Sequence alignment for CL0190

PF08190

KTU_HUMAN/43-348LTDPENR......RRYEAEITALERERG.VE.VRFVHPEPGHVLRTSLDGA.R...RCFVNVCSNALVGAP...SSRPGS
KTU_DROPS/50-355VQDPENR......KIYEQEITQLEKERG.VD.IKFVHPKPGFVVKTSIDGE.L...KCFINIASSPEVARP...NSEVGM
KTU_DANRE/39-392ISSPENR......RRYEEEIRRLEEERG.AA.VQFIHPTPHHVLKGRGPSG.....KCFINICSDQLIEKP...RSEAAT
Q9VK57_DROME/30-332INQYFGG......ADPEGS.GPQQKPPP.RD.SLIVQPTAGICVKSFKTNS.D..EKFFINVCQAAEVPAPQDVTEEELI
A0DMA1_PARTE/44-380ISDPKNR......EEYDQYLKQLERESELPKGMKLIKPEPHFCVKTSICKEITLQFKFFINICSTSVIDKP.....QSET
A0CTY4_PARTE/36-334LTDPEYL........KLKDIQEYLDQEG....GMMIEPTPHFVLKAFDQNG.E...KVFFNVTAHSVVDAP...EEKQLI
E9AFR0_LEIMA/55-423LRTLQSRLQEEATKEAKEDLEQVHSDEQ.GQ.WMFVLPDPGFCIKTNVAGG.A...KVFINVCQHARIGEPVPMEPENGS
KTU_ANOGA/36-354LRD..NR......KQYEDELSMLEAQRG.YD.VKFLKPSPGYVIKTIVDGK.G...KGFINVCQSELVQKP...TSTTGL
Q4DT93_TRYCC/46-391LRDIQMRIQEESRNAMKSKLEAIQSDEN.GQ.WMYVLPEPGFCVKCTTSGG.G...KIFLNVCQHERIAEPIPMEEDEKT
A7SEW3_NEMVE/38-354ISDPENK......KRYEEEIRQMENERG.MD.VKFVNPEEGFVVKTTRETD.G..IKAFVNICYNQHIEKATFRMAEKGD
Q17BY1_AEDAE/23-351VRDETEEQ...FNSMFGPIVEQAQDISS.GR.SKVVKPTPGFCIKAFRKDT.R..NKFFINVCQTDGIPAPEDITEDQLM
KTU_AEDAE/38-346LKDPENR......KQYEEELKLMEAERG.YD.VKFIKPLPGYVIKTVVDGK.T...KAFVNVCHCDLVGKP...SSQCST
Q38DW7_TRYB2/46-377LADLQKKIQEESMKSAKAKLEEIHSDEN.GQ.WMYILPEPGFCVKCKVAGG.G...KVFVNVCKHERIAEPIPIDDDNEA
KTU_XENTR/38-353ISDPENR......KKYEQEIYKMENERG.MD.IKFIHPKPGYVLLSSVNGV.Q...KCYLNICSNDLIQKP...EFKPGK
H3DIW3_TETNG/40-350LADPENR......RRYEEEIKILEQNRG.NT.IEFIHPEPVKALRTCMNGS.Q...KCYINICASEKIGKP...SCSPKV

PF00011

SP21_STIAD/57-157--------------------------------------------------------------------------------
HSP26_YEAST/96-207--------------------------------------------------------------------------------
HS174_ORYSJ/50-153--------------------------------------------------------------------------------
HSP17_ARATH/52-155--------------------------------------------------------------------------------
18KD_MYCLE/31-129--------------------------------------------------------------------------------
CRYAB_ANAPL/66-161--------------------------------------------------------------------------------
HSP11_CAEEL/42-135--------------------------------------------------------------------------------
HSP16_CAEEL/46-138--------------------------------------------------------------------------------
HSP18_CLOAB/48-151--------------------------------------------------------------------------------
HS176_ARATH/48-153--------------------------------------------------------------------------------
HSP21_MAIZE/56-159--------------------------------------------------------------------------------
HSP23_DROME/63-161--------------------------------------------------------------------------------
HSPB1_CHICK/85-182--------------------------------------------------------------------------------
HSP26_DROME/81-179--------------------------------------------------------------------------------
HSP27_DROME/82-180--------------------------------------------------------------------------------
HS25P_ARATH/130-227--------------------------------------------------------------------------------
HS22C_SOYBN/81-181--------------------------------------------------------------------------------
HS21C_WHEAT/134-238--------------------------------------------------------------------------------
HSP6A_DROME/119-220--------------------------------------------------------------------------------
A8I6R6_CHLRE/50-154--------------------------------------------------------------------------------
F7C8L7_XENTR/32-130--------------------------------------------------------------------------------
I1LC12_SOYBN/73-176--------------------------------------------------------------------------------
ACR_MYCTU/48-140--------------------------------------------------------------------------------
IBPA_SHIDS/42-137--------------------------------------------------------------------------------
Q329C7_SHIDS/41-137--------------------------------------------------------------------------------

PF04969

Q5K7J1_CRYNJ/33-108--------------------------------------------------------------------------------
Q7Q5Z9_ANOGA/168-244--------------------------------------------------------------------------------
CHRD1_PONAB/230-306--------------------------------------------------------------------------------
K4BTK3_SOLLC/5-81--------------------------------------------------------------------------------
F5HGH3_NEUCR/244-328--------------------------------------------------------------------------------
F6YV35_XENTR/75-156--------------------------------------------------------------------------------
CHRD1_DANRE/228-304--------------------------------------------------------------------------------
Q9VVA6_DROME/171-248--------------------------------------------------------------------------------
NUDC2_RAT/17-91--------------------------------------------------------------------------------
M4E6X8_BRARP/5-81--------------------------------------------------------------------------------
W5CHI3_WHEAT/107-183--------------------------------------------------------------------------------
Q8L7U4_ARATH/5-81--------------------------------------------------------------------------------
Q5K7I7_CRYNJ/8-89--------------------------------------------------------------------------------
Q9VYT5_DROME/294-367--------------------------------------------------------------------------------
BOB2_ARATH/134-209--------------------------------------------------------------------------------
A0A0R4IY34_DANRE/171-250--------------------------------------------------------------------------------
Q75M67_ORYSJ/5-81--------------------------------------------------------------------------------
Q8I2N9_PLAF7/17-92--------------------------------------------------------------------------------
NUDC_MOUSE/171-248--------------------------------------------------------------------------------
SGT1_YEAST/185-267--------------------------------------------------------------------------------
Q8VXX3_ARATH/19-93--------------------------------------------------------------------------------
F6ZRN5_XENTR/19-98--------------------------------------------------------------------------------
Y8359_ORYSJ/5-81--------------------------------------------------------------------------------
Q75EE3_ASHGO/168-248--------------------------------------------------------------------------------
Q7PYU2_ANOGA/81-161--------------------------------------------------------------------------------
Q6Z2U7_ORYSJ/207-282--------------------------------------------------------------------------------
CHRD1_DROME/213-291--------------------------------------------------------------------------------
Q7RGQ2_PLAYO/266-349--------------------------------------------------------------------------------
Q8I542_PLAF7/76-156--------------------------------------------------------------------------------
Q6CJS5_KLULA/181-260--------------------------------------------------------------------------------
Q6CBP8_YARLI/6-81--------------------------------------------------------------------------------
Q4WN97_ASPFU/36-116--------------------------------------------------------------------------------
K4BEI9_SOLLC/172-248--------------------------------------------------------------------------------
A8BM82_GIAIC/4-77--------------------------------------------------------------------------------
Q9C8R4_ARATH/77-154--------------------------------------------------------------------------------
Q9W3Y3_DROME/69-149--------------------------------------------------------------------------------
Q8SSJ3_ENCCU/5-78--------------------------------------------------------------------------------
Q7RF79_PLAYO/75-155--------------------------------------------------------------------------------
C8V7I9_EMENI/315-392--------------------------------------------------------------------------------
CYBP_HUMAN/76-156--------------------------------------------------------------------------------
NUDC1_MOUSE/275-349--------------------------------------------------------------------------------
F7DCK1_XENTR/141-218--------------------------------------------------------------------------------
Q5KJJ7_CRYNJ/248-324--------------------------------------------------------------------------------
Q8IDW4_PLAF7/214-288--------------------------------------------------------------------------------
C3ZHN0_BRAFL/16-94--------------------------------------------------------------------------------
UBP19_HUMAN/285-374--------------------------------------------------------------------------------
H3C642_TETNG/316-405--------------------------------------------------------------------------------
Q6DBR7_DANRE/227-303--------------------------------------------------------------------------------
V5IRH3_NEUCR/26-105--------------------------------------------------------------------------------
Q6DC89_DANRE/17-91--------------------------------------------------------------------------------
Q584U3_TRYB2/25-100--------------------------------------------------------------------------------
Q24K01_BOVIN/186-265--------------------------------------------------------------------------------
F7AJ60_XENTR/138-214--------------------------------------------------------------------------------
Q7RRD9_PLAYO/3-75--------------------------------------------------------------------------------
Q7RB97_PLAYO/167-241--------------------------------------------------------------------------------
Q7Q5W9_ANOGA/4-76--------------------------------------------------------------------------------
Q6FKN1_CANGA/178-257--------------------------------------------------------------------------------
NUDC_EMENI/32-114--------------------------------------------------------------------------------
NB5R4_RAT/167-245--------------------------------------------------------------------------------
Q5JLZ9_ORYSJ/80-157--------------------------------------------------------------------------------
Q5U3E4_DANRE/132-208--------------------------------------------------------------------------------
Q8I2V1_PLAF7/85-164--------------------------------------------------------------------------------
Q6BXK8_DEBHA/178-255--------------------------------------------------------------------------------
GIT7_SCHPO/184-261--------------------------------------------------------------------------------
ITBP2_MOUSE/219-295--------------------------------------------------------------------------------
B0S6K3_DANRE/75-155--------------------------------------------------------------------------------
G4U823_NEUT9/193-271--------------------------------------------------------------------------------
Q8IN95_DROME/136-213--------------------------------------------------------------------------------
F6WW93_XENTR/416-505--------------------------------------------------------------------------------
Q57UQ9_TRYB2/137-213--------------------------------------------------------------------------------
Q8W065_ORYSJ/19-93--------------------------------------------------------------------------------
NUDC_SCHPO/9-86--------------------------------------------------------------------------------

PF05455

GVPH2_HALSA/1-163--------------------------------------------------------------------------------
GVPH1_HALSA/8-182--------------------------------------------------------------------------------

PF08190

KTU_HUMAN/43-348GGDRGAAPGSHWSLPYSLAPGREYAGRSSSRYMVYDVVFH-PDALALARRH-EGF-RQMLDATALEAVEKQ--F...GVK
KTU_DROPS/50-355NPETGGR.GLSWSIPMAQTGGRDDCDAKNNHCKVFDVVFH-PDALHLSTRD-SQF-RKALIDTALDAVERE--Y...EVA
KTU_DANRE/39-392DDR.GRS.GHSWRIPYSLTPGRAGRDAAGAPCVLFDAVFH-PDALLMAENN-ARF-MTLIHRTATGGIQDN--F...RIR
Q9VK57_DROME/30-332GILESTT.PGSYRVPMSISDPRFTKDRSDKTVDVCDIAIN-PKFLVKIQKS-QLF-KNFFMQIVIEAMSEK--Y...NVQ
A0DMA1_PARTE/44-380ITQNGQT.GQNWKIPYSIGKIRYDQDKKQNICNTVDVAFH-PTTIGLCYKT-PNF-KNLVCSTALEASGKQ--LGERNEE
A0CTY4_PARTE/36-334DYNN....EVGIRVPMSVGSIKEDHDVKGDTCKVIDLVIN-PTVATNLTQD-DNL-KTFFCQLVQTYVDQK--Y...KLK
E9AFR0_LEIMA/55-423AGQGDTA.EMRYRIPISCGQARPGKDKGGKPCKVYDVIVN-PSTMQRCGKD-HEF-RRFVAALCMQWIKQK--S...EPT
KTU_ANOGA/36-354NED.GTK.GLKWSVPYAQTQPRKDYDNKRVECTVYDVMFH-PDALHLASKN-EGF-RKLLNDTSLDAVEQS--F...KVR
Q4DT93_TRYCC/46-391D.......EIKFKIPLSCGQARPGTDKSGKPCKVYDVIVN-PSTVQRCSKD-HEF-RCFVVSLCIHWIKQK--C...EPT
A7SEW3_NEMVE/38-354GTE.RKK.GQQWSIPYSLAQPRDDFDRAGKKCVTFDVVFH-PDTYKKCTKM-PQF-KKMVIETALEGIERQ--L...NIK
Q17BY1_AEDAE/23-351AILNDGT.PSSFKIPMSITQPRFMKDHLDKQCQVCDIAVN-STFFKKIESG-GLM-RDFLITIVLEGIDSK--Y...NIA
KTU_AEDAE/38-346NKR.GEK.GLKWSIPYAQSQPRKDYDNKNVDCVVYDVVFH-YDTLHLTKSN-KNF-RKLVTDTALDAVEGA--F...HVS
Q38DW7_TRYB2/46-377........EVKFRIPLSCGQARAESDKSGKPCKVYDVIVN-PSTIHRCTQD-HDF-RCFVISLCIHWIQQK--S...EPT
KTU_XENTR/38-353DGE.GKA.GLHWSLPYSLSPGRDDLSKDWSKHVIYDVVFH-PDTLHIASKN-GKF-KGIVDSTALEAVASQ--F...NVT
H3DIW3_TETNG/40-350LED.GRG.TLCWALPHILHPKKQELYRKGHKVTIYDVVFH-PETLDLASKN-KTF-LDMVHDTAIQGIQSA--F...SVS

PF00011

SP21_STIAD/57-157-----------------------------------EVRET-KEAYIFKADL-PGV-D.EK.DIEVTLTGDR..V------
HSP26_YEAST/96-207-----------------------------------DILDH-DNNYELKVVV-PGV-KSKK.DIDIEYHQNKNQI------
HS174_ORYSJ/50-153-----------------------------------DWKET-PEAHVFKADV-PGL-K.KE.EVKVEVEDGN..V------
HSP17_ARATH/52-155-----------------------------------DWRET-PEAHVFKADV-PGL-K.KE.EVKVEVEDGN..I------
18KD_MYCLE/31-129-----------------------------------DAWRE-GEEFVVEFDL-PGI-K.AD.SLDIDIERNV..V------
CRYAB_ANAPL/66-161-----------------------------------EMRLE-KDKFSVNLDV-KHF-S.PE.ELKVKVLGDM..V------
HSP11_CAEEL/42-135-----------------------------------EIVNN-DQKFAINLNV-SQF-K.PE.DLKINLDGHT..L------
HSP16_CAEEL/46-138-----------------------------------EIVND-ESKFSVQLDV-SHF-K.PE.NLKIKLDGRE..L------
HSP18_CLOAB/48-151-----------------------------------DIKED-DDKYTVAADL-PGV-K.KD.NIELQYENNY..L------
HS176_ARATH/48-153-----------------------------------DVIEH-PNAYAFVVDM-PGI-K.GD.EIKVQVENDN..V------
HSP21_MAIZE/56-159-----------------------------------DVKEL-PGAYAFVVDM-PGL-G.TG.DIKVQVEDER..V------
HSP23_DROME/63-161-----------------------------------VSKIG-KDGFQVCMDV-SHF-K.PS.ELVVKVQDNS..V------
HSPB1_CHICK/85-182-----------------------------------EIRQS-ADSWKVTLDV-NHF-A.PE.ELVVKTKDNI..V------
HSP26_DROME/81-179-----------------------------------TAHVG-KDGFQVCMDV-AQF-K.PS.ELNVKVVDDS..I------
HSP27_DROME/82-180-----------------------------------LPAVG-KDGFQVCMDV-SQF-K.PN.ELTVKVVDNT..V------
HS25P_ARATH/130-227-----------------------------------DIKEE-EHEIKMRFDM-PGL-S.KE.DVKISVEDNV..L------
HS22C_SOYBN/81-181-----------------------------------DIKDE-EHEIRMRFDM-PGL-A.KE.DVKVSVEDDM..L------
HS21C_WHEAT/134-238-----------------------------------DIMED-EKEVKMRFDM-PGL-S.RE.EVRVMVEDDA..L------
HSP6A_DROME/119-220-----------------------------------YSVVN-RNGFQVSMNV-KQF-A.AN.ELTVKTIDNC..I------
A8I6R6_CHLRE/50-154-----------------------------------DIIES-PTAFELHADA-PGM-G.PD.DVKVELQEGV..L------
F7C8L7_XENTR/32-130-----------------------------------..KDG-KDHFELTLDV-RDF-S.PH.ELTVKMQGRR..V------
I1LC12_SOYBN/73-176-----------------------------------DWKET-PEGHVIMLDV-PGL-K.RE.EIKIEVEENR..V------
ACR_MYCTU/48-140-----------------------------------.....-EGRYEVRAEL-PGV-D.PDKDVDIMVRDGQ..L------
IBPA_SHIDS/42-137-----------------------------------...VD-ENHYRIAIAV-AGF-A.ES.ELEITAQDNL..L------
Q329C7_SHIDS/41-137-----------------------------------..KSD-DNHYRITLAL-AGF-R.QE.DLEIQLEGTR..L------

PF04969

Q5K7J1_CRYNJ/33-108-------------------------------LPY.SWTQE.LATATVTVPL.PK..GTRSKDLEVV.......I------
Q7Q5Z9_ANOGA/168-244-------------------------------DKY.SWTQT.LQELELRVPF.DVKFTLKAKDVVVS.......I------
CHRD1_PONAB/230-306-------------------------------CRH.DWHQT.GGEVTISVYA.KNS.LPELSRVEAN........------
K4BTK3_SOLLC/5-81-------------------------------PTI.KWAQR.SDKLFITVEL.PDA.....KNVKLK.......L------
F5HGH3_NEUCR/244-328-------------------------------LRI.DFYQT.NQTVTVSLFV.KDV...KKEDLKVE.......F------
F6YV35_XENTR/75-156-------------------------------NNYAGWDQS.EKFVKIYITL.NGVQNIPAANVQVH.......F------
CHRD1_DANRE/228-304-------------------------------CRF.DWHQT.GSQVIISIYA.KNS.VPELSLVEGN........------
Q9VVA6_DROME/171-248-------------------------------ENY.TWTQT.LEEVELKIPF.NLTFGLRARDLVIS.......I------
NUDC2_RAT/17-91-------------------------------PWG.QWYQT.LEEVFIEVQV.PP..GTRAQDIQCG.......L------
M4E6X8_BRARP/5-81-------------------------------PTV.KWAQR.SDWVYITVEL.PDA.....EDVKLK.......L------
W5CHI3_WHEAT/107-183-------------------------------YRH.DYYNT.PTEVVLTIFA.KGV...PADSVVVD.......F------
Q8L7U4_ARATH/5-81-------------------------------PEV.KWAET.TEKIFLTVVL.ADT.....KDTKVN.......L------
Q5K7I7_CRYNJ/8-89-------------------------------PRY.DFYQT.PNELILALYI.KGY.DKLKDDVKVE.......F------
Q9VYT5_DROME/294-367-------------------------------PSY.SWSQT.DNNVLIRFNV.PS..TASAKEFNVS.......G------
BOB2_ARATH/134-209-------------------------------EKY.SWGQN.LQEVTINIPM.PE..GTKSRSVTCE.......I------
A0A0R4IY34_DANRE/171-250-------------------------------EKY.TWSQD.YTDVEVRVHVEPD..IIKGRQVCVD.......L------
Q75M67_ORYSJ/5-81-------------------------------PST.KWAQR.SDKVFLTIEL.PDA.....RDVKLN.......L------
Q8I2N9_PLAF7/17-92-------------------------------LIY.EWEQS.IDEINIYIDMNSK..LVNKNDLNIE.......I------
NUDC_MOUSE/171-248-------------------------------PNY.RWTQT.LAELDLAVPF.RVSFRLKGKDVVVD.......I------
SGT1_YEAST/185-267-------------------------------FKI.DWYQS.STSVTISLFT.VNL.PESKEQVNIY.......I------
Q8VXX3_ARATH/19-93-------------------------------KVF.EWDQT.LEEVNMYITL.PP..NVHPKSFHCK.......I------
F6ZRN5_XENTR/19-98-------------------------------KNY.VWSQD.YTDVEIKVPV.PKS.VIKGRQVSVD.......L------
Y8359_ORYSJ/5-81-------------------------------PEV.KWAQR.IDKVYITVQL.ADA.....KDAKVN.......L------
Q75EE3_ASHGO/168-248-------------------------------SRM.EWYQT.TQKVTISLFV.SKL.PRSHSEVIVQ......VV------
Q7PYU2_ANOGA/81-161-------------------------------KEY.AWDQS.DKFIKIFVTV.NGVQQVPEDNVNVE.......F------
Q6Z2U7_ORYSJ/207-282-------------------------------EKY.SWTQE.RPEVTITIPV.PQ..GTKSSLVTYE.......I------
CHRD1_DROME/213-291-------------------------------CRY.DWHQT.ATNVVMAIYA.KKY.DYSQSVIELN........------
Q7RGQ2_PLAYO/266-349-------------------------------TKF.DWRES.LDHIELNIPI.FD..ETNQEDILFQ.......I------
Q8I542_PLAF7/76-156-------------------------------QSF.AWNQE.RNKVTIFLTV.KNVHTVGEEKISTV.......F------
Q6CJS5_KLULA/181-260-------------------------------LKM.DWYQS.SSTVTLSLFT.KNL.PNSKSDVNVS.......I------
Q6CBP8_YARLI/6-81-------------------------------EHY.AWRQT.LQDITITFPV.PP..GTRGKQMDIK.......F------
Q4WN97_ASPFU/36-116-------------------------------LPY.KWTQT.IRDVDVTIPV.PA..NIKGRDLDVV.......L------
K4BEI9_SOLLC/172-248-------------------------------YRH.EFYQK.PEEVVVTIFA.KGI...PAKNVVVD.......F------
A8BM82_GIAIC/4-77-------------------------------PTI.YWAQR.KDVVYMRLSV.SSA.....TDVKFK.......I------
Q9C8R4_ARATH/77-154-------------------------------GTF.SWDQD.NDKVKMYISL....EGVDEDKVQAE.......F------
Q9W3Y3_DROME/69-149-------------------------------TDY.GWDQS.AKFVKLFITL.NGVQGCTEENVTVT.......Y------
Q8SSJ3_ENCCU/5-78-------------------------------AKY.TWDQE.LNEINIQFPV.TG..DADSSAIKIR.......I------
Q7RF79_PLAYO/75-155-------------------------------PSF.AWNQE.KNKVTVFLTI.KNIQNINKENIISE.......F------
C8V7I9_EMENI/315-392-------------------------------IRH.EWYQS.NDSVVVTLYA.KGV...DKEKVDAE.......I------
CYBP_HUMAN/76-156-------------------------------SNY.GWDQS.DKFVKIYITL.TGVHQVPTENVQVH.......F------
NUDC1_MOUSE/275-349-------------------------------PLY.YWQQS.EDDLTVTVRL.PE..SSTKEDIQIQ.......F------
F7DCK1_XENTR/141-218-------------------------------PHY.RWTQT.LSEVDLVVPF.PVSFRLKGKDVQVD.......I------
Q5KJJ7_CRYNJ/248-324-------------------------------CRL.DHYQT.PTQVIVSAFA.KGA...DKSRSTIT.......F------
Q8IDW4_PLAF7/214-288-------------------------------DKY.VWTQS.INTLDMYIDT.KD..NIKTKDIKID.......I------
C3ZHN0_BRAFL/16-94-------------------------------PAV.YWAQR.DDVLILTIQV.EDIDRDKNRKVTLN........------
UBP19_HUMAN/285-374-------------------------------VKN.DSYEKGPDSVVVHVYV.KEI.CRDTSRVLFREQDFTLIF------
H3C642_TETNG/316-405-------------------------------VKN.DSYEKGTDLMVVNVYM.KGL.SRDTTRVLFREQHFTLFF------
Q6DBR7_DANRE/227-303-------------------------------CRH.DWHQT.GSQVVVTIYA.KNC.NPDHSYVEAN........------
V5IRH3_NEUCR/26-105-------------------------------LPY.KWTQT.IGDVDITILV.PG..NLKGKDMVVE.......I------
Q6DC89_DANRE/17-91-------------------------------AWG.SWYQT.MEEVYIEVNV.PP..GTSAKEIKCN.......I------
Q584U3_TRYB2/25-100-------------------------------GRY.SFGQT.DTEVIVKVPL.PS..DTPTKMINVD.......V------
Q24K01_BOVIN/186-265-------------------------------ENY.TWSQD.YTDLELKVPV.PKH.VVKGKQVSVT.......L------
F7AJ60_XENTR/138-214-------------------------------YRH.DWYQT.ESHIIITVMI.KNV...QKNNVHIR.......F------
Q7RRD9_PLAYO/3-75-------------------------------PIV.LWAQK.KECLYLTIEL.QDA.....EDVKID.......L------
Q7RB97_PLAYO/167-241-------------------------------EKY.TWTQT.LGTVDMYIDV.EE..FIKTKDIKVD.......I------
Q7Q5W9_ANOGA/4-76-------------------------------VKY.DWYQT.ETAVTVTILL.KNA...ADKNYSVQ.......L------
Q6FKN1_CANGA/178-257-------------------------------VRT.DWYQS.TDKLTVSFFT.TIL.PANKDSMDIK.......I------
NUDC_EMENI/32-114-------------------------------LPY.KWTQT.IRDVDVTIPV.SA..NLKGRDLDVV.......L------
NB5R4_RAT/167-245-------------------------------PSY.DWFQT.ESSVTIVIYT.KQK.NINLDSVIVD.......L------
Q5JLZ9_ORYSJ/80-157-------------------------------GSF.SWDQD.AEKIKIYVFL....EGVEQDKVETT.......F------
Q5U3E4_DANRE/132-208-------------------------------VKH.DWYQT.ESQVAVTIMV.KNA...KKEGVIVS.......F------
Q8I2V1_PLAF7/85-164-------------------------------CSY.EWIEC.DENVEVKIRI.SP..DINSDDIQYN.......I------
Q6BXK8_DEBHA/178-255-------------------------------IRD.DWYQT.NDSVIITIYA.KNI...KEPELHVQ.......F------
GIT7_SCHPO/184-261-------------------------------IRY.DWSQT.SFSLNIDIYA.KKV...KDEDVSLL.......M------
ITBP2_MOUSE/219-295-------------------------------CRH.DWHQT.DSVVVLTVYG.QIP.LPAFNWVKAS........------
B0S6K3_DANRE/75-155-------------------------------NNY.GWDQS.DKFVKIYITL.KGVHTIPAENVETS.......F------
G4U823_NEUT9/193-271-------------------------------VRT.DFYQT.PSSVIASFFL.KKI...NKDAAKVE.......F------
Q8IN95_DROME/136-213-------------------------------ETH.CWSQT.LKDVEVQALL.PKD.HQTAKKLHIS.......I------
F6WW93_XENTR/416-505-------------------------------VKN.DHYEKGNDVVVVHVYV.KEI.CKETSRVLFREQDFTLIF------
Q57UQ9_TRYB2/137-213-------------------------------EHY.MFSQT.LKEVEVRVPL.LVA.RAKGKDVDVV.......L------
Q8W065_ORYSJ/19-93-------------------------------KVF.EWDQT.LEEVNMYIEL.PK..GVPTKLFHCA.......I------
NUDC_SCHPO/9-86-------------------------------AEY.EWDQT.IADVDIVIHV.PK..GTRAKSLQVD.......M------

PF05455

GVPH2_HALSA/1-163------------------------MPTDDPSDRPSGLLDQLSRLIETLAEL-DDDNGEQHGHSTIDRGRTRIDY------
GVPH1_HALSA/8-182------------------------DASDDQSSQLSGLLDQLHTLVEVLADI-EEEGGHRHESGRIDRGNARIDY------

PF08190

KTU_HUMAN/43-348LDRRNAKTL.KAKYKG.TPEAAVLRTPLPGVIPARPDGEPK............GPLPDFPYPYQYPAAPGP.........
KTU_DROPS/50-355LDRANLKYP.KLDYKG.IARPTVIRKLAANPTPEEQE....................PHPLEHMYPTKPPASNSEPK...
KTU_DANRE/39-392LE..HVTRLKMMKYKG.EPQPTMIRRPNPGQTEAADRGPQQTTGPQQPTGPQQPTDPQQPTDTQQPTDPQQTTGPQQTTG
Q9VK57_DROME/30-332LNMEKTIILNNRKFIG.TLVTHRVRNEDMKRAQSTS.......................GIPAALN.SRDGGAVAPENSG
A0DMA1_PARTE/44-380IS.KDFKVLKHTKCKGGEPALLPVRIDKKGKLTNELD.........................SRQGGQANAQTKLQKDIN
A0CTY4_PARTE/36-334LQ.DKFISL.KMKYKGKSVQFQRVKGKKPPKV..........................QVIDEKPNQSPVQNNDDEDETE
E9AFR0_LEIMA/55-423LNADEFRNL.SFKCKG.KLEPQRIRLSTQPKERNVMGD..................EIRLPTAAGSATAPSQVTGSQGNG
KTU_ANOGA/36-354LDRANLRFP.KLQYKG.TPSSSVVREKLPHCDSLPKD.....................ELFDKLLPPLPNVPAPGKTGSE
Q4DT93_TRYCC/46-391LNHEEYRSM.NFKVKG.DLEPQRIRLSTAPKGANAMGD..................EIRLPKDNSAALPPTTVGGRGGTG
A7SEW3_NEMVE/38-354LNKKNLKFP.KMKFKG.MKQATVIRNKSNE........................................NSFKKPNEGI
Q17BY1_AEDAE/23-351LDETDWRVLKNKKFVD.KLTAHNIQNRDVKTVLESYKY..................PTESDLSKIKELETPQLGIDKPKK
KTU_AEDAE/38-346LDRVNLKFP.KLQYKG.VAKMTVIRQKLKNFETRRKD.....................GLIDTLYRASEQSKITHDNSAD
Q38DW7_TRYB2/46-377LNLQEYRNM.SFRVKG.TLEPQRIRLSTTPKVANALGD..................EIRLPANATAASPVTNVGGRSGTG
KTU_XENTR/38-353LDKANVRTL.SMKYKG.VPNPSVLRKPLPEASPKSRDLED...............PLCFPYPYDVPTAVGTEKKDQKRVI
H3DIW3_TETNG/40-350LDRNGVKEI.RAKCKG.TPQTCVIRKPIPGYQE.........................PPGKSDLPEFPYPDERRQPTSL

PF00011

SP21_STIAD/57-157--------------------------------------------------------------------------------
HSP26_YEAST/96-207--------------------------------------------------------------------------------
HS174_ORYSJ/50-153--------------------------------------------------------------------------------
HSP17_ARATH/52-155--------------------------------------------------------------------------------
18KD_MYCLE/31-129--------------------------------------------------------------------------------
CRYAB_ANAPL/66-161--------------------------------------------------------------------------------
HSP11_CAEEL/42-135--------------------------------------------------------------------------------
HSP16_CAEEL/46-138--------------------------------------------------------------------------------
HSP18_CLOAB/48-151--------------------------------------------------------------------------------
HS176_ARATH/48-153--------------------------------------------------------------------------------
HSP21_MAIZE/56-159--------------------------------------------------------------------------------
HSP23_DROME/63-161--------------------------------------------------------------------------------
HSPB1_CHICK/85-182--------------------------------------------------------------------------------
HSP26_DROME/81-179--------------------------------------------------------------------------------
HSP27_DROME/82-180--------------------------------------------------------------------------------
HS25P_ARATH/130-227--------------------------------------------------------------------------------
HS22C_SOYBN/81-181--------------------------------------------------------------------------------
HS21C_WHEAT/134-238--------------------------------------------------------------------------------
HSP6A_DROME/119-220--------------------------------------------------------------------------------
A8I6R6_CHLRE/50-154--------------------------------------------------------------------------------
F7C8L7_XENTR/32-130--------------------------------------------------------------------------------
I1LC12_SOYBN/73-176--------------------------------------------------------------------------------
ACR_MYCTU/48-140--------------------------------------------------------------------------------
IBPA_SHIDS/42-137--------------------------------------------------------------------------------
Q329C7_SHIDS/41-137--------------------------------------------------------------------------------

PF04969

Q5K7J1_CRYNJ/33-108--------------------------------------------------------------------------------
Q7Q5Z9_ANOGA/168-244--------------------------------------------------------------------------------
CHRD1_PONAB/230-306--------------------------------------------------------------------------------
K4BTK3_SOLLC/5-81--------------------------------------------------------------------------------
F5HGH3_NEUCR/244-328--------------------------------------------------------------------------------
F6YV35_XENTR/75-156--------------------------------------------------------------------------------
CHRD1_DANRE/228-304--------------------------------------------------------------------------------
Q9VVA6_DROME/171-248--------------------------------------------------------------------------------
NUDC2_RAT/17-91--------------------------------------------------------------------------------
M4E6X8_BRARP/5-81--------------------------------------------------------------------------------
W5CHI3_WHEAT/107-183--------------------------------------------------------------------------------
Q8L7U4_ARATH/5-81--------------------------------------------------------------------------------
Q5K7I7_CRYNJ/8-89--------------------------------------------------------------------------------
Q9VYT5_DROME/294-367--------------------------------------------------------------------------------
BOB2_ARATH/134-209--------------------------------------------------------------------------------
A0A0R4IY34_DANRE/171-250--------------------------------------------------------------------------------
Q75M67_ORYSJ/5-81--------------------------------------------------------------------------------
Q8I2N9_PLAF7/17-92--------------------------------------------------------------------------------
NUDC_MOUSE/171-248--------------------------------------------------------------------------------
SGT1_YEAST/185-267--------------------------------------------------------------------------------
Q8VXX3_ARATH/19-93--------------------------------------------------------------------------------
F6ZRN5_XENTR/19-98--------------------------------------------------------------------------------
Y8359_ORYSJ/5-81--------------------------------------------------------------------------------
Q75EE3_ASHGO/168-248--------------------------------------------------------------------------------
Q7PYU2_ANOGA/81-161--------------------------------------------------------------------------------
Q6Z2U7_ORYSJ/207-282--------------------------------------------------------------------------------
CHRD1_DROME/213-291--------------------------------------------------------------------------------
Q7RGQ2_PLAYO/266-349--------------------------------------------------------------------------------
Q8I542_PLAF7/76-156--------------------------------------------------------------------------------
Q6CJS5_KLULA/181-260--------------------------------------------------------------------------------
Q6CBP8_YARLI/6-81--------------------------------------------------------------------------------
Q4WN97_ASPFU/36-116--------------------------------------------------------------------------------
K4BEI9_SOLLC/172-248--------------------------------------------------------------------------------
A8BM82_GIAIC/4-77--------------------------------------------------------------------------------
Q9C8R4_ARATH/77-154--------------------------------------------------------------------------------
Q9W3Y3_DROME/69-149--------------------------------------------------------------------------------
Q8SSJ3_ENCCU/5-78--------------------------------------------------------------------------------
Q7RF79_PLAYO/75-155--------------------------------------------------------------------------------
C8V7I9_EMENI/315-392--------------------------------------------------------------------------------
CYBP_HUMAN/76-156--------------------------------------------------------------------------------
NUDC1_MOUSE/275-349--------------------------------------------------------------------------------
F7DCK1_XENTR/141-218--------------------------------------------------------------------------------
Q5KJJ7_CRYNJ/248-324--------------------------------------------------------------------------------
Q8IDW4_PLAF7/214-288--------------------------------------------------------------------------------
C3ZHN0_BRAFL/16-94--------------------------------------------------------------------------------
UBP19_HUMAN/285-374--------------------------------------------------------------------------------
H3C642_TETNG/316-405--------------------------------------------------------------------------------
Q6DBR7_DANRE/227-303--------------------------------------------------------------------------------
V5IRH3_NEUCR/26-105--------------------------------------------------------------------------------
Q6DC89_DANRE/17-91--------------------------------------------------------------------------------
Q584U3_TRYB2/25-100--------------------------------------------------------------------------------
Q24K01_BOVIN/186-265--------------------------------------------------------------------------------
F7AJ60_XENTR/138-214--------------------------------------------------------------------------------
Q7RRD9_PLAYO/3-75--------------------------------------------------------------------------------
Q7RB97_PLAYO/167-241--------------------------------------------------------------------------------
Q7Q5W9_ANOGA/4-76--------------------------------------------------------------------------------
Q6FKN1_CANGA/178-257--------------------------------------------------------------------------------
NUDC_EMENI/32-114--------------------------------------------------------------------------------
NB5R4_RAT/167-245--------------------------------------------------------------------------------
Q5JLZ9_ORYSJ/80-157--------------------------------------------------------------------------------
Q5U3E4_DANRE/132-208--------------------------------------------------------------------------------
Q8I2V1_PLAF7/85-164--------------------------------------------------------------------------------
Q6BXK8_DEBHA/178-255--------------------------------------------------------------------------------
GIT7_SCHPO/184-261--------------------------------------------------------------------------------
ITBP2_MOUSE/219-295--------------------------------------------------------------------------------
B0S6K3_DANRE/75-155--------------------------------------------------------------------------------
G4U823_NEUT9/193-271--------------------------------------------------------------------------------
Q8IN95_DROME/136-213--------------------------------------------------------------------------------
F6WW93_XENTR/416-505--------------------------------------------------------------------------------
Q57UQ9_TRYB2/137-213--------------------------------------------------------------------------------
Q8W065_ORYSJ/19-93--------------------------------------------------------------------------------
NUDC_SCHPO/9-86--------------------------------------------------------------------------------

PF05455

GVPH2_HALSA/1-163--------------------------------------------------------------------------------
GVPH1_HALSA/8-182--------------------------------------------------------------------------------

PF08190

KTU_HUMAN/43-348...............................RAPSPPEAALQPAPTEPRY......SVVQRHHVDLQDYRCS.RDSA.PS
KTU_DROPS/50-355...............................ILPMKTKAAPVPEFAVPKY......SIKQSHDVDLSEYTDE.LDAKLHV
KTU_DANRE/39-392PQQTTGPHQPTDPQQTTGPQQPTDPQQPTGPHQPTDPQQTTDPPPTAPQY......RLKYRSVLDLQDYRCC.RDSG.SA
Q9VK57_DROME/30-332KLVQEI..............DEKDAAAIRKSRQSAGGG......FLDIQY................KLRGRV......RD
A0DMA1_PARTE/44-380QMRDEN..EKIKEEEKLKQQQQKEQQAEEEEDIKKESDEIESTAVSRPKY......RFIYSYPVEYSDFLDS..RANMSI
A0CTY4_PARTE/36-334QIRKRQ.........................REEFEKQSISTQPPAFVTY......EPEWELYLIYPNNEQE.YDGDLDY
E9AFR0_LEIMA/55-423KLIQEVLPPTN.........TNAGPSASSTEAATPGTA......ALKPEPV...VKSVIAEGVYSWALHKRPTSNPYFKE
KTU_ANOGA/36-354RTTKTK................NKENINRTAAVAAAAASPGNPFYTTPEY......KIVQCRDVEYGEMTNE.LDAKIDV
Q4DT93_TRYCC/46-391KLIQEVTNPAIA......SDAVSSPQAAVPATSTTTTAAESSA.ASKEERIAPSLVKLQGEGIYDWSRHVKPVLNPYFRE
A7SEW3_NEMVE/38-354TIGDKTIPYPYADQPTCANKQAHKSRTPGQITSKVKDNNADTRDPRNPEY......TILHRGIIDFQNFTNA.RDSC.TS
Q17BY1_AEDAE/23-351KLIEEI..............DPVTIKTMKDVKNKLSGKDEYVPDPTKVAI......SQAASKKPDCRLFREP......AS
KTU_AEDAE/38-346KEN............................VNKQTFKSASQLEYTTPAY......KLIHRKEVEYHELTGE.LDAKLDA
Q38DW7_TRYB2/46-377KLVQEI..............TDAPAPAAAPAPPPTVNS......PSPPEEPKPSVMRVESEGIYDWSTHSKPTINPYFRE
KTU_XENTR/38-353QKECKQ.........................HLVTPEQDPNVQVAATPNY......TVRHRSYVDLQDFRDS.RDST.PS
H3DIW3_TETNG/40-350QTDPTGPAVP....................TRSCAAGPRVQTKEPAKPKY......TVRYRSYVDIQDFRRS.RNSA.QS

PF00011

SP21_STIAD/57-157--------------------------------------------------------SVSGKRER...EKREESERFYAYE
HSP26_YEAST/96-207--------------------------------------------------------LVSGEIPS..TLNEESKDKVKVKE
HS174_ORYSJ/50-153--------------------------------------------------------LQISGERI..KEQEEKTDKWHRVE
HSP17_ARATH/52-155--------------------------------------------------------LQISGERS..SENEEKSDTWHRVE
18KD_MYCLE/31-129--------------------------------------------------------TVRAERP.....GVDPDREMLAAE
CRYAB_ANAPL/66-161--------------------------------------------------------EIHGKHE......ERQDEHGFIA.
HSP11_CAEEL/42-135--------------------------------------------------------SIQGEQE.......LKTEHGYSK.
HSP16_CAEEL/46-138--------------------------------------------------------KIEGIQE.......TKSEHGYLK.
HSP18_CLOAB/48-151--------------------------------------------------------TINAKRDDI.VETKDDNNNFVRRE
HS176_ARATH/48-153--------------------------------------------------------LVVSGERQR.ENKENEGVKYVRME
HSP21_MAIZE/56-159--------------------------------------------------------LVISGERR...REEREDAKYLRME
HSP23_DROME/63-161--------------------------------------------------------LVEGNHE......EREDDHGFIT.
HSPB1_CHICK/85-182--------------------------------------------------------EITGKHE......EKQDEHGFIS.
HSP26_DROME/81-179--------------------------------------------------------LVEGKHE......ERQDDHGHIM.
HSP27_DROME/82-180--------------------------------------------------------VVEGKHE......EREDGHGMIQ.
HS25P_ARATH/130-227--------------------------------------------------------VIKGEQK.......KEDSDDSWSG
HS22C_SOYBN/81-181--------------------------------------------------------VIKGGHK....SEQEHGGDDSWSS
HS21C_WHEAT/134-238--------------------------------------------------------VIRGEHKKEAGEGQGEGGDGWWKE
HSP6A_DROME/119-220--------------------------------------------------------VVEGQHD......EKEDGHGVIS.
A8I6R6_CHLRE/50-154--------------------------------------------------------MVTGERKLS.HTTKEAGGKVWRSE
F7C8L7_XENTR/32-130--------------------------------------------------------IVTGKHE......RKSDSEDGSYV
I1LC12_SOYBN/73-176--------------------------------------------------------LRVSGERK..KEEEKKGDHWHRVE
ACR_MYCTU/48-140--------------------------------------------------------TIKAERT.......EQKDFDGRSE
IBPA_SHIDS/42-137--------------------------------------------------------VVKGAHA.....DEQKERTYLYQG
Q329C7_SHIDS/41-137--------------------------------------------------------SVKGTPE.....QPKEEKKWLHQG

PF04969

Q5K7J1_CRYNJ/33-108--------------------------------------------------------GKRK...LKVKL..KSSPSSILEG
Q7Q5Z9_ANOGA/168-244--------------------------------------------------------QRKH...LKVGL.KGH..PAIIDG
CHRD1_PONAB/230-306--------------------------------------------------------....STLLNVHI......VF..EG
K4BTK3_SOLLC/5-81--------------------------------------------------------EPEGKFLFSATAGADNVPYEVDLD
F5HGH3_NEUCR/244-328--------------------------------------------------------GKRQ...VRISPIPREAAPYVKPG
F6YV35_XENTR/75-156--------------------------------------------------------SERSF.ELLVKDLDGKNHTMTVNN
CHRD1_DANRE/228-304--------------------------------------------------------....STVLKIHI......IF..EG
Q9VVA6_DROME/171-248--------------------------------------------------------GKKS...LKVGI.KGQ..TPIIDG
NUDC2_RAT/17-91--------------------------------------------------------QSRH...VALAV....GGREILKG
M4E6X8_BRARP/5-81--------------------------------------------------------EPEGKLFFSATSGASKTLYEVDLD
W5CHI3_WHEAT/107-183--------------------------------------------------------GEQM...LSVSI......ELPGE.
Q8L7U4_ARATH/5-81--------------------------------------------------------DPEGVFDFSAKVGPENHVYELKLE
Q5K7I7_CRYNJ/8-89--------------------------------------------------------GTDS...VIINL.....PALAPST
Q9VYT5_DROME/294-367--------------------------------------------------------SKTT...VVVKH....LDEVIFDE
BOB2_ARATH/134-209--------------------------------------------------------KKNR...LKVGL.KGQ..DLIVDG
A0A0R4IY34_DANRE/171-250--------------------------------------------------------QSSR...VSVSVADGGSRKVLLDG
Q75M67_ORYSJ/5-81--------------------------------------------------------KPEGQFIFSAKGPADDTPYELDLE
Q8I2N9_PLAF7/17-92--------------------------------------------------------KSKR...ITIGL...KNTKNFLEG
NUDC_MOUSE/171-248--------------------------------------------------------QRRH...LRVGL.KGQ..PPVVDG
SGT1_YEAST/185-267--------------------------------------------------------SPNDRRTLSISY......QVPKSG
Q8VXX3_ARATH/19-93--------------------------------------------------------QSKH...IEVGI...KGNPPYLNH
F6ZRN5_XENTR/19-98--------------------------------------------------------RSSC...IRVAVREGGGERVLVEG
Y8359_ORYSJ/5-81--------------------------------------------------------EPEGVFSFSATAGTDGNLYESKLE
Q75EE3_ASHGO/168-248--------------------------------------------------------NGKD...LTVSY......PITAGG
Q7PYU2_ANOGA/81-161--------------------------------------------------------TENSF.QLVISDLNNKDYIFVVNN
Q6Z2U7_ORYSJ/207-282--------------------------------------------------------MKNH...LKVGL.KGC..SFIIDG
CHRD1_DROME/213-291--------------------------------------------------------....PIRLHVNL......VFPEQD
Q7RGQ2_PLAYO/266-349--------------------------------------------------------KNDY...IKLEIMVNGEKIILLDH
Q8I542_PLAF7/76-156--------------------------------------------------------EERSF.EIKMNDVDKKHYRFCIKK
Q6CJS5_KLULA/181-260--------------------------------------------------------KGSH...LSISY......PIPDKG
Q6CBP8_YARLI/6-81--------------------------------------------------------TPTT...ISAGV.VGQ..PPVLQG
Q4WN97_ASPFU/36-116--------------------------------------------------------TKTK...IKVAI.KGQ..EALIEG
K4BEI9_SOLLC/172-248--------------------------------------------------------GEQI...LSVSI......DVPGE.
A8BM82_GIAIC/4-77--------------------------------------------------------AEET...IHFACKSGGNDYACKLT
Q9C8R4_ARATH/77-154--------------------------------------------------------KPMSL.DIKIHDVQGKNYRCAIPK
Q9W3Y3_DROME/69-149--------------------------------------------------------TPNSL.QLHVRDLQGKDFGLTVNN
Q8SSJ3_ENCCU/5-78--------------------------------------------------------VGKK...ICVKN....QGEIVIDG
Q7RF79_PLAYO/75-155--------------------------------------------------------NERDF.EIKIHNLDLKNYRFCIKK
C8V7I9_EMENI/315-392--------------------------------------------------------KSDS...VSVQF......PLP.SG
CYBP_HUMAN/76-156--------------------------------------------------------TERSF.DLLVKNLNGKSYSMIVNN
NUDC1_MOUSE/275-349--------------------------------------------------------LPDN...INIKL....KDIQVLEG
F7DCK1_XENTR/141-218--------------------------------------------------------KRHR...LTIGL.RGQ..KPVLDG
Q5KJJ7_CRYNJ/248-324--------------------------------------------------------TPQT...LSLSL......SLP.SN
Q8IDW4_PLAF7/214-288--------------------------------------------------------TYKK...LYVKV.KNQ...VLIDG
C3ZHN0_BRAFL/16-94--------------------------------------------------------..EKSLSFSGKGGAENKDYKCDIT
UBP19_HUMAN/285-374--------------------------------------------------------QTRDGNFLRLH...........PG
H3C642_TETNG/316-405--------------------------------------------------------QTSDGNFLRLH...........SD
Q6DBR7_DANRE/227-303--------------------------------------------------------....RTVLTCHI......QF..EG
V5IRH3_NEUCR/26-105--------------------------------------------------------KKQS...LTAGI.KGQ..EPVIKG
Q6DC89_DANRE/17-91--------------------------------------------------------GSKQ...IELRV....KDQQIFKG
Q584U3_TRYB2/25-100--------------------------------------------------------KVSS...LTIGM.KGQ..SPLISG
Q24K01_BOVIN/186-265--------------------------------------------------------SSSS...IRVAVLEGNGERVLMEG
F7AJ60_XENTR/138-214--------------------------------------------------------SERE...LTVNM......SLP.SG
Q7RRD9_PLAYO/3-75--------------------------------------------------------KEDS...LYFYGTKEKNEYEFTLN
Q7RB97_PLAYO/167-241--------------------------------------------------------TFKK...LSIKV.KNN...IYIEG
Q7Q5W9_ANOGA/4-76--------------------------------------------------------EQNT...LTLRADDTEPLVLT...
Q6FKN1_CANGA/178-257--------------------------------------------------------EGLH...LSISY......PIPDKG
NUDC_EMENI/32-114--------------------------------------------------------KKDS...IKVKV.KGENGEVFIDG
NB5R4_RAT/167-245--------------------------------------------------------QDDS...LRAEAVIKDHSYLIHIG
Q5JLZ9_ORYSJ/80-157--------------------------------------------------------KPMSV.DTKFHDVKGKNYRCAIPK
Q5U3E4_DANRE/132-208--------------------------------------------------------GERE...LTAVV......KLP.SG
Q8I2V1_PLAF7/85-164--------------------------------------------------------KSNY...IYFKI..RNKPKSLIEG
Q6BXK8_DEBHA/178-255--------------------------------------------------------KPNS...VTVSF......PSS.AT
GIT7_SCHPO/184-261--------------------------------------------------------EKNT...LKIEI......KLEDG.
ITBP2_MOUSE/219-295--------------------------------------------------------....QTELHVHI......VF..DG
B0S6K3_DANRE/75-155--------------------------------------------------------TERGF.NTLVKDLDGKNHQMTINN
G4U823_NEUT9/193-271--------------------------------------------------------KPNS...IVLDL.........PTT
Q8IN95_DROME/136-213--------------------------------------------------------QAQH...IKVSS.KHSPETIILEG
F6WW93_XENTR/416-505--------------------------------------------------------KTRDPNFLRLH...........PN
Q57UQ9_TRYB2/137-213--------------------------------------------------------QQRR...LRVGM.KGK..PPIVDG
Q8W065_ORYSJ/19-93--------------------------------------------------------QATH...VEVGI...RGNPPYLNH
NUDC_SCHPO/9-86--------------------------------------------------------SNHD...LKIQI.NVPERKVLLSG

PF05455

GVPH2_HALSA/1-163--------------------------------DYAVSIGLGSDARSPSTPAGNADDAGDAE...........TAHIETRA
GVPH1_HALSA/8-182--------------------------------DYDVSIGLG.RADGSSYDEEPSSNRSRSEQRSGQQRTTEDSIHVETRG

PF08190

KTU_HUMAN/43-348-PVPHELVITIELPL--LRSAEQAALEVTRKLLCLDSRKP...............................DYRLR...L
KTU_DROPS/50-355-TVPRSLVVEIELPL--LRSTAECQLDVTAKSVYLLSERLG.............................AKYRLK...L
KTU_DANRE/39-392-GRPTAIIIEVEVPR--LRSAQEAELRVEERRLLLEAPTA...............................EYRLE...L
Q9VK57_DROME/30-332-ESVDEIHAEIYLPN--YVSSQEFSLLVGEDRIVVETRKY...............................GYVFN...K
A0DMA1_PARTE/44-380-KLPNQLACDLKMQK--VEAMKEIQLDLSNQGLVLDVPN................................KYFLD...I
A0CTY4_PARTE/36-334-NAIKQYRFQILTPL--LITGKAIKLKVDEEQFQMVAGK................................FYKIS...L
E9AFR0_LEIMA/55-423-NVPSYFAITLYLPG--VQTIREVDVRIGYRRVDCYYIDEVADGEERDEEAAASAEGGERGAAAANKGSGASPFLS...L
KTU_ANOGA/36-354-TIPRELKVVITLPL--LKSTAECALDVTKTTLHLVSEKP..............................ARYKLE...L
Q4DT93_TRYCC/46-391-NIPATYAVEVCIPT--VTSIAEVEVRITPRSIEISYVD.AE...........................DGAPFLS...I
A7SEW3_NEMVE/38-354-TRPKELVIRIDLPD--L.ALNHCKYRYSAFSRCC....................................QFFLDICHI
Q17BY1_AEDAE/23-351-GRVKTLIGEFYLPE--CTSAKEITLDIGEDRILLEARKK...............................GYLLD...A
KTU_AEDAE/38-346-AIPKELVLVIELPL--LKSANQCTLNVTSSEVHLISDSP..............................AKYKLE...V
Q38DW7_TRYB2/46-377-TVPAAYLVELHIPT--VTTIAEVDVRVSPKRIELLYVD.CE...........................DGVPFLT...V
KTU_XENTR/38-353-PVPKELVITVDLPL--LNSAAGVNLHIAGKNLSLESEKP...............................AYKLN...V
H3DIW3_TETNG/40-350-PRPKEIVVTIDVPL--LKEVTGARVEARERMLLLESESP...............................AYRLE...L

PF00011

SP21_STIAD/57-157-RSFGSFSRAFTLPE..GVDGDNVRADL.KNGV----------------------------------------------L
HSP26_YEAST/96-207-SSSGKFKRVITLPDYPGVDADNIKADY.ANGV----------------------------------------------L
HS174_ORYSJ/50-153-RSSGKFLRRFRLPE..NTKPEQIKASM.ENGV----------------------------------------------L
HSP17_ARATH/52-155-RSSGKFMRRFRLPE..NAKVEEVKASM.ENGV----------------------------------------------L
18KD_MYCLE/31-129-RPRGVFNRQLVLGE..NLDTERILASY.QEGV----------------------------------------------L
CRYAB_ANAPL/66-161-...REFNRKYRIPA..DVDPLTITSSLSLDGV----------------------------------------------L
HSP11_CAEEL/42-135-...KSFSRVILLPE..DVDVGAVASNLSEDGK----------------------------------------------L
HSP16_CAEEL/46-138-...RSFSKMILLPE..DADLPSVKSAISNEGK----------------------------------------------L
HSP18_CLOAB/48-151-RSYGELRRSFYV.D..NIDDSKIDASF.LDGV----------------------------------------------L
HS176_ARATH/48-153-RRMGKFMRKFQLPE..NADLDKISAVC.HDGV----------------------------------------------L
HSP21_MAIZE/56-159-RRMGKFMRKFVLPD..NADMDKISAVC.RDGV----------------------------------------------L
HSP23_DROME/63-161-...RHFVRRYALPP..GYEADKVASTLSSDGV----------------------------------------------L
HSPB1_CHICK/85-182-...RCFTRKYTLPP..GVEATAVRSSLSPDGM----------------------------------------------L
HSP26_DROME/81-179-...RHFVRRYKVPD..GYKAEQVVSQLSSDGV----------------------------------------------L
HSP27_DROME/82-180-...RHFVRKYTLPK..GFDPNEVVSTVSSDGV----------------------------------------------L
HS25P_ARATH/130-227-RSVSSYGTRLQLPD..NCEKDKIKAEL.KNGV----------------------------------------------L
HS22C_SOYBN/81-181-RTYSSYDTRLKLPD..NCEKDKVKAEL.KNGV----------------------------------------------L
HS21C_WHEAT/134-238-RSVSSYDMRLALPD..ECDKSQVRAEL.KNGV----------------------------------------------L
HSP6A_DROME/119-220-...RHFIRKYILPK..GYDPNEVHSTLSSDGI----------------------------------------------L
A8I6R6_CHLRE/50-154-RTAYSFSRAFSLPE..NANPDGITAAM.DKGV----------------------------------------------L
F7C8L7_XENTR/32-130-HEYRQWKREAELPE..GVNPEQVVCSLSKDGH----------------------------------------------L
I1LC12_SOYBN/73-176-RSYGKFWRQFRLPQ..NVDLDSVKAKM.ENGV----------------------------------------------L
ACR_MYCTU/48-140-FAYGSFVRTVSLPV..GADEDDIKATY.DKGI----------------------------------------------L
IBPA_SHIDS/42-137-IAERNFERKFQL.....AENIHVRGANLVNGL----------------------------------------------L
Q329C7_SHIDS/41-137-LMNQPFSLSFTL.....AENMEVSGATFVNGL----------------------------------------------L

PF04969

Q5K7J1_CRYNJ/33-108E...........LYN--DIVVDDSSWTID.D..-----------------------------------------------
Q7Q5Z9_ANOGA/168-244E...........LCS--EIKIEDSLWHLEK...-----------------------------------------------
CHRD1_PONAB/230-306EKEFE...QNVKLWG--VIDVKRSYVTMT.A..-----------------------------------------------
K4BTK3_SOLLC/5-81............LFD--KINVDESKSSTT.S..-----------------------------------------------
F5HGH3_NEUCR/244-328DRQAT...STLVLAG--EIDPSASRWSAS.P..-----------------------------------------------
F6YV35_XENTR/75-156............LLK--PISPEGSTKKVK.T..-----------------------------------------------
CHRD1_DANRE/228-304EKEFE...KQISLWG--VIDPSKSLVNMM.A..-----------------------------------------------
Q9VVA6_DROME/171-248E...........LCG--EVKTEESVWVLQDS..-----------------------------------------------
NUDC2_RAT/17-91K...........LFD--STIADEGTWTLEDR..-----------------------------------------------
M4E6X8_BRARP/5-81............LLD--SVDVNESKVNVS.S..-----------------------------------------------
W5CHI3_WHEAT/107-183.EPYH...FQPRLFS--KIVPDKCKYTVL.S..-----------------------------------------------
Q8L7U4_ARATH/5-81............LAD--KVNVEESKINIG.E..-----------------------------------------------
Q5K7I7_CRYNJ/8-89.EEQR..IALKPLAS--TLSPGSSTYRVL.G..-----------------------------------------------
Q9VYT5_DROME/294-367E...........LYA--SVGDDLSAFKLAE...-----------------------------------------------
BOB2_ARATH/134-209E...........FFN--SVKPDDCFWNIEDQ..-----------------------------------------------
A0A0R4IY34_DANRE/171-250E...........FTH--RINTENSLWSLEPG..-----------------------------------------------
Q75M67_ORYSJ/5-81............LFD--AVNVEESKAAVA.A..-----------------------------------------------
Q8I2N9_PLAF7/17-92E...........LFS--IIDEDCSYWFIED...-----------------------------------------------
NUDC_MOUSE/171-248E...........LYN--EVKVEESSWLIEDG..-----------------------------------------------
SGT1_YEAST/185-267.SEFQ...YNAKLSH--EVDPKAVSLKIF.P..-----------------------------------------------
Q8VXX3_ARATH/19-93D...........LSA--PVKTDCSFWTLED...-----------------------------------------------
F6ZRN5_XENTR/19-98S...........FTH--KINAETSLWSLEPG..-----------------------------------------------
Y8359_ORYSJ/5-81............LND--KVNVEESKISVG.V..-----------------------------------------------
Q75EE3_ASHGO/168-248.SEFQ...YSLTLAH--PVDSECYSVVVL.T..-----------------------------------------------
Q7PYU2_ANOGA/81-161............LLN--SIDAEKSYRRVK.S..-----------------------------------------------
Q6Z2U7_ORYSJ/207-282E...........LFE--PVKVNDCLWTIEDG..-----------------------------------------------
CHRD1_DROME/213-291NARFD...LDLELRG--IVNVSNASAHMY.G..-----------------------------------------------
Q7RGQ2_PLAYO/266-349K...........LCG--KICCDDAYWVITKDYK-----------------------------------------------
Q8I542_PLAF7/76-156............LCD--KIIPNKCSFKVK.K..-----------------------------------------------
Q6CJS5_KLULA/181-260.SEFQ...YSIMLSH--NVDPTAIQVSVF.T..-----------------------------------------------
Q6CBP8_YARLI/6-81D...........LFG--KIAPEESTWTVEDQ..-----------------------------------------------
Q4WN97_ASPFU/36-116D...........FPH--PIIVDESSWTLETTSQ-----------------------------------------------
K4BEI9_SOLLC/172-248.ETYS...FQPRLFG--KITPAKCRYEVM.S..-----------------------------------------------
A8BM82_GIAIC/4-77............LFA--PINPDESKYKVT.G..-----------------------------------------------
Q9C8R4_ARATH/77-154............LCK--EIMPEKCKVLVK.P..-----------------------------------------------
Q9W3Y3_DROME/69-149............LLH--SIDVEKSYRKIK.T..-----------------------------------------------
Q8SSJ3_ENCCU/5-78E...........LLH--EVDVSSLWWVING...-----------------------------------------------
Q7RF79_PLAYO/75-155............LYD--KIIPNKCSIKIK.K..-----------------------------------------------
C8V7I9_EMENI/315-392.ADYA..FNLDPLFA--SIDESASKVTTF.S..-----------------------------------------------
CYBP_HUMAN/76-156............LLK--PISVEGSSKKVK.T..-----------------------------------------------
NUDC1_MOUSE/275-349K...........LYS--SIDHEGSTWTIKEN..-----------------------------------------------
F7DCK1_XENTR/141-218E...........LFN--DIKVEECSWLIEDG..-----------------------------------------------
Q5KJJ7_CRYNJ/248-324.KRVL...KTVTLYG--PIDPNVSSYRIL.S..-----------------------------------------------
Q8IDW4_PLAF7/214-288E...........FFK--QIKPEESIWTLEDN..-----------------------------------------------
C3ZHN0_BRAFL/16-94............FFK--DVDVEESKYNAT.A..-----------------------------------------------
UBP19_HUMAN/285-374CGPHTTFRWQVKLRN--LIEPEQCTFCFT.A..-----------------------------------------------
H3C642_TETNG/316-405CGPNTHFKWQVKLRN--LIEPEQCSYSFT.P..-----------------------------------------------
Q6DBR7_DANRE/227-303DKVFH...KDIHLWG--VIDVKSSLVNMV.P..-----------------------------------------------
V5IRH3_NEUCR/26-105D...........LPH--PILLDDSTWTLSPAPA-----------------------------------------------
Q6DC89_DANRE/17-91K...........LFG--STVCDEATWTLEDK..-----------------------------------------------
Q584U3_TRYB2/25-100D...........LYK--PVKVDECTWCVEDK..-----------------------------------------------
Q24K01_BOVIN/186-265K...........FTH--KINTESSLWSLEPG..-----------------------------------------------
F7AJ60_XENTR/138-214.ENYS...LNLHLLH--AIVPDQSIFKVL.S..-----------------------------------------------
Q7RRD9_PLAYO/3-75............FLK--PINVEESKYTTK....-----------------------------------------------
Q7RB97_PLAYO/167-241E...........FHK--HIKPEDSIWTLEDN..-----------------------------------------------
Q7Q5W9_ANOGA/4-76............LWN--PINTEQSTHKAT.P..-----------------------------------------------
Q6FKN1_CANGA/178-257.SEFQ...YNIDLAH--NVDPQEYSVIVM.S..-----------------------------------------------
NUDC_EMENI/32-114Q...........FPH--PIKPSESSWTLETTSK-----------------------------------------------
NB5R4_RAT/167-245............LSH--EVQENFSVRVIENV..-----------------------------------------------
Q5JLZ9_ORYSJ/80-157............LHK--EIVPEKCKVLVK.P..-----------------------------------------------
Q5U3E4_DANRE/132-208.EDYC...LKVHLLH--PIVPQQSTYKIL.S..-----------------------------------------------
Q8I2V1_PLAF7/85-164K...........LKG--SVDVNFSTWFLEKQK.-----------------------------------------------
Q6BXK8_DEBHA/178-255.SEYN..YNLEPLFA--EIDPQHSTSRIY.S..-----------------------------------------------
GIT7_SCHPO/184-261.SIFS..LVLDPLYE--EIVPEKSSFKLF.S..-----------------------------------------------
ITBP2_MOUSE/219-295NRVFQ...AQMKLWG--VINVEQSSVSLM.P..-----------------------------------------------
B0S6K3_DANRE/75-155............LLF--PIIAAESSKKIK.T..-----------------------------------------------
G4U823_NEUT9/193-271DSPVKRYKTEVSLFG--PIVPEKSSYKIL.G..-----------------------------------------------
Q8IN95_DROME/136-213N...........LSQ--RIKHKEAVWTIDQ...-----------------------------------------------
F6WW93_XENTR/416-505CTPDTVFRWQVKLRN--LIEPDLCRYCFT.G..-----------------------------------------------
Q57UQ9_TRYB2/137-213E...........LFA--SVKTEESMWTIEDG..-----------------------------------------------
Q8W065_ORYSJ/19-93D...........LTL--PVKTDSSFWTIED...-----------------------------------------------
NUDC_SCHPO/9-86P...........LEK--QINLDESTWTVEEQ..-----------------------------------------------

PF05455

GVPH2_HALSA/1-163SDDSDDLVVVADLPG--VTDETAVDAAVE.DTGALTISVGDDV------------------------------------V
GVPH1_HALSA/8-182GTSGDELVVVADLPG--VTDDD.VDVALDTDEQALTLRVDDDV------------------------------------V

PF08190

KTU_HUMAN/43-348SLPYPVDDGRGKAQFNKARRQLVVTLPV----------
KTU_DROPS/50-355DLPFVVDDKAGNARFDTEKRRLSITLPV----------
KTU_DANRE/39-392PLAYPVEEERAEAQFNHTHRLLTVTLPV----------
Q9VK57_DROME/30-332FVNYRLQQDRAQALFDKTTKMLHVRIPV----------
A0DMA1_PARTE/44-380KLPYPIEQTEASAKFDAKSKTLKIRAPI----------
A0CTY4_PARTE/36-334RFPSKINKSSVKALFLTEKRTLWISADV----------
E9AFR0_LEIMA/55-423TLDYPVSDDVVEAKYVRKTSLLKLKLAV----------
KTU_ANOGA/36-354KLPYEVKESEGKATFNVEARSLTVTLPV----------
Q4DT93_TRYCC/46-391PLDYPIDEDAPNAKFVRKTHMLKMQLLV----------
A7SEW3_NEMVE/38-354TLPYPIDENKGSAKFDKSKQQLVVTLLV----------
Q17BY1_AEDAE/23-351FVDYQIDGSRISAQFNTKTKMLNVIMPV----------
KTU_AEDAE/38-346KLPYTVLEKNGSAKFNTDETTLTVLLPV----------
Q38DW7_TRYB2/46-377PLGYPIDEELQDAKFVRKTRTLKLKLRV----------
KTU_XENTR/38-353KLPYAVEDNQGKAQFNKVKKQLIITVPV----------
H3DIW3_TETNG/40-350PLAYPVDEEKGEAKFSKQKGQLTVTLPV----------

PF00011

SP21_STIAD/57-157TLTLPKRPEV.......QPKRIQVA-------------
HSP26_YEAST/96-207TLTVPKLKPQKDG..KNHVKKIEVS-------------
HS174_ORYSJ/50-153TVTVPKEEPKKP.....DVKSIQIT-------------
HSP17_ARATH/52-155SVTVPK.VQESK....PEVKSVDIS-------------
18KD_MYCLE/31-129KLSIPVAERA.......KPRKISVD-------------
CRYAB_ANAPL/66-161TVSAPRKQSDV......PERSIPIT-------------
HSP11_CAEEL/42-135SIEAPKKEAI.......QGRSIPIQ-------------
HSP16_CAEEL/46-138QIEAPKKTN........SSRSIPIN-------------
HSP18_CLOAB/48-151RITLPKKVKGKD.....NGRRIDIH-------------
HS176_ARATH/48-153KVTVQKLPPPEP....KKPKTIQVQ-------------
HSP21_MAIZE/56-159TVTVEKLPPPEP....KKPKTIEVK-------------
HSP23_DROME/63-161TIKVPKPPAIEDK..G.NERIVQIQ-------------
HSPB1_CHICK/85-182TVEAPLPKPAIQ...S.SEITIPVT-------------
HSP26_DROME/81-179TVSIPKPQAVEDK..S.KERIIQIQ-------------
HSP27_DROME/82-180TLKAPPPPSKEQA..K.SERIVQIQ-------------
HS25P_ARATH/130-227FITIPKTKVE......RKVIDVQIQ-------------
HS22C_SOYBN/81-181YITIPKTKVE......RKVIDVQVQ-------------
HS21C_WHEAT/134-238LVSVPKRETE......RKVIDVQVQ-------------
HSP6A_DROME/119-220TVKAPQPLPVVKGSLERQERIVDIQ-------------
A8I6R6_CHLRE/50-154VVTVPKREPPAK....PEPKRIAV.-------------
F7C8L7_XENTR/32-130HIQAPRLALPPA.....PERPIPIS-------------
I1LC12_SOYBN/73-176TLTLDKLSPDKI....KGPRLVSI.-------------
ACR_MYCTU/48-140TVSVAVSEGK......PTEKHIQI.-------------
IBPA_SHIDS/42-137YIDLERVIPEAK.....KPRRIEIN-------------
Q329C7_SHIDS/41-137HIDLIRNEPEPI.....AAQRIAIS-------------

PF04969

Q5K7J1_CRYNJ/33-108----------------...GTLTIELDK----------
Q7Q5Z9_ANOGA/168-244----------------...NAVVVTVEK----------
CHRD1_PONAB/230-306----------------...TKIEITMRK----------
K4BTK3_SOLLC/5-81----------------...RSIVYLVKK----------
F5HGH3_NEUCR/244-328----------------...RKIELVLQK----------
F6YV35_XENTR/75-156----------------...DTVLIMCRK----------
CHRD1_DANRE/228-304----------------...TKIEIVLKK----------
Q9VVA6_DROME/171-248----------------...KTVMITLDK----------
NUDC2_RAT/17-91----------------...KMVRIVLTK----------
M4E6X8_BRARP/5-81----------------...RSVFYLVKK----------
W5CHI3_WHEAT/107-183----------------...TKVEMRLAK----------
Q8L7U4_ARATH/5-81----------------...RSIFCIIEK----------
Q5K7I7_CRYNJ/8-89----------------...TKIELKLAK----------
Q9VYT5_DROME/294-367----------------...NGLELSLTK----------
BOB2_ARATH/134-209----------------...KMISVLLTK----------
A0A0R4IY34_DANRE/171-250----------------...RCVLLSLSK----------
Q75M67_ORYSJ/5-81----------------...RSICYLIKK----------
Q8I2N9_PLAF7/17-92----------------...NNLHILLTK----------
NUDC_MOUSE/171-248----------------...KVVTVHLEK----------
SGT1_YEAST/185-267----------------...KKLEITLSK----------
Q8VXX3_ARATH/19-93----------------...DIMHITLQK----------
F6ZRN5_XENTR/19-98----------------...KCIVISLSK----------
Y8359_ORYSJ/5-81----------------...RSIFCIVEK----------
Q75EE3_ASHGO/168-248----------------...KKVEVVLQK----------
Q7PYU2_ANOGA/81-161----------------...DMVAIYLAK----------
Q6Z2U7_ORYSJ/207-282----------------...NTLSILLTK----------
CHRD1_DROME/213-291----------------...TKVEIKLPK----------
Q7RGQ2_PLAYO/266-349----------------INEKHIHLVLSK----------
Q8I542_PLAF7/76-156----------------...DSVHVTLVK----------
Q6CJS5_KLULA/181-260----------------...KKLEVTLGK----------
Q6CBP8_YARLI/6-81----------------...REVTISIEK----------
Q4WN97_ASPFU/36-116----------------PPGKEVSVHLDK----------
K4BEI9_SOLLC/172-248----------------...TKIEIRLAK----------
A8BM82_GIAIC/4-77----------------...PCIESILQK----------
Q9C8R4_ARATH/77-154----------------...KRIVITMVK----------
Q9W3Y3_DROME/69-149----------------...DMVAIYLQK----------
Q8SSJ3_ENCCU/5-78----------------...DVVDVNVTK----------
Q7RF79_PLAYO/75-155----------------...DLIQVYLIK----------
C8V7I9_EMENI/315-392----------------...TKIELVLRK----------
CYBP_HUMAN/76-156----------------...DTVLILCRK----------
NUDC1_MOUSE/275-349----------------...DSLEISLIK----------
F7DCK1_XENTR/141-218----------------...KVVTVHLEK----------
Q5KJJ7_CRYNJ/248-324----------------...TKVEITLVK----------
Q8IDW4_PLAF7/214-288----------------...KIIHIFIEK----------
C3ZHN0_BRAFL/16-94----------------...RGLKFLIKK----------
UBP19_HUMAN/285-374----------------...SRIDICLRK----------
H3C642_TETNG/316-405----------------...SRLDITLKK----------
Q6DBR7_DANRE/227-303----------------...SKVEVSMRK----------
V5IRH3_NEUCR/26-105----------------.GQKALEIHLEK----------
Q6DC89_DANRE/17-91----------------...KLIRIVLMK----------
Q584U3_TRYB2/25-100----------------...SVLVVTLVK----------
Q24K01_BOVIN/186-265----------------...KCVLVSLNK----------
F7AJ60_XENTR/138-214----------------...TKVEIKLKK----------
Q7RRD9_PLAYO/3-75----------------...RNIKFKIIK----------
Q7RB97_PLAYO/167-241----------------...RIIHISIEK----------
Q7Q5W9_ANOGA/4-76----------------...SKVEVKLAK----------
Q6FKN1_CANGA/178-257----------------...KKFEITFKK----------
NUDC_EMENI/32-114----------------PPGKEVSIHLDK----------
NB5R4_RAT/167-245----------------...GKIEIVLQK----------
Q5JLZ9_ORYSJ/80-157----------------...TKIIVTLYK----------
Q5U3E4_DANRE/132-208----------------...TKIEIKMKK----------
Q8I2V1_PLAF7/85-164----------------.DCNILNIVLKK----------
Q6BXK8_DEBHA/178-255----------------...TKLEITLKK----------
GIT7_SCHPO/184-261----------------...SKVEITLIK----------
ITBP2_MOUSE/219-295----------------...SRVEISLVK----------
B0S6K3_DANRE/75-155----------------...DMVLIMCKK----------
G4U823_NEUT9/193-271----------------...TKLEVTLWK----------
Q8IN95_DROME/136-213----------------...NRLIISYDK----------
F6WW93_XENTR/416-505----------------...ARVDISLQK----------
Q57UQ9_TRYB2/137-213----------------...HTVVVTLTK----------
Q8W065_ORYSJ/19-93----------------...GEMHITLQK----------
NUDC_SCHPO/9-86----------------...ERLVIHLEK----------

PF05455

GVPH2_HALSA/1-163ERLTLDDPGMTITSLTVTNQILELRVTPSEPS..ATDT
GVPH1_HALSA/8-182ERVVLDRPDVAITDMTLRNQVLEIRLARTSDTDGGEST

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window