Sequence alignment for CL0190

PF08190

KTU_HUMAN/43-348LTDPENR......RRYEAEITALERERG.VE.VRFVHPEPGHVLRTSLDGA.R...RCFVNVCSNALVGAP...SSRPGS
KTU_DROPS/50-355VQDPENR......KIYEQEITQLEKERG.VD.IKFVHPKPGFVVKTSIDGE.L...KCFINIASSPEVARP...NSEVGM
KTU_DANRE/39-392ISSPENR......RRYEEEIRRLEEERG.AA.VQFIHPTPHHVLKGRGPSG.....KCFINICSDQLIEKP...RSEAAT
Q9VK57_DROME/30-332INQYFGG......ADPEGS.GPQQKPPP.RD.SLIVQPTAGICVKSFKTNS.D..EKFFINVCQAAEVPAPQDVTEEELI
A0DMA1_PARTE/44-380ISDPKNR......EEYDQYLKQLERESELPKGMKLIKPEPHFCVKTSICKEITLQFKFFINICSTSVIDKP.....QSET
A0CTY4_PARTE/36-334LTDPEYL........KLKDIQEYLDQEG....GMMIEPTPHFVLKAFDQNG.E...KVFFNVTAHSVVDAP...EEKQLI
E9AFR0_LEIMA/55-423LRTLQSRLQEEATKEAKEDLEQVHSDEQ.GQ.WMFVLPDPGFCIKTNVAGG.A...KVFINVCQHARIGEPVPMEPENGS
KTU_ANOGA/36-354LRD..NR......KQYEDELSMLEAQRG.YD.VKFLKPSPGYVIKTIVDGK.G...KGFINVCQSELVQKP...TSTTGL
Q4DT93_TRYCC/46-391LRDIQMRIQEESRNAMKSKLEAIQSDEN.GQ.WMYVLPEPGFCVKCTTSGG.G...KIFLNVCQHERIAEPIPMEEDEKT
A7SEW3_NEMVE/38-354ISDPENK......KRYEEEIRQMENERG.MD.VKFVNPEEGFVVKTTRETD.G..IKAFVNICYNQHIEKATFRMAEKGD
Q17BY1_AEDAE/23-351VRDETEEQ...FNSMFGPIVEQAQDISS.GR.SKVVKPTPGFCIKAFRKDT.R..NKFFINVCQTDGIPAPEDITEDQLM
KTU_AEDAE/38-346LKDPENR......KQYEEELKLMEAERG.YD.VKFIKPLPGYVIKTVVDGK.T...KAFVNVCHCDLVGKP...SSQCST
Q38DW7_TRYB2/46-377LADLQKKIQEESMKSAKAKLEEIHSDEN.GQ.WMYILPEPGFCVKCKVAGG.G...KVFVNVCKHERIAEPIPIDDDNEA
KTU_XENTR/38-353ISDPENR......KKYEQEIYKMENERG.MD.IKFIHPKPGYVLLSSVNGV.Q...KCYLNICSNDLIQKP...EFKPGK
H3DIW3_TETNG/40-350LADPENR......RRYEEEIKILEQNRG.NT.IEFIHPEPVKALRTCMNGS.Q...KCYINICASEKIGKP...SCSPKV

PF04969

CYBP_HUMAN/76-156----------------------------------------------------S---------------------------
Q8I542_PLAF7/76-156----------------------------------------------------Q---------------------------
NUDC_SCHPO/9-86----------------------------------------------------A---------------------------
Q7RB97_PLAYO/167-241----------------------------------------------------E---------------------------
Q5U3E4_DANRE/132-208----------------------------------------------------V---------------------------
Q8I2N9_PLAF7/17-92----------------------------------------------------L---------------------------
Y8359_ORYSJ/5-81----------------------------------------------------P---------------------------
SGT1_YEAST/185-267----------------------------------------------------F---------------------------
Q75M67_ORYSJ/5-81----------------------------------------------------P---------------------------
Q8VXX3_ARATH/19-93----------------------------------------------------K---------------------------
Q7Q5Z9_ANOGA/168-244----------------------------------------------------D---------------------------
CHRD1_DROME/213-291----------------------------------------------------C---------------------------
GIT7_SCHPO/184-261----------------------------------------------------I---------------------------
Q7Q5W9_ANOGA/4-76----------------------------------------------------V---------------------------
Q7PYU2_ANOGA/81-161----------------------------------------------------K---------------------------
NUDC_EMENI/32-114----------------------------------------------------L---------------------------
Q8IN95_DROME/136-213----------------------------------------------------E---------------------------
Q57UQ9_TRYB2/137-213----------------------------------------------------E---------------------------
Q5JLZ9_ORYSJ/80-157----------------------------------------------------G---------------------------
BOB2_ARATH/134-209----------------------------------------------------E---------------------------
NUDC_MOUSE/171-248----------------------------------------------------P---------------------------
UBP19_HUMAN/286-374----------------------------------------------------K---------------------------
Q8I2V1_PLAF7/85-164----------------------------------------------------C---------------------------
Q5CJD2_CRYHO/4-76----------------------------------------------------P---------------------------
NUDC2_RAT/17-91----------------------------------------------------P---------------------------
Q9VVA6_DROME/171-248----------------------------------------------------E---------------------------
Q9VYT5_DROME/294-367----------------------------------------------------P---------------------------
Q6FKN1_CANGA/178-257----------------------------------------------------V---------------------------
Q584U3_TRYB2/25-100----------------------------------------------------G---------------------------
Q7RGQ2_PLAYO/266-349----------------------------------------------------T---------------------------
Q6CJS5_KLULA/181-260----------------------------------------------------L---------------------------
Q6DBR7_DANRE/227-303----------------------------------------------------C---------------------------
Q9C8R4_ARATH/77-154----------------------------------------------------G---------------------------
Q5CM61_CRYHO/144-218----------------------------------------------------D---------------------------
Q5K7I7_CRYNJ/8-89----------------------------------------------------P---------------------------
CHRD1_DANRE/228-304----------------------------------------------------C---------------------------
Q59X42_CANAL/219-296----------------------------------------------------F---------------------------
Q8W065_ORYSJ/19-93----------------------------------------------------K---------------------------
Q9W3Y3_DROME/69-149----------------------------------------------------T---------------------------
A8BM82_GIAIC/4-77----------------------------------------------------P---------------------------
Q75EE3_ASHGO/168-248----------------------------------------------------S---------------------------
Q6DC89_DANRE/17-91----------------------------------------------------A---------------------------
NUDC1_MOUSE/275-349----------------------------------------------------P---------------------------
CHRD1_PONAB/230-306----------------------------------------------------C---------------------------
ITBP2_MOUSE/219-295----------------------------------------------------C---------------------------
Q6Z2U7_ORYSJ/207-282----------------------------------------------------E---------------------------
NB5R4_RAT/167-245----------------------------------------------------P---------------------------
Q5CJI5_CRYHO/85-163----------------------------------------------------T---------------------------
Q6CBP8_YARLI/6-81----------------------------------------------------E---------------------------
Q8IDW4_PLAF7/214-288----------------------------------------------------D---------------------------
Q7RF79_PLAYO/75-155----------------------------------------------------P---------------------------
Q7RRD9_PLAYO/3-75----------------------------------------------------P---------------------------
Q5KJJ7_CRYNJ/248-324----------------------------------------------------C---------------------------
Q8SSJ3_ENCCU/5-78----------------------------------------------------A---------------------------
Q6BXK8_DEBHA/178-255----------------------------------------------------I---------------------------
Q5K7J1_CRYNJ/33-108----------------------------------------------------L---------------------------
B0S6K3_DANRE/76-155----------------------------------------------------.---------------------------
C3ZHN0_BRAFL/18-94----------------------------------------------------.---------------------------
C8V7I9_EMENI/316-392----------------------------------------------------.---------------------------
F1Q6Q1_DANRE/171-250----------------------------------------------------E---------------------------
F5HGH3_NEUCR/245-328----------------------------------------------------.---------------------------
F6WW93_XENTR/418-505----------------------------------------------------.---------------------------
F6YV35_XENTR/79-156----------------------------------------------------.---------------------------
F6ZRN5_XENTR/19-98----------------------------------------------------K---------------------------
F7AJ60_XENTR/139-214----------------------------------------------------.---------------------------
F7DCK1_XENTR/141-218----------------------------------------------------P---------------------------
G4U823_NEUT9/194-271----------------------------------------------------.---------------------------
H3C642_TETNG/318-405----------------------------------------------------.---------------------------
K4BEI9_SOLLC/173-248----------------------------------------------------.---------------------------
K4BTK3_SOLLC/6-81----------------------------------------------------.---------------------------
M4E6X8_BRARP/6-81----------------------------------------------------.---------------------------
Q24K01_BOVIN/186-265----------------------------------------------------E---------------------------
Q4WN97_ASPFU/37-116----------------------------------------------------.---------------------------
Q8L7U4_ARATH/6-81----------------------------------------------------.---------------------------
V5IRH3_NEUCR/27-105----------------------------------------------------.---------------------------
W5CHI3_WHEAT/108-183----------------------------------------------------.---------------------------

PF00011

SP21_STIAD/57-157--------------------------------------------------------------------------------
HSP26_YEAST/96-207--------------------------------------------------------------------------------
HS174_ORYSJ/50-153--------------------------------------------------------------------------------
HSP17_ARATH/52-155--------------------------------------------------------------------------------
18KD_MYCLE/31-129--------------------------------------------------------------------------------
CRYAB_ANAPL/66-161--------------------------------------------------------------------------------
HSP11_CAEEL/42-135--------------------------------------------------------------------------------
HSP16_CAEEL/46-138--------------------------------------------------------------------------------
HSP18_CLOAB/48-151--------------------------------------------------------------------------------
HS176_ARATH/48-153--------------------------------------------------------------------------------
HSP21_MAIZE/56-159--------------------------------------------------------------------------------
HSP23_DROME/63-161--------------------------------------------------------------------------------
HSPB1_CHICK/85-182--------------------------------------------------------------------------------
HSP26_DROME/81-179--------------------------------------------------------------------------------
HSP27_DROME/82-180--------------------------------------------------------------------------------
HS25P_ARATH/130-227--------------------------------------------------------------------------------
HS22C_SOYBN/81-181--------------------------------------------------------------------------------
HS21C_WHEAT/134-238--------------------------------------------------------------------------------
HSP6A_DROME/119-220--------------------------------------------------------------------------------
A8I6R6_CHLRE/50-154--------------------------------------------------------------------------------
F7C8L7_XENTR/32-130--------------------------------------------------------------------------------
I1LC12_SOYBN/73-176--------------------------------------------------------------------------------
ACR_MYCTU/48-140--------------------------------------------------------------------------------
IBPA_SHIDS/42-137--------------------------------------------------------------------------------
Q329C7_SHIDS/41-137--------------------------------------------------------------------------------

PF05455

GVPH2_HALSA/1-163---------------------------------MPTDDP........SDRPSGLLDQLSRLIETLAELDDDNGEQHGHST
GVPH1_HALSA/8-182---------------------------------DASDDQ........SSQLSGLLDQLHTLVEVLADIEEEGGHRHESGR
GVPH_HALMT/36-216---------------------------------DTPDDRPNKTPDRPSDHPSSLLDQLRAILETLAEIE.EDGHRQGHGR

PF08190

KTU_HUMAN/43-348GGDRGAAPGSHWSLPYSLAPGREYAGRSSSRYMVYDVVFHPDALALARRHEGFRQMLDATALEAVEKQF...GVKLDRRN
KTU_DROPS/50-355NPETGGR.GLSWSIPMAQTGGRDDCDAKNNHCKVFDVVFHPDALHLSTRDSQFRKALIDTALDAVEREY...EVALDRAN
KTU_DANRE/39-392DDR.GRS.GHSWRIPYSLTPGRAGRDAAGAPCVLFDAVFHPDALLMAENNARFMTLIHRTATGGIQDNF...RIRLE..H
Q9VK57_DROME/30-332GILESTT.PGSYRVPMSISDPRFTKDRSDKTVDVCDIAINPKFLVKIQKSQLFKNFFMQIVIEAMSEKY...NVQLNMEK
A0DMA1_PARTE/44-380ITQNGQT.GQNWKIPYSIGKIRYDQDKKQNICNTVDVAFHPTTIGLCYKTPNFKNLVCSTALEASGKQLGERNEEIS.KD
A0CTY4_PARTE/36-334DYNN....EVGIRVPMSVGSIKEDHDVKGDTCKVIDLVINPTVATNLTQDDNLKTFFCQLVQTYVDQKY...KLKLQ.DK
E9AFR0_LEIMA/55-423AGQGDTA.EMRYRIPISCGQARPGKDKGGKPCKVYDVIVNPSTMQRCGKDHEFRRFVAALCMQWIKQKS...EPTLNADE
KTU_ANOGA/36-354NED.GTK.GLKWSVPYAQTQPRKDYDNKRVECTVYDVMFHPDALHLASKNEGFRKLLNDTSLDAVEQSF...KVRLDRAN
Q4DT93_TRYCC/46-391D.......EIKFKIPLSCGQARPGTDKSGKPCKVYDVIVNPSTVQRCSKDHEFRCFVVSLCIHWIKQKC...EPTLNHEE
A7SEW3_NEMVE/38-354GTE.RKK.GQQWSIPYSLAQPRDDFDRAGKKCVTFDVVFHPDTYKKCTKMPQFKKMVIETALEGIERQL...NIKLNKKN
Q17BY1_AEDAE/23-351AILNDGT.PSSFKIPMSITQPRFMKDHLDKQCQVCDIAVNSTFFKKIESGGLMRDFLITIVLEGIDSKY...NIALDETD
KTU_AEDAE/38-346NKR.GEK.GLKWSIPYAQSQPRKDYDNKNVDCVVYDVVFHYDTLHLTKSNKNFRKLVTDTALDAVEGAF...HVSLDRVN
Q38DW7_TRYB2/46-377........EVKFRIPLSCGQARAESDKSGKPCKVYDVIVNPSTIHRCTQDHDFRCFVISLCIHWIQQKS...EPTLNLQE
KTU_XENTR/38-353DGE.GKA.GLHWSLPYSLSPGRDDLSKDWSKHVIYDVVFHPDTLHIASKNGKFKGIVDSTALEAVASQF...NVTLDKAN
H3DIW3_TETNG/40-350LED.GRG.TLCWALPHILHPKKQELYRKGHKVTIYDVVFHPETLDLASKNKTFLDMVHDTAIQGIQSAF...SVSLDRNG

PF04969

CYBP_HUMAN/76-156--------NYGW-------------------------------------DQSDKFVKIYITLTGVH.QVPTENVQVHFTE
Q8I542_PLAF7/76-156--------SFAW-------------------------------------NQERNKVTIFLTV.KNVHTVGEEKISTVFEE
NUDC_SCHPO/9-86--------EYEW-------------------------------------DQTIADVDIVIHV.PKG..TRAKSLQVDMSN
Q7RB97_PLAYO/167-241--------KYTW-------------------------------------TQTLGTVDMYIDV.EEF..IKTKDIKVDITF
Q5U3E4_DANRE/132-208--------KHDW-------------------------------------YQTESQVAVTIMVKNAK....KEGVIVSFGE
Q8I2N9_PLAF7/17-92--------IYEW-------------------------------------EQSIDEINIYIDMNSKL..VNKNDLNIEIKS
Y8359_ORYSJ/5-81--------EVKW-------------------------------------AQRIDKVYITVQLADA......KDAKVNLEP
SGT1_YEAST/185-267--------KIDW-------------------------------------YQSSTSVTISLFTVNLP..ESKEQVNIYISP
Q75M67_ORYSJ/5-81--------STKW-------------------------------------AQRSDKVFLTIELPDA......RDVKLNLKP
Q8VXX3_ARATH/19-93--------VFEW-------------------------------------DQTLEEVNMYITL.PPN..VHPKSFHCKIQS
Q7Q5Z9_ANOGA/168-244--------KYSW-------------------------------------TQTLQELELRVPF.DVKFTLKAKDVVVSIQR
CHRD1_DROME/213-291--------RYDW-------------------------------------HQTATNVVMAIYAKKYD....YSQSVIELNP
GIT7_SCHPO/184-261--------RYDW-------------------------------------SQTSFSLNIDIYAKKVK....DEDVSLLMEK
Q7Q5W9_ANOGA/4-76--------KYDW-------------------------------------YQTETAVTVTILLKNAA....DKNYSVQLEQ
Q7PYU2_ANOGA/81-161--------EYAW-------------------------------------DQSDKFIKIFVTV.NGVQQVPEDNVNVEFTE
NUDC_EMENI/32-114--------PYKW-------------------------------------TQTIRDVDVTIPV.SAN..LKGRDLDVVLKK
Q8IN95_DROME/136-213--------THCW-------------------------------------SQTLKDVEVQALL.PKD.HQTAKKLHISIQA
Q57UQ9_TRYB2/137-213--------HYMF-------------------------------------SQTLKEVEVRVPL.LVA.RAKGKDVDVVLQQ
Q5JLZ9_ORYSJ/80-157--------SFSW-------------------------------------DQDAEKIKIYVFL.EG...VEQDKVETTFKP
BOB2_ARATH/134-209--------KYSW-------------------------------------GQNLQEVTINIPM.PEG..TKSRSVTCEIKK
NUDC_MOUSE/171-248--------NYRW-------------------------------------TQTLAELDLAVPF.RVSFRLKGKDVVVDIQR
UBP19_HUMAN/286-374--------NDSY-------------------------------------EKGPDSVVVHVYVKEIC....RDTSRVLFRE
Q8I2V1_PLAF7/85-164--------SYEW-------------------------------------IECDENVEVKIRISPD...INSDDIQYNIKS
Q5CJD2_CRYHO/4-76--------TVLW-------------------------------------AQTKKALFVTVDLPDL......KDYKVELEE
NUDC2_RAT/17-91--------WGQW-------------------------------------YQTLEEVFIEVQV.PPG..TRAQDIQCGLQS
Q9VVA6_DROME/171-248--------NYTW-------------------------------------TQTLEEVELKIPF.NLTFGLRARDLVISIGK
Q9VYT5_DROME/294-367--------SYSW-------------------------------------SQTDNNVLIRFNV.PST..ASAKEFNVSGSK
Q6FKN1_CANGA/178-257--------RTDW-------------------------------------YQSTDKLTVSFFTTILP..ANKDSMDIKIEG
Q584U3_TRYB2/25-100--------RYSF-------------------------------------GQTDTEVIVKVPL.PSD..TPTKMINVDVKV
Q7RGQ2_PLAYO/266-349--------KFDW-------------------------------------RESLDHIELNIPIFDET...NQEDILFQIKN
Q6CJS5_KLULA/181-260--------KMDW-------------------------------------YQSSSTVTLSLFTKNLP..NSKSDVNVSIKG
Q6DBR7_DANRE/227-303--------RHDW-------------------------------------HQTGSQVVVTIYAKNCN....PDHSYVEANR
Q9C8R4_ARATH/77-154--------TFSW-------------------------------------DQDNDKVKMYISL.EG...VDEDKVQAEFKP
Q5CM61_CRYHO/144-218--------KYTW-------------------------------------TQTLGTVEVLIDT.IPG..LKSRDCNINIKT
Q5K7I7_CRYNJ/8-89--------RYDF-------------------------------------YQTPNELILALYIKGYD..KLKDDVKVEFGT
CHRD1_DANRE/228-304--------RFDW-------------------------------------HQTGSQVIISIYAKNSV....PELSLVEGNS
Q59X42_CANAL/219-296--------RDDW-------------------------------------YQSNEEVIITIYAKKVN....EEKLKVEFDT
Q8W065_ORYSJ/19-93--------VFEW-------------------------------------DQTLEEVNMYIEL.PKG..VPTKLFHCAIQA
Q9W3Y3_DROME/69-149--------DYGW-------------------------------------DQSAKFVKLFITL.NGVQGCTEENVTVTYTP
A8BM82_GIAIC/4-77--------TIYW-------------------------------------AQRKDVVYMRLSVSSA......TDVKFKIAE
Q75EE3_ASHGO/168-248--------RMEW-------------------------------------YQTTQKVTISLFVSKLP..RSHSEVIVQVVN
Q6DC89_DANRE/17-91--------WGSW-------------------------------------YQTMEEVYIEVNV.PPG..TSAKEIKCNIGS
NUDC1_MOUSE/275-349--------LYYW-------------------------------------QQSEDDLTVTVRL.PES..STKEDIQIQFLP
CHRD1_PONAB/230-306--------RHDW-------------------------------------HQTGGEVTISVYAKNSL....PELSRVEANS
ITBP2_MOUSE/219-295--------RHDW-------------------------------------HQTDSVVVLTVYGQIPL....PAFNWVKASQ
Q6Z2U7_ORYSJ/207-282--------KYSW-------------------------------------TQERPEVTITIPV.PQG..TKSSLVTYEIMK
NB5R4_RAT/167-245--------SYDW-------------------------------------FQTESSVTIVIYTKQKN..INLDSVIVDLQD
Q5CJI5_CRYHO/85-163--------KYSW-------------------------------------DQSDKSVKIYIDLVGVQ..EKPDCIEIKFGK
Q6CBP8_YARLI/6-81--------HYAW-------------------------------------RQTLQDITITFPV.PPG..TRGKQMDIKFTP
Q8IDW4_PLAF7/214-288--------KYVW-------------------------------------TQSINTLDMYIDT.KDN..IKTKDIKIDITY
Q7RF79_PLAYO/75-155--------SFAW-------------------------------------NQEKNKVTVFLTI.KNIQNINKENIISEFNE
Q7RRD9_PLAYO/3-75--------IVLW-------------------------------------AQKKECLYLTIELQDA......EDVKIDLKE
Q5KJJ7_CRYNJ/248-324--------RLDH-------------------------------------YQTPTQVIVSAFAKGAD....KSRSTITFTP
Q8SSJ3_ENCCU/5-78--------KYTW-------------------------------------DQELNEINIQFPV.TGD..ADSSAIKIRIVG
Q6BXK8_DEBHA/178-255--------RDDW-------------------------------------YQTNDSVIITIYAKNIK....EPELHVQFKP
Q5K7J1_CRYNJ/33-108--------PYSW-------------------------------------TQELATATVTVPL.PKG..TRSKDLEVVIGK
B0S6K3_DANRE/76-155--------NYGW-------------------------------------DQSDKFVKIYITLKGVH.TIPAENVETSFTE
C3ZHN0_BRAFL/18-94--------.VYW-------------------------------------AQRDDVLILTIQVEDID...RDKNRKVTLNE
C8V7I9_EMENI/316-392--------RHEW-------------------------------------YQSNDSVVVTLYAKGVD....KEKVDAEIKS
F1Q6Q1_DANRE/171-250--------KYTW-------------------------------------SQDYTDVEVRVHVEPDI..IKGRQVCVDLQS
F5HGH3_NEUCR/245-328--------RIDF-------------------------------------YQTNQTVTVSLFVKDVK....KEDLKVEFGK
F6WW93_XENTR/418-505--------NDHY-------------------------------------EKGNDVVVVHVYVKEIC....KETSRVLFRE
F6YV35_XENTR/79-156--------..GW-------------------------------------DQSEKFVKIYITLNGVQ.NIPAANVQVHFSE
F6ZRN5_XENTR/19-98--------NYVW-------------------------------------SQDYTDVEIKVPVPKSV..IKGRQVSVDLRS
F7AJ60_XENTR/139-214--------RHDW-------------------------------------YQTESHIIITVMIKNVQ....KNNVHIRFSE
F7DCK1_XENTR/141-218--------HYRW-------------------------------------TQTLSEVDLVVPF.PVSFRLKGKDVQVDIKR
G4U823_NEUT9/194-271--------RTDF-------------------------------------YQTPSSVIASFFLKKIN....KDAAKVEFKP
H3C642_TETNG/318-405--------NDSY-------------------------------------EKGTDLMVVNVYMKGLS....RDTTRVLFRE
K4BEI9_SOLLC/173-248--------RHEF-------------------------------------YQKPEEVVVTIFAKGIP....AKNVVVDFGE
K4BTK3_SOLLC/6-81--------TIKW-------------------------------------AQRSDKLFITVEL.PD.....AKNVKLKLEP
M4E6X8_BRARP/6-81--------TVKW-------------------------------------AQRSDWVYITVEL.PD.....AEDVKLKLEP
Q24K01_BOVIN/186-265--------NYTW-------------------------------------SQDYTDLELKVPV.PKH.VVKGKQVSVTLSS
Q4WN97_ASPFU/37-116--------PYKW-------------------------------------TQTIRDVDVTIPV.PAN..IKGRDLDVVLTK
Q8L7U4_ARATH/6-81--------EVKW-------------------------------------AETTEKIFLTVVLAD......TKDTKVNLDP
V5IRH3_NEUCR/27-105--------PYKW-------------------------------------TQTIGDVDITILV.PGN..LKGKDMVVEIKK
W5CHI3_WHEAT/108-183--------RHDY-------------------------------------YNTPTEVVLTIFAKGVP....ADSVVVDFGE

PF00011

SP21_STIAD/57-157----------EV-------------------------------------RETKEAYIFKADLPGVD--.EK.DIEVTLTG
HSP26_YEAST/96-207----------DI-------------------------------------LDHDNNYELKVVVPGVK--SKK.DIDIEYHQ
HS174_ORYSJ/50-153----------DW-------------------------------------KETPEAHVFKADVPGLK--.KE.EVKVEVED
HSP17_ARATH/52-155----------DW-------------------------------------RETPEAHVFKADVPGLK--.KE.EVKVEVED
18KD_MYCLE/31-129----------DA-------------------------------------WREGEEFVVEFDLPGIK--.AD.SLDIDIER
CRYAB_ANAPL/66-161----------EM-------------------------------------RLEKDKFSVNLDVKHFS--.PE.ELKVKVLG
HSP11_CAEEL/42-135----------EI-------------------------------------VNNDQKFAINLNVSQFK--.PE.DLKINLDG
HSP16_CAEEL/46-138----------EI-------------------------------------VNDESKFSVQLDVSHFK--.PE.NLKIKLDG
HSP18_CLOAB/48-151----------DI-------------------------------------KEDDDKYTVAADLPGVK--.KD.NIELQYEN
HS176_ARATH/48-153----------DV-------------------------------------IEHPNAYAFVVDMPGIK--.GD.EIKVQVEN
HSP21_MAIZE/56-159----------DV-------------------------------------KELPGAYAFVVDMPGLG--.TG.DIKVQVED
HSP23_DROME/63-161----------VS-------------------------------------KIGKDGFQVCMDVSHFK--.PS.ELVVKVQD
HSPB1_CHICK/85-182----------EI-------------------------------------RQSADSWKVTLDVNHFA--.PE.ELVVKTKD
HSP26_DROME/81-179----------TA-------------------------------------HVGKDGFQVCMDVAQFK--.PS.ELNVKVVD
HSP27_DROME/82-180----------LP-------------------------------------AVGKDGFQVCMDVSQFK--.PN.ELTVKVVD
HS25P_ARATH/130-227----------DI-------------------------------------KEEEHEIKMRFDMPGLS--.KE.DVKISVED
HS22C_SOYBN/81-181----------DI-------------------------------------KDEEHEIRMRFDMPGLA--.KE.DVKVSVED
HS21C_WHEAT/134-238----------DI-------------------------------------MEDEKEVKMRFDMPGLS--.RE.EVRVMVED
HSP6A_DROME/119-220----------YS-------------------------------------VVNRNGFQVSMNVKQFA--.AN.ELTVKTID
A8I6R6_CHLRE/50-154----------DI-------------------------------------IESPTAFELHADAPGMG--.PD.DVKVELQE
F7C8L7_XENTR/32-130----------..-------------------------------------KDGKDHFELTLDVRDFS--.PH.ELTVKMQG
I1LC12_SOYBN/73-176----------DW-------------------------------------KETPEGHVIMLDVPGLK--.RE.EIKIEVEE
ACR_MYCTU/48-140----------..-------------------------------------...EGRYEVRAELPGVD--.PDKDVDIMVRD
IBPA_SHIDS/42-137----------..-------------------------------------.VDENHYRIAIAVAGFA--.ES.ELEITAQD
Q329C7_SHIDS/41-137----------..-------------------------------------KSDDNHYRITLALAGFR--.QE.DLEIQLEG

PF05455

GVPH2_HALSA/1-163IDRGRTRIDYDYAVSIGLGSDARSPST----------------------PAGNADDAGDAE...........TAHIETRA
GVPH1_HALSA/8-182IDRGNARIDYDYDVSIGLG.RADGSSY----------------------DEEPSSNRSRSEQRSGQQRTTEDSIHVETRG
GVPH_HALMT/36-216IDRGNAQIDYDYEVSFGLGPRSRRGKP----------------------SDEPRVEAPRTE.GTDSQPEGEKSIHIETRE

PF08190

KTU_HUMAN/43-348AKTL.KAKYKG.TPEAAVLRTPLPGVIPARPDGEPK............GPLPDFPYPYQYPAAPGP..............
KTU_DROPS/50-355LKYP.KLDYKG.IARPTVIRKLAANPTPEEQE....................PHPLEHMYPTKPPASNSEPK........
KTU_DANRE/39-392VTRLKMMKYKG.EPQPTMIRRPNPGQTEAADRGPQQTTGPQQPTGPQQPTDPQQPTDTQQPTDPQQTTGPQQTTGPQQTT
Q9VK57_DROME/30-332TIILNNRKFIG.TLVTHRVRNEDMKRAQSTS.......................GIPAALN.SRDGGAVAPENSGKLVQE
A0DMA1_PARTE/44-380FKVLKHTKCKGGEPALLPVRIDKKGKLTNELD.........................SRQGGQANAQTKLQKDINQMRDE
A0CTY4_PARTE/36-334FISL.KMKYKGKSVQFQRVKGKKPPKV..........................QVIDEKPNQSPVQNNDDEDETEQIRKR
E9AFR0_LEIMA/55-423FRNL.SFKCKG.KLEPQRIRLSTQPKERNVMGD..................EIRLPTAAGSATAPSQVTGSQGNGKLIQE
KTU_ANOGA/36-354LRFP.KLQYKG.TPSSSVVREKLPHCDSLPKD.....................ELFDKLLPPLPNVPAPGKTGSERTTKT
Q4DT93_TRYCC/46-391YRSM.NFKVKG.DLEPQRIRLSTAPKGANAMGD..................EIRLPKDNSAALPPTTVGGRGGTGKLIQE
A7SEW3_NEMVE/38-354LKFP.KMKFKG.MKQATVIRNKSNE........................................NSFKKPNEGITIGDK
Q17BY1_AEDAE/23-351WRVLKNKKFVD.KLTAHNIQNRDVKTVLESYKY..................PTESDLSKIKELETPQLGIDKPKKKLIEE
KTU_AEDAE/38-346LKFP.KLQYKG.VAKMTVIRQKLKNFETRRKD.....................GLIDTLYRASEQSKITHDNSADKEN..
Q38DW7_TRYB2/46-377YRNM.SFRVKG.TLEPQRIRLSTTPKVANALGD..................EIRLPANATAASPVTNVGGRSGTGKLVQE
KTU_XENTR/38-353VRTL.SMKYKG.VPNPSVLRKPLPEASPKSRDLED...............PLCFPYPYDVPTAVGTEKKDQKRVIQKECK
H3DIW3_TETNG/40-350VKEI.RAKCKG.TPQTCVIRKPIPGYQE.........................PPGKSDLPEFPYPDERRQPTSLQTDPT

PF04969

CYBP_HUMAN/76-156.RS...FDLL..........VKNLNG.KS---------------------------------------------------
Q8I542_PLAF7/76-156.RS...FEIK..........MNDVDK.KH---------------------------------------------------
NUDC_SCHPO/9-86.HD...LKIQ..........IN.VPE..R---------------------------------------------------
Q7RB97_PLAYO/167-241.KK...LSIK..........VK.NN....---------------------------------------------------
Q5U3E4_DANRE/132-208.RE...LTAV..........VKLPSG..E---------------------------------------------------
Q8I2N9_PLAF7/17-92.KR...ITIG..........LKNTK....---------------------------------------------------
Y8359_ORYSJ/5-81.EG...VFSF..........SATAGTDGN---------------------------------------------------
SGT1_YEAST/185-267.NDRRTLSIS..........YQVPKS.GS---------------------------------------------------
Q75M67_ORYSJ/5-81.EG...QFIF..........SAKGPADDT---------------------------------------------------
Q8VXX3_ARATH/19-93.KH...IEVG..........IKGNP....---------------------------------------------------
Q7Q5Z9_ANOGA/168-244.KH...LKVG..........LK.GH....---------------------------------------------------
CHRD1_DROME/213-291.IR...LHVN..........LVFPEQDNA---------------------------------------------------
GIT7_SCHPO/184-261.NT...LKIE..........IKLEDG..S---------------------------------------------------
Q7Q5W9_ANOGA/4-76.NT...LTLR..........AD......D---------------------------------------------------
Q7PYU2_ANOGA/81-161.NS...FQLV..........ISDLNN.KD---------------------------------------------------
NUDC_EMENI/32-114.DS...IKVK..........VK.GEN..G---------------------------------------------------
Q8IN95_DROME/136-213.QH...IKVS..........SK.HSP..E---------------------------------------------------
Q57UQ9_TRYB2/137-213.RR...LRVG..........MK.GK....---------------------------------------------------
Q5JLZ9_ORYSJ/80-157.MS...VDTK..........FHDVKG.KN---------------------------------------------------
BOB2_ARATH/134-209.NR...LKVG..........LK.GQ....---------------------------------------------------
NUDC_MOUSE/171-248.RH...LRVG..........LK.GQ....---------------------------------------------------
UBP19_HUMAN/286-374.QD...FTLIFQTRDGNFLRLHPGCGPHT---------------------------------------------------
Q8I2V1_PLAF7/85-164.NY...IYFK..........IRNK....P---------------------------------------------------
Q5CJD2_CRYHO/4-76.QY...LKFH..........ANVEN...N---------------------------------------------------
NUDC2_RAT/17-91.RH...VALA..........VGGRE....---------------------------------------------------
Q9VVA6_DROME/171-248.KS...LKVG..........IK.GQ....---------------------------------------------------
Q9VYT5_DROME/294-367.TT...VVVK..............HL..D---------------------------------------------------
Q6FKN1_CANGA/178-257.LH...LSIS..........YPIPDK.GS---------------------------------------------------
Q584U3_TRYB2/25-100.SS...LTIG..........MK.GQ....---------------------------------------------------
Q7RGQ2_PLAYO/266-349.DY...IKLE..........IMVNGE..K---------------------------------------------------
Q6CJS5_KLULA/181-260.SH...LSIS..........YPIPDK.GS---------------------------------------------------
Q6DBR7_DANRE/227-303.TV...LTCH..........IQFEGD..K---------------------------------------------------
Q9C8R4_ARATH/77-154.MS...LDIK..........IHDVQG.KN---------------------------------------------------
Q5CM61_CRYHO/144-218.NR...LKVV..........VK.GE....---------------------------------------------------
Q5K7I7_CRYNJ/8-89.DS...VIIN..........LPALAPSTE---------------------------------------------------
CHRD1_DANRE/228-304.TV...LKIH..........IIFEGE..K---------------------------------------------------
Q59X42_CANAL/219-296.NS...VSIS..........FPSAAA..S---------------------------------------------------
Q8W065_ORYSJ/19-93.TH...VEVG..........IRGNP....---------------------------------------------------
Q9W3Y3_DROME/69-149.NS...LQLH..........VRDLQG.KD---------------------------------------------------
A8BM82_GIAIC/4-77.ET...IHFA..........CKSGG...N---------------------------------------------------
Q75EE3_ASHGO/168-248GKD...LTVS..........YPITAG.GS---------------------------------------------------
Q6DC89_DANRE/17-91.KQ...IELR..........VKDQQ....---------------------------------------------------
NUDC1_MOUSE/275-349.DN...INIK..........LKDIQ....---------------------------------------------------
CHRD1_PONAB/230-306.TL...LNVH..........IVFEGE..K---------------------------------------------------
ITBP2_MOUSE/219-295.TE...LHVH..........IVFDGN..R---------------------------------------------------
Q6Z2U7_ORYSJ/207-282.NH...LKVG..........LK.GC....---------------------------------------------------
NB5R4_RAT/167-245.DS...LRAE..........AVIKD...H---------------------------------------------------
Q5CJI5_CRYHO/85-163.DN...VEMY..........VKNLDN..K---------------------------------------------------
Q6CBP8_YARLI/6-81.TT...ISAG..........VV.GQ....---------------------------------------------------
Q8IDW4_PLAF7/214-288.KK...LYVK..........VK.NQ....---------------------------------------------------
Q7RF79_PLAYO/75-155.RD...FEIK..........IHNLDL.KN---------------------------------------------------
Q7RRD9_PLAYO/3-75.DS...LYFY..........GTKEK...N---------------------------------------------------
Q5KJJ7_CRYNJ/248-324.QT...LSLS..........LSLPSN..K---------------------------------------------------
Q8SSJ3_ENCCU/5-78.KK...ICVK..........NQ.GE....---------------------------------------------------
Q6BXK8_DEBHA/178-255.NS...VTVS..........FPSSAT..S---------------------------------------------------
Q5K7J1_CRYNJ/33-108.RK...LKVK..........LKSSP....---------------------------------------------------
B0S6K3_DANRE/76-155.RG...FNTL..........VKDLDG.KN---------------------------------------------------
C3ZHN0_BRAFL/18-94.KS...LSFS..........GKGGAE.NK---------------------------------------------------
C8V7I9_EMENI/316-392.DS...VSVQ..........FPLPSG..A---------------------------------------------------
F1Q6Q1_DANRE/171-250.SR...VSVS..........VADGGS..R---------------------------------------------------
F5HGH3_NEUCR/245-328.RQ...VRISPIPR.EAAPYVK.PGD..R---------------------------------------------------
F6WW93_XENTR/418-505.QD...FTLIFKTRDPNFLRLHPNCTPDT---------------------------------------------------
F6YV35_XENTR/79-156.RS...FELL..........VKDLDG.KN---------------------------------------------------
F6ZRN5_XENTR/19-98.SC...IRVA..........VREGGG..E---------------------------------------------------
F7AJ60_XENTR/139-214.RE...LTVN..........MSLPSG..E---------------------------------------------------
F7DCK1_XENTR/141-218.HR...LTIG..........LR.GQ....---------------------------------------------------
G4U823_NEUT9/194-271.NS...IVLD..........LPTTDSPVK---------------------------------------------------
H3C642_TETNG/318-405.QH...FTLFFQTSDGNFLRLHSDCGPNT---------------------------------------------------
K4BEI9_SOLLC/173-248.QI...LSVS..........IDVPGE..E---------------------------------------------------
K4BTK3_SOLLC/6-81.EG...KFLF..........SATAGADNV---------------------------------------------------
M4E6X8_BRARP/6-81.EG..KLFFS..........ATSGAS.KT---------------------------------------------------
Q24K01_BOVIN/186-265.SS...IRVA..........VLEGNG..E---------------------------------------------------
Q4WN97_ASPFU/37-116.TK...IKVA..........IK.GQ....---------------------------------------------------
Q8L7U4_ARATH/6-81.EG..VFDFS..........AKVGPE.NH---------------------------------------------------
V5IRH3_NEUCR/27-105.QS...LTAG..........IK.GQ....---------------------------------------------------
W5CHI3_WHEAT/108-183.QM...LSVS..........IELPGE..E---------------------------------------------------

PF00011

SP21_STIAD/57-157-DR..VSVSGKRER...EKREESERFYAYERSFG----------------------------------------------
HSP26_YEAST/96-207-NKNQILVSGEIPS..TLNEESKDKVKVKESSSG----------------------------------------------
HS174_ORYSJ/50-153-GN..VLQISGERI..KEQEEKTDKWHRVERSSG----------------------------------------------
HSP17_ARATH/52-155-GN..ILQISGERS..SENEEKSDTWHRVERSSG----------------------------------------------
18KD_MYCLE/31-129-NV..VTVRAERP.....GVDPDREMLAAERPRG----------------------------------------------
CRYAB_ANAPL/66-161-DM..VEIHGKHE......ERQDEHGFIA....R----------------------------------------------
HSP11_CAEEL/42-135-HT..LSIQGEQE.......LKTEHGYSK....K----------------------------------------------
HSP16_CAEEL/46-138-RE..LKIEGIQE.......TKSEHGYLK....R----------------------------------------------
HSP18_CLOAB/48-151-NY..LTINAKRDDI.VETKDDNNNFVRRERSYG----------------------------------------------
HS176_ARATH/48-153-DN..VLVVSGERQR.ENKENEGVKYVRMERRMG----------------------------------------------
HSP21_MAIZE/56-159-ER..VLVISGERR...REEREDAKYLRMERRMG----------------------------------------------
HSP23_DROME/63-161-NS..VLVEGNHE......EREDDHGFIT....R----------------------------------------------
HSPB1_CHICK/85-182-NI..VEITGKHE......EKQDEHGFIS....R----------------------------------------------
HSP26_DROME/81-179-DS..ILVEGKHE......ERQDDHGHIM....R----------------------------------------------
HSP27_DROME/82-180-NT..VVVEGKHE......EREDGHGMIQ....R----------------------------------------------
HS25P_ARATH/130-227-NV..LVIKGEQK.......KEDSDDSWSGRSVS----------------------------------------------
HS22C_SOYBN/81-181-DM..LVIKGGHK....SEQEHGGDDSWSSRTYS----------------------------------------------
HS21C_WHEAT/134-238-DA..LVIRGEHKKEAGEGQGEGGDGWWKERSVS----------------------------------------------
HSP6A_DROME/119-220-NC..IVVEGQHD......EKEDGHGVIS....R----------------------------------------------
A8I6R6_CHLRE/50-154-GV..LMVTGERKLS.HTTKEAGGKVWRSERTAY----------------------------------------------
F7C8L7_XENTR/32-130-RR..VIVTGKHE......RKSDSEDGSYVHEYR----------------------------------------------
I1LC12_SOYBN/73-176-NR..VLRVSGERK..KEEEKKGDHWHRVERSYG----------------------------------------------
ACR_MYCTU/48-140-GQ..LTIKAERT.......EQKDFDGRSEFAYG----------------------------------------------
IBPA_SHIDS/42-137-NL..LVVKGAHA.....DEQKERTYLYQGIAER----------------------------------------------
Q329C7_SHIDS/41-137-TR..LSVKGTPE.....QPKEEKKWLHQGLMNQ----------------------------------------------

PF05455

GVPH2_HALSA/1-163SDDSDDLVVVADLPGVTDETAVDAAVE.D---------------------------------------------------
GVPH1_HALSA/8-182GTSGDELVVVADLPGVTDDD.VDVALDTD---------------------------------------------------
GVPH_HALMT/36-216TDDG.ERVVIADLPGVADDE.LDVTLDAD---------------------------------------------------

PF08190

KTU_HUMAN/43-348..........................RAPSPPEAALQPAPTEPRY......SVVQRHHVDLQDYRCS.RDSA.PSPVPHE
KTU_DROPS/50-355..........................ILPMKTKAAPVPEFAVPKY......SIKQSHDVDLSEYTDE.LDAKLHVTVPRS
KTU_DANRE/39-392GPHQPTDPQQTTGPQQPTDPQQPTGPHQPTDPQQTTDPPPTAPQY......RLKYRSVLDLQDYRCC.RDSG.SAGRPTA
Q9VK57_DROME/30-332I..............DEKDAAAIRKSRQSAGGG......FLDIQY................KLRGRV......RDESVDE
A0DMA1_PARTE/44-380N..EKIKEEEKLKQQQQKEQQAEEEEDIKKESDEIESTAVSRPKY......RFIYSYPVEYSDFLDS..RANMSIKLPNQ
A0CTY4_PARTE/36-334Q.........................REEFEKQSISTQPPAFVTY......EPEWELYLIYPNNEQE.YDGDLDYNAIKQ
E9AFR0_LEIMA/55-423VLPPTN.........TNAGPSASSTEAATPGTA......ALKPEPV...VKSVIAEGVYSWALHKRPTSNPYFKENVPSY
KTU_ANOGA/36-354K................NKENINRTAAVAAAAASPGNPFYTTPEY......KIVQCRDVEYGEMTNE.LDAKIDVTIPRE
Q4DT93_TRYCC/46-391VTNPAIA......SDAVSSPQAAVPATSTTTTAAESSA.ASKEERIAPSLVKLQGEGIYDWSRHVKPVLNPYFRENIPAT
A7SEW3_NEMVE/38-354TIPYPYADQPTCANKQAHKSRTPGQITSKVKDNNADTRDPRNPEY......TILHRGIIDFQNFTNA.RDSC.TSTRPKE
Q17BY1_AEDAE/23-351I..............DPVTIKTMKDVKNKLSGKDEYVPDPTKVAI......SQAASKKPDCRLFREP......ASGRVKT
KTU_AEDAE/38-346..........................VNKQTFKSASQLEYTTPAY......KLIHRKEVEYHELTGE.LDAKLDAAIPKE
Q38DW7_TRYB2/46-377I..............TDAPAPAAAPAPPPTVNS......PSPPEEPKPSVMRVESEGIYDWSTHSKPTINPYFRETVPAA
KTU_XENTR/38-353Q.........................HLVTPEQDPNVQVAATPNY......TVRHRSYVDLQDFRDS.RDST.PSPVPKE
H3DIW3_TETNG/40-350GPAVP....................TRSCAAGPRVQTKEPAKPKY......TVRYRSYVDIQDFRRS.RNSA.QSPRPKE

PF04969

CYBP_HUMAN/76-156--------------------------------------------------------------------------------
Q8I542_PLAF7/76-156--------------------------------------------------------------------------------
NUDC_SCHPO/9-86--------------------------------------------------------------------------------
Q7RB97_PLAYO/167-241--------------------------------------------------------------------------------
Q5U3E4_DANRE/132-208--------------------------------------------------------------------------------
Q8I2N9_PLAF7/17-92--------------------------------------------------------------------------------
Y8359_ORYSJ/5-81--------------------------------------------------------------------------------
SGT1_YEAST/185-267--------------------------------------------------------------------------------
Q75M67_ORYSJ/5-81--------------------------------------------------------------------------------
Q8VXX3_ARATH/19-93--------------------------------------------------------------------------------
Q7Q5Z9_ANOGA/168-244--------------------------------------------------------------------------------
CHRD1_DROME/213-291--------------------------------------------------------------------------------
GIT7_SCHPO/184-261--------------------------------------------------------------------------------
Q7Q5W9_ANOGA/4-76--------------------------------------------------------------------------------
Q7PYU2_ANOGA/81-161--------------------------------------------------------------------------------
NUDC_EMENI/32-114--------------------------------------------------------------------------------
Q8IN95_DROME/136-213--------------------------------------------------------------------------------
Q57UQ9_TRYB2/137-213--------------------------------------------------------------------------------
Q5JLZ9_ORYSJ/80-157--------------------------------------------------------------------------------
BOB2_ARATH/134-209--------------------------------------------------------------------------------
NUDC_MOUSE/171-248--------------------------------------------------------------------------------
UBP19_HUMAN/286-374--------------------------------------------------------------------------------
Q8I2V1_PLAF7/85-164--------------------------------------------------------------------------------
Q5CJD2_CRYHO/4-76--------------------------------------------------------------------------------
NUDC2_RAT/17-91--------------------------------------------------------------------------------
Q9VVA6_DROME/171-248--------------------------------------------------------------------------------
Q9VYT5_DROME/294-367--------------------------------------------------------------------------------
Q6FKN1_CANGA/178-257--------------------------------------------------------------------------------
Q584U3_TRYB2/25-100--------------------------------------------------------------------------------
Q7RGQ2_PLAYO/266-349--------------------------------------------------------------------------------
Q6CJS5_KLULA/181-260--------------------------------------------------------------------------------
Q6DBR7_DANRE/227-303--------------------------------------------------------------------------------
Q9C8R4_ARATH/77-154--------------------------------------------------------------------------------
Q5CM61_CRYHO/144-218--------------------------------------------------------------------------------
Q5K7I7_CRYNJ/8-89--------------------------------------------------------------------------------
CHRD1_DANRE/228-304--------------------------------------------------------------------------------
Q59X42_CANAL/219-296--------------------------------------------------------------------------------
Q8W065_ORYSJ/19-93--------------------------------------------------------------------------------
Q9W3Y3_DROME/69-149--------------------------------------------------------------------------------
A8BM82_GIAIC/4-77--------------------------------------------------------------------------------
Q75EE3_ASHGO/168-248--------------------------------------------------------------------------------
Q6DC89_DANRE/17-91--------------------------------------------------------------------------------
NUDC1_MOUSE/275-349--------------------------------------------------------------------------------
CHRD1_PONAB/230-306--------------------------------------------------------------------------------
ITBP2_MOUSE/219-295--------------------------------------------------------------------------------
Q6Z2U7_ORYSJ/207-282--------------------------------------------------------------------------------
NB5R4_RAT/167-245--------------------------------------------------------------------------------
Q5CJI5_CRYHO/85-163--------------------------------------------------------------------------------
Q6CBP8_YARLI/6-81--------------------------------------------------------------------------------
Q8IDW4_PLAF7/214-288--------------------------------------------------------------------------------
Q7RF79_PLAYO/75-155--------------------------------------------------------------------------------
Q7RRD9_PLAYO/3-75--------------------------------------------------------------------------------
Q5KJJ7_CRYNJ/248-324--------------------------------------------------------------------------------
Q8SSJ3_ENCCU/5-78--------------------------------------------------------------------------------
Q6BXK8_DEBHA/178-255--------------------------------------------------------------------------------
Q5K7J1_CRYNJ/33-108--------------------------------------------------------------------------------
B0S6K3_DANRE/76-155--------------------------------------------------------------------------------
C3ZHN0_BRAFL/18-94--------------------------------------------------------------------------------
C8V7I9_EMENI/316-392--------------------------------------------------------------------------------
F1Q6Q1_DANRE/171-250--------------------------------------------------------------------------------
F5HGH3_NEUCR/245-328--------------------------------------------------------------------------------
F6WW93_XENTR/418-505--------------------------------------------------------------------------------
F6YV35_XENTR/79-156--------------------------------------------------------------------------------
F6ZRN5_XENTR/19-98--------------------------------------------------------------------------------
F7AJ60_XENTR/139-214--------------------------------------------------------------------------------
F7DCK1_XENTR/141-218--------------------------------------------------------------------------------
G4U823_NEUT9/194-271--------------------------------------------------------------------------------
H3C642_TETNG/318-405--------------------------------------------------------------------------------
K4BEI9_SOLLC/173-248--------------------------------------------------------------------------------
K4BTK3_SOLLC/6-81--------------------------------------------------------------------------------
M4E6X8_BRARP/6-81--------------------------------------------------------------------------------
Q24K01_BOVIN/186-265--------------------------------------------------------------------------------
Q4WN97_ASPFU/37-116--------------------------------------------------------------------------------
Q8L7U4_ARATH/6-81--------------------------------------------------------------------------------
V5IRH3_NEUCR/27-105--------------------------------------------------------------------------------
W5CHI3_WHEAT/108-183--------------------------------------------------------------------------------

PF00011

SP21_STIAD/57-157--------------------------------------------------------------------------------
HSP26_YEAST/96-207--------------------------------------------------------------------------------
HS174_ORYSJ/50-153--------------------------------------------------------------------------------
HSP17_ARATH/52-155--------------------------------------------------------------------------------
18KD_MYCLE/31-129--------------------------------------------------------------------------------
CRYAB_ANAPL/66-161--------------------------------------------------------------------------------
HSP11_CAEEL/42-135--------------------------------------------------------------------------------
HSP16_CAEEL/46-138--------------------------------------------------------------------------------
HSP18_CLOAB/48-151--------------------------------------------------------------------------------
HS176_ARATH/48-153--------------------------------------------------------------------------------
HSP21_MAIZE/56-159--------------------------------------------------------------------------------
HSP23_DROME/63-161--------------------------------------------------------------------------------
HSPB1_CHICK/85-182--------------------------------------------------------------------------------
HSP26_DROME/81-179--------------------------------------------------------------------------------
HSP27_DROME/82-180--------------------------------------------------------------------------------
HS25P_ARATH/130-227--------------------------------------------------------------------------------
HS22C_SOYBN/81-181--------------------------------------------------------------------------------
HS21C_WHEAT/134-238--------------------------------------------------------------------------------
HSP6A_DROME/119-220--------------------------------------------------------------------------------
A8I6R6_CHLRE/50-154--------------------------------------------------------------------------------
F7C8L7_XENTR/32-130--------------------------------------------------------------------------------
I1LC12_SOYBN/73-176--------------------------------------------------------------------------------
ACR_MYCTU/48-140--------------------------------------------------------------------------------
IBPA_SHIDS/42-137--------------------------------------------------------------------------------
Q329C7_SHIDS/41-137--------------------------------------------------------------------------------

PF05455

GVPH2_HALSA/1-163--------------------------------------------------------------------------------
GVPH1_HALSA/8-182--------------------------------------------------------------------------------
GVPH_HALMT/36-216--------------------------------------------------------------------------------

PF08190

KTU_HUMAN/43-348LVITIELPLLRSAEQAALEVTRKLLCLDSRKP...............................DYRLR...LS-LPY--P
KTU_DROPS/50-355LVVEIELPLLRSTAECQLDVTAKSVYLLSERLG.............................AKYRLK...LD-LPF--V
KTU_DANRE/39-392IIIEVEVPRLRSAQEAELRVEERRLLLEAPTA...............................EYRLE...LP-LAY--P
Q9VK57_DROME/30-332IHAEIYLPNYVSSQEFSLLVGEDRIVVETRKY...............................GYVFN...KF-VNY--R
A0DMA1_PARTE/44-380LACDLKMQKVEAMKEIQLDLSNQGLVLDVPN................................KYFLD...IK-LPY--P
A0CTY4_PARTE/36-334YRFQILTPLLITGKAIKLKVDEEQFQMVAGK................................FYKIS...LR-FPS--K
E9AFR0_LEIMA/55-423FAITLYLPGVQTIREVDVRIGYRRVDCYYIDEVADGEERDEEAAASAEGGERGAAAANKGSGASPFLS...LT-LDY--P
KTU_ANOGA/36-354LKVVITLPLLKSTAECALDVTKTTLHLVSEKP..............................ARYKLE...LK-LPY--E
Q4DT93_TRYCC/46-391YAVEVCIPTVTSIAEVEVRITPRSIEISYVD.AE...........................DGAPFLS...IP-LDY--P
A7SEW3_NEMVE/38-354LVIRIDLPDL.ALNHCKYRYSAFSRCC....................................QFFLDICHIT-LPY--P
Q17BY1_AEDAE/23-351LIGEFYLPECTSAKEITLDIGEDRILLEARKK...............................GYLLD...AF-VDY--Q
KTU_AEDAE/38-346LVLVIELPLLKSANQCTLNVTSSEVHLISDSP..............................AKYKLE...VK-LPY--T
Q38DW7_TRYB2/46-377YLVELHIPTVTTIAEVDVRVSPKRIELLYVD.CE...........................DGVPFLT...VP-LGY--P
KTU_XENTR/38-353LVITVDLPLLNSAAGVNLHIAGKNLSLESEKP...............................AYKLN...VK-LPY--A
H3DIW3_TETNG/40-350IVVTIDVPLLKEVTGARVEARERMLLLESESP...............................AYRLE...LP-LAY--P

PF04969

CYBP_HUMAN/76-156---------------------------------------------------------------YSMIV---NN.LLK--P
Q8I542_PLAF7/76-156---------------------------------------------------------------YRFCI---KK.LCD--K
NUDC_SCHPO/9-86---------------------------------------------------------------KVLLS---GP.LEK--Q
Q7RB97_PLAYO/167-241---------------------------------------------------------------I.YIE---GE.FHK--H
Q5U3E4_DANRE/132-208---------------------------------------------------------------DYCLK---VH.LLH--P
Q8I2N9_PLAF7/17-92---------------------------------------------------------------.NFLE---GE.LFS--I
Y8359_ORYSJ/5-81---------------------------------------------------------------LYESK---LE.LND--K
SGT1_YEAST/185-267---------------------------------------------------------------EFQYN---AK.LSH--E
Q75M67_ORYSJ/5-81---------------------------------------------------------------PYELD---LE.LFD--A
Q8VXX3_ARATH/19-93---------------------------------------------------------------.PYLN---HD.LSA--P
Q7Q5Z9_ANOGA/168-244---------------------------------------------------------------PAIID---GE.LCS--E
CHRD1_DROME/213-291---------------------------------------------------------------RFDLD---LE.LRG--I
GIT7_SCHPO/184-261---------------------------------------------------------------IFSLV---LDPLYE--E
Q7Q5W9_ANOGA/4-76---------------------------------------------------------------TEPLV---LT.LWN--P
Q7PYU2_ANOGA/81-161---------------------------------------------------------------YIFVV---NN.LLN--S
NUDC_EMENI/32-114---------------------------------------------------------------EVFID---GQ.FPH--P
Q8IN95_DROME/136-213---------------------------------------------------------------TIILE---GN.LSQ--R
Q57UQ9_TRYB2/137-213---------------------------------------------------------------PPIVD---GE.LFA--S
Q5JLZ9_ORYSJ/80-157---------------------------------------------------------------YRCAI---PK.LHK--E
BOB2_ARATH/134-209---------------------------------------------------------------DLIVD---GE.FFN--S
NUDC_MOUSE/171-248---------------------------------------------------------------PPVVD---GE.LYN--E
UBP19_HUMAN/286-374---------------------------------------------------------------TFRWQ---VK.LRN--L
Q8I2V1_PLAF7/85-164---------------------------------------------------------------KSLIE---GK.LKG--S
Q5CJD2_CRYHO/4-76---------------------------------------------------------------EYEFK---LD.FLK--P
NUDC2_RAT/17-91---------------------------------------------------------------..ILK---GK.LFD--S
Q9VVA6_DROME/171-248---------------------------------------------------------------TPIID---GE.LCG--E
Q9VYT5_DROME/294-367---------------------------------------------------------------EVIFD---EE.LYA--S
Q6FKN1_CANGA/178-257---------------------------------------------------------------EFQYN---ID.LAH--N
Q584U3_TRYB2/25-100---------------------------------------------------------------SPLIS---GD.LYK--P
Q7RGQ2_PLAYO/266-349---------------------------------------------------------------IILLD---HK.LCG--K
Q6CJS5_KLULA/181-260---------------------------------------------------------------EFQYS---IM.LSH--N
Q6DBR7_DANRE/227-303---------------------------------------------------------------VFHKD---IH.LWG--V
Q9C8R4_ARATH/77-154---------------------------------------------------------------YRCAI---PK.LCK--E
Q5CM61_CRYHO/144-218---------------------------------------------------------------V.IID---GE.LNS--K
Q5K7I7_CRYNJ/8-89---------------------------------------------------------------EQRIA---LKPLAS--T
CHRD1_DANRE/228-304---------------------------------------------------------------EFEKQ---IS.LWG--V
Q59X42_CANAL/219-296---------------------------------------------------------------EYNYY---LDPLFA--E
Q8W065_ORYSJ/19-93---------------------------------------------------------------.PYLN---HD.LTL--P
Q9W3Y3_DROME/69-149---------------------------------------------------------------FGLTV---NN.LLH--S
A8BM82_GIAIC/4-77---------------------------------------------------------------DYACK---LT.LFA--P
Q75EE3_ASHGO/168-248---------------------------------------------------------------EFQYS---LT.LAH--P
Q6DC89_DANRE/17-91---------------------------------------------------------------..IFK---GK.LFG--S
NUDC1_MOUSE/275-349---------------------------------------------------------------..VLE---GK.LYS--S
CHRD1_PONAB/230-306---------------------------------------------------------------EFEQN---VK.LWG--V
ITBP2_MOUSE/219-295---------------------------------------------------------------VFQAQ---MK.LWG--V
Q6Z2U7_ORYSJ/207-282---------------------------------------------------------------SFIID---GE.LFE--P
NB5R4_RAT/167-245---------------------------------------------------------------SYLIH---IG.LSH--E
Q5CJI5_CRYHO/85-163---------------------------------------------------------------FYSFT---VK.LHD--T
Q6CBP8_YARLI/6-81---------------------------------------------------------------PPVLQ---GD.LFG--K
Q8IDW4_PLAF7/214-288---------------------------------------------------------------.VLID---GE.FFK--Q
Q7RF79_PLAYO/75-155---------------------------------------------------------------YRFCI---KK.LYD--K
Q7RRD9_PLAYO/3-75---------------------------------------------------------------EYEFT---LN.FLK--P
Q5KJJ7_CRYNJ/248-324---------------------------------------------------------------RVLKT---VT.LYG--P
Q8SSJ3_ENCCU/5-78---------------------------------------------------------------.IVID---GE.LLH--E
Q6BXK8_DEBHA/178-255---------------------------------------------------------------EYNYN---LEPLFA--E
Q5K7J1_CRYNJ/33-108---------------------------------------------------------------SSILE---GE.LYN--D
B0S6K3_DANRE/76-155---------------------------------------------------------------HQMTI---NN.LLF--P
C3ZHN0_BRAFL/18-94---------------------------------------------------------------DYKCD---IT.FFK--D
C8V7I9_EMENI/316-392---------------------------------------------------------------DYAFN---LDPLFA--S
F1Q6Q1_DANRE/171-250---------------------------------------------------------------KVLLD---GE.FTH--R
F5HGH3_NEUCR/245-328---------------------------------------------------------------QATST---LV.LAG--E
F6WW93_XENTR/418-505---------------------------------------------------------------VFRWQ---VK.LRN--L
F6YV35_XENTR/79-156---------------------------------------------------------------HTMTV---NN.LLK--P
F6ZRN5_XENTR/19-98---------------------------------------------------------------RVLVE---GS.FTH--K
F7AJ60_XENTR/139-214---------------------------------------------------------------NYSLN---LH.LLH--A
F7DCK1_XENTR/141-218---------------------------------------------------------------KPVLD---GE.LFN--D
G4U823_NEUT9/194-271---------------------------------------------------------------RYKTE---VS.LFG--P
H3C642_TETNG/318-405---------------------------------------------------------------HFKWQ---VK.LRN--L
K4BEI9_SOLLC/173-248---------------------------------------------------------------TYSFQ---PR.LFG--K
K4BTK3_SOLLC/6-81---------------------------------------------------------------PYEVD---LD.LFD--K
M4E6X8_BRARP/6-81---------------------------------------------------------------LYEVD---LD.LLD--S
Q24K01_BOVIN/186-265---------------------------------------------------------------RVLME---GK.FTH--K
Q4WN97_ASPFU/37-116---------------------------------------------------------------EALIE---GD.FPH--P
Q8L7U4_ARATH/6-81---------------------------------------------------------------VYELK---LE.LAD--K
V5IRH3_NEUCR/27-105---------------------------------------------------------------EPVIK---GD.LPH--P
W5CHI3_WHEAT/108-183---------------------------------------------------------------PYHFQ---PR.LFS--K

PF00011

SP21_STIAD/57-157---------------------------------------------------------------SFSRA---FT-LPE..G
HSP26_YEAST/96-207---------------------------------------------------------------KFKRV---IT-LPDYPG
HS174_ORYSJ/50-153---------------------------------------------------------------KFLRR---FR-LPE..N
HSP17_ARATH/52-155---------------------------------------------------------------KFMRR---FR-LPE..N
18KD_MYCLE/31-129---------------------------------------------------------------VFNRQ---LV-LGE..N
CRYAB_ANAPL/66-161---------------------------------------------------------------EFNRK---YR-IPA..D
HSP11_CAEEL/42-135---------------------------------------------------------------SFSRV---IL-LPE..D
HSP16_CAEEL/46-138---------------------------------------------------------------SFSKM---IL-LPE..D
HSP18_CLOAB/48-151---------------------------------------------------------------ELRRS---FY-V.D..N
HS176_ARATH/48-153---------------------------------------------------------------KFMRK---FQ-LPE..N
HSP21_MAIZE/56-159---------------------------------------------------------------KFMRK---FV-LPD..N
HSP23_DROME/63-161---------------------------------------------------------------HFVRR---YA-LPP..G
HSPB1_CHICK/85-182---------------------------------------------------------------CFTRK---YT-LPP..G
HSP26_DROME/81-179---------------------------------------------------------------HFVRR---YK-VPD..G
HSP27_DROME/82-180---------------------------------------------------------------HFVRK---YT-LPK..G
HS25P_ARATH/130-227---------------------------------------------------------------SYGTR---LQ-LPD..N
HS22C_SOYBN/81-181---------------------------------------------------------------SYDTR---LK-LPD..N
HS21C_WHEAT/134-238---------------------------------------------------------------SYDMR---LA-LPD..E
HSP6A_DROME/119-220---------------------------------------------------------------HFIRK---YI-LPK..G
A8I6R6_CHLRE/50-154---------------------------------------------------------------SFSRA---FS-LPE..N
F7C8L7_XENTR/32-130---------------------------------------------------------------QWKRE---AE-LPE..G
I1LC12_SOYBN/73-176---------------------------------------------------------------KFWRQ---FR-LPQ..N
ACR_MYCTU/48-140---------------------------------------------------------------SFVRT---VS-LPV..G
IBPA_SHIDS/42-137---------------------------------------------------------------NFERK---FQ-L.....
Q329C7_SHIDS/41-137---------------------------------------------------------------PFSLS---FT-L.....

PF05455

GVPH2_HALSA/1-163---------------------------------------------------------------TGALTISVGDDVVE--R
GVPH1_HALSA/8-182---------------------------------------------------------------EQALTLRVDDDVVE--R
GVPH_HALMT/36-216---------------------------------------------------------------ESALELRTDEGIVG--R

PF08190

KTU_HUMAN/43-348VDDGRGKAQFNKA----RRQLVVTLPV-------------------
KTU_DROPS/50-355VDDKAGNARFDTE----KRRLSITLPV-------------------
KTU_DANRE/39-392VEEERAEAQFNHT----HRLLTVTLPV-------------------
Q9VK57_DROME/30-332LQQDRAQALFDKT----TKMLHVRIPV-------------------
A0DMA1_PARTE/44-380IEQTEASAKFDAK----SKTLKIRAPI-------------------
A0CTY4_PARTE/36-334INKSSVKALFLTE----KRTLWISADV-------------------
E9AFR0_LEIMA/55-423VSDDVVEAKYVRK----TSLLKLKLAV-------------------
KTU_ANOGA/36-354VKESEGKATFNVE----ARSLTVTLPV-------------------
Q4DT93_TRYCC/46-391IDEDAPNAKFVRK----THMLKMQLLV-------------------
A7SEW3_NEMVE/38-354IDENKGSAKFDKS----KQQLVVTLLV-------------------
Q17BY1_AEDAE/23-351IDGSRISAQFNTK----TKMLNVIMPV-------------------
KTU_AEDAE/38-346VLEKNGSAKFNTD----ETTLTVLLPV-------------------
Q38DW7_TRYB2/46-377IDEELQDAKFVRK----TRTLKLKLRV-------------------
KTU_XENTR/38-353VEDNQGKAQFNKV----KKQLIITVPV-------------------
H3DIW3_TETNG/40-350VDEEKGEAKFSKQ----KGQLTVTLPV-------------------

PF04969

CYBP_HUMAN/76-156ISVEGSSKKVKTD......TVLILCRK-------------------
Q8I542_PLAF7/76-156IIPNKCSFKVKKD......SVHVTLVK-------------------
NUDC_SCHPO/9-86INLDESTWTVEEQ.....ERLVIHLEK-------------------
Q7RB97_PLAYO/167-241IKPEDSIWTLEDN.....RIIHISIEK-------------------
Q5U3E4_DANRE/132-208IVPQQSTYKILST......KIEIKMKK-------------------
Q8I2N9_PLAF7/17-92IDEDCSYWFIEDN......NLHILLTK-------------------
Y8359_ORYSJ/5-81VNVEESKISVGVR......SIFCIVEK-------------------
SGT1_YEAST/185-267VDPKAVSLKIFPK......KLEITLSK-------------------
Q75M67_ORYSJ/5-81VNVEESKAAVAAR......SICYLIKK-------------------
Q8VXX3_ARATH/19-93VKTDCSFWTLEDD......IMHITLQK-------------------
Q7Q5Z9_ANOGA/168-244IKIEDSLWHLEKN......AVVVTVEK-------------------
CHRD1_DROME/213-291VNVSNASAHMYGT......KVEIKLPK-------------------
GIT7_SCHPO/184-261IVPEKSSFKLFSS......KVEITLIK-------------------
Q7Q5W9_ANOGA/4-76INTEQSTHKATPS......KVEVKLAK-------------------
Q7PYU2_ANOGA/81-161IDAEKSYRRVKSD......MVAIYLAK-------------------
NUDC_EMENI/32-114IKPSESSWTLETTSKPPGKEVSIHLDK-------------------
Q8IN95_DROME/136-213IKHKEAVWTIDQN......RLIISYDK-------------------
Q57UQ9_TRYB2/137-213VKTEESMWTIEDG.....HTVVVTLTK-------------------
Q5JLZ9_ORYSJ/80-157IVPEKCKVLVKPT......KIIVTLYK-------------------
BOB2_ARATH/134-209VKPDDCFWNIEDQ.....KMISVLLTK-------------------
NUDC_MOUSE/171-248VKVEESSWLIEDG.....KVVTVHLEK-------------------
UBP19_HUMAN/286-374IEPEQCTFCFTAS......RIDICLRK-------------------
Q8I2V1_PLAF7/85-164VDVNFSTWFLEKQKD..CNILNIVLKK-------------------
Q5CJD2_CRYHO/4-76INKEESRYQVTR.......SLHFMITK-------------------
NUDC2_RAT/17-91TIADEGTWTLEDR.....KMVRIVLTK-------------------
Q9VVA6_DROME/171-248VKTEESVWVLQDS.....KTVMITLDK-------------------
Q9VYT5_DROME/294-367VGDDLSAFKLAEN......GLELSLTK-------------------
Q6FKN1_CANGA/178-257VDPQEYSVIVMSK......KFEITFKK-------------------
Q584U3_TRYB2/25-100VKVDECTWCVEDK.....SVLVVTLVK-------------------
Q7RGQ2_PLAYO/266-349ICCDDAYWVITKDYKINEKHIHLVLSK-------------------
Q6CJS5_KLULA/181-260VDPTAIQVSVFTK......KLEVTLGK-------------------
Q6DBR7_DANRE/227-303IDVKSSLVNMVPS......KVEVSMRK-------------------
Q9C8R4_ARATH/77-154IMPEKCKVLVKPK......RIVITMVK-------------------
Q5CM61_CRYHO/144-218VKPDDCLWSIIDG.....KTIQIVLEK-------------------
Q5K7I7_CRYNJ/8-89LSPGSSTYRVLGT......KIELKLAK-------------------
CHRD1_DANRE/228-304IDPSKSLVNMMAT......KIEIVLKK-------------------
Q59X42_CANAL/219-296IVPSESKYKVYST......KLEITLKK-------------------
Q8W065_ORYSJ/19-93VKTDSSFWTIEDG......EMHITLQK-------------------
Q9W3Y3_DROME/69-149IDVEKSYRKIKTD......MVAIYLQK-------------------
A8BM82_GIAIC/4-77INPDESKYKVTGP......CIESILQK-------------------
Q75EE3_ASHGO/168-248VDSECYSVVVLTK......KVEVVLQK-------------------
Q6DC89_DANRE/17-91TVCDEATWTLEDK.....KLIRIVLMK-------------------
NUDC1_MOUSE/275-349IDHEGSTWTIKEN.....DSLEISLIK-------------------
CHRD1_PONAB/230-306IDVKRSYVTMTAT......KIEITMRK-------------------
ITBP2_MOUSE/219-295INVEQSSVSLMPS......RVEISLVK-------------------
Q6Z2U7_ORYSJ/207-282VKVNDCLWTIEDG.....NTLSILLTK-------------------
NB5R4_RAT/167-245VQENFSVRVIENV.....GKIEIVLQK-------------------
Q5CJI5_CRYHO/85-163ISPEECSHKVKKD......MIVITLKK-------------------
Q6CBP8_YARLI/6-81IAPEESTWTVEDQ.....REVTISIEK-------------------
Q8IDW4_PLAF7/214-288IKPEESIWTLEDN.....KIIHIFIEK-------------------
Q7RF79_PLAYO/75-155IIPNKCSIKIKKD......LIQVYLIK-------------------
Q7RRD9_PLAYO/3-75INVEESKYTTKR.......NIKFKIIK-------------------
Q5KJJ7_CRYNJ/248-324IDPNVSSYRILST......KVEITLVK-------------------
Q8SSJ3_ENCCU/5-78VDVSSLWWVINGD......VVDVNVTK-------------------
Q6BXK8_DEBHA/178-255IDPQHSTSRIYST......KLEITLKK-------------------
Q5K7J1_CRYNJ/33-108IVVDDSSWTIDDG......TLTIELDK-------------------
B0S6K3_DANRE/76-155IIAAESSKKIKTD......MVLIMCKK-------------------
C3ZHN0_BRAFL/18-94VDVEESKYNATAR......GLKFLIKK-------------------
C8V7I9_EMENI/316-392IDESASKVTTFST......KIELVLRK-------------------
F1Q6Q1_DANRE/171-250INTENSLWSLEPG.....RCVLLSLSK-------------------
F5HGH3_NEUCR/245-328IDPSASRWSASPR......KIELVLQK-------------------
F6WW93_XENTR/418-505IEPDLCRYCFTGA......RVDISLQK-------------------
F6YV35_XENTR/79-156ISPEGSTKKVKTD......TVLIMCRK-------------------
F6ZRN5_XENTR/19-98INAETSLWSLEPG.....KCIVISLSK-------------------
F7AJ60_XENTR/139-214IVPDQSIFKVLST......KVEIKLKK-------------------
F7DCK1_XENTR/141-218IKVEECSWLIEDG.....KVVTVHLEK-------------------
G4U823_NEUT9/194-271IVPEKSSYKILGT......KLEVTLWK-------------------
H3C642_TETNG/318-405IEPEQCSYSFTPS......RLDITLKK-------------------
K4BEI9_SOLLC/173-248ITPAKCRYEVMST......KIEIRLAK-------------------
K4BTK3_SOLLC/6-81INVDESKSSTTSR......SIVYLVKK-------------------
M4E6X8_BRARP/6-81VDVNESKVNVSSR......SVFYLVKK-------------------
Q24K01_BOVIN/186-265INTESSLWSLEPG.....KCVLVSLNK-------------------
Q4WN97_ASPFU/37-116IIVDESSWTLETTSQPPGKEVSVHLDK-------------------
Q8L7U4_ARATH/6-81VNVEESKINIGER......SIFCIIEK-------------------
V5IRH3_NEUCR/27-105ILLDDSTWTLSPAPA.GQKALEIHLEK-------------------
W5CHI3_WHEAT/108-183IVPDKCKYTVLST......KVEMRLAK-------------------

PF00011

SP21_STIAD/57-157VDGDNVRADL.KN-----GVLTLTLPKRPEV.......QPKRIQVA
HSP26_YEAST/96-207VDADNIKADY.AN-----GVLTLTVPKLKPQKDG..KNHVKKIEVS
HS174_ORYSJ/50-153TKPEQIKASM.EN-----GVLTVTVPKEEPKKP.....DVKSIQIT
HSP17_ARATH/52-155AKVEEVKASM.EN-----GVLSVTVPK.VQESK....PEVKSVDIS
18KD_MYCLE/31-129LDTERILASY.QE-----GVLKLSIPVAERA.......KPRKISVD
CRYAB_ANAPL/66-161VDPLTITSSLSLD-----GVLTVSAPRKQSDV......PERSIPIT
HSP11_CAEEL/42-135VDVGAVASNLSED-----GKLSIEAPKKEAI.......QGRSIPIQ
HSP16_CAEEL/46-138ADLPSVKSAISNE-----GKLQIEAPKKTN........SSRSIPIN
HSP18_CLOAB/48-151IDDSKIDASF.LD-----GVLRITLPKKVKGKD.....NGRRIDIH
HS176_ARATH/48-153ADLDKISAVC.HD-----GVLKVTVQKLPPPEP....KKPKTIQVQ
HSP21_MAIZE/56-159ADMDKISAVC.RD-----GVLTVTVEKLPPPEP....KKPKTIEVK
HSP23_DROME/63-161YEADKVASTLSSD-----GVLTIKVPKPPAIEDK..G.NERIVQIQ
HSPB1_CHICK/85-182VEATAVRSSLSPD-----GMLTVEAPLPKPAIQ...S.SEITIPVT
HSP26_DROME/81-179YKAEQVVSQLSSD-----GVLTVSIPKPQAVEDK..S.KERIIQIQ
HSP27_DROME/82-180FDPNEVVSTVSSD-----GVLTLKAPPPPSKEQA..K.SERIVQIQ
HS25P_ARATH/130-227CEKDKIKAEL.KN-----GVLFITIPKTKVE......RKVIDVQIQ
HS22C_SOYBN/81-181CEKDKVKAEL.KN-----GVLYITIPKTKVE......RKVIDVQVQ
HS21C_WHEAT/134-238CDKSQVRAEL.KN-----GVLLVSVPKRETE......RKVIDVQVQ
HSP6A_DROME/119-220YDPNEVHSTLSSD-----GILTVKAPQPLPVVKGSLERQERIVDIQ
A8I6R6_CHLRE/50-154ANPDGITAAM.DK-----GVLVVTVPKREPPAK....PEPKRIAV.
F7C8L7_XENTR/32-130VNPEQVVCSLSKD-----GHLHIQAPRLALPPA.....PERPIPIS
I1LC12_SOYBN/73-176VDLDSVKAKM.EN-----GVLTLTLDKLSPDKI....KGPRLVSI.
ACR_MYCTU/48-140ADEDDIKATY.DK-----GILTVSVAVSEGK......PTEKHIQI.
IBPA_SHIDS/42-137AENIHVRGANLVN-----GLLYIDLERVIPEAK.....KPRRIEIN
Q329C7_SHIDS/41-137AENMEVSGATFVN-----GLLHIDLIRNEPEPI.....AAQRIAIS

PF05455

GVPH2_HALSA/1-163LTLDDPGMTITSL-TVTNQILELRVTPSEPS..ATDT---------
GVPH1_HALSA/8-182VVLDRPDVAITDM-TLRNQVLEIRLARTSDTDGGEST---------
GVPH_HALMT/36-216VPLDQPDVEITDV-RLRNQVLEIRLTRTNESNGSESK---------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window