISOV2/17-131--------------------------------------------------------------------------------
Q0AAG5_ALKEH/8-117--------------------------------------------------------------------------------
CRCB_NITMS/7-116--------------------------------------------------------------------------------
R5KYM1_9BACT/6-120--------------------------------------------------------------------------------
G3XXW1_ASPNA/251-368--------------------------------------------------------------------------------
E1VUY2_ARTAR/24-138--------------------------------------------------------------------------------
D5X1S9_THIK1/4-117--------------------------------------------------------------------------------
CRCB_DESAG/5-118--------------------------------------------------------------------------------
F0NZN4_WEEVC/5-117--------------------------------------------------------------------------------
S0EFS8_GIBF5/358-468--------------------------------------------------------------------------------
H6RV33_BLASD/4-116--------------------------------------------------------------------------------
R7AIG3_9ACTN/32-142--------------------------------------------------------------------------------
H8H3E6_DEIGI/5-121--------------------------------------------------------------------------------
D7G2L8_ECTSI/73-183--------------------------------------------------------------------------------
E6SCS6_INTC7/42-153--------------------------------------------------------------------------------
E6SN01_BACT6/6-118--------------------------------------------------------------------------------
CRCB1_MYCTU/10-120--------------------------------------------------------------------------------
CRCB_ALBFT/8-119--------------------------------------------------------------------------------
A6M382_CLOB8/25-136--------------------------------------------------------------------------------
V4IP94_9ACTO/68-178--------------------------------------------------------------------------------
D1B173_SULD5/6-118--------------------------------------------------------------------------------
M1FMG3_9ALTE/6-118--------------------------------------------------------------------------------
R9NVS0_PSEHS/377-496--------------------------------------------------------------------------------
R9AAS0_WALI9/209-320--------------------------------------------------------------------------------
D3F1Y3_CONWI/11-121--------------------------------------------------------------------------------
R5AYW3_9BACE/2-115--------------------------------------------------------------------------------
F4RMR0_MELLP/249-363--------------------------------------------------------------------------------
CRCB_ROSS1/4-117--------------------------------------------------------------------------------
A0ZZG7_BIFAA/96-213--------------------------------------------------------------------------------
CRCB1_CORJK/11-135--------------------------------------------------------------------------------
F0R1M5_BACSH/6-118--------------------------------------------------------------------------------
Q04FV7_OENOB/4-114--------------------------------------------------------------------------------
B5GT34_STRC2/54-181--------------------------------------------------------------------------------
Q0RJG1_FRAAA/1-111--------------------------------------------------------------------------------
C0ZES3_BREBN/4-114--------------------------------------------------------------------------------
C1D600_LARHH/6-118--------------------------------------------------------------------------------
G3BBM5_CANTC/177-292--------------------------------------------------------------------------------
K0IK43_NITGG/42-151--------------------------------------------------------------------------------
I0I7C2_CALAS/5-118--------------------------------------------------------------------------------
CRCB_ROSDO/5-118--------------------------------------------------------------------------------
R7CT11_9FIRM/8-120--------------------------------------------------------------------------------
CRCB3_STRAW/64-176--------------------------------------------------------------------------------
Q4Q5Z9_LEIMA/274-382--------------------------------------------------------------------------------
A2U3U0_9FLAO/5-117--------------------------------------------------------------------------------
C3KN78_RHISN/4-117--------------------------------------------------------------------------------
B1VR67_STRGG/24-136--------------------------------------------------------------------------------
Q0VQ07_ALCBS/15-127--------------------------------------------------------------------------------
G2T1C4_ROSHA/5-114--------------------------------------------------------------------------------
F8K2W7_STREN/41-152--------------------------------------------------------------------------------
CRCB_CYTH3/5-117--------------------------------------------------------------------------------
F6H0U1_VITVI/394-506--------------------------------------------------------------------------------
R6E8F9_9BACT/1-112--------------------------------------------------------------------------------
F5YHC5_TREPZ/11-123--------------------------------------------------------------------------------
R6D677_9FIRM/7-118--------------------------------------------------------------------------------
G2IKM0_9SPHN/5-119--------------------------------------------------------------------------------
D2RLY9_ACIFV/11-122--------------------------------------------------------------------------------
K3WL52_PYTUL/44-163--------------------------------------------------------------------------------
R5D2F8_9FIRM/6-118--------------------------------------------------------------------------------
N1JR95_BLUG1/279-388--------------------------------------------------------------------------------
G2I655_GLUMN/9-123--------------------------------------------------------------------------------
E6X1Y5_NITSE/7-118--------------------------------------------------------------------------------
W0DRI4_9GAMM/7-120--------------------------------------------------------------------------------
D3IC67_9BACT/7-120--------------------------------------------------------------------------------
C5MFT6_CANTT/258-376--------------------------------------------------------------------------------
B8FMC9_DESAA/9-122--------------------------------------------------------------------------------
R6APN1_9FIRM/8-120--------------------------------------------------------------------------------
CRCB_RHIME/5-118--------------------------------------------------------------------------------
B5H5Q4_STRPR/39-152--------------------------------------------------------------------------------
CRCB2_PROMA/12-124--------------------------------------------------------------------------------
A2F7Z4_TRIVA/4-116--------------------------------------------------------------------------------
CRCB_ACIAD/6-117--------------------------------------------------------------------------------
R6EUL5_9FIRM/6-118--------------------------------------------------------------------------------
CRCB_RHOCS/5-118--------------------------------------------------------------------------------
F4P7Z1_BATDJ/25-134--------------------------------------------------------------------------------
X2H985_9GAMM/6-117--------------------------------------------------------------------------------
CRCB_RALME/7-119--------------------------------------------------------------------------------
A6TJ57_KLEP7/5-117--------------------------------------------------------------------------------
E4U4J6_OCEP5/5-117--------------------------------------------------------------------------------
H2IXD1_RAHAC/6-118--------------------------------------------------------------------------------
R6VEX1_9BACT/6-115--------------------------------------------------------------------------------
CRCB1_GEOKA/5-112--------------------------------------------------------------------------------
CRCB_NITEU/6-118--------------------------------------------------------------------------------
A7HKE3_FERNB/5-118--------------------------------------------------------------------------------
I0IE85_PHYMF/13-128--------------------------------------------------------------------------------
A6H5U3_STRAW/6-118--------------------------------------------------------------------------------
D7A8E4_STAND/9-124--------------------------------------------------------------------------------
CRCB1_STRCO/30-141--------------------------------------------------------------------------------
B9DN27_STACT/4-113--------------------------------------------------------------------------------
CRCB_BURP8/6-118--------------------------------------------------------------------------------
I1YK49_METFJ/5-118--------------------------------------------------------------------------------
CRCB1_BIFLO/3-122--------------------------------------------------------------------------------
X2HAQ4_9NEIS/6-118--------------------------------------------------------------------------------
L8FMT9_PSED2/399-516--------------------------------------------------------------------------------
F2U1Y9_SALR5/330-450--------------------------------------------------------------------------------
CRCB_SHEPW/5-117--------------------------------------------------------------------------------
D9QGP8_BRESC/17-132--------------------------------------------------------------------------------
CRCB_ELUMP/8-118--------------------------------------------------------------------------------
CRCB_THEM4/4-117--------------------------------------------------------------------------------
R5T1S9_9GAMM/6-119--------------------------------------------------------------------------------
M2U1Z2_COCH5/244-361--------------------------------------------------------------------------------
A5GQ38_SYNR3/15-133--------------------------------------------------------------------------------
X5DQX6_9CORY/15-131--------------------------------------------------------------------------------
K9T9L8_9CYAN/31-143--------------------------------------------------------------------------------
W0E4F2_MARPU/5-118--------------------------------------------------------------------------------
CRCB2_RHOPB/9-124--------------------------------------------------------------------------------
B8GLE5_THISH/5-118--------------------------------------------------------------------------------
CRCB_AROAE/11-123--------------------------------------------------------------------------------
G4N5E6_MAGO7/229-342--------------------------------------------------------------------------------
F8F4D4_TRECH/4-116--------------------------------------------------------------------------------
D5UGH6_CELFN/27-139--------------------------------------------------------------------------------
A1T6G9_MYCVP/9-121--------------------------------------------------------------------------------
A3U8B6_CROAH/5-117--------------------------------------------------------------------------------
Q03FL7_PEDPA/4-114--------------------------------------------------------------------------------
E1RIE7_METP4/5-116--------------------------------------------------------------------------------
F5YDX2_TREAZ/4-114--------------------------------------------------------------------------------
G2YQJ8_BOTF4/435-544--------------------------------------------------------------------------------
YI7B_SCHPO/189-297--------------------------------------------------------------------------------
D8PPZ6_SCHCM/244-354--------------------------------------------------------------------------------
CRCB_GLUOX/7-122--------------------------------------------------------------------------------
D5XBR0_THEPJ/4-117--------------------------------------------------------------------------------
W5W322_9PSEU/18-129--------------------------------------------------------------------------------
G4R8S3_PELHB/9-124--------------------------------------------------------------------------------
B7GIC9_ANOFW/6-113--------------------------------------------------------------------------------
CRCB_FRATT/6-122--------------------------------------------------------------------------------
M3J430_CANMX/264-381--------------------------------------------------------------------------------
R6NNH2_9FIRM/5-116--------------------------------------------------------------------------------
G8AKN8_AZOBR/9-122--------------------------------------------------------------------------------
A8LA02_FRASN/57-168--------------------------------------------------------------------------------
C5BXB4_BEUC1/18-135--------------------------------------------------------------------------------
CRCB_DESMR/7-119--------------------------------------------------------------------------------
I2H781_TETBL/282-401--------------------------------------------------------------------------------
K0NIU2_DESTT/5-119--------------------------------------------------------------------------------
C1A5H5_GEMAT/11-122--------------------------------------------------------------------------------
B8CZY9_HALOH/4-116--------------------------------------------------------------------------------
CRCB_PSEU5/6-119--------------------------------------------------------------------------------
C9YX49_STRSW/32-143--------------------------------------------------------------------------------
A7HGD5_ANADF/17-129--------------------------------------------------------------------------------
E8N037_ANATU/5-118--------------------------------------------------------------------------------
K4D6B6_SOLLC/136-253--------------------------------------------------------------------------------
K4LHK9_THEPS/5-118--------------------------------------------------------------------------------
CRCB1_CARHZ/5-113--------------------------------------------------------------------------------
E6SH98_THEM7/4-115--------------------------------------------------------------------------------
H8L558_FRAAD/8-120--------------------------------------------------------------------------------
A2EQG0_TRIVA/6-118--------------------------------------------------------------------------------
CRCB_DESDA/6-118--------------------------------------------------------------------------------
I4AMY3_FLELS/9-122--------------------------------------------------------------------------------
C9RIR9_FIBSS/4-115--------------------------------------------------------------------------------
W8S598_9RHOB/6-118--------------------------------------------------------------------------------
E3D7A9_GARV3/26-149--------------------------------------------------------------------------------
E3GGU4_EUBLK/5-118--------------------------------------------------------------------------------
B4SGW3_PELPB/8-120--------------------------------------------------------------------------------
E3RZP5_PYRTT/436-553--------------------------------------------------------------------------------
CRCB_ACIC5/4-117--------------------------------------------------------------------------------
CRCB_HISS2/8-120--------------------------------------------------------------------------------
CRCB_BEII9/5-120--------------------------------------------------------------------------------
CRCB1_LISMO/6-114--------------------------------------------------------------------------------
A5FV99_ACICJ/74-187--------------------------------------------------------------------------------
D5MLU2_9BACT/5-118--------------------------------------------------------------------------------
CRCB_CHLCH/9-121--------------------------------------------------------------------------------
M4RA76_9BIFI/210-326--------------------------------------------------------------------------------
D9S1E5_THEOJ/4-115--------------------------------------------------------------------------------
D3SME5_THEAH/5-118--------------------------------------------------------------------------------
K0C6N2_CYCSP/5-118--------------------------------------------------------------------------------
D5WTI1_KYRT2/4-114--------------------------------------------------------------------------------
R6EJN5_9FIRM/5-117--------------------------------------------------------------------------------
R9PA85_PSEHS/337-456--------------------------------------------------------------------------------
I1JZ91_SOYBN/281-398--------------------------------------------------------------------------------
H5WIB8_9BURK/11-121--------------------------------------------------------------------------------
R5FYM5_9ACTN/6-119--------------------------------------------------------------------------------
D0KZJ2_HALNC/5-117--------------------------------------------------------------------------------
CRCB_CAMJE/6-118--------------------------------------------------------------------------------
B0RF14_CLAMS/46-159--------------------------------------------------------------------------------
CRCB_FLAPJ/5-118--------------------------------------------------------------------------------
S9W181_SCHCR/189-297--------------------------------------------------------------------------------
E6XA34_CELAD/5-117--------------------------------------------------------------------------------
A6W0D0_MARMS/4-117--------------------------------------------------------------------------------
R4SNZ1_AMYOR/16-128--------------------------------------------------------------------------------
E8T378_THEA1/4-115--------------------------------------------------------------------------------
N0AXP0_9BACI/7-117--------------------------------------------------------------------------------
CRCB1_BRADU/17-130--------------------------------------------------------------------------------
F4FEU5_VERMA/34-146--------------------------------------------------------------------------------
CRCB1_STAA8/4-114--------------------------------------------------------------------------------
A1SKX4_NOCSJ/30-141--------------------------------------------------------------------------------
L0IFM0_HALRX/14-128--------------------------------------------------------------------------------
CRCB_XYLFA/11-124--------------------------------------------------------------------------------
D5CDU7_ENTCC/6-117--------------------------------------------------------------------------------
F6DSF1_DESRL/5-118--------------------------------------------------------------------------------
D2QFU6_SPILD/5-118--------------------------------------------------------------------------------
G9AUR5_PANAN/6-118--------------------------------------------------------------------------------
G8PD75_PEDCP/8-119--------------------------------------------------------------------------------
R7CG99_9FIRM/5-115--------------------------------------------------------------------------------
CRCB2_LACPL/5-115--------------------------------------------------------------------------------
CRCB_PARDP/6-116--------------------------------------------------------------------------------
E8RTG2_ASTEC/5-118--------------------------------------------------------------------------------
I4D723_DESAJ/4-117--------------------------------------------------------------------------------
C5CFG1_KOSOT/5-118--------------------------------------------------------------------------------
F6XSK1_CIOIN/279-394--------------------------------------------------------------------------------
F6ACC1_PSEF1/6-119--------------------------------------------------------------------------------
Q6FVY7_CANGA/246-367--------------------------------------------------------------------------------
D8MNN0_ERWBE/6-118--------------------------------------------------------------------------------
Q15T15_PSEA6/9-122--------------------------------------------------------------------------------
A7IPP1_XANP2/9-124--------------------------------------------------------------------------------
C7R2V9_JONDD/19-134--------------------------------------------------------------------------------
A4J4K8_DESRM/4-117--------------------------------------------------------------------------------
R4X8S9_TAPDE/91-203--------------------------------------------------------------------------------
CRCB_IDILO/9-121--------------------------------------------------------------------------------
CRCB1_RUBXD/8-116--------------------------------------------------------------------------------
CRCB_METCA/6-119--------------------------------------------------------------------------------
F0S0U4_DESTD/4-115--------------------------------------------------------------------------------
L0A1W9_DEIPD/61-173--------------------------------------------------------------------------------
CRCB_PHOLL/6-118--------------------------------------------------------------------------------
K7WB35_9NOST/12-125--------------------------------------------------------------------------------
I3TNV4_TISMK/10-123--------------------------------------------------------------------------------
F2NRH7_TRES6/6-121--------------------------------------------------------------------------------
D5BVT3_NITHN/6-119--------------------------------------------------------------------------------
E9D1L5_COCPS/348-470--------------------------------------------------------------------------------
CRCB2_BACSK/2-110--------------------------------------------------------------------------------
I0GV10_SELRL/4-121--------------------------------------------------------------------------------
S2IXM6_MUCC1/204-312--------------------------------------------------------------------------------
U5LDB8_9BACI/4-115--------------------------------------------------------------------------------
C8WG84_EGGLE/5-115--------------------------------------------------------------------------------
G3AVR1_SPAPN/277-394--------------------------------------------------------------------------------
B8HU37_CYAP4/31-143--------------------------------------------------------------------------------
X5E2L7_9BACT/6-119--------------------------------------------------------------------------------
R6LKJ6_9BACE/21-133--------------------------------------------------------------------------------
R7JLB7_9BACT/6-115--------------------------------------------------------------------------------
F2NPK9_MARHT/5-117--------------------------------------------------------------------------------
CRCB_CHLPD/10-122--------------------------------------------------------------------------------
F8ABD8_THEID/5-117--------------------------------------------------------------------------------
CRCB2_LACJO/5-113--------------------------------------------------------------------------------
F8K2W6_STREN/4-116--------------------------------------------------------------------------------
C5DYN9_ZYGRC/228-347--------------------------------------------------------------------------------
R7JF48_9PORP/6-119--------------------------------------------------------------------------------
X5DYC8_9CORY/11-119--------------------------------------------------------------------------------
R7MJ60_9CLOT/5-117--------------------------------------------------------------------------------
M4ZXF6_9ACTN/1-113--------------------------------------------------------------------------------
D1A9J9_THECD/28-139--------------------------------------------------------------------------------
CRCB_RHORT/4-119--------------------------------------------------------------------------------
CRCB2_LACDA/3-113--------------------------------------------------------------------------------
R6G5P7_9BACE/6-118--------------------------------------------------------------------------------
CRCB_PELLD/10-122--------------------------------------------------------------------------------
F8I0K6_WEIKK/6-117--------------------------------------------------------------------------------
H6NR20_9BACL/4-115--------------------------------------------------------------------------------
L0DY20_THIND/10-124--------------------------------------------------------------------------------
CRCB_CHESB/5-118--------------------------------------------------------------------------------
CRCB_ANADE/5-117--------------------------------------------------------------------------------
E6ZYC1_SPORE/379-498--------------------------------------------------------------------------------
I1C7K4_RHIO9/197-308--------------------------------------------------------------------------------
R4LFU7_9ACTO/4-112--------------------------------------------------------------------------------
N1PE79_MYCP1/225-335--------------------------------------------------------------------------------
D5BQE3_PUNMI/13-127--------------------------------------------------------------------------------
R5UDY9_9BACE/6-118--------------------------------------------------------------------------------
R9TBU9_9EURY/9-124--------------------------------------------------------------------------------
A1WKD0_VEREI/32-143--------------------------------------------------------------------------------
F4KLE8_PORAD/6-115--------------------------------------------------------------------------------
A3M0N0_PICST/269-386--------------------------------------------------------------------------------
CRCB2_PROMP/7-115--------------------------------------------------------------------------------
M0TIZ7_MUSAM/229-344--------------------------------------------------------------------------------
F8A718_CELGA/20-133--------------------------------------------------------------------------------
CRCB_GEOMG/5-118--------------------------------------------------------------------------------
G2LF15_CHLTF/8-120--------------------------------------------------------------------------------
U5H7I1_USTV1/61-177--------------------------------------------------------------------------------
A8NXR3_COPC7/281-391--------------------------------------------------------------------------------
G4Q410_ACIIR/3-115--------------------------------------------------------------------------------
M1VWN1_CLAP2/314-424--------------------------------------------------------------------------------
C5BH47_EDWI9/8-121--------------------------------------------------------------------------------
CRCB_SPHAL/5-118--------------------------------------------------------------------------------
CRCB_AQUAE/5-118--------------------------------------------------------------------------------
CRCB2_NOCFA/16-128--------------------------------------------------------------------------------
D7DRE9_METV3/5-115--------------------------------------------------------------------------------
U5T4R2_9GAMM/8-121--------------------------------------------------------------------------------
B2AWA8_PODAN/397-506--------------------------------------------------------------------------------
D1BHA1_SANKS/35-148--------------------------------------------------------------------------------
R5XLK6_9FIRM/5-115--------------------------------------------------------------------------------
CRCB_OCHA4/5-119--------------------------------------------------------------------------------
C8X3J8_DESRD/6-120--------------------------------------------------------------------------------
S6B3S2_9PROT/7-119--------------------------------------------------------------------------------
G0REV4_HYPJQ/243-352--------------------------------------------------------------------------------
CRCB1_SYMTH/4-118--------------------------------------------------------------------------------
W8UG12_YEREN/6-118--------------------------------------------------------------------------------
CRCB_THIDA/5-117--------------------------------------------------------------------------------
CRCB_RUEST/6-118--------------------------------------------------------------------------------
A4CMI6_ROBBH/5-117--------------------------------------------------------------------------------
H1XRN1_9BACT/5-119--------------------------------------------------------------------------------
D7GFF6_PROFC/7-122--------------------------------------------------------------------------------
A2SG21_METPP/9-119--------------------------------------------------------------------------------
D4B425_ARTBC/346-466--------------------------------------------------------------------------------
CRCB2_STRR6/10-118--------------------------------------------------------------------------------
K9PWI8_9CYAN/11-124--------------------------------------------------------------------------------
F9ZBH9_ODOSD/6-119--------------------------------------------------------------------------------
G0G9G3_AMYMS/11-123--------------------------------------------------------------------------------
CRCB_PECAS/6-118--------------------------------------------------------------------------------
F2I1G0_PELSM/5-117--------------------------------------------------------------------------------
CRCB1_LACSS/7-116--------------------------------------------------------------------------------
A9TSK9_PHYPA/206-323--------------------------------------------------------------------------------
CRCB2_STRCO/4-116--------------------------------------------------------------------------------
E0TB42_PARBH/54-160--------------------------------------------------------------------------------
F2R3F8_STRVP/11-129--------------------------------------------------------------------------------
C7RPT9_ACCPU/5-117--------------------------------------------------------------------------------
R6PLB2_9BACT/5-119--------------------------------------------------------------------------------
E3JAM9_FRASU/35-146--------------------------------------------------------------------------------
M4BCV8_HYAAE/78-196--------------------------------------------------------------------------------
K9RWB3_SYNP3/11-124--------------------------------------------------------------------------------
D2PXR3_KRIFD/12-120--------------------------------------------------------------------------------
G0EE80_PYRF1/24-136--------------------------------------------------------------------------------
E9T3M4_COREQ/13-119--------------------------------------------------------------------------------
A8EWL7_ARCB4/15-126--------------------------------------------------------------------------------
H2JQT4_STRHJ/3-114--------------------------------------------------------------------------------
C7MG85_BRAFD/31-146--------------------------------------------------------------------------------
CRCB_METS4/5-116--------------------------------------------------------------------------------
D1CCE4_THET1/4-117--------------------------------------------------------------------------------
CRCB_THEKO/7-118--------------------------------------------------------------------------------
C9LUG5_SELS3/6-122--------------------------------------------------------------------------------
C7NFB3_KYTSD/8-131--------------------------------------------------------------------------------
E5ANM6_BURRH/10-122--------------------------------------------------------------------------------
H2G1J1_OCESG/5-118--------------------------------------------------------------------------------
K5WJ99_PHACS/36-154--------------------------------------------------------------------------------
B5GT33_STRC2/4-112--------------------------------------------------------------------------------
B1VIZ2_CORU7/54-180--------------------------------------------------------------------------------
S6CLA6_9ACTN/5-115--------------------------------------------------------------------------------
G4KZT9_OSCVS/4-113--------------------------------------------------------------------------------
CRCB_HAHCH/7-120--------------------------------------------------------------------------------
M1PG46_DESSD/5-117--------------------------------------------------------------------------------
E6U3C1_ETHHY/7-118--------------------------------------------------------------------------------
D6Z3E2_DESAT/25-137--------------------------------------------------------------------------------
CRCB_HAEDU/5-112--------------------------------------------------------------------------------
R7KTC6_9BURK/12-126--------------------------------------------------------------------------------
K5WJ99_PHACS/207-317--------------------------------------------------------------------------------
K9FHV6_PEND2/281-398--------------------------------------------------------------------------------
F4HAX1_GALAU/5-117--------------------------------------------------------------------------------
CRCB2_BIFLO/33-147--------------------------------------------------------------------------------
E6WPA5_PSEUU/5-117--------------------------------------------------------------------------------
I0HP37_RUBGI/6-118--------------------------------------------------------------------------------
D3RQ80_ALLVD/5-117--------------------------------------------------------------------------------
M9SJ20_9EURY/5-112--------------------------------------------------------------------------------
W0J3M8_9BACT/13-127--------------------------------------------------------------------------------
U5DA10_AMBTC/185-301--------------------------------------------------------------------------------
F2KPC2_ARCVS/5-116--------------------------------------------------------------------------------
G0V7Z6_NAUCC/248-366--------------------------------------------------------------------------------
M7WQY7_RHOT1/266-373--------------------------------------------------------------------------------
CRCB_DESVM/5-118--------------------------------------------------------------------------------
V4JGW8_9GAMM/5-118--------------------------------------------------------------------------------
J4VST1_BEAB2/320-431--------------------------------------------------------------------------------
Q4WZP6_ASPFU/297-421--------------------------------------------------------------------------------
CRCB_POLSQ/6-118--------------------------------------------------------------------------------
I0DVX9_PROSM/6-117--------------------------------------------------------------------------------
R5G7W5_9PORP/4-118--------------------------------------------------------------------------------
G8ZNE7_TORDC/239-356--------------------------------------------------------------------------------
K0SZ12_THAOC/443-557--------------------------------------------------------------------------------
C3PIR4_CORA7/6-112--------------------------------------------------------------------------------
CRCB_IGNH4/5-114--------------------------------------------------------------------------------
CRCB_CHLPB/9-121--------------------------------------------------------------------------------
R5LBB8_9SPIR/6-112--------------------------------------------------------------------------------
N0B0J1_9RHIZ/7-121--------------------------------------------------------------------------------
B2J4R5_NOSP7/10-125--------------------------------------------------------------------------------
F6IMX4_9SPHN/11-128--------------------------------------------------------------------------------
F4CS98_PSEUX/33-144--------------------------------------------------------------------------------
D5V5P5_ARCNC/9-120--------------------------------------------------------------------------------
G8PPE0_PSEUV/5-118--------------------------------------------------------------------------------
CRCB1_PROMM/13-126--------------------------------------------------------------------------------
E1R2J6_SPISS/1-113--------------------------------------------------------------------------------
K0KMS3_WICCF/227-345--------------------------------------------------------------------------------
G4L620_TETHN/5-114--------------------------------------------------------------------------------
CRCB_PSEF5/6-119--------------------------------------------------------------------------------
G0HI73_CORVD/17-130--------------------------------------------------------------------------------
K2RLS9_MACPH/243-361--------------------------------------------------------------------------------
D5CTU7_SIDLE/7-119--------------------------------------------------------------------------------
M4U625_9GAMM/9-123--------------------------------------------------------------------------------
I4EVT0_MODMB/24-139--------------------------------------------------------------------------------
C5C9Z4_MICLC/19-136--------------------------------------------------------------------------------
G8R792_OWEHD/7-120--------------------------------------------------------------------------------
R7NMD5_9BACE/12-124--------------------------------------------------------------------------------
CRCB1_BACAN/7-120--------------------------------------------------------------------------------
G2NX45_STRVO/37-148--------------------------------------------------------------------------------
B5I3X9_9ACTO/27-138--------------------------------------------------------------------------------
V6F7B6_9PROT/11-124--------------------------------------------------------------------------------
F0RJH9_DEIPM/4-117--------------------------------------------------------------------------------
A3N2I1_ACTP2/4-111--------------------------------------------------------------------------------
G8JUV7_ERECY/203-319--------------------------------------------------------------------------------
CRCB_VARPS/6-117--------------------------------------------------------------------------------
R5FQU8_9BACT/5-118--------------------------------------------------------------------------------
F4AXA4_KROS4/5-117--------------------------------------------------------------------------------
C5DC82_LACTC/216-332--------------------------------------------------------------------------------
CRCB_RHOPA/4-117--------------------------------------------------------------------------------
H2J7L4_MARPK/4-118--------------------------------------------------------------------------------
K9W201_9CYAN/10-124--------------------------------------------------------------------------------
D1BRL5_XYLCX/15-129--------------------------------------------------------------------------------
R7GLD8_9FIRM/5-115--------------------------------------------------------------------------------
W8KKC5_HALHR/5-120--------------------------------------------------------------------------------
I1JZ91_SOYBN/93-208--------------------------------------------------------------------------------
CRCB_AZOPC/6-119--------------------------------------------------------------------------------
R5JFM8_9FIRM/5-117--------------------------------------------------------------------------------
R7F2G8_9BACT/7-123--------------------------------------------------------------------------------
CRCB_CLONN/8-121--------------------------------------------------------------------------------
A4X7W1_SALTO/33-145--------------------------------------------------------------------------------
D0J3S6_COMT2/8-119--------------------------------------------------------------------------------
CRCB_MAGSM/4-117--------------------------------------------------------------------------------
CRCB3_YERPE/7-122--------------------------------------------------------------------------------
CRCB1_LACPL/7-114--------------------------------------------------------------------------------
I1QW29_ORYGL/373-486--------------------------------------------------------------------------------
G8RTP8_MYCRN/31-146--------------------------------------------------------------------------------
A4AVL4_MARSH/5-117--------------------------------------------------------------------------------
I0K3J8_9BACT/9-121--------------------------------------------------------------------------------
I5AR27_EUBCE/4-113--------------------------------------------------------------------------------
K8GKY2_9CYAN/31-143--------------------------------------------------------------------------------
CRCB2_MOOTA/4-115--------------------------------------------------------------------------------
R1GHA3_BOTPV/349-458--------------------------------------------------------------------------------
D3UIE7_HELM1/4-114--------------------------------------------------------------------------------
B0CYF7_LACBS/172-282--------------------------------------------------------------------------------
E0UPF1_SULAO/7-120--------------------------------------------------------------------------------
E1STR4_FERBD/5-117--------------------------------------------------------------------------------
J7ITS3_DESMD/5-118--------------------------------------------------------------------------------
G7Z210_AZOL4/9-122--------------------------------------------------------------------------------
Q5AFH3_CANAL/262-380--------------------------------------------------------------------------------
E4MZN4_KITSK/4-111--------------------------------------------------------------------------------
CRCB2_RHOSR/4-110--------------------------------------------------------------------------------
B3PL39_CELJU/4-117--------------------------------------------------------------------------------
CRCB_GLOVI/6-119--------------------------------------------------------------------------------
F3Z1S0_DESAF/5-118--------------------------------------------------------------------------------
CRCB_PSYA2/4-116--------------------------------------------------------------------------------
K4LEU4_THEPS/4-116--------------------------------------------------------------------------------
B1YHY0_EXIS2/4-117--------------------------------------------------------------------------------
R7CZL0_9BACE/6-119--------------------------------------------------------------------------------
E9CDR5_CAPO3/296-409--------------------------------------------------------------------------------
U5QJZ1_9CYAN/34-146--------------------------------------------------------------------------------
W0PBD4_9BURK/6-118--------------------------------------------------------------------------------
E4TXK3_SULKY/6-118--------------------------------------------------------------------------------
L0K7M6_HALHC/6-118--------------------------------------------------------------------------------
CRCB_OPITP/5-120--------------------------------------------------------------------------------
C7QES3_CATAD/36-147--------------------------------------------------------------------------------
CRCB2_BACHD/9-117--------------------------------------------------------------------------------
G0GBW7_SPITZ/7-119--------------------------------------------------------------------------------
K0ESJ3_9NOCA/35-146--------------------------------------------------------------------------------
G2KQT3_MICAA/5-118--------------------------------------------------------------------------------
K4D6B6_SOLLC/326-443--------------------------------------------------------------------------------
CRCB1_RHOPB/14-129--------------------------------------------------------------------------------
G2IVX1_PSEUL/5-117--------------------------------------------------------------------------------
W6R9V2_9RHIZ/5-118--------------------------------------------------------------------------------
CRCB2_BRADU/14-129--------------------------------------------------------------------------------
F0T2T5_SYNGF/5-118--------------------------------------------------------------------------------
R5E6T8_9BURK/4-111--------------------------------------------------------------------------------
A9BWH4_DELAS/7-120--------------------------------------------------------------------------------
CRCB_CHLTE/7-119--------------------------------------------------------------------------------
A5V9U9_SPHWW/5-118--------------------------------------------------------------------------------
B2UNL3_AKKM8/6-118--------------------------------------------------------------------------------
L0DGX5_SINAD/8-120--------------------------------------------------------------------------------
C0QTQ0_PERMH/4-117--------------------------------------------------------------------------------
CRCB_METSB/4-119--------------------------------------------------------------------------------
J9R4B9_RIEAN/5-117--------------------------------------------------------------------------------
CRCB_RHOS4/6-116--------------------------------------------------------------------------------
K4L570_9FIRM/7-120--------------------------------------------------------------------------------
F9XQR4_MYCGM/302-413--------------------------------------------------------------------------------
D5DAP2_BACMD/7-115--------------------------------------------------------------------------------
F3Z559_9ACTO/76-187--------------------------------------------------------------------------------
I4WYT6_9GAMM/7-119--------------------------------------------------------------------------------
W0DEP3_9AQUI/5-118--------------------------------------------------------------------------------
A9TPH4_PHYPA/20-134--------------------------------------------------------------------------------
A8ZZ09_DESOH/10-123--------------------------------------------------------------------------------
D4KET5_9FIRM/5-117--------------------------------------------------------------------------------
C7JDR1_ACEP3/7-122--------------------------------------------------------------------------------
CRCB1_LACJO/9-115--------------------------------------------------------------------------------
J9W0J8_LACBU/13-122--------------------------------------------------------------------------------
A6W4E3_KINRD/37-151--------------------------------------------------------------------------------
J9SRC0_9ACTO/34-149--------------------------------------------------------------------------------
X4ZPG0_9BORD/8-118--------------------------------------------------------------------------------
T2GG52_DESGI/5-118--------------------------------------------------------------------------------
R7GA30_9FIRM/5-115--------------------------------------------------------------------------------
A1W8S2_ACISJ/5-117--------------------------------------------------------------------------------
D8TQI4_VOLCA/636-748--------------------------------------------------------------------------------
L7WCG2_NONDD/5-114--------------------------------------------------------------------------------
CRCB_CLOPE/8-121--------------------------------------------------------------------------------
A3CNB4_STRSV/8-116--------------------------------------------------------------------------------
D3FXF9_BACPE/9-116--------------------------------------------------------------------------------
B8C349_THAPS/648-760--------------------------------------------------------------------------------
D1B6Q4_THEAS/4-117--------------------------------------------------------------------------------
CRCB_DESPS/8-119--------------------------------------------------------------------------------
C1D065_DEIDV/5-117--------------------------------------------------------------------------------
D7E3Z4_NOSA0/11-125--------------------------------------------------------------------------------
CRCB2_STAA8/5-115--------------------------------------------------------------------------------
C6X7L4_METGS/6-118--------------------------------------------------------------------------------
E4TMJ0_MARTH/6-117--------------------------------------------------------------------------------
D0MU45_PHYIT/239-358--------------------------------------------------------------------------------
X4RAS3_9ACTO/4-114--------------------------------------------------------------------------------
D8IT50_HERSS/4-116--------------------------------------------------------------------------------
V5FQ20_BYSSN/358-476--------------------------------------------------------------------------------

PF03151

S35E1_DROME/12-300--------------------------------------------------------------------------------
Q7XJ66_CHLRE/90-384--------------------------------------------------------------------------------
XPT_ARATH/110-400--------------------------------------------------------------------------------
S352B_HUMAN/73-368--------------------------------------------------------------------------------
Q7QFK8_ANOGA/5-293--------------------------------------------------------------------------------
PPT2_ARATH/77-369--------------------------------------------------------------------------------
Q84XW3_CHLRE/83-381--------------------------------------------------------------------------------
Q8I420_PLAF7/43-340--------------------------------------------------------------------------------
Q802Y0_DANRE/14-303--------------------------------------------------------------------------------
Q7RSG8_PLAYO/40-339--------------------------------------------------------------------------------
GPT2_ARATH/95-384--------------------------------------------------------------------------------
B7FPD9_PHATC/80-375--------------------------------------------------------------------------------
D7TJE0_VITVI/103-390--------------------------------------------------------------------------------
M4FCY2_BRARP/103-393--------------------------------------------------------------------------------
PPT1_ORYSJ/106-396--------------------------------------------------------------------------------

PF00892

D6EP20_STRLI/151-288--------------------------------------------------------------------------------
L8ANE0_BACIU/7-146--------------------------------------------------------------------------------
I0ZKJ3_HELPX/6-141--------------------------------------------------------------------------------
D5AVZ9_RICPP/9-142--------------------------------------------------------------------------------
O86204_ECOLX/151-286--------------------------------------------------------------------------------
Y1533_ARCFU/1-136--------------------------------------------------------------------------------
O86204_ECOLX/5-139--------------------------------------------------------------------------------
B9E5E1_CLOK1/155-292--------------------------------------------------------------------------------
YTR1_BUCSC/151-288--------------------------------------------------------------------------------
Y270_BUCAP/150-287--------------------------------------------------------------------------------
A0A017QUD2_SALET/150-287--------------------------------------------------------------------------------
O85268_YEREN/152-289--------------------------------------------------------------------------------
O57793_PYRHO/1-137--------------------------------------------------------------------------------
Y1552_ARCFU/8-133--------------------------------------------------------------------------------
D5AUW8_RHOCB/5-144--------------------------------------------------------------------------------
A4XDY4_NOVAD/20-156--------------------------------------------------------------------------------
A0A017HZK6_ECOLX/5-145--------------------------------------------------------------------------------
J7JRE9_BACIU/7-149--------------------------------------------------------------------------------
Q9ZF46_BACME/4-143--------------------------------------------------------------------------------
F7UPD3_SYNYG/16-164--------------------------------------------------------------------------------
A0A017HZK6_ECOLX/156-291--------------------------------------------------------------------------------
Q9ZF46_BACME/154-289--------------------------------------------------------------------------------
J7JRE9_BACIU/160-296--------------------------------------------------------------------------------
G4EPI0_BACIU/13-147--------------------------------------------------------------------------------
F7URF2_SYNYG/11-146--------------------------------------------------------------------------------
J7JS06_BACIU/27-163--------------------------------------------------------------------------------
YTR1_BUCSC/5-140--------------------------------------------------------------------------------
Q56929_YEREN/6-141--------------------------------------------------------------------------------
Y270_BUCAP/4-139--------------------------------------------------------------------------------
A0A017QUD2_SALET/4-139--------------------------------------------------------------------------------
J7JNU4_BACIU/3-140--------------------------------------------------------------------------------
Y266_ARCFU/2-133--------------------------------------------------------------------------------
C4PN91_CHLTZ/23-158--------------------------------------------------------------------------------
Q9Z799_CHLPN/1-135--------------------------------------------------------------------------------
J7JZ94_BACIU/4-141--------------------------------------------------------------------------------
J7JVD8_BACIU/2-137--------------------------------------------------------------------------------
O58666_PYRHO/6-134--------------------------------------------------------------------------------
Q9ZAR1_ENTAG/3-139--------------------------------------------------------------------------------
J7JUX2_BACIU/4-140--------------------------------------------------------------------------------
O66073_BACLI/12-147--------------------------------------------------------------------------------
J7JS00_BACIU/7-142--------------------------------------------------------------------------------
Y510_ARCFU/3-136--------------------------------------------------------------------------------
O58324_PYRHO/8-137--------------------------------------------------------------------------------
Y788_ARCFU/41-166--------------------------------------------------------------------------------
J7JU04_BACIU/4-138--------------------------------------------------------------------------------
Q9Z6F0_MYCSM/151-288--------------------------------------------------------------------------------
D5AVZ9_RICPP/149-281--------------------------------------------------------------------------------
O59158_PYRHO/22-155--------------------------------------------------------------------------------
A0A009E7X9_ECOLX/158-292--------------------------------------------------------------------------------
C9MFS0_HAEIF/155-289--------------------------------------------------------------------------------
D6EP20_STRLI/5-140--------------------------------------------------------------------------------
Y841_METTH/44-192--------------------------------------------------------------------------------
F7UTM7_SYNYG/180-316--------------------------------------------------------------------------------
YD3A_METJA/2-135--------------------------------------------------------------------------------
C4PN91_CHLTZ/173-314--------------------------------------------------------------------------------
Q9Z6F0_MYCSM/7-141--------------------------------------------------------------------------------
A0A009EIR4_ECOLX/9-142--------------------------------------------------------------------------------
F7UPD3_SYNYG/180-319--------------------------------------------------------------------------------
Y788_ARCFU/171-306--------------------------------------------------------------------------------
Q9ZAR1_ENTAG/144-287--------------------------------------------------------------------------------
A0A009EIR4_ECOLX/151-290--------------------------------------------------------------------------------
PECM_DICD3/1-130--------------------------------------------------------------------------------
J7JS06_BACIU/176-314--------------------------------------------------------------------------------
Y841_METTH/205-340--------------------------------------------------------------------------------
O66073_BACLI/158-302--------------------------------------------------------------------------------
A0A017JYW9_ECOLX/147-281--------------------------------------------------------------------------------
J7JU04_BACIU/147-282--------------------------------------------------------------------------------
Y510_ARCFU/148-285--------------------------------------------------------------------------------
Y976A_HAEIN/24-161--------------------------------------------------------------------------------
L8ANE0_BACIU/160-300--------------------------------------------------------------------------------
J7JUX2_BACIU/153-290--------------------------------------------------------------------------------
A4XDY4_NOVAD/169-306--------------------------------------------------------------------------------
Y266_ARCFU/139-274--------------------------------------------------------------------------------
D5AUW8_RHOCB/157-295--------------------------------------------------------------------------------
WTR2_ARATH/184-324--------------------------------------------------------------------------------
O59388_PYRHO/154-290--------------------------------------------------------------------------------
O58347_PYRHO/149-285--------------------------------------------------------------------------------
YSO2_ACIAM/105-237--------------------------------------------------------------------------------
J7JNU4_BACIU/149-285--------------------------------------------------------------------------------
O59158_PYRHO/167-298--------------------------------------------------------------------------------
F7URF2_SYNYG/171-308--------------------------------------------------------------------------------
J7JVD8_BACIU/148-285--------------------------------------------------------------------------------
J7JZ94_BACIU/150-287--------------------------------------------------------------------------------
YCB6_PSEDE/3-140--------------------------------------------------------------------------------
O58983_PYRHO/5-140--------------------------------------------------------------------------------
Y1533_ARCFU/143-274--------------------------------------------------------------------------------
A0A009DPG9_ECOLX/149-285--------------------------------------------------------------------------------
G4EPI0_BACIU/159-292--------------------------------------------------------------------------------
O59388_PYRHO/9-144--------------------------------------------------------------------------------
O58347_PYRHO/2-140--------------------------------------------------------------------------------
J7JN80_BACIU/162-303--------------------------------------------------------------------------------
A0A009DPG9_ECOLX/9-141--------------------------------------------------------------------------------
C9MFS0_HAEIF/6-142--------------------------------------------------------------------------------
A0A009E7X9_ECOLX/6-144--------------------------------------------------------------------------------
O67627_AQUAE/4-141--------------------------------------------------------------------------------
G4F0I2_BACIU/7-141--------------------------------------------------------------------------------
Y1552_ARCFU/139-269--------------------------------------------------------------------------------
O57793_PYRHO/144-274--------------------------------------------------------------------------------

PF08449

S35B4_MOUSE/2-314.......NIVTFAQ.....FLFIAVEGF...........LFEA.NLGRKPPAIPIRYYAIMVTMFFTVSVVNNYAL---N
O44166_CAEEL/6-310.......NLMTFST.....FLFISTVGL...........VSTS.KFFTVKNQIPLKGYFKTVTMFFIVNVVNNQAL---N
Q9VAN9_DROME/6-318.......NLITGAQ.....FAFIALEGF...........IFTS.KFGLAQRVISLRDYALLVAMFFLTSVCNNYVF---K
YEA4_KLULA/2-321.......NIVTFTQ.....FVSVTLIQLPNALDFSHFPFR.......LRPRHIPLKIHMLAVFLFFTSSVANNSVF---K
YEA4_SCHPO/1-304.......ILITFSQ.....FILITIEGL.....I....YFLLNDVQSLKHPKVPRKRWFVVVVMFFAINVLNNVAL---G
S35B4_DICDI/7-328.......ILVTFFQ.....FATVAFISFFVNIRWKQVFSIFWI.PIGLRERKIPLKTYFLMVSIFFILSVLNNKAL---D
S35B3_DROME/61-364.......WFLTLVQ.....FGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSL---G
UTR5B_ARATH/18-321KEFFKHSLFLVFCNR..LTTSAVSAGALLASKK..............VLDPVAPVYKYCLISVTNILTTTCQYEAL---K
YEA4_YEAST/3-327.......NLITFCQ.....FLFVTCQGLPEFLDVHQPFPY.......FKPLKTPLHVYVITVVLFYISSTTNNNVF---K
UTR1_ARATH/13-318EKRFEHLAFLNLAQSVVCLIWSYIMIKLWSN................AGNGGAPWWTYWSAGITNTIGPAMGIEAL---K
S35B4_DROME/6-325.......NLITFAQ.....FLFIALEGL...........VFTS.KFFTVRPKIALKDYVILVALFFGANVCNNYAF---N
S35B3_CAEEL/41-332.......WTLTLIQ.....FLIYSGCGYTECIIW....H........NTKRMIPWRIYGVIAFFTVATMGLSNASV---G
UTR2_ARATH/22-312.......WYFTFIQGFVYLFLIY.LQGFT..................TKHIVNPMRTYVKLSAVLMGSHGLTKGSL---A
S35B4_DANRE/2-314.......NIVTFAQ.....FAFIALEGF...........IFET.NFGRKKPQIPLSNYVIMVTMFFTVSVINNYAL---D
F1P4W7_CHICK/48-339.......WYLTLVQ.....FGFYSVFGLIELQL.....IQ.......DKRRRIPGKTYMIIAFLTVGTMGLSNTSL---G
F7D3M1_XENTR/123-422GERFRDSQFLVFMN....RILALTVAGVYCSIS......K.......QPRHGAPMYKYSFASLSNILSSWCQYEAL---K
Q1K947_NEUCR/81-406.......TLLTFVQ.....FLFVALVGLPSQIDWSRPPFF.......LKKNQVPIKRWLINIALFFAINVLNNHAF---S

PF06027

S35F1_MOUSE/56-355GLIDLEANYLVVKAYQYTTLTSVQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQ.---G
Q948Q8_ARATH/10-301AVVDVEANFLVVKAFQNTSMTSIMLLDCWAIPCVLVLTWVFLKTRYRLMKISGVVICIVGVVMVVFSDVHAGDRA.---.
S35F2_HUMAN/35-334GLADVEANYVIVRAYQYTTLTSVQLLDCFGIPVLMALSWFILHARYRVIHFIAVAVCLLGVGTMVGADILAGRED.---N
Q948Q7_ARATH/12-303ALVDVEGNFLVVKANQYTSITSIMLLDCWAIPCVLVLTWMFLKTKYRLMKISGVFICIAGVVMVLFSDVHAGSRA.---.
YCN8_SCHPO/137-433AFFDVEGNYFVVLAYQYTNMLSASLLDSWATVAVVILSFIFLKVRYHWSQILGVVACIGGLVLLVVSDVIS..RGD---Y

PF08627

D3B5S8_POLPA/52-390TRDFPKYKFLIMGALDAVTGYFVVIGGISTSGPLQQLLNQAIIPFTMLSSLVFLKMRYSWIQVTGALVIIAGVVV.---.
H3GRN7_PHYRM/13-337QRSIPKRKFAVMGGLDSVAGILQVFAATYLGGSLIILLGQAAIPISMLISSLLLKAKYSGYQYVGAMVVTLGLLI.---.
Q5CIN3_CRYHO/46-383NLEFPISKFWMMGFFDAFSSILTLLASTHTSGVMQVVLGQMCTPITLVMLSSICKDRFHKLQYIGATVMVMGIFIV---K
CRTP2_DICDI/60-403TRSFPQWKFVIMGALDAVTGYFVVIGGIKTTGPLQQLLNQSVIPFTMLLSFIFLKERYSLIQLGGALIIIGGVVV.---.
CRTP1_DICDI/52-397TRDFPTRKFAIMGALDAITGFFVVIGGVSTSGPLQQLLNQAIIPFTMIASFIFLKERYSLIQLGGALVIIGGVVT.---.
B6AJI0_CRYMR/52-389TLKIPLRKFWIMGFLDSFGSILTLLASVHTSGVMQVILGQFCTPITLIMLTIFCKDKFHIMQYLGAFIMIIGIFI.---.
CRTP3_DICDI/55-397TRNFPQYKFVIMGLLDAINGFFVVIGGVSTSGPLQQLLNQAIIPFTMIASFIFLRERYSLFQLGGAAVILGGVIV.---.
D7G582_ECTSI/57-381QTSVPKRVFAVMGALDGVSGIMQIFASTYLGGSLIILLTQAAIPISMVTSKRLTGARYSVSQYTGATVVAAGIVI.---.
F0VNJ4_NEOCL/328-662MAEFPKRNFAVMGSLDSFSGILAIIGAVHTTGTTQVVLQQSCIVFILLASIVMLRKRFHVAHYLGAAVIILGVLV.---.
F4Q0G1_DICFS/42-373TKLFPKYKFLIMGALDAVTGYFVVIGGVRTSGPLQQLLNQAIIPFTMLASLIFLKERYSLIQVGGAAVILSGVVV.---.
F0Z9W2_DICPU/55-406TRAFPTYKFAIMGALDAVSGYFVVIGGISTSGPLQQLLNQAIIPFTMLASFLILKERYSLVQMGGAAVIVGGVIV.---.
CRT_PLAF7/61-391RHRSFNLQFFAISMLDACSVILAFIGLTRTTGNIQSFVLQLSIPINMFFCFLILRYRYHLYNYLGAVIIVVTIA..---.

PF05653

NPAL2_MOUSE/45-332QKYSHLHLAQKEHPKP......YFKSVLWLSGVLLTALGETGNFAAYGVAPITLIAPLGCMSVTGSAIISVLFLKE---N
Q9VK62_DROME/43-338KKKALIRLSRYGEVRASAGGFGYLREWIWWAGLLTMGVGEAANFAAYAFAPASLVTPLGALSVIISAVMASRFLNE---K
NIPA2_HUMAN/8-302KKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNE---R
B3LFA3_ARATH/7-299KKKGLKKAGVSG.ARAGEGGYGYLYEPWWWAGMITMIVGEIANFAAYAFAPAILVTPLGALSIIFSAVLAHFILEE---K
H2U3Z2_TAKRU/23-316KKRGLLRLARKGSMRAGQGGHAYLKEWLWWAGLISMGTGEAANFAAYAFAPATLVTPLGALSVLVSAVLSSYFLNE---R
Q8GWX2_ARATH/3-295KKKGLKRAGAIG.TRAGYGGYTYLLEPLWWAGMVTMIVGEAANFVAYIYAPAVLVTPLGALSIIISAVLAHFLLKE---K

PF16913

PUP2_ARATH/6-340..........IWFPSFLQTVGCPL...IFFPLLLSFLRRRRCL......EEQETTPFFLMKPPLFIAAIVVGLLVG---F
PUP11_ARATH/44-362..........KWMATLVQTAAFPI...LYIPLLLLPSSASVES...........SESSCSLKYIVLIYVLLGVIIA---G
PUP20_ARATH/46-377ACDDPKQFKGTWLQSFLQNAAFPSIAFLLLLWRSLFSTHGETQ.............SSSSFGKLFLLYISLGVLFS---A
PUP6_ARATH/36-361..........TWLETLVQLVGFP....LTLPCYYYLKPEPSKT.......KTITKKTTSSFLTLSLVYIGLGLLVA---G
Q8H7P2_ORYSJ/48-373..........LWLSATLQISGWPL...LLPPLCVSLYRGRRHG...........IGNLLLPRRLVGAAAVLGGLYA---V
PUP12_ARATH/30-348..........KWISTLVQTGGFPI...LYLPLSLLPASQSSSS...........SSSSSSFKTLVWIYLSLGFAIG---L
PUP1_ARATH/4-334..........IWFMSFLSTAGFPI...ILIPLLVSFLSRRRSNRNPNNAENKRKTKLFLMETPLFIASIVIGLLTG---L
PUP3_ARATH/4-327..........IWFSTFLETAGFPV...IFIPLLFSYITRRRSN......NVGDSTSFFLIKPRLLIAAVIVGILSG---F
PUP15_ARATH/45-380......RRRGILTQTLLQVVGFPI...LLLPFLLHFLIKKQKQ........LLIFSGETSLKHLAITYSILCIYMF---C
PUP5_ARATH/38-353..........KWIISWVAVAGWPITCLILLPTYIFQKIKPTPL.................NTKLVLSYVVLGFLSA---A
PUP18_ARATH/39-376DSDQDLQYRGTWLQALVQNAAFP....LLIPLFFIFPSPKQNQ.........ETTNTRFLSFRLILLYISLGVLVA---A
PUP14_ARATH/47-391EYNENRQNDGVWTQSLLQTVGFPL...LLLPFLIFITKNKRNH.....HQQPPITSDSIHLKSLAVIYICIGIIMS---V
PUP4_ARATH/26-344..........RWVSTWVQSAGFPL...LLILIYFPHYVLKTTT..........RRPFTRFTLRHLIFSVLIGLVLG---F
PUP8_ARATH/46-367..........TWMGTLVQLIGFPV...LFLFRFFSQTKNPKPT........EADFRKFSSFTILGSVYIVTGLLVS---A
PUP16_ARATH/30-368ESDQDRQYKGTWTQALIQNAAFP....ILIPFFFILSSPKPNP.......ETVSNQTNNGWFRVLSLYVSLGVLVS---V
Q7XN26_ORYSJ/40-356..........KWMATLTQSAGSPL...LAILLLFTPAPAADEP..............RPAAAKMAPIYVGLGIIIG---F

PF04657

Q21DH8_SACD2/19-159--------------------------------------------------------------------------------
Q39SB9_GEOMG/5-141--------------------------------------------------------------------------------
A6TN22_ALKMQ/4-138--------------------------------------------------------------------------------
A3QFA9_SHELP/30-170--------------------------------------------------------------------------------
A6VSJ3_MARMS/9-148--------------------------------------------------------------------------------
Q1GQL8_SPHAL/9-147--------------------------------------------------------------------------------
Q1QZC8_CHRSD/5-140--------------------------------------------------------------------------------
Q2RGM8_MOOTA/15-156--------------------------------------------------------------------------------
Q0AXV4_SYNWW/5-143--------------------------------------------------------------------------------
Q7N4X7_PHOLL/3-137--------------------------------------------------------------------------------
Q03TA8_LACBA/2-142--------------------------------------------------------------------------------
A6LU87_CLOB8/1-136--------------------------------------------------------------------------------
Q03TA8_LACBA/164-305--------------------------------------------------------------------------------
Q11NT1_CYTH3/6-142--------------------------------------------------------------------------------
Q0KF63_CUPNH/16-155--------------------------------------------------------------------------------
A1AK06_PELPD/5-141--------------------------------------------------------------------------------
Q5KZC7_GEOKA/4-140--------------------------------------------------------------------------------
Q4KHW5_PSEF5/5-144--------------------------------------------------------------------------------
A0JUK3_ARTS2/163-299--------------------------------------------------------------------------------
Q7UTT1_RHOBA/5-133--------------------------------------------------------------------------------
Q03HH1_PEDPA/168-308--------------------------------------------------------------------------------
Q03HH1_PEDPA/2-142--------------------------------------------------------------------------------
A6VKF2_ACTSZ/4-143--------------------------------------------------------------------------------
Q03Y21_LEUMM/166-301--------------------------------------------------------------------------------
B1YHB6_EXIS2/3-139--------------------------------------------------------------------------------
Q3A9B8_CARHZ/6-140--------------------------------------------------------------------------------
A8MKQ0_ALKOO/2-138--------------------------------------------------------------------------------
B1YEL8_EXIS2/4-140--------------------------------------------------------------------------------
Q8YKX2_NOSS1/5-144--------------------------------------------------------------------------------
Q12R75_SHEDO/9-146--------------------------------------------------------------------------------
Q9RVB6_DEIRA/8-144--------------------------------------------------------------------------------
A1A0P8_BIFAA/203-343--------------------------------------------------------------------------------
Q749R3_GEOSL/5-141--------------------------------------------------------------------------------
A6M3J1_CLOB8/2-138--------------------------------------------------------------------------------
Q65J95_BACLD/5-146--------------------------------------------------------------------------------
Q28TA8_JANSC/7-146--------------------------------------------------------------------------------
Q12K32_SHEDO/8-147--------------------------------------------------------------------------------
Q9RVB7_DEIRA/19-157--------------------------------------------------------------------------------
A3QFA8_SHELP/3-133--------------------------------------------------------------------------------
A5G8U5_GEOUR/6-141--------------------------------------------------------------------------------
Q8YKX1_NOSS1/33-172--------------------------------------------------------------------------------
A9KHN5_CLOPH/2-140--------------------------------------------------------------------------------
Q8FQJ9_COREF/99-239--------------------------------------------------------------------------------
B1YGF5_EXIS2/14-153--------------------------------------------------------------------------------
Q6D0D7_PECAS/13-152--------------------------------------------------------------------------------
A8LKG3_DINSH/5-143--------------------------------------------------------------------------------
Q28R25_JANSC/3-140--------------------------------------------------------------------------------
Q316U3_DESAG/4-143--------------------------------------------------------------------------------
B1YGF5_EXIS2/179-317--------------------------------------------------------------------------------
Q65QN9_MANSM/39-179--------------------------------------------------------------------------------
B1YIK4_EXIS2/3-139--------------------------------------------------------------------------------
Q04FL6_OENOB/173-313--------------------------------------------------------------------------------
Q31P27_SYNE7/5-144--------------------------------------------------------------------------------
Q5R178_IDILO/5-143--------------------------------------------------------------------------------
A9BWW9_DELAS/11-150--------------------------------------------------------------------------------
A0PXE0_CLONN/7-143--------------------------------------------------------------------------------
Q6FEY6_ACIAD/10-149--------------------------------------------------------------------------------
Q03UQ1_LEUMM/173-314--------------------------------------------------------------------------------
Q97DD1_CLOAB/2-138--------------------------------------------------------------------------------
Q5Z3K6_NOCFA/3-148--------------------------------------------------------------------------------
Q67KE9_SYMTH/5-146--------------------------------------------------------------------------------
Q2RM98_MOOTA/3-140--------------------------------------------------------------------------------
Q65J96_BACLD/10-156--------------------------------------------------------------------------------
Q1LCM1_RALME/14-153--------------------------------------------------------------------------------
Q7NSE3_CHRVO/15-151--------------------------------------------------------------------------------
A6LU86_CLOB8/2-134--------------------------------------------------------------------------------
Q9CJV1_PASMU/4-144--------------------------------------------------------------------------------
Q53WI3_THET8/6-144--------------------------------------------------------------------------------
A9CIC3_AGRT5/3-135--------------------------------------------------------------------------------
Q0BSA2_GRABC/6-144--------------------------------------------------------------------------------
B1YHB4_EXIS2/2-138--------------------------------------------------------------------------------
Q3HKF8_RHOS4/5-144--------------------------------------------------------------------------------
Q18BT7_PEPD6/5-139--------------------------------------------------------------------------------
B1YIK3_EXIS2/2-138--------------------------------------------------------------------------------
Q1QZC9_CHRSD/5-141--------------------------------------------------------------------------------
Q7NSE2_CHRVO/2-129--------------------------------------------------------------------------------
Q5HRB7_STAEQ/151-293--------------------------------------------------------------------------------
A5D651_PELTS/6-144--------------------------------------------------------------------------------
Q7P1D2_CHRVO/22-162--------------------------------------------------------------------------------
A4J0N8_DESRM/6-144--------------------------------------------------------------------------------
A4XQ88_PSEMY/7-145--------------------------------------------------------------------------------
Q03UQ1_LEUMM/2-142--------------------------------------------------------------------------------
Q168E1_ROSDO/6-143--------------------------------------------------------------------------------
Q1WV36_LACS1/3-143--------------------------------------------------------------------------------
A1A0P8_BIFAA/19-158--------------------------------------------------------------------------------
Q03Y21_LEUMM/4-142--------------------------------------------------------------------------------
Q98M54_RHILO/5-145--------------------------------------------------------------------------------
Q899N2_CLOTE/13-149--------------------------------------------------------------------------------
Q04FL6_OENOB/2-142--------------------------------------------------------------------------------
B1YEL9_EXIS2/4-140--------------------------------------------------------------------------------
Q2KZA1_BORA1/11-150--------------------------------------------------------------------------------
B0UV26_HISS2/5-138--------------------------------------------------------------------------------
B2HD53_MYCMM/9-144--------------------------------------------------------------------------------
B4EH13_BURCJ/7-144--------------------------------------------------------------------------------
C5AMM3_BURGB/15-150--------------------------------------------------------------------------------
D5C835_ENTCC/6-143--------------------------------------------------------------------------------
Q24WC2_DESHY/8-142--------------------------------------------------------------------------------
Q24WK5_DESHY/6-141--------------------------------------------------------------------------------
Q2G2U7_STAA8/151-293--------------------------------------------------------------------------------
Q4FVN5_PSYA2/4-139--------------------------------------------------------------------------------
Q4FVN6_PSYA2/5-140--------------------------------------------------------------------------------
Q6M0K5_METMP/6-143--------------------------------------------------------------------------------
Q726Q6_DESVH/5-141--------------------------------------------------------------------------------
Q7CQI5_SALTY/6-143--------------------------------------------------------------------------------
Q813A7_BACCR/2-135--------------------------------------------------------------------------------
Q813A8_BACCR/2-136--------------------------------------------------------------------------------
Q88GV8_PSEPK/16-154--------------------------------------------------------------------------------
Q8EJT6_SHEON/3-135--------------------------------------------------------------------------------
Q8EJT7_SHEON/11-158--------------------------------------------------------------------------------
Q8NRH8_CORGL/57-196--------------------------------------------------------------------------------
Q8XH76_CLOPE/3-138--------------------------------------------------------------------------------
Q8Y7R1_LISMO/4-145--------------------------------------------------------------------------------
Q8ZLF8_SALTY/10-154--------------------------------------------------------------------------------
Q92CJ8_LISMO/11-151--------------------------------------------------------------------------------
Q9CES9_LACLA/4-142--------------------------------------------------------------------------------
Q9HUZ5_PSEAE/8-145--------------------------------------------------------------------------------
Q9HYS5_PSEAE/5-144--------------------------------------------------------------------------------

PF10639

Q4TT81_CAEEL/12-122--------------------------------------------------------------------------------
A0C2W3_PARTE/7-116--------------------------------------------------------------------------------
Q4D1L3_TRYCC/4-115--------------------------------------------------------------------------------
Q22BW6_TETTS/16-127--------------------------------------------------------------------------------
TM234_ANOGA/20-135--------------------------------------------------------------------------------
TM234_PONAB/11-126--------------------------------------------------------------------------------
Q0U0B5_PHANO/22-148--------------------------------------------------------------------------------
A4I0H4_LEIIN/5-115--------------------------------------------------------------------------------
TM234_DICDI/9-124--------------------------------------------------------------------------------
A7SF34_NEMVE/12-127--------------------------------------------------------------------------------
Q57W61_TRYB2/4-115--------------------------------------------------------------------------------
Q179X3_AEDAE/11-126--------------------------------------------------------------------------------
A1Z7W3_DROME/8-123--------------------------------------------------------------------------------
B8A4M2_DANRE/10-125--------------------------------------------------------------------------------
H3DIR9_TETNG/11-126--------------------------------------------------------------------------------

PF00893

EMRE_ECOLI/2-94--------------------------------------------------------------------------------
YVAE_BACSU/1-93--------------------------------------------------------------------------------
MDTI_ECOLI/4-99--------------------------------------------------------------------------------
YVDS_BACSU/1-89--------------------------------------------------------------------------------
EBRB_BACSU/2-94--------------------------------------------------------------------------------
YKKD_BACSU/2-94--------------------------------------------------------------------------------
EBRA_BACSU/3-95--------------------------------------------------------------------------------
YVDR_BACSU/1-93--------------------------------------------------------------------------------
Y4NH_RHISN/1-106--------------------------------------------------------------------------------
YKKC_BACSU/1-90--------------------------------------------------------------------------------
B4EWY3_PROMH/1-93--------------------------------------------------------------------------------
E6W493_DESIS/3-94--------------------------------------------------------------------------------
SUGE_ECOLI/1-93--------------------------------------------------------------------------------
MMR_MYCTU/1-94--------------------------------------------------------------------------------
MDTJ_SHIDS/4-94--------------------------------------------------------------------------------

PF04142

GMS1_SCHPO/11-323LNELIKLVVCFSVGYHQFRKNVGKEAKLRAFLPQIFG.....GDSWKLAIPAFLYTCQNNLQYVAAGNLTAASFQV---T
O01879_CAEEL/6-314MMEIIKVVVCSAIMIYTTKSVM...KYINELKLAIFEHR...SETLKVCIPALIYTLQNNLYYIALSHLEATTFCI---S
O76865_DROME/18-342MAEFAKLITCLFLVFNEEGKDA..QKFVRSLHKTIIANP...MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQV---T
S35A1_HUMAN/8-314ITEVIKLLLSVGILAKETGSLG...RFKASLRENVLGSP...KELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQV---T
S35A2_HUMAN/31-339MAEVLKGLTCLLLLFAQKRGNV..KHLVLFLHEAVLVQY...VDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQV---T
S35A3_CANFA/1-314VAELLKIMACILLVYKDSKCSL..RALNRILHDEILNKP...METLKLAIPSGIYTLQNNLLYVALSNLDAATYQV---T
UGTP1_CAEEL/37-351CAEILKLVITFAMFYKECNFDS..RQFSEQVSKYYINAP...RELAKMSVPSFAYALQNNLDFVGLSNLDAGLYQV---T
O16658_CAEEL/7-326CAEIIKLITCFFVIYRNNGYRF..SGMLNELNREIFASPQTRADSLKVAVPAIMYVIQNNLLFFALKKLDAATYQV---T
O02345_CAEEL/5-360FGEIFKCTVSLLLACIEEKSIA...KGLRKIHHEFFVNW...RDTLKVLVPSAIYTVQNFLLYVAVDNLPAATYMV---T

PF06800

GLCU_BACSU/4-283----------------------------LLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVIYFFVQP---V
Y176_LISMO/4-283----------------------------MIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIVFFFTDP---V
Y2157_STRA5/5-285----------------------------LIALIPMFAWGSIGFVSNKIGGRPNQQTFGMTLGALLFAIIVWLFKQP---E
RBSU_LACPL/7-294----------------------------LIGLGPLLGWGLYPTIASKIGGRPVNQILGSTIGTLIFALIYAWVQGI---A
Y2503_LACPL/4-283----------------------------LIALIPAIAWGSIGLISGRMGGTARQQTLGMTMGALVFGLALWAVEQP---T
RBSU_LACSS/7-293----------------------------LIGLMPMIGWGIFPVIVGKIGGKPASQILGTTFGTLILAIVVAIFRGT---P
Y169_LISMO/4-283----------------------------VIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGVFIFTNP---E
YXFA_LACLA/5-291----------------------------LLALVPMFAWGSIGFVANKFGGDAKQQTLGMTLGAFVFALIVFLFRMP---T
Y2594_LACPL/4-282----------------------------LIAIIPALCWGINPLLVGKINGHSENEMFGMGIGDGLIALIFWLFSQP---T
Y2205_STRP1/5-285----------------------------FYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRP---E
Y424_LISMO/5-284----------------------------LIALLPVLGWGFMPIIANLRKSTPEEQLLGTSISALLFALILFWILSP---E
Q2G1A4_STAA8/7-292----------------------------LIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFAILLAVVTSS---G
RBSU_STAEQ/7-292----------------------------LIGLGPLLGWGLFPTIASKFGGRPVNQIFGATVGTLIFAIVLALFKGI---G
GLCU_STAEQ/7-284----------------------------LIALLPALFWGSVVIINVFVGGGPYNQIRGTTLGTLFIGFSLLATGHA---A

PF07857

Q20583_CAEEL/6-327-----------------------------TLGIVCAVVSAITFGSTYVPLKWFHKGDGLYFQWVQSLGQLLVGVAV---A
TM144_CAEEL/4-345-----------------------------AVGLSACALSSVLFGSMFVPVKKCHSGNGIFVQWIMSTAILLVGIVV---Y
Q9U3C0_CAEEL/15-349-----------------------------IVGYVALLLSCCAFGTMFVPLRRRNCKDGFFVQWIECGVVFIVGCIF---Y
TM144_HUMAN/9-344-----------------------------TFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVV---N
Q95QA2_CAEEL/2-342-----------------------------IVGILACLTATFTLGSVFAPIKRFPSSDGFMVQFFMSLGGFITSLAI---H
O01810_CAEEL/4-351-----------------------------VIGLAACAVSSVFFGSMFVPIKSYDSRDGIFAQWMMSIAILLVGFIV---F

PF04342

W0A9J2_9SPHN/8-113--------------------------------------------------------------------------------
W0ESB8_9PORP/6-120--------------------------------------------------------------------------------
R7J057_9BACT/7-121--------------------------------------------------------------------------------
R5GE85_9BACT/6-120--------------------------------------------------------------------------------
C9RMH7_FIBSS/7-121--------------------------------------------------------------------------------
C1EGV5_MICSR/11-116--------------------------------------------------------------------------------
R6M9N1_9BACE/6-121--------------------------------------------------------------------------------
M4VF68_9DELT/12-111--------------------------------------------------------------------------------
R7KRF0_9BURK/11-114--------------------------------------------------------------------------------
B3DXJ3_METI4/19-122--------------------------------------------------------------------------------
R5GGI4_9PORP/6-121--------------------------------------------------------------------------------
C0QW78_BRAHW/6-120--------------------------------------------------------------------------------
J7TKX6_MORMO/7-110--------------------------------------------------------------------------------
R6XLL0_9BACT/6-120--------------------------------------------------------------------------------
R5VDD3_9PORP/6-120--------------------------------------------------------------------------------
R7P7Y5_9BACT/6-120--------------------------------------------------------------------------------
M4S3A7_9SPHN/3-107--------------------------------------------------------------------------------
W8F6G8_9BACT/6-120--------------------------------------------------------------------------------
C6W5H8_DYAFD/6-120--------------------------------------------------------------------------------
V5SCV2_9RHIZ/12-115--------------------------------------------------------------------------------
Q9I3E0_PSEAE/7-111--------------------------------------------------------------------------------
F0P098_WEEVC/6-120--------------------------------------------------------------------------------
E3I3M7_RHOVT/8-111--------------------------------------------------------------------------------
C7PV02_CHIPD/3-107--------------------------------------------------------------------------------
Q3J4E4_RHOS4/10-113--------------------------------------------------------------------------------
W0RE32_9BACT/7-111--------------------------------------------------------------------------------
Q2G7E2_NOVAD/8-111--------------------------------------------------------------------------------
R6PI70_9CLOT/7-110--------------------------------------------------------------------------------
Q11HS8_CHESB/8-111--------------------------------------------------------------------------------
B7K215_CYAP8/8-111--------------------------------------------------------------------------------
D4Z3P0_SPHJU/3-108--------------------------------------------------------------------------------
Q6D027_PECAS/7-111--------------------------------------------------------------------------------
E1QGJ6_DESB2/5-109--------------------------------------------------------------------------------
B2ULU2_AKKM8/6-114--------------------------------------------------------------------------------
A5EXJ2_DICNV/6-112--------------------------------------------------------------------------------
D5MKV2_9BACT/7-111--------------------------------------------------------------------------------
D0MEU5_RHOM4/7-111--------------------------------------------------------------------------------
Q9PG53_XYLFA/11-114--------------------------------------------------------------------------------
E6VQT5_DESAO/7-111--------------------------------------------------------------------------------
Q1GTV7_SPHAL/7-110--------------------------------------------------------------------------------
D8PAT6_9BACT/3-106--------------------------------------------------------------------------------
Q6LXR9_METMP/6-109--------------------------------------------------------------------------------
D2R2M8_PIRSD/9-124--------------------------------------------------------------------------------
R7LE15_9BACT/6-120--------------------------------------------------------------------------------
H2FYV5_OCESG/7-111--------------------------------------------------------------------------------
C4KAD8_THASP/17-121--------------------------------------------------------------------------------
E4T2Z8_PALPW/6-120--------------------------------------------------------------------------------
E6W367_DESIS/7-111--------------------------------------------------------------------------------
E8RR36_ASTEC/10-113--------------------------------------------------------------------------------
F4HE45_GALAU/7-112--------------------------------------------------------------------------------
G7UQB0_PSEUP/7-110--------------------------------------------------------------------------------
B0T7W2_CAUSK/11-112--------------------------------------------------------------------------------
C3MDJ4_RHISN/36-139--------------------------------------------------------------------------------
W6R971_9RHIZ/97-200--------------------------------------------------------------------------------
Q0C0V6_HYPNA/7-110--------------------------------------------------------------------------------
H8KNB8_SOLCM/6-120--------------------------------------------------------------------------------
R5PS28_9BURK/8-121--------------------------------------------------------------------------------
G8M1P8_CLOCD/3-106--------------------------------------------------------------------------------
A7HZ37_PARL1/9-112--------------------------------------------------------------------------------
R6T071_9BACE/7-121--------------------------------------------------------------------------------
E1VMC8_9GAMM/8-112--------------------------------------------------------------------------------
R5W8P9_9BACT/6-120--------------------------------------------------------------------------------
D4H7Q5_DENA2/6-110--------------------------------------------------------------------------------
B4F097_PROMH/10-113--------------------------------------------------------------------------------
F4C648_SPHS2/17-130--------------------------------------------------------------------------------
G4REH9_PELHB/16-119--------------------------------------------------------------------------------
C4LDN3_TOLAT/7-111--------------------------------------------------------------------------------
C7LWT9_DESBD/7-111--------------------------------------------------------------------------------
A6LDS9_PARD8/6-121--------------------------------------------------------------------------------
G2IKI7_9SPHN/3-108--------------------------------------------------------------------------------
D2QPF2_SPILD/6-120--------------------------------------------------------------------------------
B3QYF9_CHLT3/7-111--------------------------------------------------------------------------------
R7BWA0_9BURK/14-118--------------------------------------------------------------------------------
A6WZG9_OCHA4/38-141--------------------------------------------------------------------------------
C1D6W6_LARHH/7-111--------------------------------------------------------------------------------
R5B7P2_9BACE/7-121--------------------------------------------------------------------------------
R5H459_9SPIR/13-116--------------------------------------------------------------------------------
R7JJ48_9BACT/7-119--------------------------------------------------------------------------------
Q74DP1_GEOSL/3-107--------------------------------------------------------------------------------
R5Q2I4_9PROT/6-109--------------------------------------------------------------------------------
A3N0G8_ACTP2/6-112--------------------------------------------------------------------------------
A4G8C4_HERAR/9-113--------------------------------------------------------------------------------
U5Q7E4_9BACT/7-121--------------------------------------------------------------------------------
E6SWV4_BACT6/6-120--------------------------------------------------------------------------------
K0HPY2_9BURK/13-117--------------------------------------------------------------------------------
R7JGE6_9FUSO/7-110--------------------------------------------------------------------------------
R6XHS7_9BACT/6-120--------------------------------------------------------------------------------
I0DPA6_PROSM/18-121--------------------------------------------------------------------------------
A1BAJ0_PARDP/9-112--------------------------------------------------------------------------------
Q8EH57_SHEON/7-111--------------------------------------------------------------------------------
G2LIQ0_CHLTF/3-106--------------------------------------------------------------------------------
E3F3V7_KETVY/10-113--------------------------------------------------------------------------------
X5DDK4_9BACT/6-120--------------------------------------------------------------------------------
I2EZ99_EMTOG/16-119--------------------------------------------------------------------------------
F8EEI4_RUNSL/3-106--------------------------------------------------------------------------------
F3ZRC2_9BACE/7-121--------------------------------------------------------------------------------
Q6F6M6_ACIAD/9-112--------------------------------------------------------------------------------
R6WBV4_9BACT/6-120--------------------------------------------------------------------------------
R5D1K2_9BACT/6-120--------------------------------------------------------------------------------
R7EWS2_9BACT/2-113--------------------------------------------------------------------------------
B0SL45_LEPBP/3-109--------------------------------------------------------------------------------
F4L194_HALH1/6-120--------------------------------------------------------------------------------
R6CXW8_9BACE/8-122--------------------------------------------------------------------------------
F2J1T6_POLGS/12-115--------------------------------------------------------------------------------
A4T0J4_POLSQ/14-117--------------------------------------------------------------------------------
A8ZVV9_DESOH/7-111--------------------------------------------------------------------------------
Q11YS2_CYTH3/6-121--------------------------------------------------------------------------------
Q3SFJ6_THIDA/7-111--------------------------------------------------------------------------------
D9SI46_GALCS/11-115--------------------------------------------------------------------------------
W0IXH8_9BACT/3-110--------------------------------------------------------------------------------
F8JCJ2_HYPSM/8-111--------------------------------------------------------------------------------
D8IXX1_HERSS/7-110--------------------------------------------------------------------------------
G2KSB6_MICAA/11-114--------------------------------------------------------------------------------
R5Y439_9BACE/6-120--------------------------------------------------------------------------------
R5NJ85_9BACT/38-152--------------------------------------------------------------------------------
W5X038_BDEBC/6-110--------------------------------------------------------------------------------
Q1QIE8_NITHX/17-120--------------------------------------------------------------------------------
S5XKS1_PARAH/9-112--------------------------------------------------------------------------------
C1AE72_GEMAT/11-115--------------------------------------------------------------------------------
G0A505_METMM/7-111--------------------------------------------------------------------------------
A7I2P3_CAMHC/6-120--------------------------------------------------------------------------------
R7L6H2_9BACT/6-109--------------------------------------------------------------------------------
E8QX61_ISOPI/7-111--------------------------------------------------------------------------------
D5AQ83_RHOCB/9-112--------------------------------------------------------------------------------
R5Y910_9PROT/6-109--------------------------------------------------------------------------------
A7IIY9_XANP2/18-121--------------------------------------------------------------------------------
D5EUK7_PRER2/7-121--------------------------------------------------------------------------------
E4RUT4_LEAB4/6-120--------------------------------------------------------------------------------
B8IYE0_DESDA/90-193--------------------------------------------------------------------------------
R5AYY1_9BACT/8-123--------------------------------------------------------------------------------
R5BPJ3_9BACE/6-120--------------------------------------------------------------------------------
F8BRI1_OLICO/10-113--------------------------------------------------------------------------------
I4B782_TURPD/8-122--------------------------------------------------------------------------------
B6ITG6_RHOCS/9-111--------------------------------------------------------------------------------
Q7MLC2_VIBVY/7-111--------------------------------------------------------------------------------
H8XSK5_FLAIG/6-120--------------------------------------------------------------------------------
F9Z5C1_ODOSD/6-120--------------------------------------------------------------------------------
Q9RW58_DEIRA/7-111--------------------------------------------------------------------------------
B4R8J2_PHEZH/10-113--------------------------------------------------------------------------------
G8T6T5_NIAKG/3-107--------------------------------------------------------------------------------
W0EYH8_9SPHI/5-109--------------------------------------------------------------------------------
R5EED1_9BURK/17-121--------------------------------------------------------------------------------
C6WUJ2_METML/7-111--------------------------------------------------------------------------------
T2G873_DESGI/9-113--------------------------------------------------------------------------------
E8UXU2_TERSS/9-110--------------------------------------------------------------------------------
D5SY52_PLAL2/48-153--------------------------------------------------------------------------------
F2IAM6_FLUTR/6-121--------------------------------------------------------------------------------
R6IPE3_9PROT/6-109--------------------------------------------------------------------------------
R5HYR9_9BACT/6-120--------------------------------------------------------------------------------
D9QGJ5_BRESC/9-112--------------------------------------------------------------------------------
B8DLP8_DESVM/13-116--------------------------------------------------------------------------------
Q2W577_MAGSA/8-111--------------------------------------------------------------------------------
R6A733_9BACT/7-121--------------------------------------------------------------------------------
B8FCH3_DESAA/5-109--------------------------------------------------------------------------------
B1MFP9_MYCA9/9-111--------------------------------------------------------------------------------
A5VEJ7_SPHWW/9-113--------------------------------------------------------------------------------

PF13536

Q03V04_LEUMM/46-308---------------------------------------------------RYLWMLPMLALIFIPLGG..SFRRV...N
E3EHL7_PAEPS/38-305---------------------------------------------------RYLFMVPMLFVIVMAQH...KLKPL...W
D3FXX0_BACPE/38-305---------------------------------------------------RFFFMVPFLLLIVWLRG...GLADL...F
A6LSV6_CLOB8/39-306---------------------------------------------------RYIFMLPLLLIIMIINR...QLNPV...L
Q5KZD5_GEOKA/38-305---------------------------------------------------RFFFMVPLLFVILLARR...NLGPV...W
I0I5E6_CALAS/39-305---------------------------------------------------RYLWMTLFLVVGPVLIGRGRLLLDT...L
YJLA_BACSU/38-305---------------------------------------------------RFIFMVPFLCLIVIMRG...TFTPL...L
A1SUW4_PSYIN/39-305---------------------------------------------------RYLFMVIFLLIIALLSDGIKQLKQL...L
C4L5N6_EXISA/38-295---------------------------------------------------RFLWMIPLLLVVVAFRG...GLKRV...L
C3AMC2_BACMY/38-297---------------------------------------------------RYYFMVPLLLIIVMYRG...NLKQL...F
M1LX20_9CLOT/39-306---------------------------------------------------RYIFMLPILFIIVIIKN...ELFEV...L
U5MU36_CLOSA/39-306---------------------------------------------------RYIFMLPILFIIMIIKN...QLFHV...L
D5QCP1_KOMHA/49-311---------------------------------------------------RYVDMAVLLALWLLLRRGPAYLGAV...L
E3H778_ILYPC/15-282---------------------------------------------------RFFFMVPFLYIIVFIRG...DLKPL...I
Q65J98_BACLD/38-305---------------------------------------------------RFIFMAPLLFAIVWLRG...NVKEL...F
B1YFT7_EXIS2/38-292---------------------------------------------------RFYLMLPLLVVIVAYRR...RLGRV...W
K8E5D6_CARML/38-305---------------------------------------------------RFLFAIPFLLLLVIGRK...GLKEL...L
W6EPU7_SULMU/39-303---------------------------------------------------RYAFMILFLLIVIRLFQGKKPLHAL...F
C0QIH1_DESAH/39-304---------------------------------------------------RYFFMILILTTLISLFKGTATTRSL...F
Q6ANG8_DESPS/39-305---------------------------------------------------RYLFMIIFLSAILFSQGGLRQIKDV...L
H6NI93_9BACL/38-300---------------------------------------------------RYFFMVPLLLLLV.GRH...HLKPL...W
R5J4C6_9CLOT/39-299---------------------------------------------------RYLFTFPILAAVLAISGKKQKTRPLSHTW
K7SQ00_GLUOY/57-318---------------------------------------------------RYVDMAFLLSAWLLVRRGPRYLAAV...L
D1AJ88_SEBTE/37-293---------------------------------------------------RHFFIFIFFFVWLGIKK...EIKPV...I
D5DKL9_BACMD/38-296---------------------------------------------------RYFFMVPLLLVLVYFWG...GIKPV...V
F2F9M1_SOLSS/38-303---------------------------------------------------RYFFMLPFLIAIVAIRGKV.GFRIL...S
C7JCT5_ACEP3/62-324---------------------------------------------------RYIETALLLLVWGFVAKGPRWVGAI...W
Q9KE50_BACHD/38-301---------------------------------------------------RFFFMLPFLFLIVLFRR...NVREV...F
G7MAH8_9CLOT/39-306---------------------------------------------------RYVFMLPILSVIVFFKK...ELFYV...L
U5RPE5_9CLOT/54-321---------------------------------------------------RYIFTLPILFVIMIVKN...ELSEV...V
B5EDY2_GEOBB/39-305---------------------------------------------------RYLYMFAMFSAWLVLTGKSRLLREV...F
C7PA25_CHIPD/45-307---------------------------------------------------RSLFLIPILGLVVFLAG...QLKST...L
F0JIH0_DESDE/39-305---------------------------------------------------RYFWMLVMLLGWLAATGKGRLASES...L
M4NIF9_9GAMM/43-304---------------------------------------------------RYLITLPLLVVVLPLQG...GLGEL...P
C6BZX5_DESAD/38-303---------------------------------------------------RYFWMLALLFIGLGFF.RRELLLSS...F
Q6LY72_METMP/38-305---------------------------------------------------RYIFTLPFLLIILYGKN...NIKKV...I
C8WR01_ALIAD/49-311---------------------------------------------------RYFLTLPILFTYVAWKG...RIGAL...L
X2GJH8_9BACI/38-301---------------------------------------------------RYFFMLPFLLAIVFYRK...GFSPL...T
I4D678_DESAJ/38-305---------------------------------------------------RYEFMVPPLLLIVIVRG...NIKAL...L
A5WEC6_PSYWF/39-359---------------------------------------------------RYVFMLLLVSAIIIAQHGMGRLKQL...T
Q4FTR9_PSYA2/39-359---------------------------------------------------RYLFMWLIITILIAMQHGFGRIKEL...S
E1VGW5_9GAMM/39-307---------------------------------------------------RYGFVLAFLAVGLLLTGHVRLILAA...V
C3ARA6_BACMY/38-305---------------------------------------------------RFLFALPILFLIVLFRK...NLWPL...W
C4XLI6_DESMR/39-305---------------------------------------------------RYAFMLPILLLWTLASGGPRAVTEA...L
D5V665_ARCNC/39-305---------------------------------------------------RYFFMILFLFFVLLFQGGIQRVIDV...C
Q74GJ7_GEOSL/39-305---------------------------------------------------RYGYMLLLLCTWLLLKGRRGVLIAA...W
U5L9M7_9BACI/38-300---------------------------------------------------RFMFMVPFLVIIVALRG...NGKQL...W
J7J0N8_DESMD/38-305---------------------------------------------------RYLFMVPPLLLIVIIRG...NFKPL...L
Q5WCC4_BACSK/44-307---------------------------------------------------RFLFMLPFLLVIVYIRT...GFKAL...W
N0ASW8_9BACI/38-305---------------------------------------------------RYFLMVPFLFLIVLFRG...NLTLL...F
R5FF82_9CLOT/39-293---------------------------------------------------RYLFTFPILRIMLAGSP...SPARV...W
E6VZC7_DESAO/38-303---------------------------------------------------RYFWMLALLVAGLLAF.RRPLLVET...L
X4ZGT8_9BACL/90-357---------------------------------------------------RYFFTLPFLLALVAGRR...RLKPL...L
D5DEQ8_BACMD/38-305---------------------------------------------------RFLLALPILLILVLVQK...KFTPL...W
A9B6H6_HERA2/38-299---------------------------------------------------RYLFMLVPLLAIVVWRG...KLGLV...L
F0SEG2_PEDSD/42-303---------------------------------------------------RYIITLPIILLIALFNK...EAKIL...F
F4CEV5_SPHS2/37-299---------------------------------------------------RSLFMIPVMLLPLLVTK...KFKTF...W
K0AXA0_CLOA9/38-305---------------------------------------------------RYFMAIPILFIIVAIRG...ELKPL...F
M1WNJ2_DESPC/39-305---------------------------------------------------RYFWMLFFLAVWLGVTGKARLGMDA...L

PF02694

YFJF_BACSU/2-109--------------------------------------------------------------------------------
YNFA_ECOLI/1-108--------------------------------------------------------------------------------
Y793_SYNY3/2-108--------------------------------------------------------------------------------
Y2639_MYCTU/2-109--------------------------------------------------------------------------------

PF07168

A9T133_PHYPA/41-393IGPDTPEAPNFLTQLFQ..ENGPSVAFALAGGLALCLGNISLQYSLAFVGISLTEVVSASVAVVLGTTVNYFLDDGLNRA
K4ATM4_SOLLC/41-402IGTSSLEKPNFLSQLAQ..DNWPSVLFAMAGGVVLSIGNLTTQYAWAFVGLSVTEVVSSSITVVIGTTLNYYLDDKINKA
K4BXV4_SOLLC/41-401FGPSTPERPNFLTQLSQ..DNWPSVLFAMAGGMVLSLGNLSTQYAFAFVGLSVTEVVSASITVVIGTTLNYYLDDKINKA
D7LQJ5_ARALL/41-385IG...PSRPNFFTQLSQ..DNWQSVMFAMAGGIVLSLGNLATQYAWAYVGLSVTEVIAASITVVIGTTLNYFLDDRINRA
A9S1P5_PHYPA/41-386IGSSTPEQPNFITQLHQ..DNWPSVGFALAGGLVLFMGNLACQYAWPFVGLSVTEVVSASITVVAGTTMNYFLDDRINRA
D8RRC9_SELML/41-386IGDSDPSAPNFIQQLSQ..DNLPCVLIAMAGGIALCLGNICMQYSLVFVGISITEVISASLAVIFGTTANYYLDNCLNSA
C5YNZ3_SORBI/41-417IGPDTPETPNFLTQLAQVQNNWPSVLFAMAGGVTLSLGTLATQYGWAFVGLSVTEVMASSLKVVIGTTLNYFLDGRINKA
D7LQI7_ARALL/41-397IGSTKPDSPNFITQLAQ..DNWPSVMFAMAGGIVLSLGNLATQYAWALVGLSVTEVVTSSITVVIGSTLNYFLDDKINKA
D7LQI6_ARALL/41-402IGKSTFRKPDFTTQLPQ..DNWPSVLLAVAGGVLLSIGNLATQYAFAFVGLSVTEVITASITVVIGTTLNYFLDDKINKA
K4BNE7_SOLLC/41-401IGTNSMKQPNFLTQLSQVQDNWPSVLFAIAGGVVLSLGNLSTQYAWAFVGLSVTEVITASITVVIGTTLNYYLDDKINKA
D8STK4_SELML/41-404IGESSTQTPNFLEQLKQ..DNWPSVGFAMAGGIVLCLGNLSLQYALAYVGLSVAEVISCSITVVAGTTMNYFLDDRINRA
M0SF12_MUSAM/41-412IGDSTPEMPNFITQLGQ..DNWPSTLFAMAGGIVLSLGNLSTQYAWAYVGLSVTEVISSSITVVIGTTLNYFLDDRINRA
I1J5Z9_SOYBN/68-423IGKGTHDQPNFLVQLAQ..DNWPSVLFAMGGGLFLSLGNLSSQYAFAFVGLSVTEVITASITVVIGTTLNYFLDDKINKA
B9HIE2_POPTR/41-399IGS...GRPNFTTQLSQ..DNWPSIMFAMAGGVVLSLGNLSTQYAWAFVGLSVTEVITSSITVVIGTTLNYFLDDKINKA
I1II69_BRADI/41-408IGPDSPDTPNFLTQLARPQDTWPSILFAMAGGVVISLGTLATQYGWAYVGLSVTEVMASSLKVVIGTTLNYFLDGRINKA
I1II72_BRADI/41-402LGD...GRPNFFTQLRQAQDDWPSVLFALGGGAALSVGNLCTQYGWAYVGLSLTEVIVSSLTVVVGTTLNYFLDNKINSA
I1R8V4_ORYGL/41-393LGGTSPGMPSFFTQLTQ..DNWPSVLFAMAGGIALSIGNLISQYAWAFVGLSVTNIICSSLAVVLGTTMNYFLDGRINRA
Q2QQ90_ORYSJ/41-411IGADTPETPNFLTQLTQMQDNWPSILFAMSGGIFNGLGTLATQYGWAFVGLSVTEVMASSLKVVIGTTLNYFLDGRINKA
UPS5_ARATH/49-404IGESTHEAPSFITQLTQIQDNWPSVLFAMAGGVGLSIGNLATQYSLAFVGLSVTEVTAASITVVVGTTVNYFLDNGLNRA

PF06379

A0A017QNF2_SALET/1-344ASAACFYAPFKQVKQWSWETMWSVGGIVSWLILPWTISALLLPDFWAYYGQFNLSTLLPVFLFGAMWGIGNINYGLTMRY
A0A014M1F6_YERPE/1-344ASAACFYAPFKQVKKWSWETMWSIGGLVSWLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIGNINYGLTMRY

PF02535

Q17996_CAEEL/106-349----------------------------------------------SATWI.YALIGCSLVVSTGILPAFLLPANIHV..
S39A8_MOUSE/126-453----------------------------------------------SEVWG.YGFLSVTIINLASLLGLILTPLIKKS..
ZIP1_ARATH/48-352----------------------------------------------TKLKL.GSIALLLVAGGVGVSLPLIGKRIPALQ.
IRT1_ARATH/49-344----------------------------------------------LPLKV.IAIFVILIASMIGVGAPLFSRNVSFLQ.
P91348_CAEEL/4-439----------------------------------------------AILKL.VLMFVMFSLTVIVGLSPLKVLHKLRH..
S39AD_DROME/33-350----------------------------------------------YTPWV.FSLLGSVVIGLSGIFPLIIIPTEEKM..
Q9VFA2_DROME/25-359----------------------------------------------DLEKV.LAMLVLGLGSLLFGLLPAFISERNRR..
IRT2_ARATH/44-347----------------------------------------------LPLKI.VAIVAILTTSLIGVTSPLFSRYISFLR.
S39A6_HUMAN/322-743----------------------------------------------QIAWV.GGFIAISIISFLSLLGVILVPLMNRV..
Q9VEX1_DROME/53-407----------------------------------------------LVAKV.TAMVVLFCASAICGSIPFLLNRCYRW..
Y1036_METJA/5-231----------------------------------------------VEVPIFIAILSFIVMCIGELLAYYSVSLKYKY..
O62192_CAEEL/30-311----------------------------------------------DALRA.VLLIVLFALTFAAGMIATFLKGEW....
S39A2_HUMAN/5-306----------------------------------------------LGIKL.GCLFALLALTLGCGLTPICFKWFQIDAA
ZIP10_ARATH/49-361----------------------------------------------LDLKL.LSIFSILITSLIGVCLPFFARSIPAFQ.
S39AA_HUMAN/404-819----------------------------------------------ASAWI.CGIISITVISLLSLLGVILVPIINQG..
Q9XVJ5_CAEEL/4-376----------------------------------------------VSFLL.VLSSAMFFGSYMAGSIPLMFS.......
ZIP3_ARATH/51-336----------------------------------------------RKYKI.AAIPTVLIAGIIGVLFPLLGKVFPSLR.
ZUPT_ECOLI/5-248----------------------------------------------LILTI.LAGAATFIGAFLGVLGQK..........
S39A5_MOUSE/208-522----------------------------------------------LSALL.HSGLAVLFLSLPAPLSLLLLRLLGPR..
Q9X260_THEMA/2-241----------------------------------------------VLKGILYSTIAGMATSLGALPFLFLKPHH.....
ATX2_YEAST/4-307----------------------------------------------LGVIL.LASFLLIATFLIGLIPLYYIDKQKSSIV
ZIP4_ARATH/25-371----------------------------------------------FLLKF.VAIASILLAGAAGVAIPLIGRNRRFLQ.
Q9XWH3_CAEEL/4-315----------------------------------------------ELLKW.IMLGVMALMTIIFGLLPIKVISYLNT..
ZRT2_YEAST/24-419----------------------------------------------AGLRI.LAVFIILISSGLGVYFPILSSRYSFIR.
Q9XVR4_CAEEL/9-378----------------------------------------------FDTVL.YGVISVTVVSLLSLGGACIGPLMTKD..
YKE4_YEAST/63-344----------------------------------------------LGPRY.NAIVAILIIQLMPCLFVLFVPGLRKN..
ZIP2_ARATH/61-350----------------------------------------------VLVKI.YCIIILFFSTFLAGVSPYFYR.......
FOI_DROME/258-684----------------------------------------------FYVWI.YAFISVFACGILGLVGVAIIPFMGSR..
ZRT1_SCHPO/60-405----------------------------------------------LGYRI.GAIFVILATSLIGMNLPLVLSKITKNRP
ZRT1_YEAST/47-373----------------------------------------------LGARI.SSVFVILFVSTFFTMFPLISTKVKRLR.
S39A7_MOUSE/140-473----------------------------------------------VTLWA.YALGATVLISAAPFFVLFLIPVESNS..
ZIP6_ARATH/24-338----------------------------------------------SHLKI.VAVFAIFLTSVFGVWGPVLLAKYFHGKP
ZIP2_SCHPO/8-384----------------------------------------------ILS...LSINAFCVFGASGIYLDKLVNKWFGY..
S39A1_MOUSE/27-320----------------------------------------------LEVKL.GALVLLLLLTLICSLVPVCVLRRSGA..
HKE42_CAEEL/155-459----------------------------------------------TRLWV.YAISATLLISAAPCFILMFIPIQANT..
CSUP_DROME/129-446----------------------------------------------STIWL.HSIGSTLLISAAPFVLLYIIPLDNSE..
Q09957_CAEEL/4-356----------------------------------------------FLFMT.TSAFAVFILLLISTSIPYTFLRTCCVN.

PF16965

C5DEG8_LACTC/3-369LYFLFAHCSSWILVAPLTQVYYYVRYGKTNRREIWNMGFWVAI......QDYNIGSDAEAQMQGASKVGRQ.........
I2H772_TETBL/1-419VYLAFMYFGGWLLLLPLSALIKDETRTSLLPLGGSSNQRPAAIRSPTTSSERGLANGADSVTPSVTSSTSALDIPPTIAE
G0VFG5_NAUCC/1-403VYLTFIYFASWLLVLPLSRLWKDDAKPLLP...................LENSIASNSSLSLDHDEDDEIDNVIDTVTVD
J7SAV7_KAZNA/1-372VQMAIVYFASWLLLLPIARIWNITTL.......................KSSALESGAESSSSLNLVRSTDNFFDETTNG
A7TJZ2_VANPO/1-355VYLTFIYFASWLLIFPLSKLLKD.................................NSTSSLPISNQIENRINSENLNL.
J7RRP8_KAZNA/1-406IYLAFIYFVSLLLLLPITSFFTDKIGSMGSGYSRVPDGTDE........RENMVSNSSEEEYELQNIVSPRPSALSLDLT
G8ZTN7_TORDC/1-379VVLAFMYFASLLLLSPVARFFDKA.........................KETKRKRNSTAPLTLSS.SSSDLELQTLTEE
G0WDU7_NAUDC/2-437VYLTFIYFASWLLILPISRIWNETTSSSTFSTVSSNDNEQLLPL.....SMNDPNGNSSSSLSLDDGDTNDATLGDKIKK
C5DPJ8_ZYGRC/1-375IFLLFMYFVPWLLLVPSARLVSIASSMTVSRPGTPELRARGERNGIMDGENNNNSNNGRSYDSYDNGVKNNDIIG.....
H2AWT3_KAZAF/1-414IYLTSLYFVSLLLLLPVARFYIDFSNRN.....................KNPFEEFEEEESYELNPVTSSRSTIDQHDEL
E7K9R5_YEASA/1-403FYLTFMYFASWLLLVPASRLWEKMRPMFVSDSDSN..............RNSQFDNNNSGSVTNEDVDTFSHVLDDPQPR
Q6FQN7_CANGA/1-416LYLTFIYFASWTFLMPIAKMWKEFK.............................QSTEPDQADLVPIVEGDEDPEHRNTN

PF02537

C6WWF8_METML/11-123--------------------------------------------------------------------------------
CRCB2_STAEQ/5-115--------------------------------------------------------------------------------
C9SP40_VERA1/254-364--------------------------------------------------------------------------------
A8FBH5_BACP2/4-113--------------------------------------------------------------------------------
CRCB2_PROAC/4-117--------------------------------------------------------------------------------
B3QV70_CHLT3/8-120--------------------------------------------------------------------------------
C1D9V8_LARHH/7-119--------------------------------------------------------------------------------
G0VL39_MEGEL/5-118--------------------------------------------------------------------------------
CRCB_METFK/5-119--------------------------------------------------------------------------------
D7C3E0_STRBB/34-146--------------------------------------------------------------------------------
CRCB_AGRT5/5-118--------------------------------------------------------------------------------
M3A446_MYCFI/449-566--------------------------------------------------------------------------------
R5ASY3_9BACT/6-119--------------------------------------------------------------------------------
L0GYQ4_9GAMM/6-118--------------------------------------------------------------------------------
K5WXB2_AGABU/250-360--------------------------------------------------------------------------------
R5M4P7_9BACE/6-118--------------------------------------------------------------------------------
R6IVI8_9PROT/5-112--------------------------------------------------------------------------------
CRCB_OCEIH/5-116--------------------------------------------------------------------------------
CRCB1_LEIXX/7-119--------------------------------------------------------------------------------
D2BDX8_STRRD/29-141--------------------------------------------------------------------------------
F0LQJ5_VIBFN/9-121--------------------------------------------------------------------------------
CRCB2_BACLD/5-113--------------------------------------------------------------------------------
CRCB2_SYMTH/3-115--------------------------------------------------------------------------------
C4KCX0_THASP/7-119--------------------------------------------------------------------------------
R5ETQ3_9BACE/7-118--------------------------------------------------------------------------------
R5XBL0_9CLOT/5-117--------------------------------------------------------------------------------
F8E4Q4_FLESM/4-117--------------------------------------------------------------------------------
R5CLX0_9BACT/6-119--------------------------------------------------------------------------------
CRCB_KORVE/7-117--------------------------------------------------------------------------------
C6X4K7_FLAB3/5-116--------------------------------------------------------------------------------
W6S7T4_9CLOT/5-115--------------------------------------------------------------------------------
CRCB_THET8/5-117--------------------------------------------------------------------------------
CRCB_CHLAA/5-118--------------------------------------------------------------------------------
E6K2D1_PARDN/8-130--------------------------------------------------------------------------------
CRCB_LEGPH/7-120--------------------------------------------------------------------------------
R5EGH4_9GAMM/6-118--------------------------------------------------------------------------------
E9DRD7_METAQ/373-482--------------------------------------------------------------------------------
C4XY25_CLAL4/192-311--------------------------------------------------------------------------------
CRCB2_MYCTU/13-121--------------------------------------------------------------------------------
E8R574_ISOPI/9-121--------------------------------------------------------------------------------
S3DSZ6_GLAL2/346-455--------------------------------------------------------------------------------
R4KGL0_9FIRM/4-114--------------------------------------------------------------------------------
B1MB99_MYCA9/26-141--------------------------------------------------------------------------------
D6XXI5_BACIE/10-121--------------------------------------------------------------------------------
C7M331_ACIFD/13-125--------------------------------------------------------------------------------
D7BPA4_ARCHD/2-113--------------------------------------------------------------------------------
M4RZG3_9SPHN/5-119--------------------------------------------------------------------------------
R6IXJ2_9CLOT/5-113--------------------------------------------------------------------------------
CRCB_SYNY3/9-121--------------------------------------------------------------------------------
B9GUE1_POPTR/148-267--------------------------------------------------------------------------------
G2PRJ4_MURRD/5-117--------------------------------------------------------------------------------
L2G8F8_COLGN/310-420--------------------------------------------------------------------------------
I7HE85_9HELI/6-120--------------------------------------------------------------------------------
A5E776_LODEL/317-433--------------------------------------------------------------------------------
CRCB_NITSB/7-117--------------------------------------------------------------------------------
CRCB1_PROAC/17-131--------------------------------------------------------------------------------
H3ZNJ0_THELN/7-118--------------------------------------------------------------------------------
G2TNF8_BACCO/4-117--------------------------------------------------------------------------------
CRCB_BACFN/5-119--------------------------------------------------------------------------------
CRCB1_METAC/5-116--------------------------------------------------------------------------------
C5D7E4_GEOSW/6-119--------------------------------------------------------------------------------
E4MZN3_KITSK/10-122--------------------------------------------------------------------------------
D3BAW9_POLPA/73-187--------------------------------------------------------------------------------
R5H7M2_9FIRM/6-118--------------------------------------------------------------------------------
CRCB1_BACSK/8-118--------------------------------------------------------------------------------
R5CN17_9BACT/6-120--------------------------------------------------------------------------------
G2QBD4_THIHA/273-388--------------------------------------------------------------------------------
M4YQP3_9EURY/10-117--------------------------------------------------------------------------------
C6XLD7_HIRBI/5-118--------------------------------------------------------------------------------
S0EVW8_CHTCT/9-120--------------------------------------------------------------------------------
CRCB_BORPD/11-121--------------------------------------------------------------------------------
G0L6H9_ZOBGA/5-117--------------------------------------------------------------------------------
F8B1R5_FRADG/37-148--------------------------------------------------------------------------------
CRCB2_DEIGD/5-121--------------------------------------------------------------------------------
CRCB_HYPNA/5-119--------------------------------------------------------------------------------
R6KNV6_9BACE/5-117--------------------------------------------------------------------------------
N0BF30_9EURY/5-116--------------------------------------------------------------------------------
R5CZJ3_9FIRM/5-115--------------------------------------------------------------------------------
CRCB_WOLSU/5-117--------------------------------------------------------------------------------
T0U590_9ENTE/4-110--------------------------------------------------------------------------------
I5AZX8_9DELT/5-119--------------------------------------------------------------------------------
CRCB1_BACSU/5-114--------------------------------------------------------------------------------
L0EDL6_THECK/5-117--------------------------------------------------------------------------------
C8W9R6_ATOPD/5-116--------------------------------------------------------------------------------
CRCB_HYDS0/4-116--------------------------------------------------------------------------------
CRCB1_DEIGD/7-120--------------------------------------------------------------------------------
R5CMS3_9FIRM/5-113--------------------------------------------------------------------------------
A8FBH6_BACP2/5-114--------------------------------------------------------------------------------
CRCB_PSYWF/4-116--------------------------------------------------------------------------------
F5YT39_MYCSD/33-144--------------------------------------------------------------------------------
D2W3G1_NAEGR/379-490--------------------------------------------------------------------------------
W8X514_CASDE/6-118--------------------------------------------------------------------------------
R0K2X2_SETT2/485-602--------------------------------------------------------------------------------
E8UC80_DEIML/3-114--------------------------------------------------------------------------------
CRCB2_LACSS/4-111--------------------------------------------------------------------------------
V4J700_9DELT/5-119--------------------------------------------------------------------------------
CRCB_NOSS1/36-150--------------------------------------------------------------------------------
CRCB_NOVAD/5-119--------------------------------------------------------------------------------
CRCB_PROA2/9-121--------------------------------------------------------------------------------
G0W4L0_NAUDC/237-356--------------------------------------------------------------------------------
M5DRR4_9GAMM/4-117--------------------------------------------------------------------------------
J7QR13_METSZ/4-117--------------------------------------------------------------------------------
C7M7A1_CAPOD/6-119--------------------------------------------------------------------------------
F6BEH8_METIK/5-114--------------------------------------------------------------------------------
J7LE55_NOCAA/58-169--------------------------------------------------------------------------------
K0CCV4_ALCDB/9-121--------------------------------------------------------------------------------
A1A1D2_BIFAA/43-157--------------------------------------------------------------------------------
D3PZ73_STANL/6-117--------------------------------------------------------------------------------
R6QEN7_9FIRM/5-117--------------------------------------------------------------------------------
R7HRQ9_9BACT/6-117--------------------------------------------------------------------------------
D3DI07_HYDTT/5-118--------------------------------------------------------------------------------
M4G634_MAGP6/261-375--------------------------------------------------------------------------------
R6Y3S9_9FIRM/5-114--------------------------------------------------------------------------------
M9RC40_9RHOB/6-116--------------------------------------------------------------------------------
F2KZA6_PREDF/6-120--------------------------------------------------------------------------------
CRCB_CAMHC/6-119--------------------------------------------------------------------------------
H6R9E5_NOCCG/16-128--------------------------------------------------------------------------------
A1VMF2_POLNA/5-116--------------------------------------------------------------------------------
CRCB1_CLOAB/5-118--------------------------------------------------------------------------------
K9Z4N8_CYAAP/12-122--------------------------------------------------------------------------------
B8NQY0_ASPFN/290-411--------------------------------------------------------------------------------
G4ST05_META2/6-120--------------------------------------------------------------------------------
D2S7W2_GEOOG/4-116--------------------------------------------------------------------------------
F2IKB4_FLUTR/4-118--------------------------------------------------------------------------------
CRCB_CAUCR/5-119--------------------------------------------------------------------------------
I2BBA6_SHIBC/6-118--------------------------------------------------------------------------------
R5RJJ6_9FIRM/5-115--------------------------------------------------------------------------------
I7ETE5_PHAIB/6-118--------------------------------------------------------------------------------
H6C454_EXODN/374-484--------------------------------------------------------------------------------
CRCB2_LEIXX/17-131--------------------------------------------------------------------------------
C5AXC1_METEA/6-118--------------------------------------------------------------------------------
CRCB3_BIFLO/7-119--------------------------------------------------------------------------------
K3WL52_PYTUL/283-404--------------------------------------------------------------------------------
C5ACE0_BURGB/6-118--------------------------------------------------------------------------------
CRCB2_YERPE/6-118--------------------------------------------------------------------------------
E0UEC0_CYAP2/11-125--------------------------------------------------------------------------------
A1R8I4_ARTAT/19-132--------------------------------------------------------------------------------
Q035E4_LACC3/13-122--------------------------------------------------------------------------------
V5UCX4_9BURK/6-118--------------------------------------------------------------------------------
CRCB_RHOBA/8-137--------------------------------------------------------------------------------
E1ZCW8_CHLVA/348-466--------------------------------------------------------------------------------
G4T5L1_PIRID/243-353--------------------------------------------------------------------------------
Q5KAE8_CRYNJ/258-374--------------------------------------------------------------------------------
E3GYY7_METFV/11-123--------------------------------------------------------------------------------
G0A435_METMM/5-118--------------------------------------------------------------------------------
B7GAP9_PHATC/378-490--------------------------------------------------------------------------------
U5MTZ5_CLOSA/5-116--------------------------------------------------------------------------------
D5BHQ3_ZUNPS/6-118--------------------------------------------------------------------------------
CRCB_TOLAT/6-118--------------------------------------------------------------------------------
D3VAF1_XENNA/6-117--------------------------------------------------------------------------------
E3Q272_COLGM/355-464--------------------------------------------------------------------------------
U7PUX1_SPOS1/392-505--------------------------------------------------------------------------------
A7TEG1_VANPO/253-372--------------------------------------------------------------------------------
A0KEF5_AERHH/18-131--------------------------------------------------------------------------------
R5D5F3_9FIRM/5-115--------------------------------------------------------------------------------
M9MIG9_PSEA3/340-458--------------------------------------------------------------------------------
A5N506_CLOK5/5-118--------------------------------------------------------------------------------
CRCB1_THEFY/4-112--------------------------------------------------------------------------------
D4H0T5_DENA2/4-117--------------------------------------------------------------------------------
C8XKP0_NAKMY/30-140--------------------------------------------------------------------------------
I4Y5T4_WALSC/195-308--------------------------------------------------------------------------------
C4L2E8_EXISA/4-117--------------------------------------------------------------------------------
R6ANW5_9BACT/1-111--------------------------------------------------------------------------------
B2GKQ2_KOCRD/11-124--------------------------------------------------------------------------------
D5GBZ0_TUBMM/232-341--------------------------------------------------------------------------------
D9SY00_MICAI/31-140--------------------------------------------------------------------------------
J3PZU4_PUCT1/267-383--------------------------------------------------------------------------------
R5X278_9BACT/7-116--------------------------------------------------------------------------------
W5X599_9BACT/8-120--------------------------------------------------------------------------------
H6BKG0_EXODN/235-345--------------------------------------------------------------------------------
Q7SB51_NEUCR/400-510--------------------------------------------------------------------------------
CRCB_NAUPA/7-120--------------------------------------------------------------------------------
R9T8D3_9EURY/6-115--------------------------------------------------------------------------------
A8IAM2_AZOC5/31-149--------------------------------------------------------------------------------
CRCB_THEMA/7-120--------------------------------------------------------------------------------
CRCB_BORPE/10-120--------------------------------------------------------------------------------
M0TIZ7_MUSAM/414-528--------------------------------------------------------------------------------
C5G6P1_AJEDR/432-565--------------------------------------------------------------------------------
CRCB_DICNV/5-117--------------------------------------------------------------------------------
CRCB2_NITHX/4-117--------------------------------------------------------------------------------
M4CKA5_BRARP/127-244--------------------------------------------------------------------------------
CRCB_METJA/6-116--------------------------------------------------------------------------------
C7N638_SLAHD/6-121--------------------------------------------------------------------------------
F8PP72_SERL3/170-280--------------------------------------------------------------------------------
H8GL89_METAL/5-118--------------------------------------------------------------------------------
F7V936_CLOSS/5-115--------------------------------------------------------------------------------
G1WYL7_ARTOA/302-412--------------------------------------------------------------------------------
A9TSK9_PHYPA/17-127--------------------------------------------------------------------------------
R7XRH6_9ACTO/3-115--------------------------------------------------------------------------------
D5AM26_RHOCB/6-117--------------------------------------------------------------------------------
C8W1M9_DESAS/5-115--------------------------------------------------------------------------------
J7S9K9_KAZNA/261-379--------------------------------------------------------------------------------
M4BCV8_HYAAE/316-434--------------------------------------------------------------------------------
H8XUS4_FLAIG/6-119--------------------------------------------------------------------------------
CRCB_LEPIN/8-121--------------------------------------------------------------------------------
D3PBW8_DEFDS/4-117--------------------------------------------------------------------------------
CRCB_MANSM/8-120--------------------------------------------------------------------------------
F2JWF0_MARM1/4-117--------------------------------------------------------------------------------
Q0TWS1_PHANO/407-524--------------------------------------------------------------------------------
CRCB_DESVH/5-118--------------------------------------------------------------------------------
K4IR73_BIFAP/14-126--------------------------------------------------------------------------------
CRCB_MAGSA/5-120--------------------------------------------------------------------------------
D6S5U3_9LACO/8-114--------------------------------------------------------------------------------
A4XUX5_PSEMY/7-120--------------------------------------------------------------------------------
E7KJR4_YEASA/242-361--------------------------------------------------------------------------------
M2NHH3_BAUCO/447-563--------------------------------------------------------------------------------
A1SVE3_PSYIN/9-122--------------------------------------------------------------------------------
CRCB2_BACCR/5-113--------------------------------------------------------------------------------
R7Z6B3_CONA1/475-594--------------------------------------------------------------------------------
I3YSC9_AEQSU/5-117--------------------------------------------------------------------------------
R6XGS9_9BACT/6-118--------------------------------------------------------------------------------
H6LFI8_ACEWD/5-122--------------------------------------------------------------------------------
E8V0J1_TERSS/5-118--------------------------------------------------------------------------------
A0CCJ9_PARTE/7-113--------------------------------------------------------------------------------
E1VK19_9GAMM/6-116--------------------------------------------------------------------------------
A6VLE2_ACTSZ/6-118--------------------------------------------------------------------------------
CRCB2_LISMO/4-114--------------------------------------------------------------------------------
C5ZY55_9HELI/7-132--------------------------------------------------------------------------------
C7NDH5_LEPBD/4-113--------------------------------------------------------------------------------
R6UNI6_9FIRM/5-115--------------------------------------------------------------------------------
CRCB_PSEHT/1-113--------------------------------------------------------------------------------
CRCB_SHEON/5-117--------------------------------------------------------------------------------
R7LGK9_9BACT/6-117--------------------------------------------------------------------------------
CRCB1_SYNPX/9-120--------------------------------------------------------------------------------
E4T0Z0_PALPW/5-118--------------------------------------------------------------------------------
CRCB_CAUSK/5-119--------------------------------------------------------------------------------
CRCB_DESAD/5-118--------------------------------------------------------------------------------
CRCB1_BACLD/5-114--------------------------------------------------------------------------------
CRCB_METMP/5-115--------------------------------------------------------------------------------
R6TCQ5_9BACE/6-117--------------------------------------------------------------------------------
D4Z191_SPHJU/5-120--------------------------------------------------------------------------------
A4FCL9_SACEN/27-138--------------------------------------------------------------------------------
F9YPS8_CAPCC/6-118--------------------------------------------------------------------------------
CRCB_AZOVD/6-119--------------------------------------------------------------------------------
I3YKA1_ALIFI/6-119--------------------------------------------------------------------------------
CRCB_GEOSL/5-118--------------------------------------------------------------------------------
CRCB_HAEIN/5-117--------------------------------------------------------------------------------
CRCB2_GEOKA/4-117--------------------------------------------------------------------------------
CRCB1_FRASC/4-121--------------------------------------------------------------------------------
Q4PD24_USTMA/175-285--------------------------------------------------------------------------------
F0RHR7_CELLC/5-117--------------------------------------------------------------------------------
A0JYB8_ARTS2/13-125--------------------------------------------------------------------------------
B1X047_CYAA5/9-121--------------------------------------------------------------------------------
R7BXD8_9BURK/14-126--------------------------------------------------------------------------------
V5SAX2_9RHIZ/5-118--------------------------------------------------------------------------------
I7A6W3_MELRP/5-117--------------------------------------------------------------------------------
F0XIJ5_GROCL/765-880--------------------------------------------------------------------------------
CRCB_BACTN/6-119--------------------------------------------------------------------------------
Q6BZJ5_DEBHA/257-375--------------------------------------------------------------------------------
D5UMQ9_TSUPD/4-113--------------------------------------------------------------------------------
B9GUE1_POPTR/334-451--------------------------------------------------------------------------------
CRCB_DESAH/6-119--------------------------------------------------------------------------------
B7K4M6_CYAP8/8-119--------------------------------------------------------------------------------
A7HWU1_PARL1/5-118--------------------------------------------------------------------------------
M4CKA5_BRARP/315-431--------------------------------------------------------------------------------
A1WYB7_HALHL/11-123--------------------------------------------------------------------------------
I3VSZ5_THESW/4-117--------------------------------------------------------------------------------
E3H2P9_ROTDC/4-128--------------------------------------------------------------------------------
B9RJ54_RICCO/284-401--------------------------------------------------------------------------------
R5C403_9FIRM/14-124--------------------------------------------------------------------------------
F6XSK1_CIOIN/104-215--------------------------------------------------------------------------------
C1D5Z9_LARHH/7-122--------------------------------------------------------------------------------
C6VYX9_DYAFD/5-118--------------------------------------------------------------------------------
CRCB_GRABC/5-117--------------------------------------------------------------------------------
R5YAN9_9FIRM/5-114--------------------------------------------------------------------------------
F0JEC8_DESDE/6-119--------------------------------------------------------------------------------
Q03TH0_LACBA/6-116--------------------------------------------------------------------------------
U4LGC1_PYROM/193-307--------------------------------------------------------------------------------
CRCB2_DESHY/6-111--------------------------------------------------------------------------------
F2F590_SOLSS/4-117--------------------------------------------------------------------------------
G2NNA3_9ACTO/46-157--------------------------------------------------------------------------------
F2IUX1_POLGS/5-118--------------------------------------------------------------------------------
R7BR51_9ACTN/32-142--------------------------------------------------------------------------------
CRCB_SERP5/6-118--------------------------------------------------------------------------------
S3CUB1_OPHP1/412-521--------------------------------------------------------------------------------
G0S6M1_CHATD/360-471--------------------------------------------------------------------------------
H6MYC3_GORPV/37-152--------------------------------------------------------------------------------
R7JBS3_9FUSO/5-118--------------------------------------------------------------------------------
CRCB_SYNJB/10-123--------------------------------------------------------------------------------
R5K2R2_9CLOT/5-115--------------------------------------------------------------------------------
CRCB_RALPJ/7-119--------------------------------------------------------------------------------
Q6CGB9_YARLI/188-302--------------------------------------------------------------------------------
CRCB2_PROMT/5-119--------------------------------------------------------------------------------
R7IYR4_9BACT/5-114--------------------------------------------------------------------------------
R5NYS9_9BACT/6-119--------------------------------------------------------------------------------
F6B6F1_DESCC/4-117--------------------------------------------------------------------------------
A4Z186_BRASO/14-127--------------------------------------------------------------------------------
R5Z2Y5_9FIRM/4-112--------------------------------------------------------------------------------
D1C4M3_SPHTD/5-118--------------------------------------------------------------------------------
R6VF31_9BACT/2-114--------------------------------------------------------------------------------
CRCB_HELPY/6-120--------------------------------------------------------------------------------
B0JNB3_MICAN/10-125--------------------------------------------------------------------------------
CRCB_SULDN/7-120--------------------------------------------------------------------------------
G8C0E3_TETPH/229-348--------------------------------------------------------------------------------
CRCB_SORC5/5-118--------------------------------------------------------------------------------
F0SNW9_PLABD/6-119--------------------------------------------------------------------------------
W6EHN9_SULMU/6-118--------------------------------------------------------------------------------
CRCB_METKA/10-120--------------------------------------------------------------------------------
CRCB_METRJ/7-121--------------------------------------------------------------------------------
CRCB_PHEZH/5-119--------------------------------------------------------------------------------
Q03UF6_LEUMM/14-122--------------------------------------------------------------------------------
W0AKR0_9SPHN/1-111--------------------------------------------------------------------------------
N1PYF2_MYCP1/240-357--------------------------------------------------------------------------------
CRCB1_STAEQ/4-114--------------------------------------------------------------------------------
B9L2H7_THERP/8-117--------------------------------------------------------------------------------
R5GLL4_9BACT/6-118--------------------------------------------------------------------------------
A0LYN3_GRAFK/7-118--------------------------------------------------------------------------------
F8KQZ6_HELBC/6-120--------------------------------------------------------------------------------
CRCB_PARD8/5-117--------------------------------------------------------------------------------
B2FK58_STRMK/8-122--------------------------------------------------------------------------------
D3SG20_THISK/10-124--------------------------------------------------------------------------------
D6ZE48_SEGRD/18-132--------------------------------------------------------------------------------
CRCB_PROMH/6-118--------------------------------------------------------------------------------
R6TF31_9FIRM/4-113--------------------------------------------------------------------------------
Q4PD24_USTMA/376-495--------------------------------------------------------------------------------
G7UWM0_PSEUP/11-124--------------------------------------------------------------------------------
C5WRE9_SORBI/367-479--------------------------------------------------------------------------------
E6TV03_BACCJ/9-118--------------------------------------------------------------------------------
D1BPN5_VEIPT/5-117--------------------------------------------------------------------------------
R5HK91_9SPIR/5-118--------------------------------------------------------------------------------
R5QQ50_9PROT/5-112--------------------------------------------------------------------------------
B8DVC3_BIFA0/101-223--------------------------------------------------------------------------------
G3JA95_CORMM/291-403--------------------------------------------------------------------------------
CRCB_CHRVO/6-118--------------------------------------------------------------------------------
CRCB_ALTMD/9-121--------------------------------------------------------------------------------
Q4CXK7_TRYCC/54-164--------------------------------------------------------------------------------
K7SGS5_PROA4/6-121--------------------------------------------------------------------------------
CRCB_ACIAC/6-117--------------------------------------------------------------------------------
CRCB_DECAR/13-125--------------------------------------------------------------------------------
C8WQX7_ALIAD/8-117--------------------------------------------------------------------------------
CRCB2_CORJK/8-136--------------------------------------------------------------------------------
R5QM20_9PROT/7-116--------------------------------------------------------------------------------
CRCB_SULNB/7-118--------------------------------------------------------------------------------
CRCB_SALTY/6-118--------------------------------------------------------------------------------
D7CY59_TRURR/21-133--------------------------------------------------------------------------------
CRCB2_CLOAB/4-111--------------------------------------------------------------------------------
K4IHE3_PSYTT/5-119--------------------------------------------------------------------------------
I1XG94_METNJ/5-118--------------------------------------------------------------------------------
R6I131_9PROT/4-111--------------------------------------------------------------------------------
CRCB_ERWT9/6-118--------------------------------------------------------------------------------
G8Y8E2_PICSO/247-364--------------------------------------------------------------------------------
CRCB2_MYCPA/8-116--------------------------------------------------------------------------------
C7LR69_DESBD/5-118--------------------------------------------------------------------------------
CRCB_RENSM/4-122--------------------------------------------------------------------------------
Q6CW46_KLULA/204-319--------------------------------------------------------------------------------
CRCB_MARAV/6-118--------------------------------------------------------------------------------
U5RPB7_9CLOT/5-117--------------------------------------------------------------------------------
W0E9P6_9FIRM/5-118--------------------------------------------------------------------------------
CRCB_SHEAM/5-117--------------------------------------------------------------------------------
CRCB_GEOBB/5-118--------------------------------------------------------------------------------
CRCB_NITWN/7-120--------------------------------------------------------------------------------
H6L1N4_SAPGL/4-114--------------------------------------------------------------------------------
A9TPH4_PHYPA/207-329--------------------------------------------------------------------------------
F4GUT6_PUSST/1-113--------------------------------------------------------------------------------
W0I074_9ENTR/7-118--------------------------------------------------------------------------------
D8RW03_SELML/170-287--------------------------------------------------------------------------------
V6K2X1_STRNV/39-151--------------------------------------------------------------------------------
CRCB_AGRVS/5-118--------------------------------------------------------------------------------
CRCB_META3/5-115--------------------------------------------------------------------------------
CRCB_PELPD/5-118--------------------------------------------------------------------------------
D7G2L8_ECTSI/252-367--------------------------------------------------------------------------------
U5NEL7_9BURK/2-114--------------------------------------------------------------------------------
CRCB_SACD2/14-125--------------------------------------------------------------------------------
S6BZ64_9GAMM/5-118--------------------------------------------------------------------------------
F9FY81_FUSOF/343-451--------------------------------------------------------------------------------
V5FBU9_BYSSN/386-500--------------------------------------------------------------------------------
M9X2S7_PASHA/5-112--------------------------------------------------------------------------------
I0JQ72_HALH3/11-117--------------------------------------------------------------------------------
E3HV70_ACHXA/13-123--------------------------------------------------------------------------------
R6PJ06_9CLOT/5-118--------------------------------------------------------------------------------
D2NQE6_ROTMD/5-129--------------------------------------------------------------------------------
CRCB_BURPS/6-118--------------------------------------------------------------------------------
CRCB_DEHM1/5-118--------------------------------------------------------------------------------
K9WKI7_9CYAN/34-148--------------------------------------------------------------------------------
E8RCU5_DESPD/6-118--------------------------------------------------------------------------------
CRCB_CYAP7/5-117--------------------------------------------------------------------------------
CRCB2_RUBXD/28-141--------------------------------------------------------------------------------
L0F682_DESDL/4-117--------------------------------------------------------------------------------
CRCB_PYRFU/7-118--------------------------------------------------------------------------------
E0S341_BUTPB/4-113--------------------------------------------------------------------------------
J9VXS3_LACBU/5-112--------------------------------------------------------------------------------
R5P3S6_9PORP/6-119--------------------------------------------------------------------------------
C5BIK3_TERTT/5-117--------------------------------------------------------------------------------
K7APB2_9ALTE/8-121--------------------------------------------------------------------------------
G7V718_THELD/10-123--------------------------------------------------------------------------------
E6W8T7_PANSA/6-118--------------------------------------------------------------------------------
G9P0K0_HYPAI/346-453--------------------------------------------------------------------------------
CRCB1_MOOTA/4-117--------------------------------------------------------------------------------
G8MBQ1_9BURK/6-118--------------------------------------------------------------------------------
R5JNY8_9BACE/5-119--------------------------------------------------------------------------------
F7QJT5_9BRAD/7-119--------------------------------------------------------------------------------
F8L5Q8_SIMNZ/6-120--------------------------------------------------------------------------------
B0TB34_HELMI/4-118--------------------------------------------------------------------------------
V5X8U7_MYCNE/35-150--------------------------------------------------------------------------------
R5IPR5_9PORP/5-118--------------------------------------------------------------------------------
E1VBH3_HALED/8-122--------------------------------------------------------------------------------
R7FEZ1_9FIRM/7-115--------------------------------------------------------------------------------
H5WWL3_9PSEU/11-123--------------------------------------------------------------------------------
A9H9I7_GLUDA/8-122--------------------------------------------------------------------------------
C7RB99_KANKD/7-119--------------------------------------------------------------------------------
A5DNP2_PICGU/290-406--------------------------------------------------------------------------------
W0RHG9_9BACT/5-116--------------------------------------------------------------------------------
U9UIL3_RHIID/251-359--------------------------------------------------------------------------------
CRCB2_CARHZ/4-114--------------------------------------------------------------------------------
J7U6G5_MORMO/5-117--------------------------------------------------------------------------------
CRCB_THICR/10-123--------------------------------------------------------------------------------
G9WG75_9LACT/6-114--------------------------------------------------------------------------------
R5QDH0_9BURK/7-120--------------------------------------------------------------------------------
R4K5H3_CLOPA/5-117--------------------------------------------------------------------------------
F9CZJ4_PREDD/6-119--------------------------------------------------------------------------------
Q12CN6_POLSJ/5-116--------------------------------------------------------------------------------
A1C7V8_ASPCL/303-428--------------------------------------------------------------------------------
CRCB2_LACAC/4-118--------------------------------------------------------------------------------
E0SET2_DICD3/6-118--------------------------------------------------------------------------------
E1QJH8_DESB2/6-119--------------------------------------------------------------------------------
R5Q419_9BACT/6-119--------------------------------------------------------------------------------
D6Y471_THEBD/35-145--------------------------------------------------------------------------------
F5XQW7_MICPN/39-152--------------------------------------------------------------------------------
Q6C7Z3_YARLI/216-332--------------------------------------------------------------------------------
CRCB_GEODF/5-118--------------------------------------------------------------------------------
D3BK38_POLPA/37-151--------------------------------------------------------------------------------
A1AV95_RUTMC/8-121--------------------------------------------------------------------------------
G8QMX7_AZOSU/7-119--------------------------------------------------------------------------------
I3YBU9_THIV6/7-119--------------------------------------------------------------------------------
B7FNU9_PHATC/760-870--------------------------------------------------------------------------------
C4R3B5_PICPG/194-305--------------------------------------------------------------------------------
E4TJQ8_CALNY/4-117--------------------------------------------------------------------------------
D3HM17_LEGLN/5-118--------------------------------------------------------------------------------
I1S625_GIBZE/360-470--------------------------------------------------------------------------------
A8AY05_STRGC/8-119--------------------------------------------------------------------------------
D3PMB8_MEIRD/5-117--------------------------------------------------------------------------------
E2SCN0_9ACTO/12-118--------------------------------------------------------------------------------
E4ZZ91_LEPMJ/466-583--------------------------------------------------------------------------------
A4G6Z5_HERAR/11-123--------------------------------------------------------------------------------
F6EJF8_AMYSD/4-116--------------------------------------------------------------------------------
G8SCM3_ACTS5/11-119--------------------------------------------------------------------------------
R5K2C1_9CLOT/5-115--------------------------------------------------------------------------------
J6EMU8_SACK1/217-335--------------------------------------------------------------------------------
L0IVY4_MYCSM/10-121--------------------------------------------------------------------------------
V9XIT4_9NOCA/24-139--------------------------------------------------------------------------------
CRCB_SULSY/5-118--------------------------------------------------------------------------------
D7BCB6_MEISD/13-125--------------------------------------------------------------------------------
R6WPF5_9PORP/5-117--------------------------------------------------------------------------------
Q0ANT1_MARMM/25-139--------------------------------------------------------------------------------
E3I3A3_RHOVT/7-122--------------------------------------------------------------------------------
R6HCB3_9ACTN/26-135--------------------------------------------------------------------------------
E7A8W5_HELFC/6-120--------------------------------------------------------------------------------
E4RXK0_LEAB4/5-113--------------------------------------------------------------------------------
A0QUA4_MYCS2/7-115--------------------------------------------------------------------------------
F4H414_CELFA/11-125--------------------------------------------------------------------------------
E8SJC6_STAPH/4-113--------------------------------------------------------------------------------
G7DUV6_MIXOS/246-354--------------------------------------------------------------------------------
G8BJM3_CANPC/268-385--------------------------------------------------------------------------------
K4KIN2_SIMAS/4-116--------------------------------------------------------------------------------
CRCB_RHILO/5-117--------------------------------------------------------------------------------
E6W087_DESIS/5-118--------------------------------------------------------------------------------
S7ZVM7_PENO1/345-461--------------------------------------------------------------------------------
R7DGN2_9PORP/5-117--------------------------------------------------------------------------------
CRCB1_BACHD/4-121--------------------------------------------------------------------------------
CRCB_PHOPR/9-121--------------------------------------------------------------------------------
D0MU45_PHYIT/2-120--------------------------------------------------------------------------------
U5VT02_9ACTO/11-119--------------------------------------------------------------------------------
CRCB_PSEAE/6-118--------------------------------------------------------------------------------
D0LRD6_HALO1/5-121--------------------------------------------------------------------------------
CRCB2_THEFY/7-117--------------------------------------------------------------------------------
W5TSX0_9NOCA/40-152--------------------------------------------------------------------------------
C1H7A3_PARBA/424-557--------------------------------------------------------------------------------
I0AFH5_IGNAJ/6-119--------------------------------------------------------------------------------
CRCB_ERYLH/11-129--------------------------------------------------------------------------------
E3E6H7_PAEPS/5-117--------------------------------------------------------------------------------
CRCB_NITMU/7-119--------------------------------------------------------------------------------
CRCB_COLP3/12-125--------------------------------------------------------------------------------
E4N1S6_KITSK/33-146--------------------------------------------------------------------------------
L0DZW0_THIND/6-121--------------------------------------------------------------------------------
CRCB1_STRAW/4-116--------------------------------------------------------------------------------
CRCB_PASMU/9-121--------------------------------------------------------------------------------
D7B6X0_NOCDD/20-130--------------------------------------------------------------------------------
CRCB_PELCD/4-117--------------------------------------------------------------------------------
CRCB_SOLUE/4-117--------------------------------------------------------------------------------
X2GU24_9BACI/5-112--------------------------------------------------------------------------------
CRCB_RUEPO/9-115--------------------------------------------------------------------------------
CRCB_CHRSD/6-118--------------------------------------------------------------------------------
D7DIK5_METV0/7-119--------------------------------------------------------------------------------
R6B5L2_9BACT/5-119--------------------------------------------------------------------------------
S5Y388_PARAH/6-116--------------------------------------------------------------------------------
CRCB_ACIF2/7-119--------------------------------------------------------------------------------
CRCB1_NOCFA/26-133--------------------------------------------------------------------------------
CRCB_CLOCE/8-120--------------------------------------------------------------------------------
I3WFR8_BIFBI/109-231--------------------------------------------------------------------------------
A4XHA7_CALS8/5-114--------------------------------------------------------------------------------
G9AP47_PANAN/7-119--------------------------------------------------------------------------------
K9P356_CYAGP/20-131--------------------------------------------------------------------------------
B6Q2S5_PENMQ/335-486--------------------------------------------------------------------------------
D6ZH23_MOBCV/4-144--------------------------------------------------------------------------------
G2RBC5_THITE/375-493--------------------------------------------------------------------------------
F2NE00_DESAR/47-161--------------------------------------------------------------------------------
CRCB_CAMFF/7-120--------------------------------------------------------------------------------
N4VR51_COLOR/350-459--------------------------------------------------------------------------------
CRCB_SALRD/5-117--------------------------------------------------------------------------------
D0MH17_RHOM4/4-116--------------------------------------------------------------------------------
F7AZ18_CIOIN/241-364--------------------------------------------------------------------------------
F6FW41_ISOV2/17-131--------------------------------------------------------------------------------
Q0AAG5_ALKEH/8-117--------------------------------------------------------------------------------
CRCB_NITMS/7-116--------------------------------------------------------------------------------
R5KYM1_9BACT/6-120--------------------------------------------------------------------------------
G3XXW1_ASPNA/251-368--------------------------------------------------------------------------------
E1VUY2_ARTAR/24-138--------------------------------------------------------------------------------
D5X1S9_THIK1/4-117--------------------------------------------------------------------------------
CRCB_DESAG/5-118--------------------------------------------------------------------------------
F0NZN4_WEEVC/5-117--------------------------------------------------------------------------------
S0EFS8_GIBF5/358-468--------------------------------------------------------------------------------
H6RV33_BLASD/4-116--------------------------------------------------------------------------------
R7AIG3_9ACTN/32-142--------------------------------------------------------------------------------
H8H3E6_DEIGI/5-121--------------------------------------------------------------------------------
D7G2L8_ECTSI/73-183--------------------------------------------------------------------------------
E6SCS6_INTC7/42-153--------------------------------------------------------------------------------
E6SN01_BACT6/6-118--------------------------------------------------------------------------------
CRCB1_MYCTU/10-120--------------------------------------------------------------------------------
CRCB_ALBFT/8-119--------------------------------------------------------------------------------
A6M382_CLOB8/25-136--------------------------------------------------------------------------------
V4IP94_9ACTO/68-178--------------------------------------------------------------------------------
D1B173_SULD5/6-118--------------------------------------------------------------------------------
M1FMG3_9ALTE/6-118--------------------------------------------------------------------------------
R9NVS0_PSEHS/377-496--------------------------------------------------------------------------------
R9AAS0_WALI9/209-320--------------------------------------------------------------------------------
D3F1Y3_CONWI/11-121--------------------------------------------------------------------------------
R5AYW3_9BACE/2-115--------------------------------------------------------------------------------
F4RMR0_MELLP/249-363--------------------------------------------------------------------------------
CRCB_ROSS1/4-117--------------------------------------------------------------------------------
A0ZZG7_BIFAA/96-213--------------------------------------------------------------------------------
CRCB1_CORJK/11-135--------------------------------------------------------------------------------
F0R1M5_BACSH/6-118--------------------------------------------------------------------------------
Q04FV7_OENOB/4-114--------------------------------------------------------------------------------
B5GT34_STRC2/54-181--------------------------------------------------------------------------------
Q0RJG1_FRAAA/1-111--------------------------------------------------------------------------------
C0ZES3_BREBN/4-114--------------------------------------------------------------------------------
C1D600_LARHH/6-118--------------------------------------------------------------------------------
G3BBM5_CANTC/177-292--------------------------------------------------------------------------------
K0IK43_NITGG/42-151--------------------------------------------------------------------------------
I0I7C2_CALAS/5-118--------------------------------------------------------------------------------
CRCB_ROSDO/5-118--------------------------------------------------------------------------------
R7CT11_9FIRM/8-120--------------------------------------------------------------------------------
CRCB3_STRAW/64-176--------------------------------------------------------------------------------
Q4Q5Z9_LEIMA/274-382--------------------------------------------------------------------------------
A2U3U0_9FLAO/5-117--------------------------------------------------------------------------------
C3KN78_RHISN/4-117--------------------------------------------------------------------------------
B1VR67_STRGG/24-136--------------------------------------------------------------------------------
Q0VQ07_ALCBS/15-127--------------------------------------------------------------------------------
G2T1C4_ROSHA/5-114--------------------------------------------------------------------------------
F8K2W7_STREN/41-152--------------------------------------------------------------------------------
CRCB_CYTH3/5-117--------------------------------------------------------------------------------
F6H0U1_VITVI/394-506--------------------------------------------------------------------------------
R6E8F9_9BACT/1-112--------------------------------------------------------------------------------
F5YHC5_TREPZ/11-123--------------------------------------------------------------------------------
R6D677_9FIRM/7-118--------------------------------------------------------------------------------
G2IKM0_9SPHN/5-119--------------------------------------------------------------------------------
D2RLY9_ACIFV/11-122--------------------------------------------------------------------------------
K3WL52_PYTUL/44-163--------------------------------------------------------------------------------
R5D2F8_9FIRM/6-118--------------------------------------------------------------------------------
N1JR95_BLUG1/279-388--------------------------------------------------------------------------------
G2I655_GLUMN/9-123--------------------------------------------------------------------------------
E6X1Y5_NITSE/7-118--------------------------------------------------------------------------------
W0DRI4_9GAMM/7-120--------------------------------------------------------------------------------
D3IC67_9BACT/7-120--------------------------------------------------------------------------------
C5MFT6_CANTT/258-376--------------------------------------------------------------------------------
B8FMC9_DESAA/9-122--------------------------------------------------------------------------------
R6APN1_9FIRM/8-120--------------------------------------------------------------------------------
CRCB_RHIME/5-118--------------------------------------------------------------------------------
B5H5Q4_STRPR/39-152--------------------------------------------------------------------------------
CRCB2_PROMA/12-124--------------------------------------------------------------------------------
A2F7Z4_TRIVA/4-116--------------------------------------------------------------------------------
CRCB_ACIAD/6-117--------------------------------------------------------------------------------
R6EUL5_9FIRM/6-118--------------------------------------------------------------------------------
CRCB_RHOCS/5-118--------------------------------------------------------------------------------
F4P7Z1_BATDJ/25-134--------------------------------------------------------------------------------
X2H985_9GAMM/6-117--------------------------------------------------------------------------------
CRCB_RALME/7-119--------------------------------------------------------------------------------
A6TJ57_KLEP7/5-117--------------------------------------------------------------------------------
E4U4J6_OCEP5/5-117--------------------------------------------------------------------------------
H2IXD1_RAHAC/6-118--------------------------------------------------------------------------------
R6VEX1_9BACT/6-115--------------------------------------------------------------------------------
CRCB1_GEOKA/5-112--------------------------------------------------------------------------------
CRCB_NITEU/6-118--------------------------------------------------------------------------------
A7HKE3_FERNB/5-118--------------------------------------------------------------------------------
I0IE85_PHYMF/13-128--------------------------------------------------------------------------------
A6H5U3_STRAW/6-118--------------------------------------------------------------------------------
D7A8E4_STAND/9-124--------------------------------------------------------------------------------
CRCB1_STRCO/30-141--------------------------------------------------------------------------------
B9DN27_STACT/4-113--------------------------------------------------------------------------------
CRCB_BURP8/6-118--------------------------------------------------------------------------------
I1YK49_METFJ/5-118--------------------------------------------------------------------------------
CRCB1_BIFLO/3-122--------------------------------------------------------------------------------
X2HAQ4_9NEIS/6-118--------------------------------------------------------------------------------
L8FMT9_PSED2/399-516--------------------------------------------------------------------------------
F2U1Y9_SALR5/330-450--------------------------------------------------------------------------------
CRCB_SHEPW/5-117--------------------------------------------------------------------------------
D9QGP8_BRESC/17-132--------------------------------------------------------------------------------
CRCB_ELUMP/8-118--------------------------------------------------------------------------------
CRCB_THEM4/4-117--------------------------------------------------------------------------------
R5T1S9_9GAMM/6-119--------------------------------------------------------------------------------
M2U1Z2_COCH5/244-361--------------------------------------------------------------------------------
A5GQ38_SYNR3/15-133--------------------------------------------------------------------------------
X5DQX6_9CORY/15-131--------------------------------------------------------------------------------
K9T9L8_9CYAN/31-143--------------------------------------------------------------------------------
W0E4F2_MARPU/5-118--------------------------------------------------------------------------------
CRCB2_RHOPB/9-124--------------------------------------------------------------------------------
B8GLE5_THISH/5-118--------------------------------------------------------------------------------
CRCB_AROAE/11-123--------------------------------------------------------------------------------
G4N5E6_MAGO7/229-342--------------------------------------------------------------------------------
F8F4D4_TRECH/4-116--------------------------------------------------------------------------------
D5UGH6_CELFN/27-139--------------------------------------------------------------------------------
A1T6G9_MYCVP/9-121--------------------------------------------------------------------------------
A3U8B6_CROAH/5-117--------------------------------------------------------------------------------
Q03FL7_PEDPA/4-114--------------------------------------------------------------------------------
E1RIE7_METP4/5-116--------------------------------------------------------------------------------
F5YDX2_TREAZ/4-114--------------------------------------------------------------------------------
G2YQJ8_BOTF4/435-544--------------------------------------------------------------------------------
YI7B_SCHPO/189-297--------------------------------------------------------------------------------
D8PPZ6_SCHCM/244-354--------------------------------------------------------------------------------
CRCB_GLUOX/7-122--------------------------------------------------------------------------------
D5XBR0_THEPJ/4-117--------------------------------------------------------------------------------
W5W322_9PSEU/18-129--------------------------------------------------------------------------------
G4R8S3_PELHB/9-124--------------------------------------------------------------------------------
B7GIC9_ANOFW/6-113--------------------------------------------------------------------------------
CRCB_FRATT/6-122--------------------------------------------------------------------------------
M3J430_CANMX/264-381--------------------------------------------------------------------------------
R6NNH2_9FIRM/5-116--------------------------------------------------------------------------------
G8AKN8_AZOBR/9-122--------------------------------------------------------------------------------
A8LA02_FRASN/57-168--------------------------------------------------------------------------------
C5BXB4_BEUC1/18-135--------------------------------------------------------------------------------
CRCB_DESMR/7-119--------------------------------------------------------------------------------
I2H781_TETBL/282-401--------------------------------------------------------------------------------
K0NIU2_DESTT/5-119--------------------------------------------------------------------------------
C1A5H5_GEMAT/11-122--------------------------------------------------------------------------------
B8CZY9_HALOH/4-116--------------------------------------------------------------------------------
CRCB_PSEU5/6-119--------------------------------------------------------------------------------
C9YX49_STRSW/32-143--------------------------------------------------------------------------------
A7HGD5_ANADF/17-129--------------------------------------------------------------------------------
E8N037_ANATU/5-118--------------------------------------------------------------------------------
K4D6B6_SOLLC/136-253--------------------------------------------------------------------------------
K4LHK9_THEPS/5-118--------------------------------------------------------------------------------
CRCB1_CARHZ/5-113--------------------------------------------------------------------------------
E6SH98_THEM7/4-115--------------------------------------------------------------------------------
H8L558_FRAAD/8-120--------------------------------------------------------------------------------
A2EQG0_TRIVA/6-118--------------------------------------------------------------------------------
CRCB_DESDA/6-118--------------------------------------------------------------------------------
I4AMY3_FLELS/9-122--------------------------------------------------------------------------------
C9RIR9_FIBSS/4-115--------------------------------------------------------------------------------
W8S598_9RHOB/6-118--------------------------------------------------------------------------------
E3D7A9_GARV3/26-149--------------------------------------------------------------------------------
E3GGU4_EUBLK/5-118--------------------------------------------------------------------------------
B4SGW3_PELPB/8-120--------------------------------------------------------------------------------
E3RZP5_PYRTT/436-553--------------------------------------------------------------------------------
CRCB_ACIC5/4-117--------------------------------------------------------------------------------
CRCB_HISS2/8-120--------------------------------------------------------------------------------
CRCB_BEII9/5-120--------------------------------------------------------------------------------
CRCB1_LISMO/6-114--------------------------------------------------------------------------------
A5FV99_ACICJ/74-187--------------------------------------------------------------------------------
D5MLU2_9BACT/5-118--------------------------------------------------------------------------------
CRCB_CHLCH/9-121--------------------------------------------------------------------------------
M4RA76_9BIFI/210-326--------------------------------------------------------------------------------
D9S1E5_THEOJ/4-115--------------------------------------------------------------------------------
D3SME5_THEAH/5-118--------------------------------------------------------------------------------
K0C6N2_CYCSP/5-118--------------------------------------------------------------------------------
D5WTI1_KYRT2/4-114--------------------------------------------------------------------------------
R6EJN5_9FIRM/5-117--------------------------------------------------------------------------------
R9PA85_PSEHS/337-456--------------------------------------------------------------------------------
I1JZ91_SOYBN/281-398--------------------------------------------------------------------------------
H5WIB8_9BURK/11-121--------------------------------------------------------------------------------
R5FYM5_9ACTN/6-119--------------------------------------------------------------------------------
D0KZJ2_HALNC/5-117--------------------------------------------------------------------------------
CRCB_CAMJE/6-118--------------------------------------------------------------------------------
B0RF14_CLAMS/46-159--------------------------------------------------------------------------------
CRCB_FLAPJ/5-118--------------------------------------------------------------------------------
S9W181_SCHCR/189-297--------------------------------------------------------------------------------
E6XA34_CELAD/5-117--------------------------------------------------------------------------------
A6W0D0_MARMS/4-117--------------------------------------------------------------------------------
R4SNZ1_AMYOR/16-128--------------------------------------------------------------------------------
E8T378_THEA1/4-115--------------------------------------------------------------------------------
N0AXP0_9BACI/7-117--------------------------------------------------------------------------------
CRCB1_BRADU/17-130--------------------------------------------------------------------------------
F4FEU5_VERMA/34-146--------------------------------------------------------------------------------
CRCB1_STAA8/4-114--------------------------------------------------------------------------------
A1SKX4_NOCSJ/30-141--------------------------------------------------------------------------------
L0IFM0_HALRX/14-128--------------------------------------------------------------------------------
CRCB_XYLFA/11-124--------------------------------------------------------------------------------
D5CDU7_ENTCC/6-117--------------------------------------------------------------------------------
F6DSF1_DESRL/5-118--------------------------------------------------------------------------------
D2QFU6_SPILD/5-118--------------------------------------------------------------------------------
G9AUR5_PANAN/6-118--------------------------------------------------------------------------------
G8PD75_PEDCP/8-119--------------------------------------------------------------------------------
R7CG99_9FIRM/5-115--------------------------------------------------------------------------------
CRCB2_LACPL/5-115--------------------------------------------------------------------------------
CRCB_PARDP/6-116--------------------------------------------------------------------------------
E8RTG2_ASTEC/5-118--------------------------------------------------------------------------------
I4D723_DESAJ/4-117--------------------------------------------------------------------------------
C5CFG1_KOSOT/5-118--------------------------------------------------------------------------------
F6XSK1_CIOIN/279-394--------------------------------------------------------------------------------
F6ACC1_PSEF1/6-119--------------------------------------------------------------------------------
Q6FVY7_CANGA/246-367--------------------------------------------------------------------------------
D8MNN0_ERWBE/6-118--------------------------------------------------------------------------------
Q15T15_PSEA6/9-122--------------------------------------------------------------------------------
A7IPP1_XANP2/9-124--------------------------------------------------------------------------------
C7R2V9_JONDD/19-134--------------------------------------------------------------------------------
A4J4K8_DESRM/4-117--------------------------------------------------------------------------------
R4X8S9_TAPDE/91-203--------------------------------------------------------------------------------
CRCB_IDILO/9-121--------------------------------------------------------------------------------
CRCB1_RUBXD/8-116--------------------------------------------------------------------------------
CRCB_METCA/6-119--------------------------------------------------------------------------------
F0S0U4_DESTD/4-115--------------------------------------------------------------------------------
L0A1W9_DEIPD/61-173--------------------------------------------------------------------------------
CRCB_PHOLL/6-118--------------------------------------------------------------------------------
K7WB35_9NOST/12-125--------------------------------------------------------------------------------
I3TNV4_TISMK/10-123--------------------------------------------------------------------------------
F2NRH7_TRES6/6-121--------------------------------------------------------------------------------
D5BVT3_NITHN/6-119--------------------------------------------------------------------------------
E9D1L5_COCPS/348-470--------------------------------------------------------------------------------
CRCB2_BACSK/2-110--------------------------------------------------------------------------------
I0GV10_SELRL/4-121--------------------------------------------------------------------------------
S2IXM6_MUCC1/204-312--------------------------------------------------------------------------------
U5LDB8_9BACI/4-115--------------------------------------------------------------------------------
C8WG84_EGGLE/5-115--------------------------------------------------------------------------------
G3AVR1_SPAPN/277-394--------------------------------------------------------------------------------
B8HU37_CYAP4/31-143--------------------------------------------------------------------------------
X5E2L7_9BACT/6-119--------------------------------------------------------------------------------
R6LKJ6_9BACE/21-133--------------------------------------------------------------------------------
R7JLB7_9BACT/6-115--------------------------------------------------------------------------------
F2NPK9_MARHT/5-117--------------------------------------------------------------------------------
CRCB_CHLPD/10-122--------------------------------------------------------------------------------
F8ABD8_THEID/5-117--------------------------------------------------------------------------------
CRCB2_LACJO/5-113--------------------------------------------------------------------------------
F8K2W6_STREN/4-116--------------------------------------------------------------------------------
C5DYN9_ZYGRC/228-347--------------------------------------------------------------------------------
R7JF48_9PORP/6-119--------------------------------------------------------------------------------
X5DYC8_9CORY/11-119--------------------------------------------------------------------------------
R7MJ60_9CLOT/5-117--------------------------------------------------------------------------------
M4ZXF6_9ACTN/1-113--------------------------------------------------------------------------------
D1A9J9_THECD/28-139--------------------------------------------------------------------------------
CRCB_RHORT/4-119--------------------------------------------------------------------------------
CRCB2_LACDA/3-113--------------------------------------------------------------------------------
R6G5P7_9BACE/6-118--------------------------------------------------------------------------------
CRCB_PELLD/10-122--------------------------------------------------------------------------------
F8I0K6_WEIKK/6-117--------------------------------------------------------------------------------
H6NR20_9BACL/4-115--------------------------------------------------------------------------------
L0DY20_THIND/10-124--------------------------------------------------------------------------------
CRCB_CHESB/5-118--------------------------------------------------------------------------------
CRCB_ANADE/5-117--------------------------------------------------------------------------------
E6ZYC1_SPORE/379-498--------------------------------------------------------------------------------
I1C7K4_RHIO9/197-308--------------------------------------------------------------------------------
R4LFU7_9ACTO/4-112--------------------------------------------------------------------------------
N1PE79_MYCP1/225-335--------------------------------------------------------------------------------
D5BQE3_PUNMI/13-127--------------------------------------------------------------------------------
R5UDY9_9BACE/6-118--------------------------------------------------------------------------------
R9TBU9_9EURY/9-124--------------------------------------------------------------------------------
A1WKD0_VEREI/32-143--------------------------------------------------------------------------------
F4KLE8_PORAD/6-115--------------------------------------------------------------------------------
A3M0N0_PICST/269-386--------------------------------------------------------------------------------
CRCB2_PROMP/7-115--------------------------------------------------------------------------------
M0TIZ7_MUSAM/229-344--------------------------------------------------------------------------------
F8A718_CELGA/20-133--------------------------------------------------------------------------------
CRCB_GEOMG/5-118--------------------------------------------------------------------------------
G2LF15_CHLTF/8-120--------------------------------------------------------------------------------
U5H7I1_USTV1/61-177--------------------------------------------------------------------------------
A8NXR3_COPC7/281-391--------------------------------------------------------------------------------
G4Q410_ACIIR/3-115--------------------------------------------------------------------------------
M1VWN1_CLAP2/314-424--------------------------------------------------------------------------------
C5BH47_EDWI9/8-121--------------------------------------------------------------------------------
CRCB_SPHAL/5-118--------------------------------------------------------------------------------
CRCB_AQUAE/5-118--------------------------------------------------------------------------------
CRCB2_NOCFA/16-128--------------------------------------------------------------------------------
D7DRE9_METV3/5-115--------------------------------------------------------------------------------
U5T4R2_9GAMM/8-121--------------------------------------------------------------------------------
B2AWA8_PODAN/397-506--------------------------------------------------------------------------------
D1BHA1_SANKS/35-148--------------------------------------------------------------------------------
R5XLK6_9FIRM/5-115--------------------------------------------------------------------------------
CRCB_OCHA4/5-119--------------------------------------------------------------------------------
C8X3J8_DESRD/6-120--------------------------------------------------------------------------------
S6B3S2_9PROT/7-119--------------------------------------------------------------------------------
G0REV4_HYPJQ/243-352--------------------------------------------------------------------------------
CRCB1_SYMTH/4-118--------------------------------------------------------------------------------
W8UG12_YEREN/6-118--------------------------------------------------------------------------------
CRCB_THIDA/5-117--------------------------------------------------------------------------------
CRCB_RUEST/6-118--------------------------------------------------------------------------------
A4CMI6_ROBBH/5-117--------------------------------------------------------------------------------
H1XRN1_9BACT/5-119--------------------------------------------------------------------------------
D7GFF6_PROFC/7-122--------------------------------------------------------------------------------
A2SG21_METPP/9-119--------------------------------------------------------------------------------
D4B425_ARTBC/346-466--------------------------------------------------------------------------------
CRCB2_STRR6/10-118--------------------------------------------------------------------------------
K9PWI8_9CYAN/11-124--------------------------------------------------------------------------------
F9ZBH9_ODOSD/6-119--------------------------------------------------------------------------------
G0G9G3_AMYMS/11-123--------------------------------------------------------------------------------
CRCB_PECAS/6-118--------------------------------------------------------------------------------
F2I1G0_PELSM/5-117--------------------------------------------------------------------------------
CRCB1_LACSS/7-116--------------------------------------------------------------------------------
A9TSK9_PHYPA/206-323--------------------------------------------------------------------------------
CRCB2_STRCO/4-116--------------------------------------------------------------------------------
E0TB42_PARBH/54-160--------------------------------------------------------------------------------
F2R3F8_STRVP/11-129--------------------------------------------------------------------------------
C7RPT9_ACCPU/5-117--------------------------------------------------------------------------------
R6PLB2_9BACT/5-119--------------------------------------------------------------------------------
E3JAM9_FRASU/35-146--------------------------------------------------------------------------------
M4BCV8_HYAAE/78-196--------------------------------------------------------------------------------
K9RWB3_SYNP3/11-124--------------------------------------------------------------------------------
D2PXR3_KRIFD/12-120--------------------------------------------------------------------------------
G0EE80_PYRF1/24-136--------------------------------------------------------------------------------
E9T3M4_COREQ/13-119--------------------------------------------------------------------------------
A8EWL7_ARCB4/15-126--------------------------------------------------------------------------------
H2JQT4_STRHJ/3-114--------------------------------------------------------------------------------
C7MG85_BRAFD/31-146--------------------------------------------------------------------------------
CRCB_METS4/5-116--------------------------------------------------------------------------------
D1CCE4_THET1/4-117--------------------------------------------------------------------------------
CRCB_THEKO/7-118--------------------------------------------------------------------------------
C9LUG5_SELS3/6-122--------------------------------------------------------------------------------
C7NFB3_KYTSD/8-131--------------------------------------------------------------------------------
E5ANM6_BURRH/10-122--------------------------------------------------------------------------------
H2G1J1_OCESG/5-118--------------------------------------------------------------------------------
K5WJ99_PHACS/36-154--------------------------------------------------------------------------------
B5GT33_STRC2/4-112--------------------------------------------------------------------------------
B1VIZ2_CORU7/54-180--------------------------------------------------------------------------------
S6CLA6_9ACTN/5-115--------------------------------------------------------------------------------
G4KZT9_OSCVS/4-113--------------------------------------------------------------------------------
CRCB_HAHCH/7-120--------------------------------------------------------------------------------
M1PG46_DESSD/5-117--------------------------------------------------------------------------------
E6U3C1_ETHHY/7-118--------------------------------------------------------------------------------
D6Z3E2_DESAT/25-137--------------------------------------------------------------------------------
CRCB_HAEDU/5-112--------------------------------------------------------------------------------
R7KTC6_9BURK/12-126--------------------------------------------------------------------------------
K5WJ99_PHACS/207-317--------------------------------------------------------------------------------
K9FHV6_PEND2/281-398--------------------------------------------------------------------------------
F4HAX1_GALAU/5-117--------------------------------------------------------------------------------
CRCB2_BIFLO/33-147--------------------------------------------------------------------------------
E6WPA5_PSEUU/5-117--------------------------------------------------------------------------------
I0HP37_RUBGI/6-118--------------------------------------------------------------------------------
D3RQ80_ALLVD/5-117--------------------------------------------------------------------------------
M9SJ20_9EURY/5-112--------------------------------------------------------------------------------
W0J3M8_9BACT/13-127--------------------------------------------------------------------------------
U5DA10_AMBTC/185-301--------------------------------------------------------------------------------
F2KPC2_ARCVS/5-116--------------------------------------------------------------------------------
G0V7Z6_NAUCC/248-366--------------------------------------------------------------------------------
M7WQY7_RHOT1/266-373--------------------------------------------------------------------------------
CRCB_DESVM/5-118--------------------------------------------------------------------------------
V4JGW8_9GAMM/5-118--------------------------------------------------------------------------------
J4VST1_BEAB2/320-431--------------------------------------------------------------------------------
Q4WZP6_ASPFU/297-421--------------------------------------------------------------------------------
CRCB_POLSQ/6-118--------------------------------------------------------------------------------
I0DVX9_PROSM/6-117--------------------------------------------------------------------------------
R5G7W5_9PORP/4-118--------------------------------------------------------------------------------
G8ZNE7_TORDC/239-356--------------------------------------------------------------------------------
K0SZ12_THAOC/443-557--------------------------------------------------------------------------------
C3PIR4_CORA7/6-112--------------------------------------------------------------------------------
CRCB_IGNH4/5-114--------------------------------------------------------------------------------
CRCB_CHLPB/9-121--------------------------------------------------------------------------------
R5LBB8_9SPIR/6-112--------------------------------------------------------------------------------
N0B0J1_9RHIZ/7-121--------------------------------------------------------------------------------
B2J4R5_NOSP7/10-125--------------------------------------------------------------------------------
F6IMX4_9SPHN/11-128--------------------------------------------------------------------------------
F4CS98_PSEUX/33-144--------------------------------------------------------------------------------
D5V5P5_ARCNC/9-120--------------------------------------------------------------------------------
G8PPE0_PSEUV/5-118--------------------------------------------------------------------------------
CRCB1_PROMM/13-126--------------------------------------------------------------------------------
E1R2J6_SPISS/1-113--------------------------------------------------------------------------------
K0KMS3_WICCF/227-345--------------------------------------------------------------------------------
G4L620_TETHN/5-114--------------------------------------------------------------------------------
CRCB_PSEF5/6-119--------------------------------------------------------------------------------
G0HI73_CORVD/17-130--------------------------------------------------------------------------------
K2RLS9_MACPH/243-361--------------------------------------------------------------------------------
D5CTU7_SIDLE/7-119--------------------------------------------------------------------------------
M4U625_9GAMM/9-123--------------------------------------------------------------------------------
I4EVT0_MODMB/24-139--------------------------------------------------------------------------------
C5C9Z4_MICLC/19-136--------------------------------------------------------------------------------
G8R792_OWEHD/7-120--------------------------------------------------------------------------------
R7NMD5_9BACE/12-124--------------------------------------------------------------------------------
CRCB1_BACAN/7-120--------------------------------------------------------------------------------
G2NX45_STRVO/37-148--------------------------------------------------------------------------------
B5I3X9_9ACTO/27-138--------------------------------------------------------------------------------
V6F7B6_9PROT/11-124--------------------------------------------------------------------------------
F0RJH9_DEIPM/4-117--------------------------------------------------------------------------------
A3N2I1_ACTP2/4-111--------------------------------------------------------------------------------
G8JUV7_ERECY/203-319--------------------------------------------------------------------------------
CRCB_VARPS/6-117--------------------------------------------------------------------------------
R5FQU8_9BACT/5-118--------------------------------------------------------------------------------
F4AXA4_KROS4/5-117--------------------------------------------------------------------------------
C5DC82_LACTC/216-332--------------------------------------------------------------------------------
CRCB_RHOPA/4-117--------------------------------------------------------------------------------
H2J7L4_MARPK/4-118--------------------------------------------------------------------------------
K9W201_9CYAN/10-124--------------------------------------------------------------------------------
D1BRL5_XYLCX/15-129--------------------------------------------------------------------------------
R7GLD8_9FIRM/5-115--------------------------------------------------------------------------------
W8KKC5_HALHR/5-120--------------------------------------------------------------------------------
I1JZ91_SOYBN/93-208--------------------------------------------------------------------------------
CRCB_AZOPC/6-119--------------------------------------------------------------------------------
R5JFM8_9FIRM/5-117--------------------------------------------------------------------------------
R7F2G8_9BACT/7-123--------------------------------------------------------------------------------
CRCB_CLONN/8-121--------------------------------------------------------------------------------
A4X7W1_SALTO/33-145--------------------------------------------------------------------------------
D0J3S6_COMT2/8-119--------------------------------------------------------------------------------
CRCB_MAGSM/4-117--------------------------------------------------------------------------------
CRCB3_YERPE/7-122--------------------------------------------------------------------------------
CRCB1_LACPL/7-114--------------------------------------------------------------------------------
I1QW29_ORYGL/373-486--------------------------------------------------------------------------------
G8RTP8_MYCRN/31-146--------------------------------------------------------------------------------
A4AVL4_MARSH/5-117--------------------------------------------------------------------------------
I0K3J8_9BACT/9-121--------------------------------------------------------------------------------
I5AR27_EUBCE/4-113--------------------------------------------------------------------------------
K8GKY2_9CYAN/31-143--------------------------------------------------------------------------------
CRCB2_MOOTA/4-115--------------------------------------------------------------------------------
R1GHA3_BOTPV/349-458--------------------------------------------------------------------------------
D3UIE7_HELM1/4-114--------------------------------------------------------------------------------
B0CYF7_LACBS/172-282--------------------------------------------------------------------------------
E0UPF1_SULAO/7-120--------------------------------------------------------------------------------
E1STR4_FERBD/5-117--------------------------------------------------------------------------------
J7ITS3_DESMD/5-118--------------------------------------------------------------------------------
G7Z210_AZOL4/9-122--------------------------------------------------------------------------------
Q5AFH3_CANAL/262-380--------------------------------------------------------------------------------
E4MZN4_KITSK/4-111--------------------------------------------------------------------------------
CRCB2_RHOSR/4-110--------------------------------------------------------------------------------
B3PL39_CELJU/4-117--------------------------------------------------------------------------------
CRCB_GLOVI/6-119--------------------------------------------------------------------------------
F3Z1S0_DESAF/5-118--------------------------------------------------------------------------------
CRCB_PSYA2/4-116--------------------------------------------------------------------------------
K4LEU4_THEPS/4-116--------------------------------------------------------------------------------
B1YHY0_EXIS2/4-117--------------------------------------------------------------------------------
R7CZL0_9BACE/6-119--------------------------------------------------------------------------------
E9CDR5_CAPO3/296-409--------------------------------------------------------------------------------
U5QJZ1_9CYAN/34-146--------------------------------------------------------------------------------
W0PBD4_9BURK/6-118--------------------------------------------------------------------------------
E4TXK3_SULKY/6-118--------------------------------------------------------------------------------
L0K7M6_HALHC/6-118--------------------------------------------------------------------------------
CRCB_OPITP/5-120--------------------------------------------------------------------------------
C7QES3_CATAD/36-147--------------------------------------------------------------------------------
CRCB2_BACHD/9-117--------------------------------------------------------------------------------
G0GBW7_SPITZ/7-119--------------------------------------------------------------------------------
K0ESJ3_9NOCA/35-146--------------------------------------------------------------------------------
G2KQT3_MICAA/5-118--------------------------------------------------------------------------------
K4D6B6_SOLLC/326-443--------------------------------------------------------------------------------
CRCB1_RHOPB/14-129--------------------------------------------------------------------------------
G2IVX1_PSEUL/5-117--------------------------------------------------------------------------------
W6R9V2_9RHIZ/5-118--------------------------------------------------------------------------------
CRCB2_BRADU/14-129--------------------------------------------------------------------------------
F0T2T5_SYNGF/5-118--------------------------------------------------------------------------------
R5E6T8_9BURK/4-111--------------------------------------------------------------------------------
A9BWH4_DELAS/7-120--------------------------------------------------------------------------------
CRCB_CHLTE/7-119--------------------------------------------------------------------------------
A5V9U9_SPHWW/5-118--------------------------------------------------------------------------------
B2UNL3_AKKM8/6-118--------------------------------------------------------------------------------
L0DGX5_SINAD/8-120--------------------------------------------------------------------------------
C0QTQ0_PERMH/4-117--------------------------------------------------------------------------------
CRCB_METSB/4-119--------------------------------------------------------------------------------
J9R4B9_RIEAN/5-117--------------------------------------------------------------------------------
CRCB_RHOS4/6-116--------------------------------------------------------------------------------
K4L570_9FIRM/7-120--------------------------------------------------------------------------------
F9XQR4_MYCGM/302-413--------------------------------------------------------------------------------
D5DAP2_BACMD/7-115--------------------------------------------------------------------------------
F3Z559_9ACTO/76-187--------------------------------------------------------------------------------
I4WYT6_9GAMM/7-119--------------------------------------------------------------------------------
W0DEP3_9AQUI/5-118--------------------------------------------------------------------------------
A9TPH4_PHYPA/20-134--------------------------------------------------------------------------------
A8ZZ09_DESOH/10-123--------------------------------------------------------------------------------
D4KET5_9FIRM/5-117--------------------------------------------------------------------------------
C7JDR1_ACEP3/7-122--------------------------------------------------------------------------------
CRCB1_LACJO/9-115--------------------------------------------------------------------------------
J9W0J8_LACBU/13-122--------------------------------------------------------------------------------
A6W4E3_KINRD/37-151--------------------------------------------------------------------------------
J9SRC0_9ACTO/34-149--------------------------------------------------------------------------------
X4ZPG0_9BORD/8-118--------------------------------------------------------------------------------
T2GG52_DESGI/5-118--------------------------------------------------------------------------------
R7GA30_9FIRM/5-115--------------------------------------------------------------------------------
A1W8S2_ACISJ/5-117--------------------------------------------------------------------------------
D8TQI4_VOLCA/636-748--------------------------------------------------------------------------------
L7WCG2_NONDD/5-114--------------------------------------------------------------------------------
CRCB_CLOPE/8-121--------------------------------------------------------------------------------
A3CNB4_STRSV/8-116--------------------------------------------------------------------------------
D3FXF9_BACPE/9-116--------------------------------------------------------------------------------
B8C349_THAPS/648-760--------------------------------------------------------------------------------
D1B6Q4_THEAS/4-117--------------------------------------------------------------------------------
CRCB_DESPS/8-119--------------------------------------------------------------------------------
C1D065_DEIDV/5-117--------------------------------------------------------------------------------
D7E3Z4_NOSA0/11-125--------------------------------------------------------------------------------
CRCB2_STAA8/5-115--------------------------------------------------------------------------------
C6X7L4_METGS/6-118--------------------------------------------------------------------------------
E4TMJ0_MARTH/6-117--------------------------------------------------------------------------------
D0MU45_PHYIT/239-358--------------------------------------------------------------------------------
X4RAS3_9ACTO/4-114--------------------------------------------------------------------------------
D8IT50_HERSS/4-116--------------------------------------------------------------------------------
V5FQ20_BYSSN/358-476--------------------------------------------------------------------------------

PF03151

S35E1_DROME/12-300-----AV----------------------VLLM---CLFWYVI---------SSSNNVIG-KMV--LNEF.---------
Q7XJ66_CHLRE/90-384-----MV----------------------LGLM---FVAWYGT---------NIFFNIYN-KQL--FKVF.---------
XPT_ARATH/110-400-----LQ----------------------LGIV---FGLWYFQ---------NIVFNIFN-KKA--LNVF.---------
S352B_HUMAN/73-368-----SR----------------------ALLY---LTLWFFF---------SFCTLFLN-KYI--LSLL.---------
Q7QFK8_ANOGA/5-293-----LT----------------------IVFL---CILWYVV---------SSSNNVIG-KMI--LSEF.---------
PPT2_ARATH/77-369-----LK----------------------LGGM---FGVWYLL---------NIYYNIFN-KQV--LRVY.---------
Q84XW3_CHLRE/83-381-----LV----------------------LGSM---FAGWYAA---------NIAFNIYN-KQL--LKAF.---------
Q8I420_PLAF7/43-340-----LK----------------------LALL---FLTWYTL---------NVLYNVDN-KKA--LNMV.---------
Q802Y0_DANRE/14-303-----MR----------------------IAVL---CLCWYTV---------SSGGNVIN-KII--LNSF.---------
Q7RSG8_PLAYO/40-339-----IK----------------------LALL---FITWYTL---------NVFYNVDN-KKI--LNIT.---------
GPT2_ARATH/95-384-----LK----------------------IGIY---FATWWAL---------NVVFNIYN-KKV--LNAF.---------
B7FPD9_PHATC/80-375-----.G----------------------LLLY---FGLWYLG---------NYYYNITN-KLA--LNAAG---------
D7TJE0_VITVI/103-390-----.V----------------------TGFF---FFMWYFL---------NVIFNILN-KKI--YNYF.---------
M4FCY2_BRARP/103-393-----LE----------------------LGLL---FAMWYLF---------NIYFNIYN-KQV--LKAL.---------
PPT1_ORYSJ/106-396-----LQ----------------------LGAL---FGLWYLF---------NIYFNIYN-KQV--LKVF.---------

PF00892

D6EP20_STRLI/151-288-----GP----------------------WLPM...AILICVA.------..WGVQAFCMRKAA..LVGV.---------
L8ANE0_BACIU/7-146-----FI----------------------GALT...CLVASMS.------..WGAMFPVA.DHA..LEFV.---------
I0ZKJ3_HELPX/6-141-----LF----------------------GVSM...ILLANLC.------..FGIMSAFV.KIT..ADYF.---------
D5AVZ9_RICPP/9-142-----LN----------------------GICW...FLLSLVT.------..SSINDVMS.KYL..GTRL.---------
O86204_ECOLX/151-286-----IV----------------------GYCL....VVAGVL.------..SAAFYVVISSRL..IKSF.---------
Y1533_ARCFU/1-136-----ML----------------------EILM...SLTAAIC.------..WAFNGIAY.RKG..VKDV.---------
O86204_ECOLX/5-139-----IK----------------------GMLF...AFLAAFS.------..WGAAIVMS.KKG..VEEL.---------
B9E5E1_CLOK1/155-292-----LI----------------------GICF...ALVAAVV.------..WSLYTVIS.KKR..IEIY.---------
YTR1_BUCSC/151-288-----IK----------------------GVIA...LLLAMTS.------..HAIIYLYS.KEK..YSNI.---------
Y270_BUCAP/150-287-----WK----------------------GILA...LLLALLS.------..HAVIYVEC.QKK..SCNV.---------
A0A017QUD2_SALET/150-287-----WQ----------------------GITA...LISAVLI.------..HAIIYTQC.KKR..SCTV.---------
O85268_YEREN/152-289-----WV----------------------GIIS...LVIAVIM.------..HALVYVQC.KKR..SCSV.---------
O57793_PYRHO/1-137-----MR----------------------GYLL...VFLAASM.------..WGTLGIFA.KFL..YRYN.---------
Y1552_ARCFU/8-133-----RY----------------------GEAA...IVLSAVL.------..MGTVSVFV.RNV....GG.---------
D5AUW8_RHOCB/5-144-----KG----------------------GWKLWAVLALPPLF.------..WAGNFIVA.RAS..RGEW.---------
A4XDY4_NOVAD/20-156-----QS----------------------PALL...LCLASFF.------..WALNPIVG.RAA..KDLL.---------
A0A017HZK6_ECOLX/5-145-----RK----------------------GMLN...VLIAAVL.------..WGSSGVCA.QYIMEQSQM.---------
J7JRE9_BACIU/7-149-----RM----------------------GLFY...VITGATC.------..WGIGGTVA.KKL..FQEY.---------
Q9ZF46_BACME/4-143-----AW----------------------GLLL...VIIGATM.------..WGVSGTVA.QYLFQHKSF.---------
F7UPD3_SYNYG/16-164-----HS----------------------PIYL...ALAVVIF.------..SAANPVTS.RIIELGKTYE---------
A0A017HZK6_ECOLX/156-291-----PA----------------------ALFW...GIASAFA.------..AAFYTTYP.STL..IARY.---------
Q9ZF46_BACME/154-289-----GW----------------------ALFW...GIGAAVT.------..SAFYTLQP.KRL..LAKW.---------
J7JRE9_BACIU/160-296-----AA----------------------AVVW...GVLSGFA.------..AAFYTLYA.VGL..LNKF.---------
G4EPI0_BACIU/13-147-----ST----------------------AVIK...MVISMVI.------..FGSIGFFS.EHT....NL.---------
F7URF2_SYNYG/11-146-----IR----------------------SGLT...LIAPFFL.------..WGTAMVAM.KGV..LADT.---------
J7JS06_BACIU/27-163-----MG----------------------AYVS...LAAAMAI.------..VGSSVVVG.KLM..VERI.---------
YTR1_BUCSC/5-140-----TI----------------------ILLL...FIIVSIT.------..WGTTFIAI.RIA..SDTI.---------
Q56929_YEREN/6-141-----FL----------------------VILL...FIMVSVT.------..WGTTWLAM.KLT..VETI.---------
Y270_BUCAP/4-139-----II----------------------IIML...FFLVSIT.------..WGTTWIAM.KIA..VETI.---------
A0A017QUD2_SALET/4-139-----VS----------------------ISIL...FMLVSLT.------..WGTTWLAM.RIA..VETI.---------
J7JNU4_BACIU/3-140-----KK----------------------TVQI...MISHSLMI------GLWASAFPGI.RAG..LEGY.---------
Y266_ARCFU/2-133-----KK----------------------WIVL...ALTVTF..------..WGLAFTAI.KYS..VRFL.---------
C4PN91_CHLTZ/23-158-----DM----------------------AIFL...IFLNAFI.------..WSSSFALS.KSA..MEAA.---------
Q9Z799_CHLPN/1-135-----.M----------------------SLFL...VFLTAFI.------..WSSSFALS.KLV..MNAS.---------
J7JZ94_BACIU/4-141-----LP----------------------KTRT...ALLLAFLV------IMWGVNWPLS.KAA..LAYS.---------
J7JVD8_BACIU/2-137-----VK----------------------VMLG...IISVTLI.------..WGYTWVAM.KVG..IHDI.---------
O58666_PYRHO/6-134-----SE----------------------GVIL...ALIGMLL.------..YGLEPVVI...S..YNPV.---------
Q9ZAR1_ENTAG/3-139-----KS----------------------SLWL...TMLMALI.------..WGTSFPVS.KIA..INVI.---------
J7JUX2_BACIU/4-140-----LN----------------------IYIM...LLGFSIF.------..TGATFNLA.KYT..VGYF.---------
O66073_BACLI/12-147-----QI----------------------CLCG...SFALCFY.------..HWFSFFFV.KLA..LTAA.---------
J7JS00_BACIU/7-142-----TP----------------------AYIA...AILYSFI.------..IGLSFLFV.KIA..LQTA.---------
Y510_ARCFU/3-136-----SK----------------------THLL...LALTMLI.------..WAGSFIFI.KIG..LKEL.---------
O58324_PYRHO/8-137-----RK----------------------AELI...LLGLSAI.------..WGTTFPVM.KIG..IKDF.---------
Y788_ARCFU/41-166-----LY----------------------ADLG...LALVALI.------..WGSTFPVV.KIA..LDSM.---------
J7JU04_BACIU/4-138-----NI----------------------YSLF...VLIAAFF.------..WGTTGTVQ.ALA..PESA.---------
Q9Z6F0_MYCSM/151-288-----HW----------------------ADLL....LFGAVI.------..AAAIGYAEGGLL..AREL.---------
D5AVZ9_RICPP/149-281-----NP----------------------EILY...LILAAIS.------..FAMLDIIN.KKF..VVKE.---------
O59158_PYRHO/22-155-----KP----------------------MNKY...AILAVLL.------..WSTVASAF.KLT..LSRL.---------
A0A009E7X9_ECOLX/158-292-----TW----------------------GVIF...GVGAATV.------..WVSYGVAQ.KVL..LRRL.---------
C9MFS0_HAEIF/155-289-----ST----------------------GVIL...GVGGALI.------..WVAYGMAQ.KLM..LRKF.---------
D6EP20_STRLI/5-140-----TR----------------------GWILY..ASLLVLF.------..WGVWGAFSSEPN..SRYG.---------
Y841_METTH/44-192-----LW----------------------GYIS...IITATIF.------..FGISATLD.KIM..LSSM.---------
F7UTM7_SYNYG/180-316-----VL----------------------GVST...GIASGIV.------..YAGYTVFA.QRS..FQRL.---------
YD3A_METJA/2-135-----DT----------------------AIIL...GLLVAVF.------..YGVGTFFA.KIV..CEKN.---------
C4PN91_CHLTZ/173-314-----GL----------------------PELL...LIAATCL.------..SSYGWTLL.RKL..GRRC.---------
Q9Z6F0_MYCSM/7-141-----RA----------------------GLGW...GFLGVAA.------..FSFTVIFT.RVA..LGGL.---------
A0A009EIR4_ECOLX/9-142-----PL----------------------AISG...LVVLTLI.------..WSYSWIFM.KQV..TSYI.---------
F7UPD3_SYNYG/180-319-----GL----------------------GESF...VAIAAFI.------..SAITTILS.KQQ..LQSI.---------
Y788_ARCFU/171-306-----NI----------------------GDIL...MLFCALF.------..FGAEIAMI.SHY..SRLS.---------
Q9ZAR1_ENTAG/144-287-----GL----------------------GEIV...ILCSAIF.------..WAIGAVVS.QKI..VTVT.---------
A0A009EIR4_ECOLX/151-290-----MK----------------------SAML...AILSGVS.------..WGASAIVA.KRL..YARH.---------
PECM_DICD3/1-130-----MK----------------------LKDF...AFYAPCV.------..WGTTYFVT.TQF..LPAD.---------
J7JS06_BACIU/176-314-----LF----------------------GNML...IIAAVIG.------..EALFTLMA.KLL..SPHI.---------
Y841_METTH/205-340-----VT----------------------GNFL...VMAAAFF.------..WSLDTVLS.KFL..SRKR.---------
O66073_BACLI/158-302-----LR----------------------GAAL...ILLSALS.------..SAGYSVLA.RKM..TRTF.---------
A0A017JYW9_ECOLX/147-281-----LT----------------------GCAL...ALGAGAC.------..WAIYILSG.QRA..GAEH.---------
J7JU04_BACIU/147-282-----VA----------------------GVLM...ALGAGAS.------..FAGYTLIS.KAM..MKTQ.---------
Y510_ARCFU/148-285-----IF----------------------GDVL...MIVDGFL.------..WAVYTVLG.SKM..LLKY.---------
Y976A_HAEIN/24-161-----LF----------------------GCLL...VLSAGII.------..FAAVLRWT.QRV..VAKV.---------
L8ANE0_BACIU/160-300-----LF----------------------SILF...IFIGVLG.------..WVVYTMGG.QI...FREW.---------
J7JUX2_BACIU/153-290-----SG----------------------GDLI...IFTGNVC.------..WALYGVLG.RRF..VKDG.---------
A4XDY4_NOVAD/169-306-----NR----------------------GDLL...AIIAVFL.------..YSAYATFL.RRA...PAM.---------
Y266_ARCFU/139-274-----IY----------------------GIAL...VMVSTVA.------..AAIYTTFG.KSL..LSKY.---------
D5AUW8_RHOCB/157-295-----AR----------------------GDLI...IFAAMVA.------..WALYTMGL.KTF..PAEV.---------
WTR2_ARATH/184-324-----FL----------------------GPFL...IMAAAVS.------..WAAWFIIQTKMS..ETFA.---------
O59388_PYRHO/154-290-----AR----------------------GVLL...VVVAELL.------..WTIAILIT.DWL..VSNE.---------
O58347_PYRHO/149-285-----YK----------------------GILF...ALITPIL.------..WSIAIVIM.DWL..SNFI.---------
YSO2_ACIAM/105-237-----LI----------------------GIVL...TLINAFF.------..WALFTVYF.RK...LRGF.---------
J7JNU4_BACIU/149-285-----MS----------------------GILV...ILLAAFS.------..ESIYFVFQ.ARY..IKKY.---------
O59158_PYRHO/167-298-----PM----------------------GDLL...ALCSAII.------..WAIYWILN......LRDP.---------
F7URF2_SYNYG/171-308-----SS----------------------GELW...MLLASLS.------..MAVGTVLI.PFV..SRRV.---------
J7JVD8_BACIU/148-285-----LF----------------------GELC...VLVAALS.------..WGIANVFS.KLQ..FKHI.---------
J7JZ94_BACIU/150-287-----VI----------------------GVLL...ALGSAVS.------..WALGTVYM.KKT..GSRV.---------
YCB6_PSEDE/3-140-----QS----------------------WQFW...ALLSAAF.------..AALTAVFA.KVG..VAQI.---------
O58983_PYRHO/5-140-----QA----------------------YLIY...AVLAAFF.------..ASLVPIFG.KIG..LKDV.---------
Y1533_ARCFU/143-274-----TS----------------------GLFY...ALLAAFS.------..WALAILTL.DFL..TDRL.---------
A0A009DPG9_ECOLX/149-285-----PW----------------------GAIL...ILIGSIS.------..WAFGSVYG......SRIT.---------
G4EPI0_BACIU/159-292-----GS----------------------GIIW...AVLAALF.------..YAFTTLLG.KG...IHNL.---------
O59388_PYRHO/9-144-----AL----------------------GVIL...AFSAAFT.------..WALTSVLS.KVS..MRRV.---------
O58347_PYRHO/2-140-----LL----------------------GVLL...ALTSAFC.------..WGTSSVLI.KVG..LRGK.---------
J7JN80_BACIU/162-303-----MI----------------------GAVF...ILLSSAV.------..YAGYLVLS.GHL..VHQI.---------
A0A009DPG9_ECOLX/9-141-----LF----------------------GALF...ALYII...------..WGSTYFVI.RIG..VESW.---------
C9MFS0_HAEIF/6-142-----LL----------------------GFTF...ALITAMA.------..WGSLPIAL.KQV..LSVM.---------
A0A009E7X9_ECOLX/6-144-----GI----------------------GILL...ALTTAIC.------..WGALPIAM.KQV..LEVM.---------
O67627_AQUAE/4-141-----LK----------------------AVFW...ALLAAFI.------..WGTAPIFF.KLG..MKGE.---------
G4F0I2_BACIU/7-141-----TS----------------------GHIA...AIVTILI.------..WGTTFIST.KVL..LADF.---------
Y1552_ARCFU/139-269-----TF----------------------GIIF...GIVSGLS.------..YAIVFVLS.KEA..RKKH.---------
O57793_PYRHO/144-274-----LK----------------------AIVA...GLTSGFT.------..YALYGVFA.KMA..VSKE.---------

PF08449

S35B4_MOUSE/2-314LNIAMPL----------------------HMIFRSGSLIANMI---------LGIIILK..KRYSMFKYT----------
O44166_CAEEL/6-310FHVPVPL----------------------HIIFRSGSLLATLI---------LSVVMVG..KSYSARKYI----------
Q9VAN9_DROME/6-318FKVPMTL----------------------HMIIRGGSLISNMC---------LCTLILK..RSYRLSQYI----------
YEA4_KLULA/2-321FDISVPI----------------------HIIIRCSGTTLTMI---------IGWAVCN..KRYSKLQVQ----------
YEA4_SCHPO/1-304FDISVPV----------------------HIILRSSGPLTTMA---------VGRILAG..KRYSSLQIG----------
S35B4_DICDI/7-328CDIPIPF----------------------HMIFRSSSLLSTIV---------IGSIFYR..KSYSKQQIL----------
S35B3_DROME/61-364Y.LNYPT----------------------QVIFKCCKLIPVLV---------GSILIQG..KRYGLLDFA----------
UTR5B_ARATH/18-321Y.VSFPV----------------------QTLAKCAKMIPVMV---------WGTLIMQ..KKYKGFDYL----------
YEA4_YEAST/3-327YNISIPI----------------------HIVFRCFGTVITMF---------TCWLLNG..RKYTKIQIL----------
UTR1_ARATH/13-318Y.ISYPA----------------------QVLAKSSKMIPVML---------MGTLVYG..IRYTFPEYM----------
S35B4_DROME/6-325FNIPMPL----------------------HMIFRSGSLMANMI---------MGIVLLK..KRYNLRQYS----------
S35B3_CAEEL/41-332Y.LNYPT----------------------QVIFKCCKLIPVLI---------GGILIQG..KRYGWIDIG----------
UTR2_ARATH/22-312Y.LNYPA----------------------QIMFKSTKVLPVMI---------MGAFIPGLRRKYPVHEYI----------
S35B4_DANRE/2-314FNIAMPL----------------------HMIFRSGSLIANMI---------LGIIILK..NRYSMSKYL----------
F1P4W7_CHICK/48-339Y.LNYPT----------------------QVIFKCCKLIPVMV---------GGVFIQG..KRYNIADVS----------
F7D3M1_XENTR/123-422F.ISFPT----------------------QVLAKASKVIPVML---------MGKLVSH..KTYEYWEYL----------
Q1K947_NEUCR/81-406YDISVPV----------------------HIILRSGGSITTMI---------AGALWG...KRYSRIQIV----------

PF06027

S35F1_MOUSE/56-355AGENKLV----------------------GDLL---VLGGATL---------YGISNVWE-ESI--IRTL----------
Q948Q8_ARATH/10-301GGSNPVK----------------------GDFL---VIAGATL---------YAVSNVTE-EFL--VKNA----------
S35F2_HUMAN/35-334SGSDVLI----------------------GDIL---VLLGASL---------YAISNVCE-EYI--VKKL----------
Q948Q7_ARATH/12-303GGSNPVK----------------------GDFL---VLAGATL---------YAVSNTTE-EFL--VKNA----------
YCN8_SCHPO/137-433SAVNPGL----------------------GDGY---MIIGATC---------YGVSNTLE-EYF--ASKL----------

PF08627

D3B5S8_POLPA/52-390.SLIPSL..TG.....KSDA..N..N...KVFWNLFYLISMIP---------FALSNIYKDIGFQSVQDM----------
H3GRN7_PHYRM/13-337.VLGSGD..SG.....SSSG..T..NPHLIVLWSVVMIFSCVP---------MCLSSVYKEKTLGEA.EL----------
Q5CIN3_CRYHO/46-383STLILGIRKSS.....GAEN..S..N...QLIFNILFVIACIP---------ASASSVYKDLSFREYSSL----------
CRTP2_DICDI/60-403.SLIPSL..TG.....GNTS..G..N...MLFYNFFYLISMIP---------YAFSNVYKAIGFSTVEDM----------
CRTP1_DICDI/52-397.SLIPSL..LG.....GSSG..G..N...KPFWNFFYLLSVIP---------GALSNVYKDIGFQAVADM----------
B6AJI0_CRYMR/52-389.VKSAVI..LGFRDISESDK..S..N...YLVFNILFIISCIP---------ASASSVYKDMTFRETSSL----------
CRTP3_DICDI/55-397.SLIPSL..VG.....GSSG..G..N...ILFYNFFYLISVIP---------GALSNVYKDIAFQSI.DM----------
D7G582_ECTSI/57-381.AIGPSL..AV.....GSSSGGG..Q...ELVWSMVLVASCLP---------MALSSVYKEMALGES.EL----------
F0VNJ4_NEOCL/328-662.VKLPDL..LH.....PSPD..GGDD...MFVFNLLYLLSNLP---------VAISCVYKEMAFRGV.EM----------
F4Q0G1_DICFS/42-373.SLIPSL..TG.....PPDP..T..N...SVFWNFFYLISIIP---------FAGSNVYKDIGFQAVADM----------
F0Z9W2_DICPU/55-406.SLIPSL..VG.....GGNS..G..N...KPFWNVFYLISVVP---------GALSNVYKDIGFKAVEDM----------
CRT_PLAF7/61-391.LVEMKL..SF.....ETQE..E..N...SIIFNLVLISALIP---------VCFSNMTREIVFKKY.KI----------

PF05653

NPAL2_MOUSE/45-332LRASDLL----------------------GMTL---AFAGTYL---------LVNFAPNI-TQAISARTVQ---------
Q9VK62_DROME/43-338LNLLGKI----------------------GCFL---CILGSTI---------IVIHSPKE-KEIEDLQLLF---------
NIPA2_HUMAN/8-302LNLHGKI----------------------GCLL---SILGSTV---------MVIHAPKE-EEIETLNEMS---------
B3LFA3_ARATH/7-299LHMFGIL----------------------GCVL---CVVGSTT---------IVLHAPHE-QGIESVKQVW---------
H2U3Z2_TAKRU/23-316LNIHGKV----------------------GCLL---SILGSTV---------MVIHAPQE-EEVASLSAMA---------
Q8GWX2_ARATH/3-295LKKMGVL----------------------GCVS---CIVGSVV---------IVIHAPKE-QTPNSVEEIW---------

PF16913

PUP2_ARATH/6-340DNYLYSY----------------------GLAYIPVSTASLIIS------AQLGFTALFA-FFMVKQKFT----------
PUP11_ARATH/44-362DNMLYSV----------------------GLLYLSASTYSLICA------TQLAFNAVFS-YFINAQKFT----------
PUP20_ARATH/46-377YSQLYAI----------------------GRTHCVF..FFWIFT------TQLIFTSIFT-AIINKHKFN----------
PUP6_ARATH/36-361HCILYSF----------------------GLLYLPVSTFSLISA------SQLAFNAVFS-YFLNSQKIT----------
Q8H7P2_ORYSJ/48-373SCFVYAL----------------------GSQALPLSTSSLLLA------TQLAFTAVFA-FLFVGLRFT----------
PUP12_ARATH/30-348DNFLYSV----------------------GLLYLSASTYSILCA------SQLAFNGVFY-YYINSQKIT----------
PUP1_ARATH/4-334DNYLYSY----------------------GLAYLPVSTSSLIIG------TQLAFNALFA-FLLVKQKFT----------
PUP3_ARATH/4-327DNYLYAY----------------------GIAYLPVSTAALIIA------SQLAFIAIFS-FFMVKHKFT----------
PUP15_ARATH/45-380QAFFSDV----------------------.RNQIPYRVFTLTYT------TQLLFTLIFS-KYYNDIKFN----------
PUP5_ARATH/38-353DNLMYAY----------------------AYAYLPASTSSLLAS------SSLAFSALFG-YLIVKNPLN----------
PUP18_ARATH/39-376HSKLFAL----------------------GKLYANFGVFTLISA------TQLIFTAIFA-AIINRFKFT----------
PUP14_ARATH/47-391QGRLAAM----------------------GKLEIPFGVFTLIYT------AQLFFTPIFA-AFINKIKFN----------
PUP4_ARATH/26-344NNFLFSW----------------------GTSYLPVSTSSLLLS------TQLVFTLILS-RIIVKQKIT----------
PUP8_ARATH/46-367NSYMSSV----------------------GLLYLPVSTFSLILA------SQLAFTAFFS-YFLNSQKFT----------
PUP16_ARATH/30-368YSKLYAL----------------------GKLYVGWG...ILLS------TQLILTSLFS-AFINRLKFN----------
Q7XN26_ORYSJ/40-356DNLMYSY----------------------ALQYLPVSTFSLVAA------TQLGFNSVTS-RLINAQRFT----------

PF04657

Q21DH8_SACD2/19-159------L----------------------PAML---ALLAGAA---------IAVQASLNAKLGVL.IH.----------
Q39SB9_GEOMG/5-141------A----------------------LFLL---MMCGGTA---------VALQPSINARLAQK.IG.----------
A6TN22_ALKMQ/4-138------I----------------------AMLL---SILAGVS---------LVFARMVNASLAKE.VG.----------
A3QFA9_SHELP/30-170------L----------------------NLML---GLLGGVA---------LAVMIALNSELAKY..G.----------
A6VSJ3_MARMS/9-148------M----------------------LAAV---AVIAGAL---------VPFQAGSNAELGRA.LG.----------
Q1GQL8_SPHAL/9-147------A----------------------FAAI---MLLTGVG---------IPILAALNGGLGAR.LG.----------
Q1QZC8_CHRSD/5-140------V----------------------ILLA---VLLAGMG---------LSMEAGLLGPLGED.IG.----------
Q2RGM8_MOOTA/15-156------V----------------------FFFL---ALGIGAI---------WALQPVINAGLARS.TG.----------
Q0AXV4_SYNWW/5-143------L----------------------YLSL---AALSGAA---------MALQGTFNAALGKV.VG.----------
Q7N4X7_PHOLL/3-137------S----------------------LIFI---AFLNGIF---------IAATRTINGQLSVS.IG.----------
Q03TA8_LACBA/2-142------L----------------------PVTI---GIIIGGI---------ISCQTAINSRLRAF.IG.----------
A6LU87_CLOB8/1-136------M----------------------YNIL---SLLIGVL---------ITIMIAFNAKLSDG.LG.----------
Q03TA8_LACBA/164-305------P----------------------WRLL---GIVGGAL---------GAVQTTINGHLGVV.LN.----------
Q11NT1_CYTH3/6-142------T----------------------TFIM---LAIAGIA---------VAFQAGVNGALGKQ.IG.----------
Q0KF63_CUPNH/16-155------L----------------------PLGT---AVLAGAA---------IPFQAGANATLGRT.LG.----------
A1AK06_PELPD/5-141------T----------------------LILL---MLCGGMA---------IAVQPSINARLAQK.IG.----------
Q5KZC7_GEOKA/4-140------V----------------------WMLL---ALTAGMA---------VSVQAGVNGGLGKR.IG.----------
Q4KHW5_PSEF5/5-144------I----------------------SILL---SLLAGFA---------VPLQAGTNSRLGHL.LG.----------
A0JUK3_ARTS2/163-299------L----------------------PVLL---PVIAGFL---------MSFQQAMNGTATVH.YG.----------
Q7UTT1_RHOBA/5-133------I----------------------WILM---ALAAGSA---------LPLQGGVNAKLGKA..GA----------
Q03HH1_PEDPA/168-308------L----------------------WQIF---GVLVGGM---------LAIQAALNGRLGGL.LQ.----------
Q03HH1_PEDPA/2-142------G----------------------LLML---GLVAGAV---------VPFQTAVNSRLRTY.VI.----------
A6VKF2_ACTSZ/4-143------P----------------------YFLL---ALVAGAA---------LASQAAINSRLAQAVLG.----------
Q03Y21_LEUMM/166-301------L----------------------NRLW---AFGAGIL---------CTVQSTFNGQLGHY.IQ.----------
B1YHB6_EXIS2/3-139------L----------------------GIVL---ALFGGMM---------VCIQNTFNAKVKEQ.VG.----------
Q3A9B8_CARHZ/6-140------L----------------------AYMI---AALAGMA---------MAIQGSMNSALSKS.IG.----------
A8MKQ0_ALKOO/2-138------L----------------------GIIF---SILAGIF---------VSLQSVFNTRVSDK.VG.----------
B1YEL8_EXIS2/4-140------I----------------------YYLL---ALLAGIA---------LSIEGAIYGELGNS.IG.----------
Q8YKX2_NOSS1/5-144------L----------------------ALLG---AGSAGGF---------STIGAAANAQLKTI.LD.----------
Q12R75_SHEDO/9-146------F----------------------YGLL---MCAAGIG---------IPVMAALNAGLGTK.LN.----------
Q9RVB6_DEIRA/8-144------L----------------------VLLG---TLGAGLG---------LSAGGAFNLRLLRG.LR.----------
A1A0P8_BIFAA/203-343------L----------------------WSCA---GIAFGMC---------SAVQTALLGKLGVA.LG.----------
Q749R3_GEOSL/5-141------V----------------------LFLL---MMCGGVF---------IAVQPSINARLAQK.TG.----------
A6M3J1_CLOB8/2-138------F----------------------GIIC---AIISGIA---------MSIQGVFNTRLGEK.IG.----------
Q65J95_BACLD/5-146------L----------------------ILIA---GILAGMA---------IPVQTSINSRLGMK.IG.----------
Q28TA8_JANSC/7-146------L----------------------VIAL---VVAVGAA---------LAMQAPINAALARE.VG.----------
Q12K32_SHEDO/8-147------L----------------------LLPF---SILVGFS---------FASQAGINAQLRLG.LS.----------
Q9RVB7_DEIRA/19-157------G----------------------PLLL---LIAAGAL---------LPGQFAVNTALARQ.VG.----------
A3QFA8_SHELP/3-133------T----------------------LLLL---ALLNGVC---------IGLCRILNGRLGQA.SD.----------
A5G8U5_GEOUR/6-141------L----------------------FF.L---MFCGGFA---------VALQPSINGRLAQK.VG.----------
Q8YKX1_NOSS1/33-172------L----------------------YVLL---ALLNGAI---------LPIQSNLNAQLARS.LN.----------
A9KHN5_CLOPH/2-140------I----------------------GWIV---ALISGAL---------MSIQGVFNTGVTKQ.TS.----------
Q8FQJ9_COREF/99-239------L----------------------WRGL---GLLMGAC---------AAMQVSVNGQLGVV.LG.----------
B1YGF5_EXIS2/14-153------L----------------------AIII---GLIIGIL---------VPVQTSVNTRLRGI.VG.----------
Q6D0D7_PECAS/13-152------L----------------------PLGI---AVLAGSI---------VPFQAASNAALGRS.LG.----------
A8LKG3_DINSH/5-143------L----------------------AIGA---IALGGAG---------IALQAPINAQLARA.SG.----------
Q28R25_JANSC/3-140------T----------------------QALI---MVLAGIG---------IPILAALNARLGAN.IG.----------
Q316U3_DESAG/4-143------L----------------------LFVM---ALLAGAT---------LPTQAGINSGLQAHWAG.----------
B1YGF5_EXIS2/179-317------G----------------------WRIM---GVVMGMM---------SAAQAAINGHLGVV.LD.----------
Q65QN9_MANSM/39-179------P----------------------YILI---ALIAGTA---------LASQAAINSKLAQAMLG.----------
B1YIK4_EXIS2/3-139------L----------------------GMFC---AIVAGMM---------ISLQTVLNARMSHA.FG.----------
Q04FL6_OENOB/173-313------F----------------------WRIG---GIVTGMF---------SASQTAINGHLGTV.LN.----------
Q31P27_SYNE7/5-144------I----------------------ALLG---AGSGGGL---------LSIGAAANARLKQT.LR.----------
Q5R178_IDILO/5-143------I----------------------LVIL---AIAAGMS---------ISIQASINAMMGQL.AH.----------
A9BWW9_DELAS/11-150------A----------------------PVAL---ALLAGAI---------LPFQAASNALVGRL.LG.----------
A0PXE0_CLONN/7-143------L----------------------GFIY---SVVAGIF---------MSIQGVFNTRLGEK.IG.----------
Q6FEY6_ACIAD/10-149------L----------------------LLPL---ALGIGIA---------MSVQTALNTQLRDY.LD.----------
Q03UQ1_LEUMM/173-314------P----------------------WQFL---GFVTGML---------SALQTAINGHLGKV.IN.----------
Q97DD1_CLOAB/2-138------I----------------------GIIS---SIISGIC---------MSLQGVFNTRLSEK.IG.----------
Q5Z3K6_NOCFA/3-148------L----------------------GLVF---GFCIGAG---------VAVQARINGALGMR.LH.----------
Q67KE9_SYMTH/5-146------L----------------------FWLI---IILGGVA---------GAVQAPVNATLAQH.I..----------
Q2RM98_MOOTA/3-140------L----------------------ALLI---ALVSGIA---------MAFQGSLNSALAKI.TG.----------
Q65J96_BACLD/10-156------L----------------------FMML---GLFAGMA---------SPIQTSINSELRNA.IH.----------
Q1LCM1_RALME/14-153------M----------------------PLGV---ALLAGAM---------IPFQAGSNATLGRA.LG.----------
Q7NSE3_CHRVO/15-151------G----------------------LSAL---ALLAGAL---------LALMIHCNSRLAAY..G.----------
A6LU86_CLOB8/2-134------F----------------------FVLI---SIAAGAI---------VVISRILNTRLSEK.VG.----------
Q9CJV1_PASMU/4-144------F----------------------YTII---ALVAGVA---------LASQAAINSQLAKA.MGN----------
Q53WI3_THET8/6-144------A----------------------WVLL---ALLAGAV---------LPLQAGVNAELARV.VG.----------
A9CIC3_AGRT5/3-135------V----------------------WIAM---AFAGGVF---------VSLSRQINGRLSLS.NS.----------
Q0BSA2_GRABC/6-144------L----------------------YPLI---.LIAGAL---------QAWGPPMNGALRVS.LI.----------
B1YHB4_EXIS2/2-138------R----------------------GILF---AISGGFF---------LTLQSVANARISNG.IG.----------
Q3HKF8_RHOS4/5-144------V----------------------LSCL---ALVSGAL---------VPLQGGANAALGRA.LG.----------
Q18BT7_PEPD6/5-139------W----------------------AIIF---ALLAGGS---------TALEAFINGELGKS.TT.----------
B1YIK3_EXIS2/2-138------K----------------------GIVF---ALFSGLF---------IALQGIFNARLGDA.VG.----------
Q1QZC9_CHRSD/5-141------F----------------------IFLV---LLVGGAA---------LAAQSSINGRLGAN.VG.----------
Q7NSE2_CHRVO/2-129------F----------------------FMTL---AIANGLC---------IGGSRSINGKLAQH.DG.----------
Q5HRB7_STAEQ/151-293------F----------------------WLLI---GFVFGFA---------PPIQTTINSTLAQH.TH.----------
A5D651_PELTS/6-144------L----------------------PLAI---AALSGIA---------MAVQGSLNSALGKV.VG.----------
Q7P1D2_CHRVO/22-162------I----------------------FPLL---AFLVGVV---------VPLQAAVNNQLRLL.LGN----------
A4J0N8_DESRM/6-144------L----------------------ALII---AAISGLT---------MALQGTMNSALGKV.VG.----------
A4XQ88_PSEMY/7-145------W----------------------LLAL---PFIAGAV---------LPLQAGINGQLARH.LA.----------
Q03UQ1_LEUMM/2-142------P----------------------LFIL---GLVIGFG---------LPIQTAVNSKLRSV.LG.----------
Q168E1_ROSDO/6-143------Q----------------------YAFT---MVLAGIG---------IPVLAALNAALGAK.IG.----------
Q1WV36_LACS1/3-143------L----------------------LALI---PVFMGSG---------LAIQTAINSRLGSV.SG.----------
A1A0P8_BIFAA/19-158------L----------------------QGLL---GIFSGLI---------TPVQTAVNTRLGRS.IG.----------
Q03Y21_LEUMM/4-142------I----------------------YIAL---AIGAGLI---------LAAQNAVNAQLSFL.LK.----------
Q98M54_RHILO/5-145------V----------------------WSLL---GILSGAF---------IAIQAPINSQLARG.LG.----------
Q899N2_CLOTE/13-149------L----------------------GIIF---SIIAGIS---------MSFQGVFNTRLSDK.VG.----------
Q04FL6_OENOB/2-142------F----------------------AVII---GLSIGIG---------LPMQTAINSRLRNA.FS.----------
B1YEL9_EXIS2/4-140------A----------------------LLGM---TLLGGIL---------LSAQSSINGAFGQK.AG.----------
Q2KZA1_BORA1/11-150------L----------------------PMLI---ALLAGAA---------VPFQGAGNAALGRA.LG.----------
B0UV26_HISS2/5-138------.----------------------FILI---ALCAGIA---------LAAQAAINTQLAQS.LSG----------
B2HD53_MYCMM/9-144------.----------------------...F---IILGGAL---------QTCGAAMNGQLYKH.MI.----------
B4EH13_BURCJ/7-144------.----------------------.YLL---VVAAGIS---------VALQQVLNANLRAQ.IG.----------
C5AMM3_BURGB/15-150------.----------------------...A---ALVAGAL---------VPLQAGSNAALGRA.LG.----------
D5C835_ENTCC/6-143------.----------------------TLAF---LVAAGIG---------LVVQNTLMVRITQS.SS.----------
Q24WC2_DESHY/8-142------.----------------------PAVI---AAISGIT---------MAIQGTLNSQLYQK.TS.----------
Q24WK5_DESHY/6-141------L----------------------FVLV---ALCGGMV---------MGIQTPINGALGKR.IG.----------
Q2G2U7_STAA8/151-293------F----------------------WLLL---GFIFGFF---------PPIQTTINSALASH.TH.----------
Q4FVN5_PSYA2/4-139------L----------------------LILI---VVLGGMG---------LSVEAGLLGPLGSQ.VG.----------
Q4FVN6_PSYA2/5-140------L----------------------MIVL---AIIGGAA---------LSIQAALNGRLGSN.VG.----------
Q6M0K5_METMP/6-143------.----------------------ALIF---AIVVGFV---------ASLQPIINSKLGEH.IG.----------
Q726Q6_DESVH/5-141------.----------------------LLLM---GLLAGAV---------LPTQAGINAMLTEQWAR.----------
Q7CQI5_SALTY/6-143------.----------------------TLIF---LIAAGVG---------LVVQNSIMVRITQT.SS.----------
Q813A7_BACCR/2-135------L----------------------YITI---AILAGVS---------IVVARIINANLAKE.IG.----------
Q813A8_BACCR/2-136------.----------------------YNFL---SIFIGVL---------IAVMLPLNGILSEL.IG.----------
Q88GV8_PSEPK/16-154------.----------------------PVAM---ALLAGAV---------LPFQAAGNAAAGRA.LG.----------
Q8EJT6_SHEON/3-135------L----------------------MVLI---ALLNGGL---------IALSRTFNGALAKH.SH.----------
Q8EJT7_SHEON/11-158------.----------------------MSFV---ALCSGVL---------LALMIKLNSQLAMY.SS.----------
Q8NRH8_CORGL/57-196------L----------------------WRLF---GVVMGMC---------QATQVAVNGYLGTV.LG.----------
Q8XH76_CLOPE/3-138------.----------------------GIIL---AIISGAA---------MSIQGVFNTRVSEK.IG.----------
Q8Y7R1_LISMO/4-145------L----------------------FIVS---GLLAGMV---------LPVQTAINTRLSTY.TK.----------
Q8ZLF8_SALTY/10-154------L----------------------LMLA---TILAGML---------SPMQSAVNGQLGHW.LQ.----------
Q92CJ8_LISMO/11-151------L----------------------FMAM---GLVSGLL---------SPIQTSINSQLRLT.VG.----------
Q9CES9_LACLA/4-142------.----------------------YLAF---ALVGGFL---------LANQNPINADLRKI.VG.----------
Q9HUZ5_PSEAE/8-145------.----------------------LFVL---PLLAGAC---------LPLQAGINGQLAKQ.VS.----------
Q9HYS5_PSEAE/5-144------L----------------------MVLM---AVSVGGM---------VVLQAGSNALLGRL.LG.----------

PF10639

Q4TT81_CAEEL/12-122------------------------------------IIVVGFV---------WGATNPLLRAASKDLENK----------
A0C2W3_PARTE/7-116------------------------------------LLVVGII---------WGITNPFMESGVGNKQQD----------
Q4D1L3_TRYCC/4-115------------------------------------LLLAAII---------WGITNPLLKRYSSGMAVS----------
Q22BW6_TETTS/16-127------------------------------------LILVGIM---------WGITNPLMEMGSKTQNLE----------
TM234_ANOGA/20-135------------------------------------ILLVAIM---------WGATNPFIKRGSIGYNEL----------
TM234_PONAB/11-126------------------------------------LVLVAAL---------WGGTQPLLKRASAALQRV----------
Q0U0B5_PHANO/22-148------------------------------------FLMVGAC---------WGLTTPFMRRAAMNYTPI----------
A4I0H4_LEIIN/5-115------------------------------------MLLAALL---------WGVTNPLLKHYSRGMASS----------
TM234_DICDI/9-124------------------------------------LLLVGFI---------WGGTNPLIKRGSEGVSKV----------
A7SF34_NEMVE/12-127------------------------------------LLGVALL---------WGVTNPFIKKGSAGIEDV----------
Q57W61_TRYB2/4-115------------------------------------LLLAGII---------WGITNPLLKRYSGGMSVD----------
Q179X3_AEDAE/11-126------------------------------------IVVVALL---------WGATNPFIRRGSLGYNNL----------
A1Z7W3_DROME/8-123------------------------------------LLAVGLL---------WGVTNPFIRLGSQGIESV----------
B8A4M2_DANRE/10-125------------------------------------LLLVAIL---------WGGTNPFLKKGTEGIEEV----------
H3DIR9_TETNG/11-126------------------------------------LLLVSVL---------WGCSNPLLKRGTQGLETV----------

PF00893

EMRE_ECOLI/2-94-----------------------------NPYI...YLGGAIL---------AEVIGTTLMKF.......----------
YVAE_BACSU/1-93-----------------------------MNWV...FLCLAIL---------FEVAGTVSMKL.......----------
MDTI_ECOLI/4-99-----------------------------FEWVHAAWLALAIV---------LEIVANVFLKF.......----------
YVDS_BACSU/1-89-----------------------------MNWV...LVFIAGL---------LEVVWASSLK........----------
EBRB_BACSU/2-94-----------------------------RGLL...YLALAIV---------SEVFGSTMLKL.......----------
YKKD_BACSU/2-94-----------------------------LHWI...SLLCAGC---------LEMAGVALMNQ.......----------
EBRA_BACSU/3-95-----------------------------IGYI...FLTIAIC---------SESIGAAMLKV.......----------
YVDR_BACSU/1-93-----------------------------MAWF...LLVIAGI---------EEIIAAIAMKY.......----------
Y4NH_RHISN/1-106-----------------------------MNAVPIILVFAAGL---------NSCIGNILLKWGRASLPP----------
YKKC_BACSU/1-90-----------------------------MKWG...LVVLAAV---------FEVVWVIGLK........----------
B4EWY3_PROMH/1-93-----------------------------MSWI...ILFVAGL---------LEIVWAVGLKY.......----------
E6W493_DESIS/3-94-----------------------------.GWL...FLVIAIV---------GEVIATSALKS.......----------
SUGE_ECOLI/1-93-----------------------------MSWI...ILVIAGL---------LEVVWAVGLKY.......----------
MMR_MYCTU/1-94-----------------------------MIYL...YLLCAIF---------AEVVATSLLKS.......----------
MDTJ_SHIDS/4-94-----------------------------.YWI...LLGLAIA---------TEITGTLSMKW.......----------

PF04142

GMS1_SCHPO/11-323YQLKILT----------------------TAIFSILLLHRRLGP------MKWFSLFLLTGGIAIVQLQNLNSDDQ---M
O01879_CAEEL/6-314YQMKIFT----------------------TAIFMYFFLGKKLST------KQWWALVLLVLGVADIQYVYSPPPAS---E
O76865_DROME/18-342YQLKILT----------------------TAMFAVVILRRKLLN------TQWGALLLLVMGIVLVQLAQTEGPTS---G
S35A1_HUMAN/8-314YQLKIPC----------------------TALCTVLMLNRTLSK------LQWVSVFMLCAGVTLVQWKPAQA...---.
S35A2_HUMAN/31-339YQLKILT----------------------TALFSVLMLNRSLSR------LQWASLLLLFTGVAIVQAQQAGGGGP---R
S35A3_CANFA/1-314YQLKILT----------------------TALFSVSMLSKKLGV------YQWLSLVILMTGVAFVQWPSDSQELD---S
UGTP1_CAEEL/37-351TQLKVVS----------------------TAFFMMLFLGRKFST------RRWMAITLLMFGVAFVQMNNVSASEA---N
O16658_CAEEL/7-326YQLKILT----------------------TAIFSVTMLGKSLHR------YNWMALILLTAGVALVQYPSGDSTTS---K
O02345_CAEEL/5-360YQLKILT----------------------TAAFTVLVLHRRLTI------QQWISLFVLFAGVVVVQYDQKMSNER---E

PF06800

GLCU_BACSU/4-283L.SLR..----------------------IFIV---GIVSGLF---------WSLGQANQLKSIQLMGVS----------
Y176_LISMO/4-283Y.TLK..----------------------TVGI---SFITGCL---------WTVGQMFQLQAFKIIGVS----------
Y2157_STRA5/5-285M.TAS..----------------------LWIF---GILGGIL---------WSVGQNGQFQAMKYMGVS----------
RBSU_LACPL/7-294FPSGM..----------------------NLWF---SILSGIG---------WASAQIVTFKVFTMVGSS----------
Y2503_LACPL/4-283L.TSK..----------------------IWLI---GIVSGLF---------WSIGQGQQFTSMKAVGIS----------
RBSU_LACSS/7-293IPETK..----------------------TFIF---CLISGAC---------WALAQIITFHVFETMGVS----------
Y169_LISMO/4-283Y.TAT..----------------------IIIA---SFVSGAF---------WSLGQMNQFRAFTQVGVS----------
YXFA_LACLA/5-291L.TWQ..----------------------IFLI---GFIGGLL---------WAIGQFGQFNSMKYMGVS----------
Y2594_LACPL/4-282V.TISGV----------------------TFGL---AMISGAA---------WAIGQLGQYISYRLLGVS----------
Y2205_STRP1/5-285M.TLQ..----------------------LWLF---GILGGFI---------WSIGQTGQFHAMQYMGVS----------
Y424_LISMO/5-284I.TVL..----------------------SFIV---SFISGIF---------WSFGQLLQFKGIAASSVA----------
Q2G1A4_STAA8/7-292FPTGT..----------------------NLLF---ALLSGAG---------WGFGQIITFKAFELVGSS----------
RBSU_STAEQ/7-292LPGGM..----------------------ALVF---SLISGAG---------WAFGQIITFKAFELVGSS----------
GLCU_STAEQ/7-284FDNLT..----------------------VIIV---GLVSGAL---------WAFGQGNQLKSVHLIGVS----------

PF07857

Q20583_CAEEL/6-327MTTAPAP----------------------IHPI---AMLSGMF---------YSVGNSLTVFIMDGIGLA----------
TM144_CAEEL/4-345STQGFPE----------------------FEPL---AMLGGMF---------WALGNATAVPIMNTIGIG----------
Q9U3C0_CAEEL/15-349AARGFPK----------------------FEPI---ACIGGFL---------YATGNVFSVPIVEGIGMG----------
TM144_HUMAN/9-344LILHCPK----------------------FWPF---AMLGGCI---------WATGNIAVVPIIKTIGLG----------
Q95QA2_CAEEL/2-342ALLGFPP----------------------IYPL---AMLGGAL---------WCAANAFAFLIMNRLGLA----------
O01810_CAEEL/4-351ATTGFPG----------------------FYPL---AMLGGAS---------WCIGNATAIPIISRLGLA----------

PF04342

W0A9J2_9SPHN/8-113-----------------------------TIIL---LTFSNIF---------MTTAWYWHLK........----------
W0ESB8_9PORP/6-120-----------------------------SIGL---LIISNIF---------MTLAWYGHLK........----------
R7J057_9BACT/7-121-----------------------------TILL---LVVSNVF---------MTFAWYGHLK........----------
R5GE85_9BACT/6-120-----------------------------TLLL---LVCSNVF---------MTVAWYGHLK........----------
C9RMH7_FIBSS/7-121-----------------------------TILL---LCCSNIF---------MTFAWYGNLK........----------
C1EGV5_MICSR/11-116-----------------------------VVAL---FILSCSF---------MTVAWYGHLK........----------
R6M9N1_9BACE/6-121-----------------------------TILL---LIVSNVF---------MTFAWYGHLK........----------
M4VF68_9DELT/12-111-----------------------------SIAL---LVASNIF---------MTFAWYGHLK........----------
R7KRF0_9BURK/11-114-----------------------------TIGL---LLCSNLF---------MTFAWYGHLR........----------
B3DXJ3_METI4/19-122-----------------------------TVFL---LILSNIF---------MTLAWYLHLK........----------
R5GGI4_9PORP/6-121-----------------------------TIGL---LVVSNIF---------MTFAWYGHLK........----------
C0QW78_BRAHW/6-120-----------------------------TIVL---LILSNTF---------MTIAWYGHLK........----------
J7TKX6_MORMO/7-110-----------------------------PIFL---LVLSNIF---------MMFAWYGHLK........----------
R6XLL0_9BACT/6-120-----------------------------TVLL---LVLSNIF---------MTFAWYGHLK........----------
R5VDD3_9PORP/6-120-----------------------------TIGL---LILSNIF---------MTFAWYGHLK........----------
R7P7Y5_9BACT/6-120-----------------------------TILL---LIVSNIF---------MTFAWYGHLK........----------
M4S3A7_9SPHN/3-107-----------------------------TLGL---LILSNLF---------MTIAWYGHLK........----------
W8F6G8_9BACT/6-120-----------------------------TVLL---LTISNLF---------MTFAWYGHLQ........----------
C6W5H8_DYAFD/6-120-----------------------------TIGL---LILSNAF---------MTMAWYGHLK........----------
V5SCV2_9RHIZ/12-115-----------------------------PILM---LFVSNIF---------MTFAWYGHLN........----------
Q9I3E0_PSEAE/7-111-----------------------------TALL---LACSNLF---------MTFAWYGHLK........----------
F0P098_WEEVC/6-120-----------------------------TISL---LILSNVF---------MTFAWYGHLK........----------
E3I3M7_RHOVT/8-111-----------------------------PVLL---LLASNVF---------MTFAWYGHLK........----------
C7PV02_CHIPD/3-107-----------------------------TVIL---LLISNTF---------MTFAWYGHLK........----------
Q3J4E4_RHOS4/10-113-----------------------------TIGL---LLASNIF---------MTFAWYGHLK........----------
W0RE32_9BACT/7-111-----------------------------TALL---LTASNLF---------MTYAWYGHLR........----------
Q2G7E2_NOVAD/8-111-----------------------------PVLL---LAGSNLV---------MNVAWYGHLK........----------
R6PI70_9CLOT/7-110-----------------------------PIIL---LTISNVF---------MTFAWYGHLK........----------
Q11HS8_CHESB/8-111-----------------------------PILL---LTISNIF---------MTFAWYGHLK........----------
B7K215_CYAP8/8-111-----------------------------.IFL---LTVSNAF---------MLTAWYLHLK........----------
D4Z3P0_SPHJU/3-108-----------------------------TILL---LTISNLF---------MTAAWYWHLK........----------
Q6D027_PECAS/7-111-----------------------------TVGM---LTLSNIF---------MTFAWYGHLR........----------
E1QGJ6_DESB2/5-109-----------------------------PIAL---LVLSNVF---------MTYAWYGHLK........----------
B2ULU2_AKKM8/6-114-----------------------------TISM---LVVSNVF---------MTWAWYGHLK........----------
A5EXJ2_DICNV/6-112-----------------------------VVML---LCISNTL---------MTFAWYWHIK........----------
D5MKV2_9BACT/7-111-----------------------------TGLL---LALSNIF---------MTFAWYGHLK........----------
D0MEU5_RHOM4/7-111-----------------------------TIGL---LMLSNLF---------MTFAWYGHLR........----------
Q9PG53_XYLFA/11-114-----------------------------PVLL---LIGSNVF---------MTFAWYGHLK........----------
E6VQT5_DESAO/7-111-----------------------------TALL---LTASNIF---------MTFAWYAHLK........----------
Q1GTV7_SPHAL/7-110-----------------------------PIGL---LFLSNIF---------MTFAWYGQLG........----------
D8PAT6_9BACT/3-106-----------------------------TILL---LTVSNIF---------MTFAWYGHLK........----------
Q6LXR9_METMP/6-109-----------------------------PVLL---LVLSNIF---------MTFAWYGHLK........----------
D2R2M8_PIRSD/9-124-----------------------------TILL---LIASNAF---------MTYAWYGHLGRKTAEEGA----------
R7LE15_9BACT/6-120-----------------------------SVLL---LVCSNVF---------MTFAWYGHLK........----------
H2FYV5_OCESG/7-111-----------------------------TISL---LILSNIF---------MTFAWYGHLK........----------
C4KAD8_THASP/17-121-----------------------------TALL---LTASNVF---------MTFAWYGHLK........----------
E4T2Z8_PALPW/6-120-----------------------------TITL---LVISNIF---------MTFAWYGHLK........----------
E6W367_DESIS/7-111-----------------------------TSFL---LILSNVF---------MTFAWYAHLK........----------
E8RR36_ASTEC/10-113-----------------------------TVLL---LIGSNIF---------MTFAWYGHLK........----------
F4HE45_GALAU/7-112-----------------------------PLLL---LVISNCF---------MTLAWYSHLK........----------
G7UQB0_PSEUP/7-110-----------------------------PILM---LVGSNVF---------MTFAWYGHLK........----------
B0T7W2_CAUSK/11-112-----------------------------.WCL---LVASNVF---------MTFAWYGHLK........----------
C3MDJ4_RHISN/36-139-----------------------------PVVL---LLASNVF---------MTFAWYGHLK........----------
W6R971_9RHIZ/97-200-----------------------------PVVM---FFASNIF---------MTFAWYGHLK........----------
Q0C0V6_HYPNA/7-110-----------------------------PIVL---LSISNLF---------MTMAWYGHLK........----------
H8KNB8_SOLCM/6-120-----------------------------TIGL---LTVSNLF---------MTFAWYGHLK........----------
R5PS28_9BURK/8-121-----------------------------TIGL---LIISNVF---------MTLAWYLHLK........----------
G8M1P8_CLOCD/3-106-----------------------------PIFL---LLISNVF---------MTFAWYGHLK........----------
A7HZ37_PARL1/9-112-----------------------------PVAL---LILSNIF---------MTTAWYWHLK........----------
R6T071_9BACE/7-121-----------------------------TILL---LVTSNIF---------MTFAWYGHLK........----------
E1VMC8_9GAMM/8-112-----------------------------TVSL---LVLSNIF---------MTFAWYSHLR........----------
R5W8P9_9BACT/6-120-----------------------------TVLL---LVCSNTF---------MTIAWYGHLK........----------
D4H7Q5_DENA2/6-110-----------------------------PVVL---LLFSNVF---------MIYAWYGHLK........----------
B4F097_PROMH/10-113-----------------------------PIIL---LIISNIF---------MTFAWYGHLK........----------
F4C648_SPHS2/17-130-----------------------------TIGL---LVLSNAF---------MNVAWYGHLK........----------
G4REH9_PELHB/16-119-----------------------------PILL---LIASNVF---------MTFAWYGHLK........----------
C4LDN3_TOLAT/7-111-----------------------------SMLL---LMCSNVF---------MTFAWYGHLK........----------
C7LWT9_DESBD/7-111-----------------------------TIIL---LSLSNIF---------MTFAWYGHLR........----------
A6LDS9_PARD8/6-121-----------------------------TILL---LIVSNIF---------MTCAWYGHLK........----------
G2IKI7_9SPHN/3-108-----------------------------TIAL---LLVSNIF---------MTFAWYWHLK........----------
D2QPF2_SPILD/6-120-----------------------------CVLL---LALSNIF---------MTLAWYGHLQ........----------
B3QYF9_CHLT3/7-111-----------------------------TVLL---LICSNIF---------MTFAWYAHLK........----------
R7BWA0_9BURK/14-118-----------------------------AAGL---LVLSNCF---------MTFAWYGHLK........----------
A6WZG9_OCHA4/38-141-----------------------------PILL---LIGSNVF---------MTFAWYGHLK........----------
C1D6W6_LARHH/7-111-----------------------------TILL---LILSNCF---------MTFAWYGHLK........----------
R5B7P2_9BACE/7-121-----------------------------TVLL---LLVSNVF---------MTFAWYGHLK........----------
R5H459_9SPIR/13-116-----------------------------PVLL---LTISNIF---------MTFAWYGHLK........----------
R7JJ48_9BACT/7-119-----------------------------TIAL---LILSNTF---------MTLAWYGHIA........----------
Q74DP1_GEOSL/3-107-----------------------------TIIL---LALSNVF---------MTFAWYAHLK........----------
R5Q2I4_9PROT/6-109-----------------------------PVLL---LTASNIF---------MTFAWYGHLK........----------
A3N0G8_ACTP2/6-112-----------------------------VILL---LTLSNTL---------MTFAWYWHIK........----------
A4G8C4_HERAR/9-113-----------------------------TVGL---LTLSNVF---------MTIAWYGHLK........----------
U5Q7E4_9BACT/7-121-----------------------------SILL---LVVSNSF---------MTLAWYGHLK........----------
E6SWV4_BACT6/6-120-----------------------------TILL---LIVSNVF---------MTFAWYGHLK........----------
K0HPY2_9BURK/13-117-----------------------------TVLL---LTASNIF---------MTFAWYGHLK........----------
R7JGE6_9FUSO/7-110-----------------------------PIML---LTVSNIF---------MTFAWYGHLK........----------
R6XHS7_9BACT/6-120-----------------------------TILL---LVLSNIF---------MTLAWYGHLK........----------
I0DPA6_PROSM/18-121-----------------------------PILL---LVISNVF---------MMFAWYGHLK........----------
A1BAJ0_PARDP/9-112-----------------------------TIGL---LILSNLF---------MTVAWYGHLK........----------
Q8EH57_SHEON/7-111-----------------------------TIGL---LCLSNIF---------MTFAWYGHLK........----------
G2LIQ0_CHLTF/3-106-----------------------------TVIL---LILSNLF---------MTVAWYGHLR........----------
E3F3V7_KETVY/10-113-----------------------------TIGL---LLLSNIF---------MTFAWYGHLK........----------
X5DDK4_9BACT/6-120-----------------------------TVGL---LILSNTF---------MTFAWYGHLK........----------
I2EZ99_EMTOG/16-119-----------------------------TILL---LLVSNTF---------MTFAWYGHLK........----------
F8EEI4_RUNSL/3-106-----------------------------TTLL---LFLSNLF---------MTTAWYWHLK........----------
F3ZRC2_9BACE/7-121-----------------------------TIGL---LVCSNLF---------MTFAWYGHLK........----------
Q6F6M6_ACIAD/9-112-----------------------------..GC---LIISNCF---------MTMAWYGHLK........----------
R6WBV4_9BACT/6-120-----------------------------TVLL---LLASNIF---------MTLAWYGHLK........----------
R5D1K2_9BACT/6-120-----------------------------TIIL---LILSNVF---------MTLAWYGHLK........----------
R7EWS2_9BACT/2-113-----------------------------...L---LIISNVF---------MTFAWYGHLQ........----------
B0SL45_LEPBP/3-109-----------------------------TVVL---LIFSNIF---------MTFAWYGHLK........----------
F4L194_HALH1/6-120-----------------------------TILL---LLLSNTF---------MTLAWYGHLK........----------
R6CXW8_9BACE/8-122-----------------------------SVLL---LVLSNVF---------MTLAWYGHLK........----------
F2J1T6_POLGS/12-115-----------------------------TIGL---LLASNIF---------MTFAWYGHLK........----------
A4T0J4_POLSQ/14-117-----------------------------.IGL---LALSNVF---------MTFAWYAHLK........----------
A8ZVV9_DESOH/7-111-----------------------------TILL---LCCSNVF---------MTFAWYGHLK........----------
Q11YS2_CYTH3/6-121-----------------------------TILL---LIISNGF---------MTYAWYGHLQ........----------
Q3SFJ6_THIDA/7-111-----------------------------TLIL---LTLSNVF---------MTFAWYAHLK........----------
D9SI46_GALCS/11-115-----------------------------TILM---LAISNLF---------MTFAWYGHLK........----------
W0IXH8_9BACT/3-110-----------------------------TILL---LFASNVF---------MTLAWYGHLK........----------
F8JCJ2_HYPSM/8-111-----------------------------PIVL---LTMSNVF---------MTFAWYGHLK........----------
D8IXX1_HERSS/7-110-----------------------------PIVF---LIISNVF---------MTFAWYGHLK........----------
G2KSB6_MICAA/11-114-----------------------------TIGL---LLASNIF---------MTFAWYGHLK........----------
R5Y439_9BACE/6-120-----------------------------SVLL---LIVSNIF---------MTFAWYGHLK........----------
R5NJ85_9BACT/38-152-----------------------------TILL---LISSNIF---------MTLAWYGHLK........----------
W5X038_BDEBC/6-110-----------------------------PIIL---LVFSNIF---------MTFAWYGHLK........----------
Q1QIE8_NITHX/17-120-----------------------------PILM---LFCSNVF---------MTFAWYGHLK........----------
S5XKS1_PARAH/9-112-----------------------------TIGL---LLASNIF---------MTFAWYGHLK........----------
C1AE72_GEMAT/11-115-----------------------------TVLL---LTASNVF---------MTFAWYGHLK........----------
G0A505_METMM/7-111-----------------------------SISL---LICSNVF---------MTFAWYAHLK........----------
A7I2P3_CAMHC/6-120-----------------------------TIIL---LILSNIF---------MTIAWYGHLK........----------
R7L6H2_9BACT/6-109-----------------------------PIVL---LTASNVF---------MMFAWYGHLK........----------
E8QX61_ISOPI/7-111-----------------------------TILL---LTIANIF---------ITFAWYAHLK........----------
D5AQ83_RHOCB/9-112-----------------------------TFLL---LTASNVF---------MTFAWYGHLR........----------
R5Y910_9PROT/6-109-----------------------------PIIL---LAVSNIF---------MTFAWYGHLR........----------
A7IIY9_XANP2/18-121-----------------------------PIVM---LVASNVF---------MTFAWYGHLK........----------
D5EUK7_PRER2/7-121-----------------------------TILL---LILSNVF---------MTFAWYGHLR........----------
E4RUT4_LEAB4/6-120-----------------------------TIGL---LLVSNVF---------MTIAWYGHLR........----------
B8IYE0_DESDA/90-193-----------------------------TVGL---LILSNIF---------MTFAWYGHLR........----------
R5AYY1_9BACT/8-123-----------------------------TVAL---LVVSNIF---------MTFAWYGHLK........----------
R5BPJ3_9BACE/6-120-----------------------------TVLL---LIVSNVF---------MTFAWYGHLK........----------
F8BRI1_OLICO/10-113-----------------------------PIVM---LFASNCF---------MTFAWYGHLR........----------
I4B782_TURPD/8-122-----------------------------SIAL---LVLSNIF---------MTLAWYGHLQ........----------
B6ITG6_RHOCS/9-111-----------------------------PVFL---LVASNVF---------MTLAWYGHLK........----------
Q7MLC2_VIBVY/7-111-----------------------------SVGL---LICSNVF---------MTFAWYAHLK........----------
H8XSK5_FLAIG/6-120-----------------------------TIGL---LILSNVF---------MTLAWYGHLK........----------
F9Z5C1_ODOSD/6-120-----------------------------TVLL---LVCSNIF---------MTFAWYGHLK........----------
Q9RW58_DEIRA/7-111-----------------------------TALL---LTLSNVF---------MTFAWYGLLG........----------
B4R8J2_PHEZH/10-113-----------------------------PVLL---LVASNVF---------MTFAWYGHLK........----------
G8T6T5_NIAKG/3-107-----------------------------TILL---LICSNVF---------MTIAWYGHLK........----------
W0EYH8_9SPHI/5-109-----------------------------TVLL---LVCSNVF---------MTLAWYHHLK........----------
R5EED1_9BURK/17-121-----------------------------TAAL---LLLSNCF---------MTFAWYAHLK........----------
C6WUJ2_METML/7-111-----------------------------TILL---LTISNVF---------MTFAWYAHLK........----------
T2G873_DESGI/9-113-----------------------------TIVL---LALSNVF---------MTFAWYAHLK........----------
E8UXU2_TERSS/9-110-----------------------------...L---MLASSTL---------MATAWLGHLR........----------
D5SY52_PLAL2/48-153-----------------------------VAVL---LTISNLF---------MTYAWYGHLK........----------
F2IAM6_FLUTR/6-121-----------------------------TIAL---LIVSNSF---------MTYAWYGHLK........----------
R6IPE3_9PROT/6-109-----------------------------PIIL---LVFSNIF---------MTFAWYGHLK........----------
R5HYR9_9BACT/6-120-----------------------------TVLL---LMVSNVF---------MTFAWYGHLK........----------
D9QGJ5_BRESC/9-112-----------------------------PVVM---LALSNVF---------MTFAWYGHLK........----------
B8DLP8_DESVM/13-116-----------------------------TVGL---LLLSNVF---------MTFAWYGHLK........----------
Q2W577_MAGSA/8-111-----------------------------PIGL---LVISNVF---------MTFAWYGHLK........----------
R6A733_9BACT/7-121-----------------------------TILL---LICSNVF---------MTFAWYGHLK........----------
B8FCH3_DESAA/5-109-----------------------------PVLM---LVMSNVF---------MTYAWYGHLK........----------
B1MFP9_MYCA9/9-111-----------------------------PV.L---LICSNIF---------MTFAWYGHLK........----------
A5VEJ7_SPHWW/9-113-----------------------------PLLL---LICSNIF---------MTVAWYGHLK........----------

PF13536

Q03V04_LEUMM/46-308QSIRKQP----------------------LSWWVWSHFCFVLFY------VPLCLASTYLPGWLIA--------------
E3EHL7_PAEPS/38-305KVMKEQP----------------------GMWLWWSFIGFGLFY------APLCFASAYSPGWLIA--------------
D3FXX0_BACPE/38-305KEMKKHP----------------------REWFIWSFFGFVVFY------APITYAAGFGPGWLIA--------------
A6LSV6_CLOB8/39-306NDIINKP----------------------IQWITWSTIGFGLFY------APLSFASAYGASWLVA--------------
Q5KZD5_GEOKA/38-305RDMKRHP----------------------WTWIVWGTVGFGLFY------APLTYAAAYGPGWLVA--------------
I0I5E6_CALAS/39-305RLLHRYW----------------------AFWIVAGTVGFGVFY------AGIAFAASYAPGWVVA--------------
YJLA_BACSU/38-305LEM