Sequence alignment for CL0190

PF00011

SP21_STIAD/57-157---EVRET------------------------------------------------------------------------
ACR_MYCTU/45-141---EMKEG------------------------------------------------------------------------
HSP26_YEAST/96-207---DILDH------------------------------------------------------------------------
HS174_ORYSJ/50-153---DWKET------------------------------------------------------------------------
HSP17_ARATH/52-155---DWRET------------------------------------------------------------------------
18KD_MYCLE/31-129---DAWRE------------------------------------------------------------------------
CRYAA_ALLMI/63-162---EVRSD------------------------------------------------------------------------
CRYAA_SQUAC/63-162---EVRSE------------------------------------------------------------------------
CRYAB_ANAPL/66-161---EMRLE------------------------------------------------------------------------
CRYAB_SQUAC/69-164---ELRLD------------------------------------------------------------------------
HSP11_CAEEL/42-135---EIVNN------------------------------------------------------------------------
HSP11_CHERU/58-161---DWKET------------------------------------------------------------------------
HSP11_DAUCA/53-156---DWKET------------------------------------------------------------------------
HSP16_CAEEL/46-138---EIVND------------------------------------------------------------------------
HSP18_CLOAB/48-151---DIKED------------------------------------------------------------------------
HS176_ARATH/48-153---DVIEH------------------------------------------------------------------------
HSP21_MAIZE/56-159---DVKEL------------------------------------------------------------------------
HSP21_PEA/46-150---DVKEH------------------------------------------------------------------------
HSP21_IPONI/48-153---DVKEY------------------------------------------------------------------------
HSP22_IPONI/59-165---DVKEY------------------------------------------------------------------------
HSP23_DROME/63-161---VSKIG------------------------------------------------------------------------
HSPB1_CHICK/85-182---EIRQS------------------------------------------------------------------------
HSP26_DROME/81-179---TAHVG------------------------------------------------------------------------
HSP27_DROME/82-180---LPAVG------------------------------------------------------------------------
HS25P_ARATH/130-227---DIKEE------------------------------------------------------------------------
HS23C_CHERU/108-202---DVRED------------------------------------------------------------------------
HS22C_CHLRE/50-155---DIIES------------------------------------------------------------------------
HS21C_PEA/134-232---EIKDE------------------------------------------------------------------------
HS22C_PETHY/143-241---DIKDD------------------------------------------------------------------------
HS22C_SOYBN/81-181---DIKDE------------------------------------------------------------------------
HS21C_WHEAT/134-238---DIMED------------------------------------------------------------------------
HS30C_XENLA/86-186---SGKDG------------------------------------------------------------------------
HSP41_PEA/78-182---DWKET------------------------------------------------------------------------
HSP6A_DROME/119-220---YSVVN------------------------------------------------------------------------
IBPA_SHIFL/39-137---VELVD------------------------------------------------------------------------
IBPB_SHIFL/37-135---IEKSD------------------------------------------------------------------------
OV251_ONCVO/61-159---EVINE------------------------------------------------------------------------

PF08190

Q29L71_DROPS/1272-1547-IEQLENL............IRRV...PN.HL.WLY...KLRFCMKSFKVNS.T..EKFFINVCQASEVPAPEDVTEEEL
KTU_HUMAN/43-348-LTDPENR......RRYEAEITALERERG.VE.VRFVHPEPGHVLRTSLDGA.R...RCFVNVCSNALVGAP...SSRPG
KTU_DROPS/50-355-VQDPENR......KIYEQEITQLEKERG.VD.IKFVHPKPGFVVKTSIDGE.L...KCFINIASSPEVARP...NSEVG
KTU_DANRE/39-392-ISSPENR......RRYEEEIRRLEEERG.AA.VQFIHPTPHHVLKGRGPSG.....KCFINICSDQLIEKP...RSEAA
Q9VK57_DROME/30-332-INQYFGG......ADPEGS.GPQQKPPP.RD.SLIVQPTAGICVKSFKTNS.D..EKFFINVCQAAEVPAPQDVTEEEL
A7RX96_NEMVE/21-309-LDDLSETD....PEAYKRFIDQQVKGAK.EDMEQLQPPQPSFCITTFKLPE.VIPYKVYINVCSWDRVPAPE.......
A0DMA1_PARTE/44-380-ISDPKNR......EEYDQYLKQLERESELPKGMKLIKPEPHFCVKTSICKEITLQFKFFINICSTSVIDKP.....QSE
PIHD2_MOUSE/19-314-LDDLAEND....PERYRNFIQQELKDGK....QLCVNPEPQLCIQTKILKPNE..KVLFINLCQWERIPAPQ.......
PIHD2_DANRE/22-321-LDDMCENN....PEEYRSFIQRQMREGA....EFHSPPQSHTCIRTAVLGANE..GILYINICGWKRVPAPA.......
PIHD2_HUMAN/19-314-LDDLAQSD....PEGYEKFIQQQLKEGK....QLCAAPEPQLCLQTRILKPKE..KILFINLCQWTRIPAPQ.......
A0CTY4_PARTE/36-334-LTDPEYL........KLKDIQEYLDQEG....GMMIEPTPHFVLKAFDQNG.E...KVFFNVTAHSVVDAP...EEKQL
PIHD1_HUMAN/28-285-LLQASKE.............LQQAQTTR.PE.STQIQPQPGFCIKTNSSEG.....KVFINICHSPSIPPPADVTEEEL
PIHD2_XENTR/21-320-LDDMAENS....PESYQKFIQRHMKEGK....EFMTPPEPNLCIHTKILEPDE..KILFINICQWNRVPAPM.......
E9AFR0_LEIMA/55-423-LRTLQSRLQEEATKEAKEDLEQVHSDEQ.GQ.WMFVLPDPGFCIKTNVAGG.A...KVFINVCQHARIGEPVPMEPENG
KTU_ANOGA/36-354-LRD..NR......KQYEDELSMLEAQRG.YD.VKFLKPSPGYVIKTIVDGK.G...KGFINVCQSELVQKP...TSTTG
PIHD1_XENLA/25-294-LLKAKQE.............MQNRLPNT.PE.SKQIRPQPGFCIKTQTSEK.A...KIFINICKTNDIPAPPDLSEAEL
PIHD1_DANRE/26-284-LLQTMGK.............LQS...DS.PP.SKVIRPQPGLCVKTSSVSD.K..KKVFLNICQSQTVPPPPHLSQEAL
Q4DT93_TRYCC/46-391-LRDIQMRIQEESRNAMKSKLEAIQSDEN.GQ.WMYVLPEPGFCVKCTTSGG.G...KIFLNVCQHERIAEPIPMEEDEK
A7SEW3_NEMVE/38-354-ISDPENK......KRYEEEIRQMENERG.MD.VKFVNPEEGFVVKTTRETD.G..IKAFVNICYNQHIEKATFRMAEKG
Q17BY1_AEDAE/23-351-VRDETEEQ...FNSMFGPIVEQAQDISS.GR.SKVVKPTPGFCIKAFRKDT.R..NKFFINVCQTDGIPAPEDITEDQL
A7RZC7_NEMVE/25-290-LEQAMKT.............HQE...ED.KD.FIEFFPDHGFVFKSKVTAD.AGVKKVFVNICTSEHIPKAKDISEQEL
KTU_AEDAE/38-346-LKDPENR......KQYEEELKLMEAERG.YD.VKFIKPLPGYVIKTVVDGK.T...KAFVNVCHCDLVGKP...SSQCS
Q38DW7_TRYB2/46-377-LADLQKKIQEESMKSAKAKLEEIHSDEN.GQ.WMYILPEPGFCVKCKVAGG.G...KVFVNVCKHERIAEPIPIDDDNE
KTU_XENTR/38-353-ISDPENR......KKYEQEIYKMENERG.MD.IKFIHPKPGYVLLSSVNGV.Q...KCYLNICSNDLIQKP...EFKPG
A4HNA2_LEIBR/59-420-L......QQ.ETAKEAKKDLEQVHSDEY.GQ.WMFVLPDPGFCIKTNVAGG.V...KVFINVCQHPRIGEPVPMEPDKE
Q4RM69_TETNG/40-350-LADPENR......RRYEEEIKILEQNRG.NT.IEFIHPEPVKALRTCMNGS.Q...KCYINICASEKIGKP...SCSPK

PF04969

Q5BL62_XENTR/138-214YRHDWYQT------------------------------------------------------------------------
Q967H4_HYDVU/73-153SQYGWDES------------------------------------------------------------------------
Q5VJS2_XENLA/6-77NDYTWEQS------------------------------------------------------------------------
CHRD1_XENLA/229-305CRHDWHQT------------------------------------------------------------------------
Q8I542_PLAF7/76-156QSFAWNQE------------------------------------------------------------------------
NUDC_SCHPO/9-86AEYEWDQT------------------------------------------------------------------------
Q5BE89_EMENI/195-271VRNDFYQT------------------------------------------------------------------------
Q7RB97_PLAYO/167-241EKYTWTQT------------------------------------------------------------------------
Q5BXF1_SCHJA/230-307CRFDWYQC------------------------------------------------------------------------
Q5U3E4_DANRE/132-208VKHDWYQT------------------------------------------------------------------------
Q8I2N9_PLAF7/17-92LIYEWEQS------------------------------------------------------------------------
Y8359_ORYSJ/5-81PEVKWAQR------------------------------------------------------------------------
A0JLZ0_XENTR/417-505KNDHYEKG------------------------------------------------------------------------
SGT1_YEAST/185-267FKIDWYQS------------------------------------------------------------------------
Q75M67_ORYSJ/5-81PSTKWAQR------------------------------------------------------------------------
Q8VXX3_ARATH/19-93KVFEWDQT------------------------------------------------------------------------
Q7Q5Z9_ANOGA/168-244DKYSWTQT------------------------------------------------------------------------
CHRD1_DROME/213-291CRYDWHQT------------------------------------------------------------------------
GIT7_SCHPO/184-261IRYDWSQT------------------------------------------------------------------------
Q7Q5W9_ANOGA/4-76VKYDWYQT------------------------------------------------------------------------
Q9P6Y5_NEUCS/244-328LRIDFYQT------------------------------------------------------------------------
Q7PYU2_ANOGA/81-161KEYAWDQS------------------------------------------------------------------------
Q84LL6_BETVU/136-211ENYSWIQS------------------------------------------------------------------------
O81288_ARATH/9-85PEVKWAET------------------------------------------------------------------------
Q5EEY5_NICBE/172-248YRHEFYQK------------------------------------------------------------------------
Q5U4Q1_XENTR/75-155NNYGWDQS------------------------------------------------------------------------
Q5QIE1_MOUSE/6-77SEFSWQQT------------------------------------------------------------------------
Q5UTE8_ONCMY/4-79ATAKWYDR------------------------------------------------------------------------
NUDC_EMENI/32-114LPYKWTQT------------------------------------------------------------------------
Q8IN95_DROME/136-213ETHCWSQT------------------------------------------------------------------------
Q57UQ9_TRYB2/137-213EHYMFSQT------------------------------------------------------------------------
Q5DAE2_SCHJA/158-238DNYTWSQT------------------------------------------------------------------------
Q5JLZ9_ORYSJ/80-157GSFSWDQD------------------------------------------------------------------------
Q9STN7_ARATH/134-209EKYSWGQN------------------------------------------------------------------------
NUDC_MOUSE/171-248PNYRWTQT------------------------------------------------------------------------
Q5R370_HUMAN/33-113SNYGWDQS------------------------------------------------------------------------
UBP19_HUMAN/286-374KNDSYEKG------------------------------------------------------------------------
Q8I2V1_PLAF7/85-164CSYEWIEC------------------------------------------------------------------------
NUDC1_XENLA/278-353PLYNWQQT------------------------------------------------------------------------
Q5CJD2_CRYHO/4-76PTVLWAQT------------------------------------------------------------------------
NUDC2_RAT/17-91PWGQWYQT------------------------------------------------------------------------
Q5EBE9_XENTR/173-252KNYVWSQD------------------------------------------------------------------------
Q9VVA6_DROME/171-248ENYTWTQT------------------------------------------------------------------------
Q9VYT5_DROME/294-367PSYSWSQT------------------------------------------------------------------------
Q6FKN1_CANGA/178-257VRTDWYQS------------------------------------------------------------------------
Q584U3_TRYB2/25-100GRYSFGQT------------------------------------------------------------------------
Q5DCC6_SCHJA/11-87PSLLWAQR------------------------------------------------------------------------
Q7RGQ2_PLAYO/266-349TKFDWRES------------------------------------------------------------------------
Q6CJS5_KLULA/181-260LKMDWYQS------------------------------------------------------------------------
Q7SDS3_NEUCR/193-271VRTDFYQT------------------------------------------------------------------------
Q6DBR7_DANRE/227-303CRHDWHQT------------------------------------------------------------------------
Q9C8R4_ARATH/77-154GTFSWDQD------------------------------------------------------------------------
Q5CM61_CRYHO/144-218DKYTWTQT------------------------------------------------------------------------
Q7SG32_NEUCR/28-107LPYKWTQT------------------------------------------------------------------------
Q5K7I7_CRYNJ/8-89PRYDFYQT------------------------------------------------------------------------
CHRD1_DANRE/228-304CRFDWHQT------------------------------------------------------------------------
Q8SY87_DROME/3-74VRHDWYQS------------------------------------------------------------------------
Q59X42_CANAL/219-296FRDDWYQS------------------------------------------------------------------------
Q8W065_ORYSJ/19-93KVFEWDQT------------------------------------------------------------------------
Q9W3Y3_DROME/69-149TDYGWDQS------------------------------------------------------------------------
Q4T1P8_TETNG/506-594KNDSYEKG------------------------------------------------------------------------
Q9FR62_BRANA/5-81PTVKWAQR------------------------------------------------------------------------
Q8IAW7_PLAF7/162-236DKYYWNQA------------------------------------------------------------------------
A8BM82_GIAIC/4-77PTIYWAQR------------------------------------------------------------------------
Q6C1J0_YARLI/242-312LRTDFFQS------------------------------------------------------------------------
Q75EE3_ASHGO/168-248SRMEWYQT------------------------------------------------------------------------
Q7RBZ0_PLAYO/162-245EKYFWNQS------------------------------------------------------------------------
Q6DC89_DANRE/17-91AWGSWYQT------------------------------------------------------------------------
NUDC1_MOUSE/275-349PLYYWQQS------------------------------------------------------------------------
Q58CW7_BOVIN/186-265ENYTWSQD------------------------------------------------------------------------
Q9FR34_SOLLC/5-81PTIKWAQM------------------------------------------------------------------------
Q5VJS0_CIOIN/6-77KDYRWSET------------------------------------------------------------------------
Q86F47_SCHJA/168-245PNYSWYQT------------------------------------------------------------------------
CHRD1_PONAB/230-306CRHDWHQT------------------------------------------------------------------------
ITBP2_MOUSE/219-295CRHDWHQT------------------------------------------------------------------------
Q640C9_XENLA/166-243PHYRWTQT------------------------------------------------------------------------
Q6Z2U7_ORYSJ/207-282EKYSWTQE------------------------------------------------------------------------
Q5M992_XENLA/17-91PWGCWSQT------------------------------------------------------------------------
NB5R4_RAT/167-245PSYDWFQT------------------------------------------------------------------------
Q18949_CAEEL/5-78PRHDWFQS------------------------------------------------------------------------
Q6NYG2_DANRE/75-155NNYGWDQS------------------------------------------------------------------------
Q5ATX0_EMENI/1003-1080IRHEWYQS------------------------------------------------------------------------
Q5CJI5_CRYHO/85-163TKYSWDQS------------------------------------------------------------------------
Q8W516_HORVU/175-251YRHDYYNT------------------------------------------------------------------------
Q6CBP8_YARLI/6-81EHYAWRQT------------------------------------------------------------------------
Q8IDW4_PLAF7/214-288DKYVWTQS------------------------------------------------------------------------
Q5QIE2_CHICK/6-77REYSWRQS------------------------------------------------------------------------
Q6NZR9_DANRE/171-250EKYTWSQD------------------------------------------------------------------------
Q5DCB9_SCHJA/6-82DRFDWYQS------------------------------------------------------------------------
Q6WMT0_BRABE/8-86PAVYWAQR------------------------------------------------------------------------
Q7RF79_PLAYO/75-155PSFAWNQE------------------------------------------------------------------------
A8X8G6_CAEBR/5-78PRHDWFQS------------------------------------------------------------------------
Q6P010_DANRE/6-77RDHTWTQN------------------------------------------------------------------------
Q704T1_BRAOL/156-232FRHEFYQK------------------------------------------------------------------------
Q7RRD9_PLAYO/3-75PIVLWAQK------------------------------------------------------------------------
Q5KJJ7_CRYNJ/248-324CRLDHYQT------------------------------------------------------------------------
Q8SSJ3_ENCCU/5-78AKYTWDQE------------------------------------------------------------------------
Q6BXK8_DEBHA/178-255IRDDWYQT------------------------------------------------------------------------
Q5K7J1_CRYNJ/33-108LPYSWTQE------------------------------------------------------------------------
Q70ZY8_ASPFM/36-116LPYTWTQT------------------------------------------------------------------------

PF05455

GVPH2_HALSA/1-163MPTDDP........SDRPS...GLL-------------------------------------------------------
GVPH1_HALSA/8-182DASDDQ........SSQLS...GLL-------------------------------------------------------
O33403_NATVU/1-181MTPDDSNDESDETPDDVLSGSGGLF-------------------------------------------------------
GVPH_HALME/36-216DTPDDRPNKTPDRPSDHPS...SLL-------------------------------------------------------

PF00011

SP21_STIAD/57-157---------KEAYIFKADLPGVD--.EK.D--------IEVTLTG-DR..VSVSGKRER...EKREESERFYAYER----
ACR_MYCTU/45-141---------R..YEVRAELPGVD--.PDKD--------VDIMVRD-GQ..LTIKAERT.......EQKDFDGRSEF----
HSP26_YEAST/96-207---------DNNYELKVVVPGVK--SKK.D--------IDIEYHQ-NKNQILVSGEIPS..TLNEESKDKVKVKES----
HS174_ORYSJ/50-153---------PEAHVFKADVPGLK--.KE.E--------VKVEVED-GN..VLQISGERI..KEQEEKTDKWHRVER----
HSP17_ARATH/52-155---------PEAHVFKADVPGLK--.KE.E--------VKVEVED-GN..ILQISGERS..SENEEKSDTWHRVER----
18KD_MYCLE/31-129---------GEEFVVEFDLPGIK--.AD.S--------LDIDIER-NV..VTVRAERP.....GVDPDREMLAAER----
CRYAA_ALLMI/63-162---------RDKFTIMLDVKHFS--.PE.D--------LSVKIID-DF..VEVHGKHN......ERQDDHGYIS..----
CRYAA_SQUAC/63-162---------KDRFMINLNVKHFS--.PE.E--------LSVKIVD-DY..VEIHGKHA......ERQEDQGRVS..----
CRYAB_ANAPL/66-161---------KDKFSVNLDVKHFS--.PE.E--------LKVKVLG-DM..VEIHGKHE......ERQDEHGFIA..----
CRYAB_SQUAC/69-164---------KDKFAIHLDVKHFT--.PE.E--------LRVKILG-DF..IEVQAQHE......ERQDEHGYVS..----
HSP11_CAEEL/42-135---------DQKFAINLNVSQFK--.PE.D--------LKINLDG-HT..LSIQGEQE.......LKTEHGYSK..----
HSP11_CHERU/58-161---------PEAHVFKADLPGVK--.KE.E--------VKVEVED-GN..VLRISGQRA..REKEEKNDTWHRVER----
HSP11_DAUCA/53-156---------PQAHVFKADLPGLK--.KE.E--------VKVELEE-GK..VLQISGERN..KEKEEKNDKWHRVER----
HSP16_CAEEL/46-138---------ESKFSVQLDVSHFK--.PE.N--------LKIKLDG-RE..LKIEGIQE.......TKSEHGYLK..----
HSP18_CLOAB/48-151---------DDKYTVAADLPGVK--.KD.N--------IELQYEN-NY..LTINAKRDDI.VETKDDNNNFVRRER----
HS176_ARATH/48-153---------PNAYAFVVDMPGIK--.GD.E--------IKVQVEN-DN..VLVVSGERQR.ENKENEGVKYVRMER----
HSP21_MAIZE/56-159---------PGAYAFVVDMPGLG--.TG.D--------IKVQVED-ER..VLVISGERR...REEREDAKYLRMER----
HSP21_PEA/46-150---------PNSYVFMVDMPGVK--.SG.D--------IKVQVED-EN..VLLISGERK..REEEKEGVKYLKMER----
HSP21_IPONI/48-153---------PNSYVFIIDMPGLK--.SG.D--------IKVQVDG-DN..VLSISGERKR.EAEEKEGAKYVRMER----
HSP22_IPONI/59-165---------PNSYVFIADMPGVK--.AA.E--------IKVQVED-DN..VLVVSGERTEREKDEKDGVKYLRMER----
HSP23_DROME/63-161---------KDGFQVCMDVSHFK--.PS.E--------LVVKVQD-NS..VLVEGNHE......EREDDHGFIT..----
HSPB1_CHICK/85-182---------ADSWKVTLDVNHFA--.PE.E--------LVVKTKD-NI..VEITGKHE......EKQDEHGFIS..----
HSP26_DROME/81-179---------KDGFQVCMDVAQFK--.PS.E--------LNVKVVD-DS..ILVEGKHE......ERQDDHGHIM..----
HSP27_DROME/82-180---------KDGFQVCMDVSQFK--.PN.E--------LTVKVVD-NT..VVVEGKHE......EREDGHGMIQ..----
HS25P_ARATH/130-227---------EHEIKMRFDMPGLS--.KE.D--------VKISVED-NV..LVIKGEQK.......KEDSDDSWSGR----
HS23C_CHERU/108-202---------EEALELKVDMPGLA--.KE.D--------VKVSVED-NT..LIIKSEAEKETEEEEQRRRYSSRIEL----
HS22C_CHLRE/50-155---------PTAFELHADAPGMG--.PD.D--------VKVELQE-GV..LMVTGERKLS.HTTKEAGGKVWRSER----
HS21C_PEA/134-232---------EHEIRMRFDMPGVS--.KE.D--------VKVSVED-DV..LVIKSDHR......EENGGEDCWSRK----
HS22C_PETHY/143-241---------ENEIKMRFDMPGLS--.KE.E--------VKVSVED-DV..LVIKGEHK.....KEESGKDDSW.GR----
HS22C_SOYBN/81-181---------EHEIRMRFDMPGLA--.KE.D--------VKVSVED-DM..LVIKGGHK....SEQEHGGDDSWSSR----
HS21C_WHEAT/134-238---------EKEVKMRFDMPGLS--.RE.E--------VRVMVED-DA..LVIRGEHKKEAGEGQGEGGDGWWKER----
HS30C_XENLA/86-186---------KDHFELTLNVRDFS--.PH.E--------LTVKTQG-RR..VIVTGKHE......RKSDTEDGNYFH----
HSP41_PEA/78-182---------PEGHVIMVDVPGLK--.KD.D--------IKIEVEE-NR..VLRVSGERK..KEEDKKGDHWHRVER----
HSP6A_DROME/119-220---------RNGFQVSMNVKQFA--.AN.E--------LTVKTID-NC..IVVEGQHD......EKEDGHGVIS..----
IBPA_SHIFL/39-137---------ENHYRIAIAVAGFA--.ES.E--------LEITAQD-NL..LVVKGAHA.....DEQKERTYLYQGI----
IBPB_SHIFL/37-135---------DNHYRITLALAGFR--.QE.D--------LEIQLEG-TR..LSVKGTPE.....QPKEEKKWLHQGL----
OV251_ONCVO/61-159---------KDKFAVRADVSHFH--.PK.E--------LSVSVRD-RE..LVIEGHHK......ERADSAGHGS..----

PF08190

Q29L71_DROPS/1272-1547IAILESPT.PGSFRVPMSISDPR---HTKDRSDKTVDVCDIAINP-QF--LVKIQKSQLFKNFFQQLAAEALSEKY...N
KTU_HUMAN/43-348SGGDRGAAPGSHWSLPYSLAPGR---EYAGRSSSRYMVYDVVFHP-DA--LALARRHEGFRQMLDATALEAVEKQF...G
KTU_DROPS/50-355MNPETGGR.GLSWSIPMAQTGGR---DDCDAKNNHCKVFDVVFHP-DA--LHLSTRDSQFRKALIDTALDAVEREY...E
KTU_DANRE/39-392TDDR.GRS.GHSWRIPYSLTPGR---AGRDAAGAPCVLFDAVFHP-DA--LLMAENNARFMTLIHRTATGGIQDNF...R
Q9VK57_DROME/30-332IGILESTT.PGSYRVPMSISDPR---FTKDRSDKTVDVCDIAINP-KF--LVKIQKSQLFKNFFMQIVIEAMSEKY...N
A7RX96_NEMVE/21-309.........SEKDPIPIMTGQLQ---EHQEKG.KPYATIDAIFNT-TT--LQQIEYKQDHRNLLVHLALDYLEAHK...Q
A0DMA1_PARTE/44-380TITQNGQT.GQNWKIPYSIGKIR---YDQDKKQNICNTVDVAFHP-TT--IGLCYKTPNFKNLVCSTALEASGKQLGERN
PIHD2_MOUSE/19-314.........SATRPVPVSVGRPE---DSAEAS.DAYTIIDVAYNP-GV--LQAAEKDQGIKDQLIRMAMLCIEERL...Q
PIHD2_DANRE/22-321.........SDKEPVPVCGGRME---KLTEEK.EEYSVVDAAFNP-EV--LQTTEKDKEEKENLCLLALNFIQQQH...N
PIHD2_HUMAN/19-314.........STTHPVPLTVGKPE---DTTEIS.DAYTVIDVAYNP-DV--LHAAEKDQVKKNQLIQMAMKCIEEKF...Q
A0CTY4_PARTE/36-334IDYNN....EVGIRVPMSVGSIK---EDHDVKGDTCKVIDLVINP-TV--ATNLTQDDNLKTFFCQLVQTYVDQKY...K
PIHD1_HUMAN/28-285LQMLEED..QAGFRIPMSLGEPH---AELDAKGQGCTAYDVAVNS-DF--YRRMQNSDFLRELVITIAREGLEDKY...N
PIHD2_XENTR/21-320.........SEAHPVPISAGQLE---NLSDGT.....VVAIAYNP-EV--LKRAHQDHVELDQLIRLAMKYIEEQY...Q
E9AFR0_LEIMA/55-423SAGQGDTA.EMRYRIPISCGQAR---PGKDKGGKPCKVYDVIVNP-ST--MQRCGKDHEFRRFVAALCMQWIKQKS...E
KTU_ANOGA/36-354LNED.GTK.GLKWSVPYAQTQPR---KDYDNKRVECTVYDVMFHP-DA--LHLASKNEGFRKLLNDTSLDAVEQSF...K
PIHD1_XENLA/25-294VNILESDD.PSGYRVPMSIGEPH---VEVDNSGNGCTVYDIVINS-TF--FDKMKSNELFREFFITVAMEGLENKY...E
PIHD1_DANRE/26-284VELLESED.PTSYRVPMSLGEPH---TEVDNSSQGCTVYDVVIND-EF--FQKCEKDTLFQQFLIAVSLEGLENKY...S
Q4DT93_TRYCC/46-391TD.......EIKFKIPLSCGQAR---PGTDKSGKPCKVYDVIVNP-ST--VQRCSKDHEFRCFVVSLCIHWIKQKC...E
A7SEW3_NEMVE/38-354DGTE.RKK.GQQWSIPYSLAQPR---DDFDRAGKKCVTFDVVFHP-DT--YKKCTKMPQFKKMVIETALEGIERQL...N
Q17BY1_AEDAE/23-351MAILNDGT.PSSFKIPMSITQPR---FMKDHLDKQCQVCDIAVNS-TF--FKKIESGGLMRDFLITIVLEGIDSKY...N
A7RZC7_NEMVE/25-290AEILDSED.PMRYRVPLSLGEPH---AEMDKSGNGCTVYDIVINP-TF--LKKVQENTFFKNFFLTVVFQGLEEKY...G
KTU_AEDAE/38-346TNKR.GEK.GLKWSIPYAQSQPR---KDYDNKNVDCVVYDVVFHY-DT--LHLTKSNKNFRKLVTDTALDAVEGAF...H
Q38DW7_TRYB2/46-377A........EVKFRIPLSCGQAR---AESDKSGKPCKVYDVIVNP-ST--IHRCTQDHDFRCFVISLCIHWIQQKS...E
KTU_XENTR/38-353KDGE.GKA.GLHWSLPYSLSPGR---DDLSKDWSKHVIYDVVFHP-DT--LHIASKNGKFKGIVDSTALEAVASQF...N
A4HNA2_LEIBR/59-420NAGQEDSA.EMRYRIPISCGQAR---PGQDKCGNPCKVYDVIVNP-ST--IQRCGNDHEFRRFVAALCMQWIKQKS...E
Q4RM69_TETNG/40-350VLED.GRG.TLCWALPHILHPKK---QELYRKGHKVTIYDVVFHP-ET--LDLASKNKTFLDMVHDTAIQGIQSAF...S

PF04969

Q5BL62_XENTR/138-214---------ESHIIITVMIKNVQ....KNN--------VHIRFSE.RE...LTVN.............MSLPSG..----
Q967H4_HYDVU/73-153---------SKFVRLYVTI.PQIENLREDQ--------ISCEFTS.TS...VKF..............IAQNHLNK----
Q5VJS2_XENLA/6-77---------ENDVYISVPLKGTK....ASG--------SNVLCSE.SY...LKVN....................F----
CHRD1_XENLA/229-305---------GAGVTISIYAKNSM....PEL--------SYVEANS.TV...VNIQ.............VVFEGE..----
Q8I542_PLAF7/76-156---------RNKVTIFLTV.KNVHTVGEEK--------ISTVFEE.RS...FEIK.............MNDVDKK.----
NUDC_SCHPO/9-86---------IADVDIVIHV.PKG..TRAKS--------LQVDMSN.HD...LKIQ.............IN.VPE..----
Q5BE89_EMENI/195-271---------ATSVNVSLYLKKID....KDN--------AKVEFTS.TG...IALD.............LPTTDN..----
Q7RB97_PLAYO/167-241---------LGTVDMYIDV.EEF..IKTKD--------IKVDITF.KK...LSIK.............VK.NN...----
Q5BXF1_SCHJA/230-307---------GGFITLNIYAKNIW....PET--------VSVKANQ.II...LSVS.............LKFGVDY.----
Q5U3E4_DANRE/132-208---------ESQVAVTIMVKNAK....KEG--------VIVSFGE.RE...LTAV.............VKLPSG..----
Q8I2N9_PLAF7/17-92---------IDEINIYIDMNSKL..VNKND--------LNIEIKS.KR...ITIG.............LKNTK...----
Y8359_ORYSJ/5-81---------IDKVYITVQLADA......KD--------AKVNLEP.EG...VFSF.............SATAGTDG----
A0JLZ0_XENTR/417-505---------NDVVVVHVYVKEIC....KET--------SRVLFRE.QD...FTLI...FKTRDPNFLRLHPNCTPD----
SGT1_YEAST/185-267---------STSVTISLFTVNLP..ESKEQ--------VNIYISP.NDRRTLSIS.............YQVPKSG.----
Q75M67_ORYSJ/5-81---------SDKVFLTIELPDA......RD--------VKLNLKP.EG...QFIF.............SAKGPADD----
Q8VXX3_ARATH/19-93---------LEEVNMYITL.PPN..VHPKS--------FHCKIQS.KH...IEVG.............IKGNP...----
Q7Q5Z9_ANOGA/168-244---------LQELELRVPF.DVKFTLKAKD--------VVVSIQR.KH...LKVG.............LK.GH...----
CHRD1_DROME/213-291---------ATNVVMAIYAKKYD....YSQ--------SVIELNP.IR...LHVN.............LVFPEQDN----
GIT7_SCHPO/184-261---------SFSLNIDIYAKKVK....DED--------VSLLMEK.NT...LKIE.............IKLEDG..----
Q7Q5W9_ANOGA/4-76---------ETAVTVTILLKNAA....DKN--------YSVQLEQ.NT...LTLR.............AD......----
Q9P6Y5_NEUCS/244-328---------NQTVTVSLFVKDVK....KED--------LKVEFGK.RQ...VRIS.......PIPREAAPYVKPGD----
Q7PYU2_ANOGA/81-161---------DKFIKIFVTV.NGVQQVPEDN--------VNVEFTE.NS...FQLV.............ISDLNNK.----
Q84LL6_BETVU/136-211---------LQEVTVNVPV.PPG..TKSRF--------IDCQIKK.NH...LKVG.............LK.GQ...----
O81288_ARATH/9-85---------TEKIFLTVVLADT......KD--------TKVNLDP.EG...VFDF.............SAKVGPEN----
Q5EEY5_NICBE/172-248---------PEEVVVTIFAKGIP....AKN--------VIVDFGE.QI...LSVS.............IDVPGD..----
Q5U4Q1_XENTR/75-155---------EKFVKIYITL.NGVQNIPAAN--------VQVHFSE.RS...FELL.............VKDLDGK.----
Q5QIE1_MOUSE/6-77---------PATIFLSLPLRGVC....VRD--------ADVFCGE.SY...LKVN....................F----
Q5UTE8_ONCMY/4-79---------RDSVFIEFLVEDS......KD--------LQVKFEK.SK...LDFR..............CVGGIET----
NUDC_EMENI/32-114---------IRDVDVTIPV.SAN..LKGRD--------LDVVLKK.DS...IKVK.............VK.GEN..----
Q8IN95_DROME/136-213---------LKDVEVQALL.PKD.HQTAKK--------LHISIQA.QH...IKVS.............SK.HSP..----
Q57UQ9_TRYB2/137-213---------LKEVEVRVPL.LVA.RAKGKD--------VDVVLQQ.RR...LRVG.............MK.GK...----
Q5DAE2_SCHJA/158-238---------IKDIDIKIKV.PES.VMNARC--------VSVNIER.KH...IRIS.............IRQNGK..----
Q5JLZ9_ORYSJ/80-157---------AEKIKIYVFL.EG...VEQDK--------VETTFKP.MS...VDTK.............FHDVKGK.----
Q9STN7_ARATH/134-209---------LQEVTINIPM.PEG..TKSRS--------VTCEIKK.NR...LKVG.............LK.GQ...----
NUDC_MOUSE/171-248---------LAELDLAVPF.RVSFRLKGKD--------VVVDIQR.RH...LRVG.............LK.GQ...----
Q5R370_HUMAN/33-113---------DKFVKIYITL.TGVHQVPTEN--------VQVHFTE.RS...FDLL.............VKNLNGK.----
UBP19_HUMAN/286-374---------PDSVVVHVYVKEIC....RDT--------SRVLFRE.QD...FTLI...FQTRDGNFLRLHPGCGPH----
Q8I2V1_PLAF7/85-164---------DENVEVKIRISPD...INSDD--------IQYNIKS.NY...IYFK.............IRNK....----
NUDC1_XENLA/278-353---------GEEVTLTFLL.PEG..KTKED--------LNIKFLP.GE...IDIS.............IKDQG...----
Q5CJD2_CRYHO/4-76---------KKALFVTVDLPDL......KD--------YKVELEE.QY...LKFH.............ANVEN...----
NUDC2_RAT/17-91---------LEEVFIEVQV.PPG..TRAQD--------IQCGLQS.RH...VALA.............VGGRE...----
Q5EBE9_XENTR/173-252---------YTDVEIKVPV.PKS.VIKGRQ--------VSVDLRS.SC...IRVA.............VREGGG..----
Q9VVA6_DROME/171-248---------LEEVELKIPF.NLTFGLRARD--------LVISIGK.KS...LKVG.............IK.GQ...----
Q9VYT5_DROME/294-367---------DNNVLIRFNV.PST..ASAKE--------FNVSGSK.TT...VVVK.................HL..----
Q6FKN1_CANGA/178-257---------TDKLTVSFFTTILP..ANKDS--------MDIKIEG.LH...LSIS.............YPIPDKG.----
Q584U3_TRYB2/25-100---------DTEVIVKVPL.PSD..TPTKM--------INVDVKV.SS...LTIG.............MK.GQ...----
Q5DCC6_SCHJA/11-87---------NDCLYITVSISDV......KS--------QSVNVND.KS...LEFR.............AKAGKDKP----
Q7RGQ2_PLAYO/266-349---------LDHIELNIPIFDET...NQED--------ILFQIKN.DY...IKLE.............IMVNGE..----
Q6CJS5_KLULA/181-260---------SSTVTLSLFTKNLP..NSKSD--------VNVSIKG.SH...LSIS.............YPIPDKG.----
Q7SDS3_NEUCR/193-271---------PSSVIASFFLKKIN....KDA--------AKVEFKP.NS...IVLD.............LPTTDSPV----
Q6DBR7_DANRE/227-303---------GSQVVVTIYAKNCN....PDH--------SYVEANR.TV...LTCH.............IQFEGD..----
Q9C8R4_ARATH/77-154---------NDKVKMYISL.EG...VDEDK--------VQAEFKP.MS...LDIK.............IHDVQGK.----
Q5CM61_CRYHO/144-218---------LGTVEVLIDT.IPG..LKSRD--------CNINIKT.NR...LKVV.............VK.GE...----
Q7SG32_NEUCR/28-107---------IGDVDITILV.PGN..LKGKD--------MVVEIKK.QS...LTAG.............IK.GQ...----
Q5K7I7_CRYNJ/8-89---------PNELILALYIKGYD..KLKDD--------VKVEFGT.DS...VIIN.............LPALAPST----
CHRD1_DANRE/228-304---------GSQVIISIYAKNSV....PEL--------SLVEGNS.TV...LKIH.............IIFEGE..----
Q8SY87_DROME/3-74---------ETKVVITVLLKNAV....DKN--------YAVEITQ.KR...VHM..................TA..----
Q59X42_CANAL/219-296---------NEEVIITIYAKKVN....EEK--------LKVEFDT.NS...VSIS.............FPSAAA..----
Q8W065_ORYSJ/19-93---------LEEVNMYIEL.PKG..VPTKL--------FHCAIQA.TH...VEVG.............IRGNP...----
Q9W3Y3_DROME/69-149---------AKFVKLFITL.NGVQGCTEEN--------VTVTYTP.NS...LQLH.............VRDLQGK.----
Q4T1P8_TETNG/506-594---------TDLMVVNVYMKGLS....RDT--------TRVLFRE.QH...FTLF...FQTSDGNFLRLHSDCGPN----
Q9FR62_BRANA/5-81---------SDWVYITVELPDA......ED--------VKLKLEP.EG...KFFF.............SATSGASK----
Q8IAW7_PLAF7/162-236---------LKEINLEMPF.NEE..IKPND--------VNVQITN.TN...IKIYHCGV.........LK......----
A8BM82_GIAIC/4-77---------KDVVYMRLSVSSA......TD--------VKFKIAE.ET...IHFA.............CKSGG...----
Q6C1J0_YARLI/242-312---------NEKITVSIYRKNTP.....KD--------AKCDIQP.TS...ISII.............C.......----
Q75EE3_ASHGO/168-248---------TQKVTISLFVSKLP..RSHSE--------VIVQVVNGKD...LTVS.............YPITAGG.----
Q7RBZ0_PLAYO/162-245---------LNEINLEIPL.NKE..IKPSE--------IKVEITN.KH...IKVQHLSKKRKIVLINEVK......----
Q6DC89_DANRE/17-91---------MEEVYIEVNV.PPG..TSAKE--------IKCNIGS.KQ...IELR.............VKDQQ...----
NUDC1_MOUSE/275-349---------EDDLTVTVRL.PES..STKED--------IQIQFLP.DN...INIK.............LKDIQ...----
Q58CW7_BOVIN/186-265---------YTDLELKVPV.PKH.VVKGKQ--------VSVTLSS.SS...IRVA.............VLEGNG..----
Q9FR34_SOLLC/5-81---------SDKLFITVELPDA......KN--------VKLKLEP.EG...KFLF.............SATAGADN----
Q5VJS0_CIOIN/6-77---------KEQIFISVPLKGVR....ASN--------VDIMCTP.EF...IKAS....................Y----
Q86F47_SCHJA/168-245---------LSEVDIKIPT.RLPHRIKCRD--------VYVEIAR.RH...IKIG.............LK.NQ...----
CHRD1_PONAB/230-306---------GGEVTISVYAKNSL....PEL--------SRVEANS.TL...LNVH.............IVFEGE..----
ITBP2_MOUSE/219-295---------DSVVVLTVYGQIPL....PAF--------NWVKASQ.TE...LHVH.............IVFDGN..----
Q640C9_XENLA/166-243---------LSEVDMIVPF.PVSFRLKGKD--------VQVDIKR.RR...LTVG.............LR.GQ...----
Q6Z2U7_ORYSJ/207-282---------RPEVTITIPV.PQG..TKSSL--------VTYEIMK.NH...LKVG.............LK.GC...----
Q5M992_XENLA/17-91---------MEEIFIEVNV.PEG..TTSKE--------IQCKLGS.RD...VSLI.............VKGKD...----
NB5R4_RAT/167-245---------ESSVTIVIYTKQKN..INLDS--------VIVDLQD.DS...LRAE.............AVIKD...----
Q18949_CAEEL/5-78---------ETDVTLTILKRGVP....LDD--------CSVSLSDNNT...LTVK...................QC----
Q6NYG2_DANRE/75-155---------DKFVKIYITL.KGVHTIPAEN--------VESSFTE.RG...FNTL.............VKDLDGK.----
Q5ATX0_EMENI/1003-1080---------NDSVVVTLYAKGVD....KEK--------VDAEIKS.DS...VSVQ.............FPLPSG..----
Q5CJI5_CRYHO/85-163---------DKSVKIYIDLVGVQ..EKPDC--------IEIKFGK.DN...VEMY.............VKNLDN..----
Q8W516_HORVU/175-251---------PTEVVLTIFAKGVP....ADS--------VVVDFGE.QM...LSVS.............IELPGE..----
Q6CBP8_YARLI/6-81---------LQDITITFPV.PPG..TRGKQ--------MDIKFTP.TT...ISAG.............VV.GQ...----
Q8IDW4_PLAF7/214-288---------INTLDMYIDT.KDN..IKTKD--------IKIDITY.KK...LYVK.............VK.NQ...----
Q5QIE2_CHICK/6-77---------GAAVYLSLPVRGLR....VTA--------ANIFCTE.RY...LKVS....................V----
Q6NZR9_DANRE/171-250---------YTDVEVRVHV.EPD.IIKGRQ--------VCVDLQS.SR...VCVS.............VADGGS..----
Q5DCB9_SCHJA/6-82---------EGNVCINYFRKNLK....PSD--------IRVEIES.RK...ILLY.............LTIPTG..----
Q6WMT0_BRABE/8-86---------DDVLILTIQVEDID...RDKN--------RKVTLNE.KS...LSFS..............GKGGAEN----
Q7RF79_PLAYO/75-155---------KNKVTVFLTI.KNIQNINKEN--------IISEFNE.RD...FEIK.............IHNLDLK.----
A8X8G6_CAEBR/5-78---------DTDVVLTILKRGVP....LED--------CKVIISDDNH...LTVN...................QL----
Q6P010_DANRE/6-77---------LSTVYISVPLKAVK....TAN--------VHIICTD.DY...LKVS....................F----
Q704T1_BRAOL/156-232---------PEEVGVAIFAKGIP....KQN--------VNVEFGD.QI...LSVV.............IDVAGE..----
Q7RRD9_PLAYO/3-75---------KECLYLTIELQDA......ED--------VKIDLKE.DS...LYFY.............GTKEK...----
Q5KJJ7_CRYNJ/248-324---------PTQVIVSAFAKGAD....KSR--------STITFTP.QT...LSLS.............LSLPSN..----
Q8SSJ3_ENCCU/5-78---------LNEINIQFPV.TGD..ADSSA--------IKIRIVG.KK...ICVK.............NQ.GE...----
Q6BXK8_DEBHA/178-255---------NDSVIITIYAKNIK....EPE--------LHVQFKP.NS...VTVS.............FPSSAT..----
Q5K7J1_CRYNJ/33-108---------LATATVTVPL.PKG..TRSKD--------LEVVIGK.RK...LKVK.............LKSSP...----
Q70ZY8_ASPFM/36-116---------IRDVDVTIPV.PAN..IKGRD--------LDVVLTK.TK...IKVA.............IK.GQ...----

PF05455

GVPH2_HALSA/1-163---------DQLSRLIETLAELD.DDNGEQHGHSTIDRGRTRIDY-DYAVSIGLGSDARSPSTPAGNADDAGDAE.....
GVPH1_HALSA/8-182---------DQLHTLVEVLADIE.EEGGHRHESGRIDRGNARIDY-DYDVSIGLG.RADGSSYDEEPSSNRSRSEQRSGQ
O33403_NATVU/1-181---------TQLEALIEALAEIEANERGRIQDQGQLDHGSARVDY-GYDISIGLGSSSRDPETVDLPDPDDIDVD.....
GVPH_HALME/36-216---------DQLRAILETLAEIE..EDGHRQGHGRIDRGNAQIDY-DYEVSFGLGPRSRRGKPSDEPRVEAPRTE.GTDS

PF00011

SP21_STIAD/57-157--------------------------------------------------------------------------------
ACR_MYCTU/45-141--------------------------------------------------------------------------------
HSP26_YEAST/96-207--------------------------------------------------------------------------------
HS174_ORYSJ/50-153--------------------------------------------------------------------------------
HSP17_ARATH/52-155--------------------------------------------------------------------------------
18KD_MYCLE/31-129--------------------------------------------------------------------------------
CRYAA_ALLMI/63-162--------------------------------------------------------------------------------
CRYAA_SQUAC/63-162--------------------------------------------------------------------------------
CRYAB_ANAPL/66-161--------------------------------------------------------------------------------
CRYAB_SQUAC/69-164--------------------------------------------------------------------------------
HSP11_CAEEL/42-135--------------------------------------------------------------------------------
HSP11_CHERU/58-161--------------------------------------------------------------------------------
HSP11_DAUCA/53-156--------------------------------------------------------------------------------
HSP16_CAEEL/46-138--------------------------------------------------------------------------------
HSP18_CLOAB/48-151--------------------------------------------------------------------------------
HS176_ARATH/48-153--------------------------------------------------------------------------------
HSP21_MAIZE/56-159--------------------------------------------------------------------------------
HSP21_PEA/46-150--------------------------------------------------------------------------------
HSP21_IPONI/48-153--------------------------------------------------------------------------------
HSP22_IPONI/59-165--------------------------------------------------------------------------------
HSP23_DROME/63-161--------------------------------------------------------------------------------
HSPB1_CHICK/85-182--------------------------------------------------------------------------------
HSP26_DROME/81-179--------------------------------------------------------------------------------
HSP27_DROME/82-180--------------------------------------------------------------------------------
HS25P_ARATH/130-227--------------------------------------------------------------------------------
HS23C_CHERU/108-202--------------------------------------------------------------------------------
HS22C_CHLRE/50-155--------------------------------------------------------------------------------
HS21C_PEA/134-232--------------------------------------------------------------------------------
HS22C_PETHY/143-241--------------------------------------------------------------------------------
HS22C_SOYBN/81-181--------------------------------------------------------------------------------
HS21C_WHEAT/134-238--------------------------------------------------------------------------------
HS30C_XENLA/86-186--------------------------------------------------------------------------------
HSP41_PEA/78-182--------------------------------------------------------------------------------
HSP6A_DROME/119-220--------------------------------------------------------------------------------
IBPA_SHIFL/39-137--------------------------------------------------------------------------------
IBPB_SHIFL/37-135--------------------------------------------------------------------------------
OV251_ONCVO/61-159--------------------------------------------------------------------------------

PF08190

Q29L71_DROPS/1272-1547VQISMEKIITLNNRKFVG.TLVSHRVRNADVKHVQSLSG..........................KLAAIEPG..KDQKA
KTU_HUMAN/43-348VKLDRRNAKTL.KAKYKG.TPEAAVLRTPLPGVIPARPDGEPKG............PLPDFPYPYQYPAAPGP.......
KTU_DROPS/50-355VALDRANLKYP.KLDYKG.IARPTVIRKLAANPTPEEQEP....................HPLEHMYPTKPPASNSEPK.
KTU_DANRE/39-392IRLE..HVTRLKMMKYKG.EPQPTMIRRPNPGQTEAADRGPQQTTGPQQPTGPQQPTDPQQPTDTQQPTDPQQTTGPQQT
Q9VK57_DROME/30-332VQLNMEKTIILNNRKFIG.TLVTHRVRNEDMKRAQSTS.......................GIPAALN.SRDGGAVAPEN
A7RX96_NEMVE/21-309ISVS.RNYKNL.KIKYKG.NADDLKKYLYPRAKGGNEEP..........................KGIGTNPGNISKDSL
A0DMA1_PARTE/44-380EEIS.KDFKVLKHTKCKGGEPALLPVRIDKKGKLTNELD.........................SRQGGQANAQTKLQKD
PIHD2_MOUSE/19-314FTLA.HSYHLT.SFRLKG.SIQRMKESLMGIKTDFPDLK.................................AMTRTENT
PIHD2_DANRE/22-321LTLS.QHYKLT.NDKIKG.SIRDTKQRLMSTKTCKSTLN...............................GSQSEPAPSL
PIHD2_HUMAN/19-314FTLS.HSYHIT.KFRIKG.SIQRMKQNLMGIQTDSIDLR.................................EKMRRELT
A0CTY4_PARTE/36-334LKLQ.DKFISL.KMKYKGKSVQFQRVKGKKPPKV..........................QVIDEKPNQSPVQNNDDEDE
PIHD1_HUMAN/28-285LQLN.PEWRMMKNRPFMG.SISQQNIRSE...................................................
PIHD2_XENTR/21-320ITLC.HSYHVA.PFQLKG.NAKMMKESLERIQKQPATNK..............................GNSSCATDNSL
E9AFR0_LEIMA/55-423PTLNADEFRNL.SFKCKG.KLEPQRIRLSTQPKERNVMGDE..................IRLPTAAGSATAPSQVTGSQG
KTU_ANOGA/36-354VRLDRANLRFP.KLQYKG.TPSSSVVREKLPHCDSLPKD.....................ELFDKLLPPLPNVPAPGKTG
PIHD1_XENLA/25-294MELS.RDWRMLKNRKFMG.SISDQNIRTK...................................................
PIHD1_DANRE/26-284LELS.RDIKILKNRKFMG.SIAEQNIRTK...................................................
Q4DT93_TRYCC/46-391PTLNHEEYRSM.NFKVKG.DLEPQRIRLSTAPKGANAMGDE..................IRLPKDNSAALPPTTVGGRGG
A7SEW3_NEMVE/38-354IKLNKKNLKFP.KMKFKG.MKQATVIRNKSNE........................................NSFKKPNE
Q17BY1_AEDAE/23-351IALDETDWRVLKNKKFVD.KLTAHNIQNRDVKTVLESYKYP..................TESDLSKIKELETPQLGIDKP
A7RZC7_NEMVE/25-290LDLD.RSWSILKNKKYMG.KPQMHYVRKK...................................................
KTU_AEDAE/38-346VSLDRVNLKFP.KLQYKG.VAKMTVIRQKLKNFETRRKD.....................GLIDTLYRASEQSKITHDNS
Q38DW7_TRYB2/46-377PTLNLQEYRNM.SFRVKG.TLEPQRIRLSTTPKVANALGDE..................IRLPANATAASPVTNVGGRSG
KTU_XENTR/38-353VTLDKANVRTL.SMKYKG.VPNPSVLRKPLPEASPKSRDLED...............PLCFPYPYDVPTAVGTEKKDQKR
A4HNA2_LEIBR/59-420PTLNADEFRNL.NFKCKG.TLEPQRIRLSAQPKEHNAMGDE..................IRLPTAAGSATAPSQVIGSQG
Q4RM69_TETNG/40-350VSLDRNGVKEI.RAKCKG.TPQTCVIRKPIPGYQE.........................PPGKSDLPEFPYPDERRQPT

PF04969

Q5BL62_XENTR/138-214--------------------------------------------------------------------------------
Q967H4_HYDVU/73-153--------------------------------------------------------------------------------
Q5VJS2_XENLA/6-77--------------------------------------------------------------------------------
CHRD1_XENLA/229-305--------------------------------------------------------------------------------
Q8I542_PLAF7/76-156--------------------------------------------------------------------------------
NUDC_SCHPO/9-86--------------------------------------------------------------------------------
Q5BE89_EMENI/195-271--------------------------------------------------------------------------------
Q7RB97_PLAYO/167-241--------------------------------------------------------------------------------
Q5BXF1_SCHJA/230-307--------------------------------------------------------------------------------
Q5U3E4_DANRE/132-208--------------------------------------------------------------------------------
Q8I2N9_PLAF7/17-92--------------------------------------------------------------------------------
Y8359_ORYSJ/5-81--------------------------------------------------------------------------------
A0JLZ0_XENTR/417-505--------------------------------------------------------------------------------
SGT1_YEAST/185-267--------------------------------------------------------------------------------
Q75M67_ORYSJ/5-81--------------------------------------------------------------------------------
Q8VXX3_ARATH/19-93--------------------------------------------------------------------------------
Q7Q5Z9_ANOGA/168-244--------------------------------------------------------------------------------
CHRD1_DROME/213-291--------------------------------------------------------------------------------
GIT7_SCHPO/184-261--------------------------------------------------------------------------------
Q7Q5W9_ANOGA/4-76--------------------------------------------------------------------------------
Q9P6Y5_NEUCS/244-328--------------------------------------------------------------------------------
Q7PYU2_ANOGA/81-161--------------------------------------------------------------------------------
Q84LL6_BETVU/136-211--------------------------------------------------------------------------------
O81288_ARATH/9-85--------------------------------------------------------------------------------
Q5EEY5_NICBE/172-248--------------------------------------------------------------------------------
Q5U4Q1_XENTR/75-155--------------------------------------------------------------------------------
Q5QIE1_MOUSE/6-77--------------------------------------------------------------------------------
Q5UTE8_ONCMY/4-79--------------------------------------------------------------------------------
NUDC_EMENI/32-114--------------------------------------------------------------------------------
Q8IN95_DROME/136-213--------------------------------------------------------------------------------
Q57UQ9_TRYB2/137-213--------------------------------------------------------------------------------
Q5DAE2_SCHJA/158-238--------------------------------------------------------------------------------
Q5JLZ9_ORYSJ/80-157--------------------------------------------------------------------------------
Q9STN7_ARATH/134-209--------------------------------------------------------------------------------
NUDC_MOUSE/171-248--------------------------------------------------------------------------------
Q5R370_HUMAN/33-113--------------------------------------------------------------------------------
UBP19_HUMAN/286-374--------------------------------------------------------------------------------
Q8I2V1_PLAF7/85-164--------------------------------------------------------------------------------
NUDC1_XENLA/278-353--------------------------------------------------------------------------------
Q5CJD2_CRYHO/4-76--------------------------------------------------------------------------------
NUDC2_RAT/17-91--------------------------------------------------------------------------------
Q5EBE9_XENTR/173-252--------------------------------------------------------------------------------
Q9VVA6_DROME/171-248--------------------------------------------------------------------------------
Q9VYT5_DROME/294-367--------------------------------------------------------------------------------
Q6FKN1_CANGA/178-257--------------------------------------------------------------------------------
Q584U3_TRYB2/25-100--------------------------------------------------------------------------------
Q5DCC6_SCHJA/11-87--------------------------------------------------------------------------------
Q7RGQ2_PLAYO/266-349--------------------------------------------------------------------------------
Q6CJS5_KLULA/181-260--------------------------------------------------------------------------------
Q7SDS3_NEUCR/193-271--------------------------------------------------------------------------------
Q6DBR7_DANRE/227-303--------------------------------------------------------------------------------
Q9C8R4_ARATH/77-154--------------------------------------------------------------------------------
Q5CM61_CRYHO/144-218--------------------------------------------------------------------------------
Q7SG32_NEUCR/28-107--------------------------------------------------------------------------------
Q5K7I7_CRYNJ/8-89--------------------------------------------------------------------------------
CHRD1_DANRE/228-304--------------------------------------------------------------------------------
Q8SY87_DROME/3-74--------------------------------------------------------------------------------
Q59X42_CANAL/219-296--------------------------------------------------------------------------------
Q8W065_ORYSJ/19-93--------------------------------------------------------------------------------
Q9W3Y3_DROME/69-149--------------------------------------------------------------------------------
Q4T1P8_TETNG/506-594--------------------------------------------------------------------------------
Q9FR62_BRANA/5-81--------------------------------------------------------------------------------
Q8IAW7_PLAF7/162-236--------------------------------------------------------------------------------
A8BM82_GIAIC/4-77--------------------------------------------------------------------------------
Q6C1J0_YARLI/242-312--------------------------------------------------------------------------------
Q75EE3_ASHGO/168-248--------------------------------------------------------------------------------
Q7RBZ0_PLAYO/162-245--------------------------------------------------------------------------------
Q6DC89_DANRE/17-91--------------------------------------------------------------------------------
NUDC1_MOUSE/275-349--------------------------------------------------------------------------------
Q58CW7_BOVIN/186-265--------------------------------------------------------------------------------
Q9FR34_SOLLC/5-81--------------------------------------------------------------------------------
Q5VJS0_CIOIN/6-77--------------------------------------------------------------------------------
Q86F47_SCHJA/168-245--------------------------------------------------------------------------------
CHRD1_PONAB/230-306--------------------------------------------------------------------------------
ITBP2_MOUSE/219-295--------------------------------------------------------------------------------
Q640C9_XENLA/166-243--------------------------------------------------------------------------------
Q6Z2U7_ORYSJ/207-282--------------------------------------------------------------------------------
Q5M992_XENLA/17-91--------------------------------------------------------------------------------
NB5R4_RAT/167-245--------------------------------------------------------------------------------
Q18949_CAEEL/5-78--------------------------------------------------------------------------------
Q6NYG2_DANRE/75-155--------------------------------------------------------------------------------
Q5ATX0_EMENI/1003-1080--------------------------------------------------------------------------------
Q5CJI5_CRYHO/85-163--------------------------------------------------------------------------------
Q8W516_HORVU/175-251--------------------------------------------------------------------------------
Q6CBP8_YARLI/6-81--------------------------------------------------------------------------------
Q8IDW4_PLAF7/214-288--------------------------------------------------------------------------------
Q5QIE2_CHICK/6-77--------------------------------------------------------------------------------
Q6NZR9_DANRE/171-250--------------------------------------------------------------------------------
Q5DCB9_SCHJA/6-82--------------------------------------------------------------------------------
Q6WMT0_BRABE/8-86--------------------------------------------------------------------------------
Q7RF79_PLAYO/75-155--------------------------------------------------------------------------------
A8X8G6_CAEBR/5-78--------------------------------------------------------------------------------
Q6P010_DANRE/6-77--------------------------------------------------------------------------------
Q704T1_BRAOL/156-232--------------------------------------------------------------------------------
Q7RRD9_PLAYO/3-75--------------------------------------------------------------------------------
Q5KJJ7_CRYNJ/248-324--------------------------------------------------------------------------------
Q8SSJ3_ENCCU/5-78--------------------------------------------------------------------------------
Q6BXK8_DEBHA/178-255--------------------------------------------------------------------------------
Q5K7J1_CRYNJ/33-108--------------------------------------------------------------------------------
Q70ZY8_ASPFM/36-116--------------------------------------------------------------------------------

PF05455

GVPH2_HALSA/1-163......TAHIETRASDDS--------------------------------------------------------------
GVPH1_HALSA/8-182QRTTEDSIHVETRGGTSG--------------------------------------------------------------
O33403_NATVU/1-181..ELESVPRVEVRDRDDG--------------------------------------------------------------
GVPH_HALME/36-216QPEGEKSIHIETRETDDG--------------------------------------------------------------

PF00011

SP21_STIAD/57-157--------------------------------------------------------------------------------
ACR_MYCTU/45-141--------------------------------------------------------------------------------
HSP26_YEAST/96-207--------------------------------------------------------------------------------
HS174_ORYSJ/50-153--------------------------------------------------------------------------------
HSP17_ARATH/52-155--------------------------------------------------------------------------------
18KD_MYCLE/31-129--------------------------------------------------------------------------------
CRYAA_ALLMI/63-162--------------------------------------------------------------------------------
CRYAA_SQUAC/63-162--------------------------------------------------------------------------------
CRYAB_ANAPL/66-161--------------------------------------------------------------------------------
CRYAB_SQUAC/69-164--------------------------------------------------------------------------------
HSP11_CAEEL/42-135--------------------------------------------------------------------------------
HSP11_CHERU/58-161--------------------------------------------------------------------------------
HSP11_DAUCA/53-156--------------------------------------------------------------------------------
HSP16_CAEEL/46-138--------------------------------------------------------------------------------
HSP18_CLOAB/48-151--------------------------------------------------------------------------------
HS176_ARATH/48-153--------------------------------------------------------------------------------
HSP21_MAIZE/56-159--------------------------------------------------------------------------------
HSP21_PEA/46-150--------------------------------------------------------------------------------
HSP21_IPONI/48-153--------------------------------------------------------------------------------
HSP22_IPONI/59-165--------------------------------------------------------------------------------
HSP23_DROME/63-161--------------------------------------------------------------------------------
HSPB1_CHICK/85-182--------------------------------------------------------------------------------
HSP26_DROME/81-179--------------------------------------------------------------------------------
HSP27_DROME/82-180--------------------------------------------------------------------------------
HS25P_ARATH/130-227--------------------------------------------------------------------------------
HS23C_CHERU/108-202--------------------------------------------------------------------------------
HS22C_CHLRE/50-155--------------------------------------------------------------------------------
HS21C_PEA/134-232--------------------------------------------------------------------------------
HS22C_PETHY/143-241--------------------------------------------------------------------------------
HS22C_SOYBN/81-181--------------------------------------------------------------------------------
HS21C_WHEAT/134-238--------------------------------------------------------------------------------
HS30C_XENLA/86-186--------------------------------------------------------------------------------
HSP41_PEA/78-182--------------------------------------------------------------------------------
HSP6A_DROME/119-220--------------------------------------------------------------------------------
IBPA_SHIFL/39-137--------------------------------------------------------------------------------
IBPB_SHIFL/37-135--------------------------------------------------------------------------------
OV251_ONCVO/61-159--------------------------------------------------------------------------------

PF08190

Q29L71_DROPS/1272-1547SSKLVQEI................DDKYAAAIRKIRQTAELQ............Y................KLRAQI...
KTU_HUMAN/43-348...................................RAPSPPEAALQPA.PTEPRY......SVVQRHHVDLQDYRCS.RD
KTU_DROPS/50-355...................................ILPMKTKAAPVPE.FAVPKY......SIKQSHDVDLSEYTDE.LD
KTU_DANRE/39-392TGPQQTTGP..HQPTDPQQTTGPQQPTDPQQPTGPHQPTDPQQTTDPP.PTAPQY......RLKYRSVLDLQDYRCC.RD
Q9VK57_DROME/30-332SGKLVQEI................DEKDAAAIRKSRQSAGGG.......FLDIQY................KLRGRV...
A7RX96_NEMVE/21-309LSQLSSIAV..SETVEDLG.LSLLGNSSKQDKRNLIQEISSSAVRSQ..EIVPVY..............NVAVKNSS...
A0DMA1_PARTE/44-380INQMRDEN....EKIKEEEKLKQQQQKEQQAEEEEDIKKESDEIESTA.VSRPKY......RFIYSYPVEYSDFLDS..R
PIHD2_MOUSE/19-314LARIRSSTV..SEPNHLPEVLLTKKQASAKGRC.LIEEISSSEIQVE..VKKPAY..............ELKVVKDR...
PIHD2_DANRE/22-321LQQICSLQN..TESDEDSSIELSIEQERKPARSGLIEVISSTELDQPQ.PQLPKH..............QLTICPDG...
PIHD2_HUMAN/19-314LGQIRSSTM..SNPDHFPQLLLPKDQVSGKAVC.LIEEISSTEIQVE..MKMPAY..............ELKIVHDH...
A0CTY4_PARTE/36-334TEQIRKRQ...........................REEFEKQSISTQP.PAFVTY......EPEWELYLIYPNNEQE.YD
PIHD1_HUMAN/28-285QRPRIQEL................GDLYTPAPGRA....ESG.......PEKPHL................NLWLEA...
PIHD2_XENTR/21-320LEELKSIALIREKQETSPSICITREDAPKSTKTKLIEEISSTDLQNRDLLPSPWH..............ELSVTKDN...
E9AFR0_LEIMA/55-423NGKLIQEVL..PPTN.........TNAGPSASSTEAATPGTA.......ALKPEPV...VKSVIAEGVYSWALHKRPTSN
KTU_ANOGA/36-354SERTTKTK..................NKENINRTAAVAAAAASPGNPF.YTTPEY......KIVQCRDVEYGEMTNE.LD
PIHD1_XENLA/25-294SKPIIQEL.....DT.........SSSQTLQSKPLISEIQSS.......PKVPEY................TIAAEP...
PIHD1_DANRE/26-284SKPIIQEI.....DS.........KESLTL.........PSA.......AKRPEF................TLLVEP...
Q4DT93_TRYCC/46-391TGKLIQEVT..NPAIA......SDAVSSPQAAVPATSTTTTAAESSA..ASKEERIAPSLVKLQGEGIYDWSRHVKPVLN
A7SEW3_NEMVE/38-354GITIGDKTI..PYPYADQPTCANKQAHKSRTPGQITSKVKDNNADTRD.PRNPEY......TILHRGIIDFQNFTNA.RD
Q17BY1_AEDAE/23-351KKKLIEEI................DPVTIKTMKDVKNKLSGKDEYVPD.PTKVAI......SQAASKKPDCRLFREP...
A7RZC7_NEMVE/25-290SKPVIMDLT..NSAD.........KEESSKSTSQLISTLEPS.......IPQPMY................NILTEP...
KTU_AEDAE/38-346ADKEN..............................VNKQTFKSASQLE.YTTPAY......KLIHRKEVEYHELTGE.LD
Q38DW7_TRYB2/46-377TGKLVQEI................TDAPAPAAAPAPPPTVNS.......PSPPEEPKPSVMRVESEGIYDWSTHSKPTIN
KTU_XENTR/38-353VIQKECKQ...........................HLVTPEQDPNVQV.AATPNY......TVRHRSYVDLQDFRDS.RD
A4HNA2_LEIBR/59-420NGKLIQEVL..PPNT.........TNASPSATAMGTATPGTA.......ALKLEPA...VKSVTAEGAYNWTLHKRPASN
Q4RM69_TETNG/40-350SLQTDPTGP..AVPT....................RSCAAGPRVQTKE.PAKPKY......TVRYRSYVDIQDFRRS.RN

PF04969

Q5BL62_XENTR/138-214--------------------------------------------------------------------------------
Q967H4_HYDVU/73-153--------------------------------------------------------------------------------
Q5VJS2_XENLA/6-77--------------------------------------------------------------------------------
CHRD1_XENLA/229-305--------------------------------------------------------------------------------
Q8I542_PLAF7/76-156--------------------------------------------------------------------------------
NUDC_SCHPO/9-86--------------------------------------------------------------------------------
Q5BE89_EMENI/195-271--------------------------------------------------------------------------------
Q7RB97_PLAYO/167-241--------------------------------------------------------------------------------
Q5BXF1_SCHJA/230-307--------------------------------------------------------------------------------
Q5U3E4_DANRE/132-208--------------------------------------------------------------------------------
Q8I2N9_PLAF7/17-92--------------------------------------------------------------------------------
Y8359_ORYSJ/5-81--------------------------------------------------------------------------------
A0JLZ0_XENTR/417-505--------------------------------------------------------------------------------
SGT1_YEAST/185-267--------------------------------------------------------------------------------
Q75M67_ORYSJ/5-81--------------------------------------------------------------------------------
Q8VXX3_ARATH/19-93--------------------------------------------------------------------------------
Q7Q5Z9_ANOGA/168-244--------------------------------------------------------------------------------
CHRD1_DROME/213-291--------------------------------------------------------------------------------
GIT7_SCHPO/184-261--------------------------------------------------------------------------------
Q7Q5W9_ANOGA/4-76--------------------------------------------------------------------------------
Q9P6Y5_NEUCS/244-328--------------------------------------------------------------------------------
Q7PYU2_ANOGA/81-161--------------------------------------------------------------------------------
Q84LL6_BETVU/136-211--------------------------------------------------------------------------------
O81288_ARATH/9-85--------------------------------------------------------------------------------
Q5EEY5_NICBE/172-248--------------------------------------------------------------------------------
Q5U4Q1_XENTR/75-155--------------------------------------------------------------------------------
Q5QIE1_MOUSE/6-77--------------------------------------------------------------------------------
Q5UTE8_ONCMY/4-79--------------------------------------------------------------------------------
NUDC_EMENI/32-114--------------------------------------------------------------------------------
Q8IN95_DROME/136-213--------------------------------------------------------------------------------
Q57UQ9_TRYB2/137-213--------------------------------------------------------------------------------
Q5DAE2_SCHJA/158-238--------------------------------------------------------------------------------
Q5JLZ9_ORYSJ/80-157--------------------------------------------------------------------------------
Q9STN7_ARATH/134-209--------------------------------------------------------------------------------
NUDC_MOUSE/171-248--------------------------------------------------------------------------------
Q5R370_HUMAN/33-113--------------------------------------------------------------------------------
UBP19_HUMAN/286-374--------------------------------------------------------------------------------
Q8I2V1_PLAF7/85-164--------------------------------------------------------------------------------
NUDC1_XENLA/278-353--------------------------------------------------------------------------------
Q5CJD2_CRYHO/4-76--------------------------------------------------------------------------------
NUDC2_RAT/17-91--------------------------------------------------------------------------------
Q5EBE9_XENTR/173-252--------------------------------------------------------------------------------
Q9VVA6_DROME/171-248--------------------------------------------------------------------------------
Q9VYT5_DROME/294-367--------------------------------------------------------------------------------
Q6FKN1_CANGA/178-257--------------------------------------------------------------------------------
Q584U3_TRYB2/25-100--------------------------------------------------------------------------------
Q5DCC6_SCHJA/11-87--------------------------------------------------------------------------------
Q7RGQ2_PLAYO/266-349--------------------------------------------------------------------------------
Q6CJS5_KLULA/181-260--------------------------------------------------------------------------------
Q7SDS3_NEUCR/193-271--------------------------------------------------------------------------------
Q6DBR7_DANRE/227-303--------------------------------------------------------------------------------
Q9C8R4_ARATH/77-154--------------------------------------------------------------------------------
Q5CM61_CRYHO/144-218--------------------------------------------------------------------------------
Q7SG32_NEUCR/28-107--------------------------------------------------------------------------------
Q5K7I7_CRYNJ/8-89--------------------------------------------------------------------------------
CHRD1_DANRE/228-304--------------------------------------------------------------------------------
Q8SY87_DROME/3-74--------------------------------------------------------------------------------
Q59X42_CANAL/219-296--------------------------------------------------------------------------------
Q8W065_ORYSJ/19-93--------------------------------------------------------------------------------
Q9W3Y3_DROME/69-149--------------------------------------------------------------------------------
Q4T1P8_TETNG/506-594--------------------------------------------------------------------------------
Q9FR62_BRANA/5-81--------------------------------------------------------------------------------
Q8IAW7_PLAF7/162-236--------------------------------------------------------------------------------
A8BM82_GIAIC/4-77--------------------------------------------------------------------------------
Q6C1J0_YARLI/242-312--------------------------------------------------------------------------------
Q75EE3_ASHGO/168-248--------------------------------------------------------------------------------
Q7RBZ0_PLAYO/162-245--------------------------------------------------------------------------------
Q6DC89_DANRE/17-91--------------------------------------------------------------------------------
NUDC1_MOUSE/275-349--------------------------------------------------------------------------------
Q58CW7_BOVIN/186-265--------------------------------------------------------------------------------
Q9FR34_SOLLC/5-81--------------------------------------------------------------------------------
Q5VJS0_CIOIN/6-77--------------------------------------------------------------------------------
Q86F47_SCHJA/168-245--------------------------------------------------------------------------------
CHRD1_PONAB/230-306--------------------------------------------------------------------------------
ITBP2_MOUSE/219-295--------------------------------------------------------------------------------
Q640C9_XENLA/166-243--------------------------------------------------------------------------------
Q6Z2U7_ORYSJ/207-282--------------------------------------------------------------------------------
Q5M992_XENLA/17-91--------------------------------------------------------------------------------
NB5R4_RAT/167-245--------------------------------------------------------------------------------
Q18949_CAEEL/5-78--------------------------------------------------------------------------------
Q6NYG2_DANRE/75-155--------------------------------------------------------------------------------
Q5ATX0_EMENI/1003-1080--------------------------------------------------------------------------------
Q5CJI5_CRYHO/85-163--------------------------------------------------------------------------------
Q8W516_HORVU/175-251--------------------------------------------------------------------------------
Q6CBP8_YARLI/6-81--------------------------------------------------------------------------------
Q8IDW4_PLAF7/214-288--------------------------------------------------------------------------------
Q5QIE2_CHICK/6-77--------------------------------------------------------------------------------
Q6NZR9_DANRE/171-250--------------------------------------------------------------------------------
Q5DCB9_SCHJA/6-82--------------------------------------------------------------------------------
Q6WMT0_BRABE/8-86--------------------------------------------------------------------------------
Q7RF79_PLAYO/75-155--------------------------------------------------------------------------------
A8X8G6_CAEBR/5-78--------------------------------------------------------------------------------
Q6P010_DANRE/6-77--------------------------------------------------------------------------------
Q704T1_BRAOL/156-232--------------------------------------------------------------------------------
Q7RRD9_PLAYO/3-75--------------------------------------------------------------------------------
Q5KJJ7_CRYNJ/248-324--------------------------------------------------------------------------------
Q8SSJ3_ENCCU/5-78--------------------------------------------------------------------------------
Q6BXK8_DEBHA/178-255--------------------------------------------------------------------------------
Q5K7J1_CRYNJ/33-108--------------------------------------------------------------------------------
Q70ZY8_ASPFM/36-116--------------------------------------------------------------------------------

PF05455

GVPH2_HALSA/1-163--------------------------------------------------------------------------------
GVPH1_HALSA/8-182--------------------------------------------------------------------------------
O33403_NATVU/1-181--------------------------------------------------------------------------------
GVPH_HALME/36-216--------------------------------------------------------------------------------

PF00011

SP21_STIAD/57-157------SFGSFSRAFT-LPE..GVDGDNVRADL.KNGV------------------------------------------
ACR_MYCTU/45-141------AYGSFVRTVS-LPV..GADEDDIKATY.DKGI------------------------------------------
HSP26_YEAST/96-207------SSGKFKRVIT-LPDYPGVDADNIKADY.ANGV------------------------------------------
HS174_ORYSJ/50-153------SSGKFLRRFR-LPE..NTKPEQIKASM.ENGV------------------------------------------
HSP17_ARATH/52-155------SSGKFMRRFR-LPE..NAKVEEVKASM.ENGV------------------------------------------
18KD_MYCLE/31-129------PRGVFNRQLV-LGE..NLDTERILASY.QEGV------------------------------------------
CRYAA_ALLMI/63-162------..REFHRRYR-LPS..SVDQSAVTCVLSADGM------------------------------------------
CRYAA_SQUAC/63-162------..REFHRTYH-LPS..NLNESAIACSLSNEGL------------------------------------------
CRYAB_ANAPL/66-161------..REFNRKYR-IPA..DVDPLTITSSLSLDGV------------------------------------------
CRYAB_SQUAC/69-164------..REFHRKYK-VPA..GVDPLVITCSLSADGV------------------------------------------
HSP11_CAEEL/42-135------..KSFSRVIL-LPE..DVDVGAVASNLSEDGK------------------------------------------
HSP11_CHERU/58-161------SSGQFMRKFR-LPE..NAKVDQVKAGM.ENGV------------------------------------------
HSP11_DAUCA/53-156------SSGKFLRRFR-LPE..NAKVDEVKAAM.ANGV------------------------------------------
HSP16_CAEEL/46-138------..RSFSKMIL-LPE..DADLPSVKSAISNEGK------------------------------------------
HSP18_CLOAB/48-151------SYGELRRSFY-V.D..NIDDSKIDASF.LDGV------------------------------------------
HS176_ARATH/48-153------RMGKFMRKFQ-LPE..NADLDKISAVC.HDGV------------------------------------------
HSP21_MAIZE/56-159------RMGKFMRKFV-LPD..NADMDKISAVC.RDGV------------------------------------------
HSP21_PEA/46-150------RIGKLMRKFV-LPE..NANIEAISAIS.QDGV------------------------------------------
HSP21_IPONI/48-153------RVGKLMRKFV-LPE..NANKEKITAVC.QDGV------------------------------------------
HSP22_IPONI/59-165------RVGKFMRKFV-LPE..NANVEAINAVY.QDGV------------------------------------------
HSP23_DROME/63-161------..RHFVRRYA-LPP..GYEADKVASTLSSDGV------------------------------------------
HSPB1_CHICK/85-182------..RCFTRKYT-LPP..GVEATAVRSSLSPDGM------------------------------------------
HSP26_DROME/81-179------..RHFVRRYK-VPD..GYKAEQVVSQLSSDGV------------------------------------------
HSP27_DROME/82-180------..RHFVRKYT-LPK..GFDPNEVVSTVSSDGV------------------------------------------
HS25P_ARATH/130-227------SVSSYGTRLQ-LPD..NCEKDKIKAEL.KNGV------------------------------------------
HS23C_CHERU/108-202------TPNLY.....-.......KIDGIKAEM.KNGV------------------------------------------
HS22C_CHLRE/50-155------TAYSFSRAFS-LPE..NANPDGITAAM.DKGV------------------------------------------
HS21C_PEA/134-232------SYSCYDTRLK-LPD..NCEKEKVKAEL.KDGV------------------------------------------
HS22C_PETHY/143-241------NYSSYDTRLS-LPD..NVDKDKVKAEL.KNGV------------------------------------------
HS22C_SOYBN/81-181------TYSSYDTRLK-LPD..NCEKDKVKAEL.KNGV------------------------------------------
HS21C_WHEAT/134-238------SVSSYDMRLA-LPD..ECDKSQVRAEL.KNGV------------------------------------------
HS30C_XENLA/86-186------EYREWKREAE-LPE..SVNPEQVVCSLSKNGH------------------------------------------
HSP41_PEA/78-182------SYGKFWRQFK-LPQ..NVDLDSVKAKM.ENGV------------------------------------------
HSP6A_DROME/119-220------..RHFIRKYI-LPK..GYDPNEVHSTLSSDGI------------------------------------------
IBPA_SHIFL/39-137------AERNFERKFQ-L.....AENIHVRGANLVNGL------------------------------------------
IBPB_SHIFL/37-135------MNQPFSLSFT-L.....AENMEVSGATFVNGL------------------------------------------
OV251_ONCVO/61-159------IERHFIRKYV-LPE..EVQPDTIESHLSDKGV------------------------------------------

PF08190

Q29L71_DROPS/1272-1547...RADAVHEIQAEIY-LPN--CVSSHEINLDVGEDRILVESRKH...............................GYVF
KTU_HUMAN/43-348SA.PSPVPHELVITIE-LPL--LRSAEQAALEVTRKLLCLDSRKP...............................DYRL
KTU_DROPS/50-355AKLHVTVPRSLVVEIE-LPL--LRSTAECQLDVTAKSVYLLSERLG.............................AKYRL
KTU_DANRE/39-392SG.SAGRPTAIIIEVE-VPR--LRSAQEAELRVEERRLLLEAPTA...............................EYRL
Q9VK57_DROME/30-332...RDESVDEIHAEIY-LPN--YVSSQEFSLLVGEDRIVVETRKY...............................GYVF
A7RX96_NEMVE/21-309....EGRPRRLVVTVE-LPG--VLSVADCDLEISE.............................................
A0DMA1_PARTE/44-380ANMSIKLPNQLACDLK-MQK--VEAMKEIQLDLSNQGLVLDVPN................................KYFL
PIHD2_MOUSE/19-314....NEKPLKIELKVE-LPG--IKSVSLCELSVSEVDILIEVSE................................MYRL
PIHD2_DANRE/22-321....NGSSRILQLCVE-LPG--VRSVSQCQLRISEDDILLEVED................................IYYL
PIHD2_HUMAN/19-314....SEKPLKIELKVE-LPG--INSVSLCDLSVSEDDLLIEVSE................................KYRL
A0CTY4_PARTE/36-334GDLDYNAIKQYRFQIL-TPL--LITGKAIKLKVDEEQFQMVAGK................................FYKI
PIHD1_HUMAN/28-285.......PDLLLAEVD-LPK--LDGALGLSLEIGENRLVMGGPQQ...............................LYHL
PIHD2_XENTR/21-320....AGHPQSLILKVK-LRG--VHSVAECDLSVSKDDLLLVVPG................................RYRL
E9AFR0_LEIMA/55-423PYFKENVPSYFAITLY-LPG--VQTIREVDVRIGYRRVDCYYIDEVADGEERDEEAAASAEGGERGAAAANKGSGASPFL
KTU_ANOGA/36-354AKIDVTIPRELKVVIT-LPL--LKSTAECALDVTKTTLHLVSEKP..............................ARYKL
PIHD1_XENLA/25-294...SEGHPSFLVAEIS-LPN--VTSVRSLVLDLGEDRIVLWGRPD...............................LYHL
PIHD1_DANRE/26-284...PSGKAEHLIAEIL-LPG--VSSARSLVLDLGEDRLVLIARPS...............................LFHL
Q4DT93_TRYCC/46-391PYFRENIPATYAVEVC-IPT--VTSIAEVEVRITPRSIEISYVD.AE...........................DGAPFL
A7SEW3_NEMVE/38-354SC.TSTRPKELVIRID-LPD--L.ALNHCKYRYSAFSRCC....................................QFFL
Q17BY1_AEDAE/23-351...ASGRVKTLIGEFY-LPE--CTSAKEITLDIGEDRILLEARKK...............................GYLL
A7RZC7_NEMVE/25-290...SDDKPEFIVLEIS-LPG--LKSIKDTALDVGEDRLLLHVDPN...............................RYHL
KTU_AEDAE/38-346AKLDAAIPKELVLVIE-LPL--LKSANQCTLNVTSSEVHLISDSP..............................AKYKL
Q38DW7_TRYB2/46-377PYFRETVPAAYLVELH-IPT--VTTIAEVDVRVSPKRIELLYVD.CE...........................DGVPFL
KTU_XENTR/38-353ST.PSPVPKELVITVD-LPL--LNSAAGVNLHIAGKNLSLESEKP...............................AYKL
A4HNA2_LEIBR/59-420PYFKENVPAHFVIALH-LPG--VQTIREVDVRIGHRRVDCYYIDEVADGQEDDARAAASAGGDEGGTVVSKKGSGASPFL
Q4RM69_TETNG/40-350SA.QSPRPKEIVVTID-VPL--LKEVTGARVEARERMLLLESESP...............................AYRL

PF04969

Q5BL62_XENTR/138-214--------ENYSLNLH.LLH--AIVPDQSIFKVLST........K-----------------------------------
Q967H4_HYDVU/73-153--------NHLLQIVG.LAY--SIVPKESTCKIKSG........N-----------------------------------
Q5VJS2_XENLA/6-77--------PPFLFEAF.LFA--PIDDSTSSAKIGNG........V-----------------------------------
CHRD1_XENLA/229-305--------KTFQQNVQ.LWG--VIDVAKSYVSLTAT........K-----------------------------------
Q8I542_PLAF7/76-156--------HYRFCIKK.LCD--KIIPNKCSFKVKKD........S-----------------------------------
NUDC_SCHPO/9-86--------RKVLLSGP.LEK--QINLDESTWTVEEQ......E.R-----------------------------------
Q5BE89_EMENI/195-271--------KRYKDSYE.LFA--PIDPEKSTFKVLGT........K-----------------------------------
Q7RB97_PLAYO/167-241--------.I.YIEGE.FHK--HIKPEDSIWTLEDN......R.I-----------------------------------
Q5BXF1_SCHJA/230-307--------QIFERDFN.LYS--SIDPNQSVVKLMPL........K-----------------------------------
Q5U3E4_DANRE/132-208--------EDYCLKVH.LLH--PIVPQQSTYKILST........K-----------------------------------
Q8I2N9_PLAF7/17-92--------..NFLEGE.LFS--IIDEDCSYWFIEDN........N-----------------------------------
Y8359_ORYSJ/5-81--------NLYESKLE.LND--KVNVEESKISVGVR........S-----------------------------------
A0JLZ0_XENTR/417-505--------TVFRWQVK.LRN--LIEPDLCRYCFTGA........R-----------------------------------
SGT1_YEAST/185-267--------SEFQYNAK.LSH--EVDPKAVSLKIFPK........K-----------------------------------
Q75M67_ORYSJ/5-81--------TPYELDLE.LFD--AVNVEESKAAVAAR........S-----------------------------------
Q8VXX3_ARATH/19-93--------..PYLNHD.LSA--PVKTDCSFWTLEDD........I-----------------------------------
Q7Q5Z9_ANOGA/168-244--------.PAIIDGE.LCS--EIKIEDSLWHLEKN........A-----------------------------------
CHRD1_DROME/213-291--------ARFDLDLE.LRG--IVNVSNASAHMYGT........K-----------------------------------
GIT7_SCHPO/184-261--------SIFSLVLDPLYE--EIVPEKSSFKLFSS........K-----------------------------------
Q7Q5W9_ANOGA/4-76--------DTEPLVLT.LWN--PINTEQSTHKATPS........K-----------------------------------
Q9P6Y5_NEUCS/244-328--------RQATSTLV.LAG--EIDPSASRWSASPR........K-----------------------------------
Q7PYU2_ANOGA/81-161--------DYIFVVNN.LLN--SIDAEKSYRRVKSD........M-----------------------------------
Q84LL6_BETVU/136-211--------.PPIIDGE.LFK--PVKPDDCFWSLEDQ......K.S-----------------------------------
O81288_ARATH/9-85--------HVYELKLE.LAD--KVNVEESKINIGER........S-----------------------------------
Q5EEY5_NICBE/172-248--------ETYSFQPR.LFG--KITPAKCRYEVMST........K-----------------------------------
Q5U4Q1_XENTR/75-155--------NHTMTVNN.LLK--PISPEGSTKKVKTD........T-----------------------------------
Q5QIE1_MOUSE/6-77--------PPFLFELF.LYA--PIDDGKSKAKIGND........T-----------------------------------
Q5UTE8_ONCMY/4-79--------LKHHNELD.LFD--SIDPNASKHKRTDR........S-----------------------------------
NUDC_EMENI/32-114--------GEVFIDGQ.FPH--PIKPSESSWTLETTSKPPG.K.E-----------------------------------
Q8IN95_DROME/136-213--------ETIILEGN.LSQ--RIKHKEAVWTIDQN........R-----------------------------------
Q57UQ9_TRYB2/137-213--------.PPIVDGE.LFA--SVKTEESMWTIEDG......H.T-----------------------------------
Q5DAE2_SCHJA/158-238--------ETVYFDRD.LCW--DIHKNDAMWTFHSK......ENQ-----------------------------------
Q5JLZ9_ORYSJ/80-157--------NYRCAIPK.LHK--EIVPEKCKVLVKPT........K-----------------------------------
Q9STN7_ARATH/134-209--------.DLIVDGE.FFN--SVKPDDCFWNIEDQ......K.M-----------------------------------
NUDC_MOUSE/171-248--------.PPVVDGE.LYN--EVKVEESSWLIEDG......K.V-----------------------------------
Q5R370_HUMAN/33-113--------SYSMIVNN.LLK--PISVEGSSKKVKTD........T-----------------------------------
UBP19_HUMAN/286-374--------TTFRWQVK.LRN--LIEPEQCTFCFTAS........R-----------------------------------
Q8I2V1_PLAF7/85-164--------PKSLIEGK.LKG--SVDVNFSTWFLEKQKDCN....I-----------------------------------
NUDC1_XENLA/278-353--------..TFLKGQ.LYS--DVDCESSAWIMKEGR.......G-----------------------------------
Q5CJD2_CRYHO/4-76--------NEYEFKLD.FLK--PINKEESRYQVTR.........S-----------------------------------
NUDC2_RAT/17-91--------...ILKGK.LFD--STIADEGTWTLEDR......K.M-----------------------------------
Q5EBE9_XENTR/173-252--------ERVLVEGS.FTH--KINAETSLWSLEPG......K.C-----------------------------------
Q9VVA6_DROME/171-248--------.TPIIDGE.LCG--EVKTEESVWVLQDS......K.T-----------------------------------
Q9VYT5_DROME/294-367--------DEVIFDEE.LYA--SVGDDLSAFKLAEN........G-----------------------------------
Q6FKN1_CANGA/178-257--------SEFQYNID.LAH--NVDPQEYSVIVMSK........K-----------------------------------
Q584U3_TRYB2/25-100--------.SPLISGD.LYK--PVKVDECTWCVEDK......S.V-----------------------------------
Q5DCC6_SCHJA/11-87--------TDYEVKLD.LYG--QVCTEEPKVTTSGR........E-----------------------------------
Q7RGQ2_PLAYO/266-349--------KIILLDHK.LCG--KICCDDAYWVITKDYKINEK..H-----------------------------------
Q6CJS5_KLULA/181-260--------SEFQYSIM.LSH--NVDPTAIQVSVFTK........K-----------------------------------
Q7SDS3_NEUCR/193-271--------KRYKTEVS.LFG--PIVPEKSSYKILGT........K-----------------------------------
Q6DBR7_DANRE/227-303--------KVFHKDIH.LWG--VIDVKSSLVNMVPS........K-----------------------------------
Q9C8R4_ARATH/77-154--------NYRCAIPK.LCK--EIMPEKCKVLVKPK........R-----------------------------------
Q5CM61_CRYHO/144-218--------.V.IIDGE.LNS--KVKPDDCLWSIIDG......K.T-----------------------------------
Q7SG32_NEUCR/28-107--------.EPVIKGD.LPH--PILLDDSTWTLSPA..PAGQK.A-----------------------------------
Q5K7I7_CRYNJ/8-89--------EEQRIALKPLAS--TLSPGSSTYRVLGT........K-----------------------------------
CHRD1_DANRE/228-304--------KEFEKQIS.LWG--VIDPSKSLVNMMAT........K-----------------------------------
Q8SY87_DROME/3-74--------DGYELDLK.LLH--PIVVERSSYKAFST........K-----------------------------------
Q59X42_CANAL/219-296--------SEYNYYLDPLFA--EIVPSESKYKVYST........K-----------------------------------
Q8W065_ORYSJ/19-93--------..PYLNHD.LTL--PVKTDSSFWTIEDG........E-----------------------------------
Q9W3Y3_DROME/69-149--------DFGLTVNN.LLH--SIDVEKSYRKIKTD........M-----------------------------------
Q4T1P8_TETNG/506-594--------THFKWQVK.LRN--LIEPEQCSYSFTPS........R-----------------------------------
Q9FR62_BRANA/5-81--------TLYEVDLD.LLD--SVDVNESKASVSSR........S-----------------------------------
Q8IAW7_PLAF7/162-236--------....LEGM.FYE--EVDKQECVWSIEDK......K.N-----------------------------------
A8BM82_GIAIC/4-77--------NDYACKLT.LFA--PINPDESKYKVTGP........C-----------------------------------
Q6C1J0_YARLI/242-312--------SMYSWSTQ.LYA--PIVPSESSVQIYGT........K-----------------------------------
Q75EE3_ASHGO/168-248--------SEFQYSLT.LAH--PVDSECYSVVVLTK........K-----------------------------------
Q7RBZ0_PLAYO/162-245--------....LEGM.FYE--EVNKQECVWNIEDK......K.K-----------------------------------
Q6DC89_DANRE/17-91--------...IFKGK.LFG--STVCDEATWTLEDK......K.L-----------------------------------
NUDC1_MOUSE/275-349--------...VLEGK.LYS--SIDHEGSTWTIKEND.......S-----------------------------------
Q58CW7_BOVIN/186-265--------ERVLMEGK.FTH--KINTESSLWSLEPG......K.C-----------------------------------
Q9FR34_SOLLC/5-81--------VPYEVDLD.LFD--KINVDESKSSTTSR........S-----------------------------------
Q5VJS0_CIOIN/6-77--------PPFLFEVL.LNA--PIVDAKSAAKIRDG........C-----------------------------------
Q86F47_SCHJA/168-245--------.EPILCGK.LYN--EVKVEESSWTLLDG......L.V-----------------------------------
CHRD1_PONAB/230-306--------KEFEQNVK.LWG--VIDVKRSYVTMTAT........K-----------------------------------
ITBP2_MOUSE/219-295--------RVFQAQMK.LWG--VINVEQSSVSLMPS........R-----------------------------------
Q640C9_XENLA/166-243--------.KPVLDGE.LFN--DIKVEECSWLIEDG......K.V-----------------------------------
Q6Z2U7_ORYSJ/207-282--------.SFIIDGE.LFE--PVKVNDCLWTIEDG......N.T-----------------------------------
Q5M992_XENLA/17-91--------...VLKGK.LFD--STITDEATWTLEDR......K.L-----------------------------------
NB5R4_RAT/167-245--------HSYLIHIG.LSH--EVQENFSVRVIENVG.......K-----------------------------------
Q18949_CAEEL/5-78--------DEILFYGQ.LSG--QVKKDDLTVKCTAA........K-----------------------------------
Q6NYG2_DANRE/75-155--------NHQMTINN.LLF--PIIAAESSKKIKTD........M-----------------------------------
Q5ATX0_EMENI/1003-1080--------ADYAFNLDPLFA--SIDESASKVTTFST........K-----------------------------------
Q5CJI5_CRYHO/85-163--------KFYSFTVK.LHD--TISPEECSHKVKKD........M-----------------------------------
Q8W516_HORVU/175-251--------EPYHFQPR.LFS--KIVPDKCKYTVLST........K-----------------------------------
Q6CBP8_YARLI/6-81--------.PPVLQGD.LFG--KIAPEESTWTVEDQ......R.E-----------------------------------
Q8IDW4_PLAF7/214-288--------..VLIDGE.FFK--QIKPEESIWTLEDN......K.I-----------------------------------
Q5QIE2_CHICK/6-77--------PPFLFEAV.LYA--PIDETNSTAKIGNG........V-----------------------------------
Q6NZR9_DANRE/171-250--------RKVLLDGE.FTH--RINTENSLWSLEPG......R.C-----------------------------------
Q5DCB9_SCHJA/6-82--------DELLRKFH.LLH--DIVPEKSSYRVTGT........K-----------------------------------
Q6WMT0_BRABE/8-86--------KDYHCDIT.FFK--EVNVEESKYNATAR........G-----------------------------------
Q7RF79_PLAYO/75-155--------NYRFCIKK.LYD--KIIPNKCSIKIKKD........L-----------------------------------
A8X8G6_CAEBR/5-78--------EDVLFDGE.LFG--QVTSEDVTVKCTPA........K-----------------------------------
Q6P010_DANRE/6-77--------PPFLFEVF.LFA--SINEEKSEARIGNG........A-----------------------------------
Q704T1_BRAOL/156-232--------EAYHFQPR.LFG--KIIPEKCRYEVLST........K-----------------------------------
Q7RRD9_PLAYO/3-75--------NEYEFTLN.FLK--PINVEESKYTTKR.........N-----------------------------------
Q5KJJ7_CRYNJ/248-324--------KRVLKTVT.LYG--PIDPNVSSYRILST........K-----------------------------------
Q8SSJ3_ENCCU/5-78--------..IVIDGE.LLH--EVDVSSLWWVINGD........V-----------------------------------
Q6BXK8_DEBHA/178-255--------SEYNYNLEPLFA--EIDPQHSTSRIYST........K-----------------------------------
Q5K7J1_CRYNJ/33-108--------.SSILEGE.LYN--DIVVDDSSWTIDDG........T-----------------------------------
Q70ZY8_ASPFM/36-116--------.EALIEGD.FPH--PIIVDESSWTLETTSQPPG.K.E-----------------------------------

PF05455

GVPH2_HALSA/1-163--------DDLVVVAD-LPG--VTDETAVDAAVE.DTGALTISVG--------------DDVVERLTLDDPGMTITSLTV
GVPH1_HALSA/8-182--------DELVVVAD-LPG--VTDDD.VDVALDTDEQALTLRVD--------------DDVVERVVLDRPDVAITDMTL
O33403_NATVU/1-181--------.GVTVLAD-LPS--V.DEKSLDVDLETGVPAIIIKHK--------------DRVLKRLEFGEQITEIEQMEY
GVPH_HALME/36-216--------.ERVVIAD-LPG--VADDE.LDVTLDADESALELRTD--------------EGIVGRVPLDQPDVEITDVRL

PF00011

SP21_STIAD/57-157----LTLTLPKRPEV.......QPKRIQVA---
ACR_MYCTU/45-141----LTVSVAV.SEGKP.....TEKHIQIR---
HSP26_YEAST/96-207----LTLTVPKLKPQKDG..KNHVKKIEVS---
HS174_ORYSJ/50-153----LTVTVPKEEPKKP.....DVKSIQIT---
HSP17_ARATH/52-155----LSVTVPK.VQESK....PEVKSVDIS---
18KD_MYCLE/31-129----LKLSIPVAERA.......KPRKISVD---
CRYAA_ALLMI/63-162----LTFSGSKVQSNVDT..IHSDRPIPVA---
CRYAA_SQUAC/63-162----LTLCCPKTRPGDDS..NWQDRPIPVS---
CRYAB_ANAPL/66-161----LTVSAPRKQSDV......PERSIPIT---
CRYAB_SQUAC/69-164----LTITGPRKVADV......PERSVPIS---
HSP11_CAEEL/42-135----LSIEAPKKEAI.......QGRSIPIQ---
HSP11_CHERU/58-161----LTVTVPK.NEAPK....PQVKAINVY---
HSP11_DAUCA/53-156----VTVTVPK.VEIKK....PEVKAIDIS---
HSP16_CAEEL/46-138----LQIEAPKKTN........SSRSIPIN---
HSP18_CLOAB/48-151----LRITLPKKVKGKD.....NGRRIDIH---
HS176_ARATH/48-153----LKVTVQKLPPPEP....KKPKTIQVQ---
HSP21_MAIZE/56-159----LTVTVEKLPPPEP....KKPKTIEVK---
HSP21_PEA/46-150----LTVTVNKLPPPEP....KKPKTIQVK---
HSP21_IPONI/48-153----LTVTVENVPPPEP....KKPRTIEVK---
HSP22_IPONI/59-165----LQVTVEKLPPPEP....KKPKTVEVK---
HSP23_DROME/63-161----LTIKVPKPPAIEDK..G.NERIVQIQ---
HSPB1_CHICK/85-182----LTVEAPLPKPAIQ...S.SEITIPVT---
HSP26_DROME/81-179----LTVSIPKPQAVEDK..S.KERIIQIQ---
HSP27_DROME/82-180----LTLKAPPPPSKEQA..K.SERIVQIQ---
HS25P_ARATH/130-227----LFITIPKTKVE......RKVIDVQIQ---
HS23C_CHERU/108-202----LKVTVPKIKEE......EKKDVFQVM---
HS22C_CHLRE/50-155----LVVTVPKREPPAK....PEPKRIAVT---
HS21C_PEA/134-232----LYITIPKTKIE......RTVIDVQIQ---
HS22C_PETHY/143-241----LLISIPKTKVE......KKVTDVEIK---
HS22C_SOYBN/81-181----LYITIPKTKVE......RKVIDVQVQ---
HS21C_WHEAT/134-238----LLVSVPKRETE......RKVIDVQVQ---
HS30C_XENLA/86-186----LHIQAPRLALPPA.....PETPIPIS---
HSP41_PEA/78-182----LTLTLHKLSHDKI....KGPRMVSIV---
HSP6A_DROME/119-220----LTVKAPQPLPVVKGSLERQERIVDIQ---
IBPA_SHIFL/39-137----LYIDLERVIPEAK.....KPRRIEIN---
IBPB_SHIFL/37-135----LHIDLIRNEPEPI.....AAQRIAIS---
OV251_ONCVO/61-159----LTICANKTAVGTT.....ASRNIPIR---

PF08190

Q29L71_DROPS/1272-1547D...KFVNYRLQQDRARALFDKTSK.......M
KTU_HUMAN/43-348R...LSLPYPVDDGRGKAQFNKARRQLVVTLPV
KTU_DROPS/50-355K...LDLPFVVDDKAGNARFDTEKRRLSITLPV
KTU_DANRE/39-392E...LPLAYPVEEERAEAQFNHTHRLLTVTLPV
Q9VK57_DROME/30-332N...KFVNYRLQQDRAQALFDKTTKMLHVRIPV
A7RX96_NEMVE/21-309........VPVKDEETSATFNKSKHKLTIKIPT
A0DMA1_PARTE/44-380D...IKLPYPIEQTEASAKFDAKSKTLKIRAPI
PIHD2_MOUSE/19-314C...LNLPESINTEMTTAKFVKNKSALIITMPL
PIHD2_DANRE/22-321L...LPFPELVKEETCTAKFNKKKQTLNVTVNV
PIHD2_HUMAN/19-314H...LNLPKLIDTEMTTAKFIKEKSTLIITMPL
A0CTY4_PARTE/36-334S...LRFPSKINKSSVKALFLTEKRTLWISADV
PIHD1_HUMAN/28-285D...AYIPLQINSHESKAAFHRKRKQLMVAMPL
PIHD2_XENTR/21-320L...LNLPQAVNEETVAAKFNKANYILLVTMPT
E9AFR0_LEIMA/55-423S...LTLDYPVSDDVVEAKYVRKTSLLKLKLAV
KTU_ANOGA/36-354E...LKLPYEVKESEGKATFNVEARSLTVTLPV
PIHD1_XENLA/25-294D...IFLPYNIVQEESGAQFNRDTKVLTITMPV
PIHD1_DANRE/26-284D...IFFPVLIDQENSVAQYNTNTQTLTVTMPV
Q4DT93_TRYCC/46-391S...IPLDYPIDEDAPNAKFVRKTHMLKMQLLV
A7SEW3_NEMVE/38-354DICHITLPYPIDENKGSAKFDKSKQQLVVTLLV
Q17BY1_AEDAE/23-351D...AFVDYQIDGSRISAQFNTKTKMLNVIMPV
A7RZC7_NEMVE/25-290D...LDLPHNVDVETCGAQFNKKTK.......V
KTU_AEDAE/38-346E...VKLPYTVLEKNGSAKFNTDETTLTVLLPV
Q38DW7_TRYB2/46-377T...VPLGYPIDEELQDAKFVRKTRTLKLKLRV
KTU_XENTR/38-353N...VKLPYAVEDNQGKAQFNKVKKQLIITVPV
A4HNA2_LEIBR/59-420S...LTLDYPVSDDVMEAKYVRKTSLLKLKLAV
Q4RM69_TETNG/40-350E...LPLAYPVDEEKGEAKFSKQKGQLTVTLPV

PF04969

Q5BL62_XENTR/138-214----VEIKLKK----------------------
Q967H4_HYDVU/73-153----VVISMKK----------------------
Q5VJS2_XENLA/6-77----ILFNLHK----------------------
CHRD1_XENLA/229-305----VEVFLKK----------------------
Q8I542_PLAF7/76-156----VHVTLVK----------------------
NUDC_SCHPO/9-86----LVIHLEK----------------------
Q5BE89_EMENI/195-271----LELMLVK----------------------
Q7RB97_PLAYO/167-241----IHISIEK----------------------
Q5BXF1_SCHJA/230-307----AEIILKK----------------------
Q5U3E4_DANRE/132-208----IEIKMKK----------------------
Q8I2N9_PLAF7/17-92----LHILLTK----------------------
Y8359_ORYSJ/5-81----IFCIVEK----------------------
A0JLZ0_XENTR/417-505----VDISLQK----------------------
SGT1_YEAST/185-267----LEITLSK----------------------
Q75M67_ORYSJ/5-81----ICYLIKK----------------------
Q8VXX3_ARATH/19-93----MHITLQK----------------------
Q7Q5Z9_ANOGA/168-244----VVVTVEK----------------------
CHRD1_DROME/213-291----VEIKLPK----------------------
GIT7_SCHPO/184-261----VEITLIK----------------------
Q7Q5W9_ANOGA/4-76----VEVKLAK----------------------
Q9P6Y5_NEUCS/244-328----IELVLQK----------------------
Q7PYU2_ANOGA/81-161----VAIYLAK----------------------
Q84LL6_BETVU/136-211----ISMLLTK----------------------
O81288_ARATH/9-85----IFCIIEK----------------------
Q5EEY5_NICBE/172-248----IEIRLAK----------------------
Q5U4Q1_XENTR/75-155----VLIMCRK----------------------
Q5QIE1_MOUSE/6-77----ILFTLYK----------------------
Q5UTE8_ONCMY/4-79----VLCCLKK----------------------
NUDC_EMENI/32-114----VSIHLDK----------------------
Q8IN95_DROME/136-213----LIISYDK----------------------
Q57UQ9_TRYB2/137-213----VVVTLTK----------------------
Q5DAE2_SCHJA/158-238----IHLCLDK----------------------
Q5JLZ9_ORYSJ/80-157----IIVTLYK----------------------
Q9STN7_ARATH/134-209----ISVLLTK----------------------
NUDC_MOUSE/171-248----VTVHLEK----------------------
Q5R370_HUMAN/33-113----VLILCRK----------------------
UBP19_HUMAN/286-374----IDICLRK----------------------
Q8I2V1_PLAF7/85-164----LNIVLKK----------------------
NUDC1_XENLA/278-353----VEVTLTK----------------------
Q5CJD2_CRYHO/4-76----LHFMITK----------------------
NUDC2_RAT/17-91----VRIVLTK----------------------
Q5EBE9_XENTR/173-252----IVISLSK----------------------
Q9VVA6_DROME/171-248----VMITLDK----------------------
Q9VYT5_DROME/294-367----LELSLTK----------------------
Q6FKN1_CANGA/178-257----FEITFKK----------------------
Q584U3_TRYB2/25-100----LVVTLVK----------------------
Q5DCC6_SCHJA/11-87----VVICIKK----------------------
Q7RGQ2_PLAYO/266-349----IHLVLSK----------------------
Q6CJS5_KLULA/181-260----LEVTLGK----------------------
Q7SDS3_NEUCR/193-271----LEVTLWK----------------------
Q6DBR7_DANRE/227-303----VEVSMRK----------------------
Q9C8R4_ARATH/77-154----IVITMVK----------------------
Q5CM61_CRYHO/144-218----IQIVLEK----------------------
Q7SG32_NEUCR/28-107----LEIHLEK----------------------
Q5K7I7_CRYNJ/8-89----IELKLAK----------------------
CHRD1_DANRE/228-304----IEIVLKK----------------------
Q8SY87_DROME/3-74----VEITLAK----------------------
Q59X42_CANAL/219-296----LEITLKK----------------------
Q8W065_ORYSJ/19-93----MHITLQK----------------------
Q9W3Y3_DROME/69-149----VAIYLQK----------------------
Q4T1P8_TETNG/506-594----LDITLKK----------------------
Q9FR62_BRANA/5-81----VFYLVKK----------------------
Q8IAW7_PLAF7/162-236----IIIYLEK----------------------
A8BM82_GIAIC/4-77----IESILQK----------------------
Q6C1J0_YARLI/242-312----VDFTLMK----------------------
Q75EE3_ASHGO/168-248----VEVVLQK----------------------
Q7RBZ0_PLAYO/162-245----IIIFLEK----------------------
Q6DC89_DANRE/17-91----IRIVLMK----------------------
NUDC1_MOUSE/275-349----LEISLIK----------------------
Q58CW7_BOVIN/186-265----VLVSLNK----------------------
Q9FR34_SOLLC/5-81----IVYLVKK----------------------
Q5VJS0_CIOIN/6-77----VIFTLIK----------------------
Q86F47_SCHJA/168-245----ISVNLEK----------------------
CHRD1_PONAB/230-306----IEITMRK----------------------
ITBP2_MOUSE/219-295----VEISLVK----------------------
Q640C9_XENLA/166-243----VTVHLEK----------------------
Q6Z2U7_ORYSJ/207-282----LSILLTK----------------------
Q5M992_XENLA/17-91----IRIVLTK----------------------
NB5R4_RAT/167-245----IEIVLQK----------------------
Q18949_CAEEL/5-78----VEVRLPK----------------------
Q6NYG2_DANRE/75-155----VLIMCKK----------------------
Q5ATX0_EMENI/1003-1080----IELVLRK----------------------
Q5CJI5_CRYHO/85-163----IVITLKK----------------------
Q8W516_HORVU/175-251----VEIRLAK----------------------
Q6CBP8_YARLI/6-81----VTISIEK----------------------
Q8IDW4_PLAF7/214-288----IHIFIEK----------------------
Q5QIE2_CHICK/6-77----VFFTLYK----------------------
Q6NZR9_DANRE/171-250----VLLSLSK----------------------
Q5DCB9_SCHJA/6-82----VEIKLRK----------------------
Q6WMT0_BRABE/8-86----LKFLIKK----------------------
Q7RF79_PLAYO/75-155----IQVYLIK----------------------
A8X8G6_CAEBR/5-78----IEIRLPK----------------------
Q6P010_DANRE/6-77----AVFTLQK----------------------
Q704T1_BRAOL/156-232----VEIRLAK----------------------
Q7RRD9_PLAYO/3-75----IKFKIIK----------------------
Q5KJJ7_CRYNJ/248-324----VEITLVK----------------------
Q8SSJ3_ENCCU/5-78----VDVNVTK----------------------
Q6BXK8_DEBHA/178-255----LEITLKK----------------------
Q5K7J1_CRYNJ/33-108----LTIELDK----------------------
Q70ZY8_ASPFM/36-116----VSVHLDK----------------------

PF05455

GVPH2_HALSA/1-163TNQILELRVTPSEPS...ATDT-----------
GVPH1_HALSA/8-182RNQVLEIRLARTSDTDG.GEST-----------
O33403_NATVU/1-181NNNVLEIRLKGSSEPQGENDDA-----------
GVPH_HALME/36-216RNQVLEIRLTRTNESNG.SESK-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window