Sequence alignment for CL0189

PF08459

UVRC_BACSU/369-523----LGEALNIY..T....P---HRIEAFDNSNI---QGTNPVSAMIVFI--DGKPYKKEYR-KYKIK...TV.......
UVRC_DESVH/440-601----LARALHLA.GP....P---HRIEAVDVSHT---GGRNTRVGMVVFE--DGKPFPEAYR-TYAFE............
UVRC_PROAC/401-580----IQESLGLD.RA....P---LRMESYDISHI---QGTNVVGSMVVFE--DGMPRKSEYR-RFSIK...GF.......
UVRC_METCA/382-539----LTEMLGLA.EP....P---KRMECFDISHT---QGDQTVASCVVFD--RTGPLKSAYR-RFNIE...GI.......
UVRC_PASMU/381-540----LQAILQLG.EI.....---RRMECFDISHT---MGEQTIASCVVFN--QDGPLKSDYR-RFNIT...GI.......
UVRC_BURMA/497-680----LADVLGYE.SDD.LAQ---LRIECFDISHT---MGEATQASCVVYH--HHRMQSSEYR-RYNIA...GI.......
UVRC_NEIG1/388-550----LAKILGMN.SD...GI---NRLECFDISHT---QGEATIASCVVYD--EQNIQPSQYR-RYNIT...TA.......
UVRC_MYCGA/370-525----LKKLIKVD.KL.....---NHLEVYDNSNL---FNTDKVSAMIVFE--NNQFNKKKYR-KYKIK...DQ.......
UVRC_NOCFA/410-604----IQDALDLD.SA....P---LRIECVDISHV---QGTDVVASLVVFE--DGLPRKSDYR-HYAIK...EA.......
UVRC_LACLA/426-579----LGKILGIP..K....P---VRIESFDNSNI---MGTSPVSAMVVFI--DGKPSKKDYR-KYKIK....T.......
Q7UPD6_RHOBA/309-460----LKKVLGLS.ET....P---RVIEGVDIAHL---GGNETVASLVQFI--DGLPFKPGYR-RFRIQ....E.......
UVRC_XANOR/382-538----LREMLGLA.EP....V---KRVECFDISHT---MGEATVASCVVFD--ASGPVRGQYR-RFNIS...GI.......
UVRC_HAEIN/381-540----LCDLLNLP.KI.....---KRMECFDISHT---MGNQTVASCVVFN--KEGPLKSDYR-RFNIE...GI.......
UVRC_PSEFL/381-538----LAEVLNLD.EP....P---QRLECYDISHS---SGEATVASCVVFG--PEGPLKSDYR-RYNIE...GV.......
UVRC_SYNY3/396-555----LAEILNLE.TL....P---KRIEGYDISHI---QGSNAVASQVVFI--DGVPAQQYYR-HYKIK............
UVRC_LISMF/371-525----LGEAMGIP..T....P---SRVEAFDNSNI---HGTDPVSAMVTFL--DGKPSKNDYR-KYKIK....T.......
UVRC_WOLSU/382-537----LQELLGLE.SL....P---RRIEAFDTSHL---RGEACVGAMVVYE--EG.FCKESYR-RYA..............
UVRC_GLUOX/404-564----VAEVFGLP.EI....P---QRIETYDNSHI---MGQAPYGVMVVGG--PEGFNKRAYR-KYAIK..GPV.......
UVRC_COREF/430-611----IQEALDME.QA....P---LRIECTDISHI---QGTDVVASLVVFE--DGLPRKSDYR-RYRIK...EA.......
UVRC_BACFR/387-541----IQQELHLD.RL....P---MQIECFDNSNI---QGTDAVAACVVFK--KAKPSKSDYR-KYNIK...TV.......
Q7P6I6_FUSNV/374-524----LHDILELK.RF....P---RKIECFDISNI---QGKDAVASMSVSI--EGRAARKEYR-KFKIR............
UVRC_LEGPL/394-550----LRQLLALD.KN....I---ERMECFDISHT---QGEATVASCVVFD--TEGPRPSEYR-RFNIE...GI.......
UVRC_GEOKA/369-523----LGERLGIP..A....P---RRIEAFDNSNI---YGADPVSALVVFL--DGKPAKKEYR-KYKVK....T.......
UVRC_TREDE/428-579----LQKRLNLP.CL....P---QRIEGFDIAHL---GGTFTVAALISFK--EGNPDKKNYR-IFRLK............
UVRC_HELPY/382-538----ARSLFKLE.CM....P---YRVEIFDTSHH---SSSQCVGGMVVYE--NNAFQKNSYR-RYHLK...GS.......
UVRC_CHLTE/406-556----LKQVLHLG.KL....P---ERIECFDNSHF---QGTDYVSSMVTFV--SGKPKKSDYR-KFRLK...SF.......
UVRC_THEEB/397-555----LAQLLGLD.TL....P---HRIEGYDISHI---QGSDAVASRVVFI--DGLPAQQHYR-HYNIR............
UVRC_MYCMS/366-518----LKQISNAS.KY....L---KRIEVFDISNI---YSQFITGACIVYI--NAKPIRNEFR-KYNID............
Q6SI31_9BACT/384-554----LRVELDLA.TS....L---HRIECFDISTI---QGSDTVGAMVVCE--NGRMMRSAYR-KFKIR...GLVKGQQSI
UVRC_PHOPR/390-547----LRKALNLE.TI.....---SRMECFDISHT---MGEKTVASCVVFN--QEGPFKQDYR-RYNIT...GI.......
UVRC_WOLTR/383-536----LSKIFLLP.NI....P---KRVEVYDNSHT---SGNQQVGVMVVAG--KEGFLKSEYR-KFTIK...GE.......
UVRC_CLOAB/384-551----MTEVIGLE.EV....P---HRIEAYDISNI---QGVDSVGSMIVFE--EGKPKNSDYR-RFKIK....T.......
UVRC_UREPA/365-517----LKQILKLP.DL.....---NIIECFDNSNI---NLSLPIAGMIVYQ--NGKLNNKLNR-KYNLM...TT.......
UVRC_LEIXX/407-588----IQDALGME.DA....P---LRMECYDVSHL---SRTNIVASMVVFE--DGLPRKDQYR-RFSIP............
UVRC_HELHP/406-562----IKELCVLS.QI....P---YSIEVFDTSHH---SGTHNVGGMIVYE--NDDFIRSKYR-RYELH...TS.......
UVRC_METTH/363-507----LKDDLKLP.EI....P---RRMEGLDISNI---AGESATGSVAVFI--DGKPSSGSYR-RYRIS............
UVRC_BDEBA/390-552----IKERFNLP.ER....P---RRIECYDISTF---QGAETVASQVVFE--DGVPAKEHYR-RYKIK....T.......
UVRC_CAUCR/408-571----VAEAFKLD.AP....P---ERIEVYDNSHI---QGANAVGGMIVAG--PEGFMKGQYR-KFNIKS.TEL.......
UVRC_VIBVY/385-542----LRDVLAMD.SI.....---ARMECFDISHT---MGESTIASCVVFN--SEGPVKQEYR-RYNIT...GI.......
UVRC_METMA/359-509----LQSKLSLP.KI....P---NVIECFDISHL---SGTATVGSMVQFR--GGRPDKHNYR-RFKIE....S.......
UVRC_CLOPE/385-552----LADVLGLD.SL....P---VRIEAYDISNI---QGVDSVGTMVVFE--NGKAKNSDYR-RFKIK....S.......
UVRC_HALSA/377-526----LADALGVR..R....P---ERIEGVDVSHA---QGREVVGSNVCFV--DGSAETADYR-RKKLD............
Q64DT7_9ARCH/353-503----LKDLLGLP.RV....P---MVIECFDISHL---SGTSMVASMVQYR--SGKPDKRNYR-RFKIK....T.......
UVRC_PROMP/409-587----LTQILELT.NQ....P---RRIEGYDISHI---QGTDPVASQVVFI--DGIPSKQNYR-KYKIKD.PNI.......
UVRC_FRATT/388-545----LKEFLELE.KD....I---KRIECFDISHF---QGEATIASCVVYT--DDGEDRKSHR-RYNIK...DI.......
UVRC_RALSO/423-587----LAETIGVDLEDL..AA---LRVECFDISHT---AGEATQASCVVFH--SHAMQNGEYR-RYNIQ...DI.......
UVRC_MYCBG/355-505----LNKYLNLP.KL.....---KNIVVFDNSNI---NNINPVGVAIVYT--NGIKNKSLYR-KFNLE............
UVRC_DEIRA/374-539----LKDVLALP.ER....P---WRIEGYDNSNL---FGTNIVSGMVVFE--GGRSRRGEHR-RFKVR...GL.......
UVRC_THETN/382-548----LSNLLGIE..Y....P---KRIEAYDISNV---RGEDNVGSMVVFV--DGKPKKSEYR-KFTIK....Y.......
UVRC_PROMA/394-572----LAELLDLP.FK....P---RRIEGYDISHI---QGSDAVGSQVVFV--EGMPAKHHYR-KFIIK............
UVRC_IDILO/387-543----LQQVLEFG.VP....I---QRMECFDISHT---MGQQTVASCVVFD--QNGPKKSDYR-RYNIT...GI.......
UVRC_SALTY/383-542----LAAVLKLP.AI.....---KRMECFDISHT---MGEQTVASCVVFD--ANGPLRAEYR-RYNIA...GI.......
UVRC_ZYMMO/430-593----MVNLFHLD.KI....P---DRIEVYDNSHI---MGSNMVGGMIVAG--PEGFRRNSYR-KFNIKS.PSI.......
UVRC_BORPE/379-541----LAEALDLDTDEESLDA---LRIECFDISHT---AGEATQASCVVFL--HHDMQPSLYR-RYNIV...GI.......
UVRC_CHLTR/375-530----LQHFFNLS.QY....P---YRIECYDNAHL---QGEHNVGVCIVFE--NGLFSPKQYR-TFSIT............
UVRC_STRP6/369-523----LGQLLRID..K....P---VRIEAFDNSNI---QGTSPVAAMVVFV--DGKPSKKDYR-KFKIK....T.......
UVRC_HAEDU/384-543----LKILLKLP.TI.....---KRMECFDISHT---MGSQTVASCVVFD--ENGPLKSDYR-RFNIE...GI.......
UVRC_NOSS1/393-556----LAAILDLP.NL....P---HRIEGYDISHI---QGSNAVASQVVFI--DGLPAKQNYR-HYKIK............
UVRC_AQUAE/352-500----FAEKLGMP..V....P---RVIEGFDISHF---YGEDIVGSCVVWK--GGKMSKKDYR-RYKVK...TI.......
UVRC_RHOPA/456-633----LATTLGLP.KT....P---QRIEVYDNSHI---QGTNAVGAMIVAG--PDGFIKNQYR-KFNIRS.EGL.......
UVRC_HALMA/369-516----LADALGID..H....P---SRIEGFDVSHA---QGRSAVGSNVTFV--DETPEKSDYR-RKKLT............
UVRC_GLOVI/388-544----LAEALELP.SV....P---RRMECYDISHI---QGTDTVASRVVFV--DGAPAKQYYR-HYKIR............
UVRC_SHEON/382-541----LEEILELN.AP....I---QRMECFDISHT---MGESTVASCVVFN--REGPHKAEYR-RYNIE...GI.......
UVRC_TREPA/444-594----LQKQLHLA.RI....P---TLIEGFDISHL---GGKYTVASLICFK--NGAPDTKNYR-LFNLR............
UVRC_PORGI/380-532----IQKDLHLD.RP....P---KHIECFDNSNI---QGTSPVAACVVFK--MGKPSKKDYR-KFHVK....T.......
UVRC_TROWT/384-536----LQKYLNLN.SL....P---VRIECFDISHL---LGTNTSGSMVVFE--NGEPKKSAYR-HFNIH....I.......
UVRC_THEMA/350-492----LMKLLNMK.DF....P---YRIEGIDISHL---QGKYTVASLVVFE--DGFPKKGDYR-RYKIE............
Q93SG1_EUBAC/384-532----LRSLLELE.ET....P---NRIEAFDISNI---QGVDSVGSMVVFT--RGRKDSKEYR-RFRIK....T.......
UVRC_SYMTH/381-558----LQAYLDLP.RL....P---HRIECFDVSHV---QGAEVVASMVVFE--GGRPKKSDYR-RFKMK....V.......
UVRC_SYNP6/393-571----LADLLDLP.EL....P---RRIEGYDISHI---QGSDAVASQVVFI--DGLPAKQHYR-RYKIRN.PEV.......
Q6KH99_MYCMO/348-496----LEELLETK.NL.....---NHFLVIDNSNT---NNFSPVSVIISYK--NGLKDKKNYK-KFNLE............
UVRC_GEOSL/375-539----LKEKLHLT.NL....P---RRIECYDISTI---QGRYSVGSRVRFQ--NGAPDKAGYR-RYRIR....T.......
UVRC_CHLPN/375-532----FQNILRMS.QY....P---YRIECYDNAHM---QGAHATGVYIVFE--NNGFDPKQYR-TFSID............
UVRC_STRAW/391-568----IAEALDLD.SA....P---LRIECYDISHL---QGDDVVASMVVFE--DGLQRKSEYR-RFQIK...SF.......
UVRC_BARQU/433-609----IAEVFQLP.QT....P---HRIEVYDNSHL---MGTNAVGAMIVAD--QMGFLKNQYR-KFNIRS.TDI.......
UVRC_OCEIH/369-523----LGEQLNIE..T....P---HRIEAFDNSNI---QGTDPVSAMIVFE--DGKPNKKEYR-KYKIR....D.......
UVRC_RHILO/435-619----FAETFGLA.KP....P---VRIEVYDNSHI---MGTNAVGAMVVAG--PEGFVKNQYR-KFNIRS.TEI.......
Q98R54_MYCPU/350-499----LSNLINVK.NL.....---HRIVMMDNSHF---ANFHPISVVVSYI--DGIKNTNEYR-KFNLD............
UVRC_LACAC/372-535----IFDALGLP..Y....G---HVIESFDHSHI---QGADPVSALVVFK--DGEPDKTSYR-KYKLK...GE.......
UVRC_RICTY/383-551----VKKLFDLP.EI....P---ERIEIYDNSHI---QGMFAVGVMVVAG--KIGFDKKEYR-VFSLS...SRNFTIGSE
UVRC_THET8/373-519----LQDLLGLP.AR....P---WRLEGYDISHL---QGQARVFSIAVFE--GGRPKRQEYR-RMRLK............
UVRC_ANAMM/390-540----LAELFGLP.NP....P---ERIEVYDNSHI---SGTHPFGVMVVCG--KDGLLRKEYR-KFKIQ...TV.......
UVRC_ACIAD/383-531----LEQVVGRP.......V---DRIECFDISHT---MGEATIASCVVFD--QGGARKRDYR-QFGIE...DI.......
UVRC_MESFL/366-519----LQEKANLQ.KE....P---YRLEMFDISNI---GNEFIVGSCVVYI--NGKPARNEFR-KYNIE............
UVRC_SYNPX/388-566----LAQLLEMP.TP....P---RRIEGYDISHI---QGSDAVASQVVFI--DGLPAKQHYR-KYKIRS.SSI.......
UVRC_AROAE/379-535----LRETLDLA.EA....P---RRIECFDISHT---MGEATVASCVVSV--DGAMKNSEYR-RYNIT...GI.......
UVRC_PARUW/380-539----MQELLFLT.NY....P---TRIECFDNSNI---AGSEPVSSMVAFT--DGLKDSKRYR-TYRLK............
UVRC_CHRVO/379-534----LNEVLELE.DA.....---GRFECFDISHT---MGEATVASCVVYD--KGAMQPTEYR-RFNIT...TA.......
UVRC_SILPO/391-554----LAEAFDLD.GP....P---QRIEVYDNSHI---QGTNAVGGMIVAG--PEGFLKNQYR-KFNIRG.DDL.......
UVRC_STAAM/372-526----LGTQMGIQ..T....P---IRIEAFDNSNI---QGVDPVSAMVTFV--DGKPDKKNYR-KYKIK....T.......
UVRC_MYCGE/373-528----LAQLLNTD.YI.....---HSLEIIDVSFY---DQNHVVGCMLRFE--DGKKIKHLSR-RYNIN...SL.......
UVRC_BRUAB/386-558----LAETFGLP.RA....P---RRIEVYDNSHI---MGTNAVGGMIVAG--PEGFVKNQYR-KFNIRS.TDI.......
UVRC_METMP/364-514----LKNKLMLD.KS....P---NIIECFDISHL---SGTSTVGSVVQFR--NGKPDKKNYR-RFKIK....T.......
UVRC_COXBU/381-538----IQKSLALP.NP....I---ARIECFDISHT---LGEATVASCVVFG--EEGPIKKDYR-RFNIS...GV.......
UVRC_LACPL/370-524----ITDALGIP..A....G---HKIEAFDHSHI---QGADLVSAMVVFT--DGQPNKKLYR-KYKLR...TV.......
UVRC_MYCTU/402-571----IQDSLGLA.DA....P---LRIECVDVSHV---QGTDVVGSLVVFE--DGLPRKSDYR-HFGIREAAGQ.......
UVRC_VIBF1/382-539----LEEALVLS.SI.....---QRMECFDISHT---MGEKTVASCVVFN--QEGPVKSEYR-RYNIA...GI.......
UVRC_BORBU/372-526----LKIVLEMD.KL....P---KIIEGFDIAHL---KGQETVASMVTFK--MGMPFKENYR-LYKLN...SL.......
UVRC_CORDI/426-611----IHEALGLD.EP....P---LRIECTDISHI---QGTDVVASLVVFE--DGLPKKSDYR-RYKIK...EA.......
UVRC_NITEU/381-537----LQEALNLP.GL.....---ARIECFDISHT---MGEATIASCVVYD--RFAMRNGEYR-RYNIT...GI.......
UVRC_MYCPE/372-526----LQKLLDIK.DL.....---YRMEIFDNSNI---FNTNKVGAMVVYE--NGVKNKNEYR-KFNIK...DE.......
UVRC_CAMJR/381-537----LKFYFELE.NL....P---NDIEIFDNSHL---QGVANVGAMVTYR--INSWDKSKYR-KFHLK............
UVRC_LEPIC/388-539----IQEMFSLE.RL....P---HIIECYDISHF---QGSQPVASGVMFV--EGKPFKQGYR-KYNIR....G.......
Q601Y1_MYCH2/355-501----VKASLKIE..N....V---EKIMAIDCSNL---ESNYPTTGIIFYI--NGIYERNYNR-FFNYR...GT.......
UVRC_MYCPN/377-532----LAQLLQVP.SI.....---QSLEIIDISFY---DKDHVVGAMLRYE--NGKRMKALSR-RYNIN...ID.......
UVRC_DESPS/379-534----IKEKLQLS.RT....P---ETIECLDISNI---SGQHAIGSLVCFS--GGEANKSRFR-HYKIR....T.......
UVRC_BACSK/369-523----LGEAIGIN..A....P---YRIEAFDNSNI---QGVDPVSAMVVFV--NGVPQRKEYR-KYKIK....T.......
UVRC_CLOTE/384-551----LSDILGFD.DM....P---NRIEAYDISNI---QGVDSVGSMVVFE--KGRSKKSDYR-RFKIK....T.......
UVRC_CHLCV/375-531----MKKILKSP.DY....P---YRIECYDNAHL---QGSHGVGVYIVYE--NDAFSPKSYR-TFSIS............
UVRC_STRT1/371-525----LGKLMGIP..T....P---VRIESFDNSNI---MGTSPVSAMVVFE--NGKPNKKEYR-KYKIK....T.......

PF04493

NFI_BACSU/20-226VQFNLKNRINLSPTIHPD.SI..NTCAGVDLAYWEQDGEPYGVCCIIVIDADTKEVIEKVHS.MGRIS------------
NFI_THEAC/123-318KMQQYQEYIARKYSESGAGEF..RTVAAFDVSY....EERRAFASMVIQ...DGSTIEAYVI.SDGIN------------
Q9M087_ARATH/33-269AYDDFTWKLSSSTELSQGSEI.LKYVGGVDMSFCK.EDSSVACACLVVLELPSLRVVHHDFS.LLRLH------------
NFI_CLOAB/20-226IQSSLVKRIKLISDFKEE.DI..KLCAGVDLAYWTKGEKQYGVCCIIVIDYNTGEIIEKAYD.YGEIE------------
NFI_PYRAB/4-194KIAEVQKKLSKRIVEKEVRMV..SKIAAVDVSY....KGNKARVALVICSFPDCKVLKTKVL.ETEVS------------
NFI_SULSO/9-192FLEKLQFLISKNVKISHYGIENVKKICGVDIAY....KGNLGFSVGVSMDINSGDYNYKSYV..GEVN------------
NFI_THEMA/19-217VQNELRKKIKLTPYEGEP.....EYVAGVDLSFP...GKEEGLAVIVVLEYPSFKILEVVSE.RGEIT------------
NFI_ARCFU/12-207IQEEMSRSVVLEDLIPLE.EL..EYVVGVDQAF....ISDEVVSCAVKLTFPELEVVDKAVR.VEKVT------------
NFI_THEVO/118-313KLRELQFKIGRLYDDRNDYSL..DTIAAFDVSY....KETRGYASKVVY...NKGKIGAYVY.SSDSM------------
NFI_STRCO/22-222VQDELRARVVLDEPGPPPGTG...RVTGVDVAYD..DERDVVAAAAVVLDAGTLAVVAEATA.VGRIS------------
NFI_ECOLI/9-209QQIELASSVIREDRLDKD.PP..DLIAGADVGFEQGGEVTR..AAMVLLKYPSLELVEYKVA.RIATT------------
YDA6_SCHPO/16-239QQIELKGMLQLIPKFQSLNEI..RYVVGLDISFD..KSSPKAVSALVIYDLEQRMIIYKDYLCIEKLE------------
NFI_PYRHO/4-195RIANIQKKLSKSIVERKINEV..RKVAAVDVSY....KEEKARAALVITTFPEGEVLKTKVI.ETTVS------------
NFI_XYLFA/23-224LQSDMAERIVLKDDLNLLSEP..TLLAGFDVGFEDEGRTTR..AAAVLMNACDLKLLETHVV.RVPTS------------

PF08459

UVRC_BACSU/369-523......TGP......DDYGSMREVVRRRY..TRVLRENL......................................PLP
UVRC_DESVH/440-601......DGD.....GDDYGTLAAWAGRRV..ESGPP..........................................WP
UVRC_PROAC/401-580......EGS......DDFAAMHEVLSRRL..RRLIEDRDAMAAAQTPDGDVG...........SLIDPTTGSPRKFAYAP
UVRC_METCA/382-539......TGG......DDYAAMAQALSRRY..QRIRAGEV......................................EAP
UVRC_PASMU/381-540......TAG......DDYAAMEQALLKRY..DKPLEQE.......................................KIP
UVRC_BURMA/497-680......TPG......DDYAAMRQVLTRRY..EKMVEEAAAEASADEAAGI...............DGNAVHAAASAGRLP
UVRC_NEIG1/388-550......KPG......DDYAAMREVLTRRY..GKIQEAEANG.................................ESVKWP
UVRC_MYCGA/370-525.....QALG.......DYHYMYEVIYRRL..YQALKNNF.....................................VDLP
UVRC_NOCFA/410-604.....AGEGR....SDDVGSIAEVTRRRFYRLRKERDEAERDELDGTAAGAPLVDDDETPTSRPGIDPTTGRPRKFAYPP
UVRC_LACLA/426-579......VVG.....ADDYASMREVMTRRY..SRALKEET......................................ALP
Q7UPD6_RHOBA/309-460......VKG.....IDDFRSIYEVVSRRF..RGLSDRQE......................................SFP
UVRC_XANOR/382-538......TPG......DDYAAMRQAIERRF..RRAVEENG......................................VLP
UVRC_HAEIN/381-540......TGG......DDYAAMEQVLQKRY..ERDLEED.......................................KIP
UVRC_PSEFL/381-538......TAG......DDYAAMHQALTRRF..SKLKDGEG......................................KLP
UVRC_SYNY3/396-555......NPSIKVGHSDDFASLAEVIIRRF..QSSVKGKKN...................................QQDWP
UVRC_LISMF/371-525......VEG.....PDDYATMREVIRRRY..WRVLKEEL......................................PMP
UVRC_WOLSU/382-537......LEG.....RDEYSQMREMLGRRA..EAFDRES........................................PP
UVRC_GLUOX/404-564......TPG......DDFGMMREVMERRF..GHRSENGER...................................PEDWP
UVRC_COREF/430-611......AGDG...HSNDVASIAEVTRRRF..LRHHRDKLAVPEELDDATFSD...........EKVEEMSTDNRRFAYPP
UVRC_BACFR/387-541......VGA......DDYASMKEVVRRRY..QRAIEEES......................................PLP
Q7P6I6_FUSNV/374-524......CKDT....PDDFSMMREVIERRY..SKLADRD........................................FP
UVRC_LEGPL/394-550......TPG......DDYAAMEQAVTRRF..KRLIGAQ.......................................LLP
UVRC_GEOKA/369-523......VAG.....PNDYETMREVVRRRY..TRVLKEGL......................................PLP
UVRC_TREDE/428-579.....NTDGV....IDDYASMREVIARRY..TRLLNEGA......................................DLP
UVRC_HELPY/382-538...............DEYTQMSELLTRRA..LDFAKEP........................................PP
UVRC_CHLTE/406-556......EGS......DDYAAMREAVTRRY..GGSLAGEL......................................PLP
UVRC_THEEB/397-555......NPEVKLGHSDDFASLAEILRRRF..APYLEGQGET..................................PDDWP
UVRC_MYCMS/366-518......PSY.....TSDFSRMKFMLEKRF..LKQIKEKE......................................QLP
Q6SI31_9BACT/384-554HRSSSSGLGSVVGKPDDFSAMHEIVFRRY..RRLLEEGG......................................PFP
UVRC_PHOPR/390-547......TGG......DDYAAMGQVLERRY..GKPMEPE.......................................KIP
UVRC_WOLTR/383-536......ILG......DDYEMMREVLTRRF..SNNTKDV........................................VP
UVRC_CLOAB/384-551......VKG.....ANDYDSMREILTRRF..KHGLEEVNSIVNKNL.......................SLSAGKFCVFP
UVRC_UREPA/365-517......KNA......SDYHFMIEVITRRY..QRLVSQHQ......................................KLP
UVRC_LEIXX/407-588......ESA......DDTESIYQVISRRL..AYLRKEPPVEALTPANGHDLATDL......DAEAVEAAERRRKKFAYPP
UVRC_HELHP/406-562...............DEYSQMHEMLLRRA..QSFDSNP........................................PP
UVRC_METTH/363-507......AQG.....PDDYAMMRELVERRY..SSPELRK.........................................P
UVRC_BDEBA/390-552......VQG.....INDFASMYEVLSRRF..KHTEYDD.........................................P
UVRC_CAUCR/408-571......TPG......DDYGMMKEVLRRRF..ARLVKEEEEG.................................DDANRP
UVRC_VIBVY/385-542......TGG......DDYAAMGQALERRY..AKQLDVE.......................................KIP
UVRC_METMA/359-509......VEG.....IDDFASIAEVVRRRY..SRLLEDKH......................................EMP
UVRC_CLOPE/385-552......VKG.....PNDYESMREILSRRF..SHGLEEVNKIKERNL.......................EYSNGKFCIFP
UVRC_HALSA/377-526......EEN......DDYANMRRLVGWRA..ERAVDGRDD....................................RPDP
Q64DT7_9ARCH/353-503......VEK.....IDDFAAIAEVVRRRY..SRLKKEDG......................................EFP
UVRC_PROMP/409-587......FIGH....SDDFASIYEVIYRRF..KKWSKFKIDGGDISSLQDK................KKSTLENDLLTDWP
UVRC_FRATT/388-545......KSG......DDYAAIHQAVSRRV..SSGLEAD.......................................NLP
UVRC_RALSO/423-587......IPG......DDYAAMRQVLTRRY..QKVVEQAAED..................................APDMP
UVRC_MYCBG/355-505......ALNE...RSADVEYIKQSISKFFSSNKNTKDY..........................................
UVRC_DEIRA/374-539......EHP......DDYESMKQTIYRRF..TGSLADKL......................................PLP
UVRC_THETN/382-548......VEG.....QDDYQSMREMIERRF..LHALEEKKQIEEGTL.......................SKEKAKFIEMP
UVRC_PROMA/394-572......DETIKLGHSDDYLSIYELITRRF..SRWSKYKEKGVNLSDIRNY................KSSILDPSTLADFP
UVRC_IDILO/387-543......TPG......DDYAAMSKALAKRY..DNAKEQG.......................................NIP
UVRC_SALTY/383-542......TPG......DDYAAMNQVLRRRY..GKAIEES.......................................KIP
UVRC_ZYMMO/430-593......NPG......DDFEMMREVLTRRF..SRLERSDPDH.................................SSSEWP
UVRC_BORPE/379-541......TPG......DDYAAMRQVLTRRF..GKVTDGEA......................................PMP
UVRC_CHLTR/375-530......SHG......DDLAAFEEVLTRRF...RSLTTE........................................LP
UVRC_STRP6/369-523......VVG.....PDDYASMREVLFRRY..SRVKKEGL......................................QAP
UVRC_HAEDU/384-543......TGG......DDYAGMEQALVKRY..DKPLPIE.......................................KIP
UVRC_NOSS1/393-556......NPTVTIGHSDDFASLAEVIQRRF..RKYAEDPQLSR...............................VGNPDWP
UVRC_AQUAE/352-500......SRI......DDYLALEEVLTRRA..KRILKGEV......................................EKP
UVRC_RHOPA/456-633......TPG......DDYAMMREVLQRRF..KRLVTSQAEGDGEAAAK....................AKPKDDDVPQWP
UVRC_HALMA/369-516......EQN......DDYANMRELLRWRA..TRAVEGRDD....................................RPDP
UVRC_GLOVI/388-544......DPRIVAGRPDDFASMAEVISRRF..ARAESEPE.....................................GDLP
UVRC_SHEON/382-541......TPG......DDYAAMKQAISRRF..DKIDASG.......................................KIP
UVRC_TREPA/444-594......AHDT...RIDDFASMREAIARRY..THTPEGY.......................................TLP
UVRC_PORGI/380-532......VEG.....PNDFASMREIISRHY..TRLTEENL......................................PLP
UVRC_TROWT/384-536......DQN......NDTASMFSLICRRLRSLESVAQDS.....................................PDYP
UVRC_THEMA/350-492......QDH.....PDDYESIRTVVKRRY..SKHP...........................................LP
Q93SG1_EUBAC/384-532......VQG.....PDDYSSLYEIVLRRL..KKWSG..........................................RP
UVRC_SYMTH/381-558......DQN......NDFANMAEAVGRRF..RRGLAERAAQVEGRVRDLEEG...........RVAEGGAEYGGKFADFP
UVRC_SYNP6/393-571......RAGH....SDDFASLAEVLHRRF..RKFAEAKARGESLAPSEQR................QGSLLRPDDLADFP
Q6KH99_MYCMO/348-496......TGDR....KADVEYMKEACFRYF....SKKEN.......................................PIP
UVRC_GEOSL/375-539......VPG.....TDDFAMMHEVLSRRF..RDGHGGD.......................................GRP
UVRC_CHLPN/375-532......SEKT....QNDLALLEEVLLRRF...HSLTTA........................................LP
UVRC_STRAW/391-568......EGQ......DDVRSMHEVITRRF..RRYLSEKERTGEWADGDLKDG............ELKDDEGRPKRFAYPP
UVRC_BARQU/433-609......TPG......DDFGMMKEVIKRRF..SRLIKEHGLPHESNSI.....................KGEDEDCFSIWP
UVRC_OCEIH/369-523......VKG.....PDDYDTMREVVRRRY..SRVLKENL......................................PLP
UVRC_RHILO/435-619......TPG......DDFGMMREVMERRF..SRLLKEHGDVAPNDAASAEA.............GDDIEDDISGSFPAWP
Q98R54_MYCPU/350-499......VNHD...RKADIEYFKEGFLKYINSKSFI...........................................VP
UVRC_LACAC/372-535......VEHQN..GGDEVRNTREVVRRRY..GRLLREHK......................................KMP
UVRC_RICTY/383-551IELRDDIKG......DDYGMLRQVLTRRF..TRLKNEPN......................................KLP
UVRC_THET8/373-519......AGN......DDYAAMEEGVFRRY..TGSLKDL.......................................PLP
UVRC_ANAMM/390-540......LNG......DDYSMMHEVLFRRF..SEESPS.........................................VP
UVRC_ACIAD/383-531......TAG......DDYAAMRQALTRRY..KKHI...........................................VP
UVRC_MESFL/366-519......SKF.....TSDYDRLKEMLYRRF..QKALIEKR......................................MLP
UVRC_SYNPX/388-566......QSGH....SDDFMAMAEIMRRRF..RRWARAKADGVDVGALRHK................GGSALQTDGLNDWP
UVRC_AROAE/379-535......TPG......DDFAAMRQVLERRY..GKVAAGEG......................................VCP
UVRC_PARUW/380-539......IGSK....PDDYAAMYEVLTRRY..KRAKEEN.......................................DMP
UVRC_CHRVO/379-534......APG......DDYAAMREVLSRRY..GKLAEGEG......................................RLP
UVRC_SILPO/391-554......TPG......DDFGMMKEVLTRRF..TRLLKEDPDR.................................DKGLWP
UVRC_STAAM/372-526......VKG.....PDDYKSMREVVRRRY..SRVLNEGL......................................PLP
UVRC_MYCGE/373-528......KKG.......DTNHIALLVYRRI..LSAMQTKAN....................................LPFS
UVRC_BRUAB/386-558......TPG......DDFGMMREVIERRF..SRLVKEHGTPAGEV.........................KNPDAFPAWP
UVRC_METMP/364-514......VSG.....IDDFKSISEVVFRRY..SKLLEENL......................................ELP
UVRC_COXBU/381-538......TPG......DDYGALRQALTRRY..VRLKEGEG......................................ILP
UVRC_LACPL/370-524......DHA......DEAASTREVIRRRY..TRLLKEHA......................................ALP
UVRC_MYCTU/402-571......GRS......DDVACIAEVTRRRF..LRHLRDQSDPDLLSP.......................ERKSRRFAYPP
UVRC_VIBF1/382-539......TGG......DDYAAMAQVLERRY..SKQLDID.......................................KIP
UVRC_BORBU/372-526......LKGE....IDDFKAIKEVISRRY..SEIINNNL......................................ELP
UVRC_CORDI/426-611......AGEG...KSNDVGSIAEVVRRRF..ARYKNDCRMVPQEDEFDGSRFED.......ESLAGENTVAAKQRFAYSP
UVRC_NITEU/381-537......VPG......DDYAAMRDVLQRRY..AKLAMEEG......................................KLP
UVRC_MYCPE/372-526......DAN......SDYDYMKEVIYRRYKNNTASFGE........................................IP
UVRC_CAMJR/381-537.......HK......NDYDQMREVLTRRA..LDFDKIP........................................PP
UVRC_LEPIC/388-539......YEG.....INDPGMIHEVISRRL..QRIINEEG......................................VFP
Q601Y1_MYCH2/355-501......KKG.......DTNYMRQGFEKYI..KNPKFLK.........................................P
UVRC_MYCPN/377-532......HKG.......DTNYMADVVYRRI..ISSIQTHKQ....................................LPLS
UVRC_DESPS/379-534......IEG.....PDDYGMMREVMERRF..KRGIKEG.......................................NLP
UVRC_BACSK/369-523......VEG.....PDDYGSMREVVRRRY..VRLLKEKR......................................PLP
UVRC_CLOTE/384-551......VEG.....ANDYHSMREILRRRF..QRGIEEIQQIQKRNL.......................EFSSGKFSVFP
UVRC_CHLCV/375-531.....SLAH......NDLATFHEVLSRRF...SSLTSS........................................LP
UVRC_STRT1/371-525......VEG.....PDDYASMREVIRRRY..SRVKRDGL......................................TPP

PF04493

NFI_BACSU/20-226------VPY-----VSGFLAFREL--PLI--IEAAKKLE--------------------------------------TEP
NFI_THEAC/123-318------FPY-----IPGYLAFREF--R..--..FIKKLY--------------------------------------RKA
Q9M087_ARATH/33-269------VPY-----VPGFLAFREA--PVL--LQILQKMR--------------------------------------DEK
NFI_CLOAB/20-226------VPY-----MPGFLAFREL--PLV--IKTVKKLK--------------------------------------NEP
NFI_PYRAB/4-194------FPY-----IPTFFFLRET--RPI--..LLVTKG--------------------------------------EEF
NFI_SULSO/9-192------FPY-----IPGFLFMREA--PLM--IKAIEGLD--------------------------------------CHL
NFI_THEMA/19-217------FPY-----IPGLLAFREG--PLF--LKAWEKLR--------------------------------------TKP
NFI_ARCFU/12-207------FPY-----IPTFLMFREG--EPA--VNAVKGLV--------------------------------------DDR
NFI_THEVO/118-313------FPY-----IPGYLAFKEF--K..--..FIRALY--------------------------------------DNE
NFI_STRCO/22-222------FPY-----VPGLLAFREI--PTV--LAALEALP--------------------------------------CPP
NFI_ECOLI/9-209------MPY-----IPGFLSFREY--PAL--LAAWEMLS--------------------------------------QKP
YDA6_SCHPO/16-239------EDY-----VPGFLSFREI--KWY--LPLLNHIP--------------------------------------HQF
NFI_PYRHO/4-195------FPY-----IPTFFFLRET--KPI--..LIATKG--------------------------------------ETF
NFI_XYLFA/23-224------MPY-----VPGLLSFREL--PAL--LQALTQLS--------------------------------------RIP

PF08459

UVRC_BACSU/369-523D----------------------LIIIDGGKGQINAARDVIENELGL..D..IP.IAGLAK-------------------
UVRC_DESVH/440-601D----------------------LLLVDGGRGQLAAVVRAFE.ECGM..GAAFA.VASIAK-------------------
UVRC_PROAC/401-580H----------------------LIVVDGGAPQVHAAQQVLE.EFGL..EDEIA.LCGLAK-------------------
UVRC_METCA/382-539D----------------------ILFIDGGKGQIHAAARTLA.ELGV..E.NIR.IIGIAK-------------------
UVRC_PASMU/381-540D----------------------VIFIDGGKGQLNRALQTFS.KLNVKWDKNQPHLIGVAK-------------------
UVRC_BURMA/497-680N----------------------VVLIDGGRGQVEIARQVFS.ELGL..D..ISMLVGVAK-------------------
UVRC_NEIG1/388-550D----------------------VVLIDGGKGQIGVAVSVWE.ELGL..H..IP.LVGIAK-------------------
UVRC_MYCGA/370-525D----------------------LIILDGGKHQVLAAKKAIV.DLQI..DKKIN.LIGLAK-------------------
UVRC_NOCFA/410-604N----------------------LYVVDGGAPQVAAAAEVLD.ELGI..T.DVA.VIGLAK-------------------
UVRC_LACLA/426-579D----------------------LIAMDGGAGQVNITKQVLK.ELGL..S..IP.VAGMQK-------------------
Q7UPD6_RHOBA/309-460D----------------------VLLIDGGKGQLNAAMAAFR.DQDI..Q..PPTVISLAK-------------------
UVRC_XANOR/382-538D----------------------VLLIDGGAGQLAQAQAALA.DLGV..E.NVW.LVGVAK-------------------
UVRC_HAEIN/381-540D----------------------IIFIDGGKGQLNRALNVFQ.HLQVKWDKNRPHLIGVAK-------------------
UVRC_PSEFL/381-538D----------------------ILLVDGGKGQLSMARDVLN.ELAVPD...LI.LLGVAK-------------------
UVRC_SYNY3/396-555D----------------------LIMIDGGKGQLSAVVKVLK.KMDL..LDKFT.VVSLAK-------------------
UVRC_LISMF/371-525D----------------------LILIDGGKGQIDSAKDVLTNELGL..D..IP.VAGLAK-------------------
UVRC_WOLSU/382-537D----------------------LWLLDGGLGQIRLAQEIIE.SLGA..N..VE.IIAIAK-------------------
UVRC_GLUOX/404-564D----------------------LLLIDGGLGQFNAVRAVLA.DLGV..T.GIP.IVAIAK-------------------
UVRC_COREF/430-611Q----------------------LFIVDGGAPQVAAAQEVFD.ELGI..V.DVT.LVGLAK-------------------
UVRC_BACFR/387-541D----------------------LIITDGGKGQMEVVRQVME.ELQL..D..IP.IAGLAK-------------------
Q7P6I6_FUSNV/374-524D----------------------VILIDGGLGQINSAGEVLE.RLGK..I.HLSELLSLAK-------------------
UVRC_LEGPL/394-550D----------------------VLIIDGGKGQVSIVKRVLT.SLGV..E.DIT.LLGVSK-------------------
UVRC_GEOKA/369-523D----------------------LIIIDGGKGHLSAVRDVLENELGL..D..VP.LAGLAK-------------------
UVRC_TREDE/428-579D----------------------LILIDGGIGQVNAASKIVD.ALDL..G..IP.VIGLAE-------------------
UVRC_HELPY/382-538N----------------------LWVIDGGRAQLNIALEILK.SSGS..F..VE.VIAISK-------------------
UVRC_CHLTE/406-556D----------------------LVLIDGGKGQVNVAWQVLQ.ELGL..D..LP.VAGLAK-------------------
UVRC_THEEB/397-555D----------------------IILIDGGKGQLSAVVQVLEPLLEE.....LT.LVSLAK-------------------
UVRC_MYCMS/366-518D----------------------LVIVDGGIIQIHAAKEVLN.KLNL..K..ID.VIGLSK-------------------
Q6SI31_9BACT/384-554D----------------------LIVIDGGKGQLSASYAALE.ELGL..SNLIA..VGLVK-------------------
UVRC_PHOPR/390-547D----------------------IIFIDGGRGQLSRAYNVVK.PFMDEWP.KQPLLIGIAK-------------------
UVRC_WOLTR/383-536D----------------------FLLIDGGPGHISVVQNVLN.TLNI..N..VP.FACMAK-------------------
UVRC_CLOAB/384-551D----------------------LILMDGGKGQVNIALEVLK.EFNI..D..IP.VCGMVK-------------------
UVRC_UREPA/365-517N----------------------LIVVDGGKLQVNAALYALA.QLQI..N..IP.LIGLKK-------------------
UVRC_LEIXX/407-588N----------------------LLIVDGGQPQVAAARRALE.ESGV..S.GVH.LAGIAK-------------------
UVRC_HELHP/406-562A----------------------LWLLDGGRAQINLALDILK.SVGA..N..VE.VLAIAK-------------------
UVRC_METTH/363-507D----------------------LVLIDGGKGQLGVALEALK.NCGV..H..VP.VVGIAK-------------------
UVRC_BDEBA/390-552Q----------------------LIVIDGGKGQLSQAMKILE.EIGR..K.DIP.VVGLAK-------------------
UVRC_CAUCR/408-571D----------------------LVLVDGGQGQLDAAIEIMA.DLGV..D.DIA.VVGVAK-------------------
UVRC_VIBVY/385-542D----------------------VIFIDGGKGQLNRAHEIIAQYWGD..WPKRPVMIGIAK-------------------
UVRC_METMA/359-509D----------------------LIIIDGGKGQLSSAFQELR.KLRV..K..VP.IISIAK-------------------
UVRC_CLOPE/385-552D----------------------LIMMDGGKGQVNIALEVLK.GFGI..E..IP.VCGLVK-------------------
UVRC_HALSA/377-526D----------------------VLLVDGGRGQLDAALDAVE.AAGW..DGPDA.VIALAK-------------------
Q64DT7_9ARCH/353-503D----------------------LVIIDGGKGQLSAARGEIE.GLGL..R..IP.IISIAK-------------------
UVRC_PROMP/409-587D----------------------LIMIDGGKGQLNAALKALT.QLDL..HEEVN.ICSLAK-------------------
UVRC_FRATT/388-545D----------------------VMIIDGGKGQIHQAEAVFR.EYGI..QDKVQ.LVSLGK-------------------
UVRC_RALSO/423-587R----------------------VVLIDGGKGQVEVARQVFE.ELGL..D..IGLLVGVAK-------------------
UVRC_MYCBG/355-505D----------------------LVIADGGIQQVNEAKKTLK.TLNI..N..IP.VIGLVK-------------------
UVRC_DEIRA/374-539D----------------------LMLIDGGRGQVNAALDALK.EAGV..Q..VP.VVGLAK-------------------
UVRC_THETN/382-548D----------------------LILVDGGIGHVNAALEVIE.KLGI..S..VP.VYGMVK-------------------
UVRC_PROMA/394-572D----------------------LVMIDGGKGQLNIALKALE.KLNL..SEDIK.LCSLAK-------------------
UVRC_IDILO/387-543D----------------------ILFIDGGKGQLAQAENYFN.DWGK..E..APVLIGVAK-------------------
UVRC_SALTY/383-542D----------------------VILIDGGKGQLAQAKAVFA.ELDVPWDKHRPLLLGVAK-------------------
UVRC_ZYMMO/430-593D----------------------LLLIDGGKGQVHAVKDILA.EQGI..S.DIA.IVGISK-------------------
UVRC_BORPE/379-541G----------------------LVLIDGGKGQVEVARQVFV.ELGL..D..IQSLVGVAK-------------------
UVRC_CHLTR/375-530N----------------------LIVIDGGRNQFKRAQRILE.ELNL..T.GIT.VVTIAK-------------------
UVRC_STRP6/369-523N----------------------LIIVDGGVGQVNVAKDVIEKQLGL..T..IP.VAGLQK-------------------
UVRC_HAEDU/384-543D----------------------IIFIDGGKGQLNRALQVFE.KLTVAWDKHKPLLIGVAK-------------------
UVRC_NOSS1/393-556D----------------------LIMIDGGKGQLSSVVTVLQ.EMNL..LEDLR.VISLAK-------------------
UVRC_AQUAE/352-500D----------------------IWLIDGGKGQLNVGIRVKK.RTGL..D..VK.VFSLAK-------------------
UVRC_RHOPA/456-633D----------------------LVIIDGGRGQLNAAREALS.GIGL..TDQVT.LLGVAK-------------------
UVRC_HALMA/369-516D----------------------LLLIDGGDGQLGAARDALA.ETGW..D..VP.AIALAK-------------------
UVRC_GLOVI/388-544D----------------------LVVIDGGKGQLSAARAVME.ELSY..G.DVP.TIGLAK-------------------
UVRC_SHEON/382-541D----------------------ILFIDGGLGQLRIAQQIVD.EKFVNLD.KAPQLIGVAK-------------------
UVRC_TREPA/444-594D----------------------LILVDGGIGHVSAAQHVLD.ALGL..S..IP.LVGLAK-------------------
UVRC_PORGI/380-532D----------------------LIVVDGGKGQLSAAYETLD.KLGL..IGKIP.IIGLAE-------------------
UVRC_TROWT/384-536H----------------------LMIIDGGKPQLSAAVGALQ.EVGL..K..IP.VFALSK-------------------
UVRC_THEMA/350-492N----------------------LLFVDGGIGQVNAAIEALK.EIGK..D..CP.VVGLAK-------------------
Q93SG1_EUBAC/384-532D----------------------LMLIDGGRGQVGVVSRLLL.ELGV..D..IP.VWGMYK-------------------
UVRC_SYMTH/381-558D----------------------LLIIDGGKGQLSYARAVMR.ELGV..D.HIP.TFGLAK-------------------
UVRC_SYNP6/393-571D----------------------LVMIDGGKGQLSAVVEVLR.NLNL..LEDVK.LCSLAK-------------------
Q6KH99_MYCMO/348-496D----------------------LLIVDGALAQVREVKKILA.SLFI..K..LK.VIGLVK-------------------
UVRC_GEOSL/375-539D----------------------LIVIDGGMGQLNVLTAILE.ELGL..H.GID.AVSLAK-------------------
UVRC_CHLPN/375-532D----------------------MIVVDGGKTHYNKTKKIIQ.TLNL..T.GIQ.VVTIAK-------------------
UVRC_STRAW/391-568Q----------------------LVVVDGGQPQVAAAKRALD.ELGI..D.DIA.VCGLAK-------------------
UVRC_BARQU/433-609N----------------------LILIDGGEGQINSVHTILS.ELKL..DDFIT.VVGIAK-------------------
UVRC_OCEIH/369-523D----------------------LIIVDGGKGQMSAALEVLEDELGL..D..IP.LAGLAK-------------------
UVRC_RHILO/435-619D----------------------VILIDGGQGQMTAVRKILA.DLGI..EDRVV.AIGIAK-------------------
Q98R54_MYCPU/350-499D----------------------LFIVDGSFAQLHEVKKQMK.KANL..T..FP.IIALVK-------------------
UVRC_LACAC/372-535D----------------------LILMDGGQIQVDACEDVLRNELNL..N..IP.VAGMVK-------------------
UVRC_RICTY/383-551S----------------------LMIIDGGKGHLTVVKEVMD.KFGM..N..IP.FVCMSK-------------------
UVRC_THET8/373-519D----------------------LLLIDGGVGQVRAAARALE.RAGL..R..LP.LVGLAK-------------------
UVRC_ANAMM/390-540D----------------------FVLIDGGRGHISSAIQVLG.DLGI......P.FACMAK-------------------
UVRC_ACIAD/383-531D----------------------LLLIDGGKGQLHMAMEVMQ.TLGL.....DAFMVGVSK-------------------
UVRC_MESFL/366-519D----------------------LIIMDGGIIQIHAAKEIIN.ALGL.SE..IQ.VIGLVK-------------------
UVRC_SYNPX/388-566D----------------------VVMIDGGKGQLSAVMEALR.ELDL..HEDLN.VCSLAK-------------------
UVRC_AROAE/379-535D----------------------LILIDGGKGQVSSARSVLA.DVGL.ES..IA.MVGVAK-------------------
UVRC_PARUW/380-539D----------------------LVVVDGGKGQLNIAIKVFE.ELNI..T.GVD.LLGLAK-------------------
UVRC_CHRVO/379-534D----------------------AVFIDGGKGQVGVALEVLG.ELGL..N..LP.IVGIAK-------------------
UVRC_SILPO/391-554D----------------------LLLIDGGAGQVSAVHEIMM.AHGV..Q.DIP.MVGVAK-------------------
UVRC_STAAM/372-526D----------------------LIIVDGGKGHMNGVIDVLQNELGL..D..IP.VAGLQK-------------------
UVRC_MYCGE/373-528D----------------------LLIIDGGKAQIKSVKQVFSLFSNV..K..PPIIIGLVK-------------------
UVRC_BRUAB/386-558D----------------------VILIDGGQGQVGAVRQILG.EMGI..SDLVT.AIGIAK-------------------
UVRC_METMP/364-514D----------------------LIIIDGGKGQLSSAFSELR.KLKL..K..IP.LISIAK-------------------
UVRC_COXBU/381-538D----------------------VLLIDGGMGQLRQAAEVLE.ELQVSG...VI.LTAIAK-------------------
UVRC_LACPL/370-524D----------------------LILMDGGEIQLEAAKDVLENELGI..A..TP.VAAMVK-------------------
UVRC_MYCTU/402-571N----------------------LYVVDGGAPQVNAASAVID.ELGV..T.DVA.VIGLAK-------------------
UVRC_VIBF1/382-539D----------------------IIFIDGGKGQLNRAYEVIS.KHWEDWP.KQPLLLGIAK-------------------
UVRC_BORBU/372-526N----------------------LILIDGGKGQLNAALSILK.GLKI..ENKVK.VCSLAK-------------------
UVRC_CORDI/426-611Q----------------------LFIVDGGAPQVAAAQDVLD.ELGI..T.DVA.LIGIAK-------------------
UVRC_NITEU/381-537D----------------------LILIDGGKGQIRVASEVMI.ELGL..N.DIP.LVGVAK-------------------
UVRC_MYCPE/372-526N----------------------LIIVDGGKPQVKAALESLK.FLEL..DSIIP.VIGLAK-------------------
UVRC_CAMJR/381-537D----------------------LWLIDGGKALLDLAKEIIV.SSGA..N..VD.ILAISK-------------------
UVRC_LEPIC/388-539D----------------------LIVIDGGLTQLTKACEAAV.EAGA..E.GIP.MVGLAK-------------------
Q601Y1_MYCH2/355-501D----------------------LILVDGGIQQINLIIEILR.KNHF..E..IP.IFGMVK-------------------
UVRC_MYCPN/377-532D----------------------LLIVDGGIAQINTVTKVFASFPNV..T..QPIIIGLAK-------------------
UVRC_DESPS/379-534N----------------------LFVVDGGKGQLGMAMAVAR.ELGI..TNELD.WIGIAK-------------------
UVRC_BACSK/369-523D----------------------LIVIDGGAGQIAAAKEVIEDELGQ..A..IP.VCGLAK-------------------
UVRC_CLOTE/384-551D----------------------LILIDGGKGHVNIALEVLK.ELNI..E..IP.VAGMVK-------------------
UVRC_CHLCV/375-531D----------------------MIVIDGGRAQYSQAKKTLK.ELNL..T.GIQ.VVSLAK-------------------
UVRC_STRT1/371-525D----------------------LIIIDGGQGQVNVAKDVLRNELNL..S..IP.VAGLQK-------------------

PF04493

NFI_BACSU/20-226D......................VFLFDG-NGYLHYNHMGVATHAAF--FLGKP-TIGIAKTYLKIK.GCDFVTPEIEV.
NFI_THEAC/123-318D......................LLLIDG-NGILHPRFAGLATHAGV--LLDRA-SIGVAKHLTRST.RHQDIIYMQDR.
Q9M087_ARATH/33-269HPFYPQVSVLSISCFISCFALAKVLMVDG-NGILHPRGFGLACHLGV--LAHLP-TIGVGKNLHHVD.GLNQSEVKQSLQ
NFI_CLOAB/20-226D......................IFMFDG-NGYLHYNHMGIATHASF--FLNKP-TIGVAKSYLKVA.GVDFEMPESFE.
NFI_PYRAB/4-194D......................VLIVEG-HGKAHPRKYGLASHIGL--ILGKP-TIGVAKKLLRGT.PENSYRKVG...
NFI_SULSO/9-192L........................LVDG-HGIAHPRKSGIAAVIGV--LLDFP-TIGVAKSRLTG....DLVNESE...
NFI_THEMA/19-217D......................VVVFDG-QGLAHPRKLGIASHMGL--FIEIP-TIGVAKSRLYG....TFKMPEDKR.
NFI_ARCFU/12-207A......................AIMVDG-SGIAHPRRCGLATYIAL--KLRKP-TVGITKKRLFG....EMVEVEDG..
NFI_THEVO/118-313T......................MILIDG-NGILHPRFAGLATHAGV--SLKTA-SIGIAKHLINCT.VKGSDLLISGV.
NFI_STRCO/22-222G......................LVVCDG-YGLAHPRRFGLASHLGV--LTGLP-TIGVAKNPFTF....THDDPDTPR.
NFI_ECOLI/9-209D......................LVFVDG-HGISHPRRLGVASHFGL--LVDVP-TIGVAKKRLCG....KFEPLSSEP.
YDA6_SCHPO/16-239RI....................DIILVDG-NGVLHPVGFGLACHLGV--LLNLP-VVGVAKNYLHCVGLTESLDAHRETL
NFI_PYRHO/4-195D......................VLIVEG-HGKAHPRGYGLASHIGV--VLRKP-TIGVAKRLLKNT.PKDTYKKVG...
NFI_XYLFA/23-224A......................LVFVDG-HGIAHPRRLGIAAHFGL--VTNLP-CIGVAKKRLVG....DFVEPGTAF.

PF08459

UVRC_BACSU/369-523--------------------DEKHRTSN..........LLIGD.....PLEVAYLERNSQEFYLLQRIQDEVHRFAI
UVRC_DESVH/440-601--------------------ARTEEGRADRRAGNVSDRIFLPG.....RANPLPLRAGAPELLFLQHVRDTVHDYSI
UVRC_PROAC/401-580--------------------RLEE..............VWLPD.....EEWPVILPRTSEGLYLLQRLRDEAHRFAI
UVRC_METCA/382-539--------------------GPDRKPGME........TLFQTG.....CSDPIVVKPDNPGSLLIQHIRDEAHRFAI
UVRC_PASMU/381-540--------------------GIDRKAGLE........TLILSK.....QGKILHLPSDHLALHLIQHIRDESHQHAI
UVRC_BURMA/497-680--------------------GEGRKVGLE........TLIFAD.....GRAPLELGKESAALMLVAQIRDEAHRFAI
UVRC_NEIG1/388-550--------------------GPERKAGME........ELILPF.....TGELFRLPPNSPALHLLQTVRDESHRFAI
UVRC_MYCGA/370-525--------------------NNKHQTDK..........IVTFD......LDEISLDKSSALYFFLANLQEEVHKFAI
UVRC_NOCFA/410-604--------------------RLEE..............VWVPG.....EPDPVILPRNSEALFLLQRVRDEAHRFAI
UVRC_LACLA/426-579--------------------NDKHQTSE..........LLFGD.....PLDVVPLSRQSQEFFLLTRIQDEVHRFAI
Q7UPD6_RHOBA/309-460--------------------RDEE..............IFRPG.....ISEPLKLSKNAFALRLLQYVRDESHRFAQ
UVRC_XANOR/382-538--------------------GEERRAGHE........ALIMAD......GRELRPGAASPALQFIQQVRDEAHRFAI
UVRC_HAEIN/381-540--------------------GVDRRAGQE........VLIISK.....QDREIHLPDDSLALHLIQHIRDESHNHAI
UVRC_PSEFL/381-538--------------------GATRKTGFE........TLYLND.....AAHEFTLKGDSPALHLIQQIRDEAHRFAI
UVRC_SYNY3/396-555--------------------QREE..............IFLPG.....ESQPLPTHAEQPGVQLLRRLRDEAHRFAV
UVRC_LISMF/371-525--------------------DDKHRTSQ..........LLFGD.....PLEIVPLERNSQEFYLLQRMQDEVHRFAI
UVRC_WOLSU/382-537--------------------EKIDAKAHRAK...GAAKDILRT.....PTEEIRLLPSDKRLQLLQKIRDEVHRFAI
UVRC_GLUOX/404-564--------------------GPDRDAGR.........EWFFTE.....TKSPFQLPPRDPVLYYLQRLRDEAHRFAI
UVRC_COREF/430-611--------------------RLEE..............IWLPG.....DPDPVILPRNSPALFLLQQVRDEAHRFAI
UVRC_BACFR/387-541--------------------DRKHRTSE..........VLFGF.....PPQTIGIKQHSPLFRLLEQIQDEVHRFAI
Q7P6I6_FUSNV/374-524--------------------RDEE..............IYKYG.....ESIPYSLSKDMEALKIFQRVRDEAHRFGI
UVRC_LEGPL/394-550--------------------GPSRKAGWE........KLILVN.....ENREFVLPEDSKALHLLQHIRDEAHRFAI
UVRC_GEOKA/369-523--------------------DEKHRTSE..........LLAGD.....PPDVVPLDRQSQEFYLLQRIQDEVHRFAV
UVRC_TREDE/428-579--------------------KNEE..............VYFPH.....NSKPVILPRRSDALRLLQRIRDEAHRFSN
UVRC_HELPY/382-538--------------------EKRDSKAYRSK...GGAKDIIHT.....PSDTFKLLPSDKRLQWVQKLRDESHRYAI
UVRC_CHLTE/406-556--------------------RLEE..............IYVPN.....EPDPYNLPKTSPALKLLQQLRDEAHRFAI
UVRC_THEEB/397-555--------------------QRED..............IFLPH.....QRQPLPADPEQPGVQLLRRVRDEAHRFAL
UVRC_MYCMS/366-518--------------------DDHHKTR...........YLIDI.....FEQTIDIKNFKKLYNFLTSLQIRVDEYAK
Q6SI31_9BACT/384-554--------------------KKEV..............LVVRD.....RPDPITLPSANEALLLLQRIRDEAHRCAV
UVRC_PHOPR/390-547--------------------GVTRKAGLE.......TLIFITG.......EEFSLPSDSPALHLIQHIRDESHNHAI
UVRC_WOLTR/383-536--------------------GSYRNAGNE........RFYMPN......REDFTLKNDSKVMLYLQSLRNEAHRFAI
UVRC_CLOAB/384-551--------------------DDRHNTRG..........IIYNN.......NEIDIKSNRKIINFVTRVQDEVHRFAI
UVRC_UREPA/365-517--------------------DQKHKTDA..........IVLTN......GDEIVLDRKSILYKFLANMQNDVHNYAI
UVRC_LEIXX/407-588--------------------RLEE..............VWLPG.....SDFPVILPRNSDALFLIQRIRDEAHRFAI
UVRC_HELHP/406-562--------------------MKHNAKAYRAK...GNAFDILRS.....KNAEFKLKPNDKRLQFLQKLRDEVHRYAI
UVRC_METTH/363-507--------------------KREE..............VYLPG.....LSEPVDV..DDGALQILRHLRDEAHRFAV
UVRC_BDEBA/390-552--------------------ARTESDFQKQEVESTEERFFLPG.....RSNPVIFKHNAEALYILSGIRDEAHRFAI
UVRC_CAUCR/408-571--------------------GPDRDAGLE........RFFIPG......QTPFMLEPKSPVLYYLQRLRDEAHRFAI
UVRC_VIBVY/385-542--------------------GVTRKPGLE........TLITVD......GDEFHLPSDDPALHLIQHIRDESHNHAI
UVRC_METMA/359-509--------------------REEE..............IYVPG.....LKSPLPIKKDEKASLFVQEIRDEAHRFAI
UVRC_CLOPE/385-552--------------------DHKHRTRG..........IILNN.......EEILIRRGSGLMNLITRVQDEVHRYAI
UVRC_HALSA/377-526--------------------DEEV..............VVTPD.......RTYDWGSDAPQLHVLQRVRDEAHRFAV
Q64DT7_9ARCH/353-503--------------------REEE..............IYVPG.....LTHPLPADRNAKASLFVQEIRDEAHRFAV
UVRC_PROMP/409-587--------------------KNEE..............IFIPG.....FSKSLDTDQNQKGLLLLRRVRDEAHRFAL
UVRC_FRATT/388-545--------------------GIERISGKE........KIYKGF.....DDTEYTLDEHNPGFLLLRQVRDSAHDHAI
UVRC_RALSO/423-587--------------------GEGRKVGLE........TLVFAD.....GRPSLELGQGSAALMLVAQIRDEAHRFAI
UVRC_MYCBG/355-505--------------------NEFHKTK...........ALIDL.....DMNEIHIN.DLELYNYLVQIQVEVDRFAK
UVRC_DEIRA/374-539--------------------REERLILPGRY....GAQWWLETGTEVGVDRELLLPHTHPALRMLIGVRDEVHNYAV
UVRC_THETN/382-548--------------------DSRHRTRG............LVG.....VSGEVQMPVTGRAFRLVAQIQEEAHRFAI
UVRC_PROMA/394-572--------------------KNED..............IFIPG.....NNKPLKCNNDDNGLLLLRRLRDEAHRFAV
UVRC_IDILO/387-543--------------------GESRKPGLE........TLIMAG.....SHETIPLSKDASALHLIQHIRDESHRFAI
UVRC_SALTY/383-542--------------------GADRKAGLE........TLFFEP.....EGEGFSLPPDSPALHVIQHIRDESHDHAI
UVRC_ZYMMO/430-593--------------------GPDRNAGRE........HFHLVD......GSEYALPPNSGLLFYLQRLRDEAHRFAI
UVRC_BORPE/379-541--------------------GEGRKVGLE........TLVFAD.....GRPPVALGKESAALMLIAQVRDEAHRFAI
UVRC_CHLTR/375-530--------------------ESGNHSKSLR.....QEKLFCET.....FPQGILLHPTSAILQFFQLLRDEAHRFAI
UVRC_STRP6/369-523--------------------NDKHQTHD..........LLFGN.....PLEVVSLPRRSEEFFLLHRIQDEVHRFAV
UVRC_HAEDU/384-543--------------------GAERKAGLE........TLIIGR.....LKKEIHLPIDSPALHLIQHIRDESHHHAI
UVRC_NOSS1/393-556--------------------RREE..............IFLPG.....ESQPLKTDAEQPGVQLLRRLRDEAHRFAV
UVRC_AQUAE/352-500--------------------EEE...............IIYTE.....DGREIRLKENPILYRVFGEIRDEAHRFAL
UVRC_RHOPA/456-633--------------------GPDRDAGRE........TLFLPD......RDAIKLEPRDPVLYFIQRLRDEAHRFVI
UVRC_HALMA/369-516--------------------DEEL..............VITPD.......RVYDWNDDAPQLHLLQRIRDEAHRFAV
UVRC_GLOVI/388-544--------------------RLEE..............VFLPG.....RSDPVLIAQGDPALHLLQRIRDEAHRFAV
UVRC_SHEON/382-541--------------------GESRKPGLE........TLIFGD.....TETSFSLEDDSPALHLIQHIRDESHRFAI
UVRC_TREPA/444-594--------------------RAEE..............LFIPN.....SPTPLVLDRRNPALHMLQRIRDEAHRFAI
UVRC_PORGI/380-532--------------------RLEE..............IFFPK.....DPVPLILDKKSETLKVIQHLRDEAHRFGI
UVRC_TROWT/384-536--------------------RLEE..............LWSPG.....VKTSLILPPNSESLFLLQKIRDESHRFAL
UVRC_THEMA/350-492--------------------KEET..............VVFEN.......REIHLPHDHPVLRLLVQIRDETHRFAV
Q93SG1_EUBAC/384-532--------------------DDKHRTRG..........LVSLE.......REIELKKSSQLYRFICTIQDEAHRFAI
UVRC_SYMTH/381-558--------------------ENEL..............LCTED.....RPDWIELPRGSQALFLLQRIRDEAHRFAI
UVRC_SYNP6/393-571--------------------KREE..............IFLPG.....ASDPLPTDAEQPGVQLLRRLRDEAHRFAV
Q6KH99_MYCMO/348-496--------------------NDKHITSH............IIN.....LKEKREEISDASLLIFLKSIQEEVDRFAK
UVRC_GEOSL/375-539--------------------SRVERNMSDNEVVRSDERVFLPG.....RRNPVVLRQNGAPLLLLARIRDEAHRFAI
UVRC_CHLPN/375-532--------------------EKSNHSRGLN.....KEKIFCET.....FPEGFSLPPTSNLLQFFQILRDEAHRFAI
UVRC_STRAW/391-568--------------------RLEE..............VWLPD.....DGDPVVLPRTSEGLYLLQRVRDEAHRFAI
UVRC_BARQU/433-609--------------------GADRGAGHE........RFFIKG......KTPFTLPPHDPILYFLQRLRDEAHRFAI
UVRC_OCEIH/369-523--------------------DDRHKTSE..........LLYGM.....PPIVVPLERQSQAFYLVQRIQDEVHRFAI
UVRC_RHILO/435-619--------------------GQDRDAGRE........RFFVKG......RDSFSLPVRDPVLYFVQRLRDEVHRFAI
Q98R54_MYCPU/350-499--------------------DDFHRTKK..........LIDTN.......EKEHLLEDKEVKNFLSMIQNEVDQFAK
UVRC_LACAC/372-535--------------------DDKHRTNH..........LLFGDPINGIPLKLIPLDPKSEGFYLMTRIQDEVHRFAI
UVRC_RICTY/383-551--------------------GRDRNAGLE........QLHMQG......KEVFTLDKNLLVMKYLQILRDEAHNFAI
UVRC_THET8/373-519--------------------GEE...............VLVTP.....EGRELRLPLTHPALQLLIHLRDEAHQNGL
UVRC_ANAMM/390-540--------------------GSNRNAGEE........VFYLPD......GRKICLDPDSKLMLYMRKIRDEAHRFAI
UVRC_ACIAD/383-531--------------------GEGRKPGLE........TLHFTD......GSKIQLPEDHKALHLIQQVRDEAHRFAI
UVRC_MESFL/366-519--------------------DEHHNTS...........FLIDT.....NEEQVIIKDKPKLFNWLSSIQVRVDEYAK
UVRC_SYNPX/388-566--------------------QREE..............VFLPG.....ESQPLESEPDQLGVALLRRLRDEAHRFAV
UVRC_AROAE/379-535--------------------GEERKPGLE........TLVFPD......GRMQNLAIDHPALHLIQEIRDEAHRFAI
UVRC_PARUW/380-539--------------------EAGRHDKGMT.....AEQVFTCY.....QKEPILLKANSPILFLLQKIRDEAHRVAI
UVRC_CHRVO/379-534--------------------GEERKPGLE........TLILPY.....LEKTLQLRQDHPALHLIQTVRDEAHRFAI
UVRC_SILPO/391-554--------------------GIDRDHGKE........EFHRTG......QRPFALKRNDPVLYFIQRLRDEAHRFAI
UVRC_STAAM/372-526--------------------NDKHQTSE..........LLYGA.....SAEIVPLKKNSQAFYLLHRIQDEVHRFAI
UVRC_MYCGE/373-528--------------------NKNHQTDH..........IMLSD......FQVKKIAINSPLFHYLATIQTEVDGFAK
UVRC_BRUAB/386-558--------------------GVDREAGRE........RFFMEG......KQPFTLPPRDPVLYFIQRLRDEAHRFAI
UVRC_METMP/364-514--------------------REEE..............IYTPG.....IENPLPIKKNEKASLFIQEIRDEAHRFAI
UVRC_COXBU/381-538--------------------GPGRKAGLE........KLFVWG.....RREEIHLPADNIAFHLIQQIRDEAHRFAI
UVRC_LACPL/370-524--------------------NDHHKTAD..........LLASA.....GDQHLHLDPKSQGFYLLQRIQDEVHRFAI
UVRC_MYCTU/402-571--------------------RLEE..............VWVPS.....EPDPIIMPRNSEGLYLLQRVRDEAHRFAI
UVRC_VIBF1/382-539--------------------GVTRKHGLE.......TLVKISG.......EEFSMPSDSPALHLIQHIRDESHNHAI
UVRC_BORBU/372-526--------------------KQET..............IFLTT.....NKKGINLPQGHPALRILQNVRDEAHRKAN
UVRC_CORDI/426-611--------------------RLEE..............IWLPG.....EEDPLILPRNSQGLYLIQQLRDEAHRFAI
UVRC_NITEU/381-537--------------------GETRKPGLE........QLILPW.....QEEALHLPDDHPALHLIQQIRDEAHRFAI
UVRC_MYCPE/372-526--------------------DDKHKTDR..........IVKWD......FSEIKLDKKSDLYFFLLNIQDEVHRFAI
UVRC_CAMJR/381-537--------------------EKIDAKAHRAK...GGAKDKIHS.....LKGEFSLSINDKKLQFLQKLRDEAHRFAI
UVRC_LEPIC/388-539--------------------KREE..............IFFPG.....ENEPFIFDMNSPGMKLLRHLRDEAHRFGV
Q601Y1_MYCH2/355-501--------------------NKRHKTEK..........II........DLNGKKINVSQDVLNFFALIQENVDLFVK
UVRC_MYCPN/377-532--------------------NTRHQTDH..........IVLTD......NTTINIDKNTPLFAYLTTIQEEVDSFAK
UVRC_DESPS/379-534--------------------ERHEEGEK..........LYKPG.....RKNPILLPAHSPVLLYLMRIRDESHRYGI
UVRC_BACSK/369-523--------------------DDKHRTSQ..........LLMGS.....PPVVVPLQRDSHEFYLLQRIQDEVHRFAI
UVRC_CLOTE/384-551--------------------DDSHTTRG..........IIYNN.......IEKDISLDSNAMKLITRIQDEVHRFAI
UVRC_CHLCV/375-531--------------------EASNHSSSLR.....NEKLFCDT.....FPQGIQLAPTSKLLQFFQKLRDEAHRFAI
UVRC_STRT1/371-525--------------------NDKHQTNE..........LLFGD.....PLRVIDLPRQSEEFFLLHRIQDEVHRFAI

PF04493

NFI_BACSU/20-226.......GAYTDIII.....DGEVYGRALR.TRRDVKPIFLSCGNYIDLDSSYQITMSLINQESRLPIPVRLADLET
NFI_THEAC/123-318.......PVGVMIRK.....NMIVSPGNFI.DVNGSADTVRKMWND.RYPWPLKLAHQLSTRHAETGGRVSEYSIES
Q9M087_ARATH/33-269LQINEHEQTITLVGN.....SGITWGVGFRPTLSSLKPIYVSVGHRISLDSAVEVVKITCKY..RVPEPIRQADIRS
NFI_CLOAB/20-226.......GAFKDIVI.....NEEVYGRVLR.TKKDVKPIFVSCGNYIDLETCTKICSKLINNDSRLPITVRLADLET
NFI_PYRAB/4-194....................KAYVSVGNMI.TLKDAVRIIEKLLDG.GYPKPLKLADKLSKGKISEDENTLPSDKTS
NFI_SULSO/9-192.........ITYVYL.....NGEKVGVKFG......R.YFYSPGNKVDLQDCIELGKRGYPK..VL....KIADMLT
NFI_THEMA/19-217.......CSWSYLYD.....GEEIIGCVIR.TKEGSAPIFVSPGHLMDVESSKRLIKAFTLPGRRIPEPTRLAHIYT
NFI_ARCFU/12-207.........LWRLLD.....GSETIGYALK.SCRRCKPIFISPGSYISPDSALELTRKCLKG.YKLPEPIRIADKLT
NFI_THEVO/118-313.......VAGKMIGH.....HTIVSPGNRI.NVEEAGRLIEQREGK.EMRSLLRLAHNLTRLHIETNGNIARYDFST
NFI_STRCO/22-222.......GSTSPLLA.....GAEEVGRAVR.TRDGVKPVFVSVGHRVGLGNACAHTLALTPA.YRLPETTRRADALC
NFI_ECOLI/9-209.......GALAPLMD.....KGEQLAWVWR.SKARCNPLFIATGHRVSVDSALAWVQRCMKG.YRLPEPTRWADAVA
YDA6_SCHPO/16-239KKHVLKKTTDHPILIHSIDQSSEILGAAVWTSSNSKRPVYVSIGNQMNLEQSIQLVQKCSSSHSRVPEPIRQADIYA
NFI_PYRHO/4-195....................KVYVSVGNLI.TLEDATKIIRAILDESGYPKPLKLADKLSKGRIYEVKNTPSPNRSR
NFI_XYLFA/23-224.......GEHTPILL.....HGTQVGWALR.SKIRCKPLMISPGHKISLHSALTWTQRCLNG.YRLPEPTRQADRLA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window