Sequence alignment for CL0191

PF07244

Q98MC3_RHILO/107-184--------------------------------------------------------------------------------
Q6ARL5_DESPS/92-170--------------------------------------------------------------------------------
Q5NEP7_FRATT/354-428--------------------------------------------------------------------------------
Q5FPE9_GLUOX/347-432--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/212-301--------------------------------------------------------------------------------
Q73JH4_TREDE/105-183--------------------------------------------------------------------------------
O84244_CHLTR/185-272--------------------------------------------------------------------------------
Q9I0U1_PSEAE/190-268--------------------------------------------------------------------------------
Q8EGG7_SHEON/97-177--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/304-389--------------------------------------------------------------------------------
Q9KUB9_VIBCH/347-418--------------------------------------------------------------------------------
Q73JH4_TREDE/186-274--------------------------------------------------------------------------------
Q98MC3_RHILO/360-433--------------------------------------------------------------------------------
Q6MAE9_PARUW/218-306--------------------------------------------------------------------------------
Q8XZI3_RALSO/98-178--------------------------------------------------------------------------------
Q8EGG7_SHEON/352-426--------------------------------------------------------------------------------
Q604T9_METCA/124-204--------------------------------------------------------------------------------
Q8D271_WIGBR/189-264--------------------------------------------------------------------------------
Q82VX0_NITEU/116-201--------------------------------------------------------------------------------
Q87LW2_VIBPA/354-425--------------------------------------------------------------------------------
Q6MAE9_PARUW/390-467--------------------------------------------------------------------------------
Q6LKQ8_PHOPR/351-422--------------------------------------------------------------------------------
O84244_CHLTR/275-353--------------------------------------------------------------------------------
Q5NZG7_AROAE/348-422--------------------------------------------------------------------------------
O67326_AQUAE/374-446--------------------------------------------------------------------------------
Q5NNB2_ZYMMO/333-411--------------------------------------------------------------------------------
Q7VHH5_HELHP/344-416--------------------------------------------------------------------------------
Q98MC3_RHILO/187-275--------------------------------------------------------------------------------
Q6FCG7_ACIAD/270-348--------------------------------------------------------------------------------
Q6MMX9_BDEBA/120-198--------------------------------------------------------------------------------
Q8XZI3_RALSO/353-427--------------------------------------------------------------------------------
Q7MIG8_VIBVY/266-344--------------------------------------------------------------------------------
BAMA_HELPY/312-391--------------------------------------------------------------------------------
Q8RHT4_FUSNN/251-335--------------------------------------------------------------------------------
Q6D152_PECAS/230-304--------------------------------------------------------------------------------
Q5E2U2_VIBF1/342-414--------------------------------------------------------------------------------
Q89NX1_BRADU/319-398--------------------------------------------------------------------------------
Q92Q48_RHIME/107-184--------------------------------------------------------------------------------
Q5R0Z1_IDILO/176-264--------------------------------------------------------------------------------
Q5E3E7_VIBF1/92-172--------------------------------------------------------------------------------
Q8D2H0_WIGBR/95-175--------------------------------------------------------------------------------
Q5FPY9_GLUOX/117-194--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/132-209--------------------------------------------------------------------------------
Q83DT2_COXBU/99-179--------------------------------------------------------------------------------
Q6FCG7_ACIAD/179-267--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/187-275--------------------------------------------------------------------------------
Q6ATX4_ORYSJ/67-146--------------------------------------------------------------------------------
Q7MHW3_VIBVY/361-432--------------------------------------------------------------------------------
Q7MAB6_WOLSU/88-166--------------------------------------------------------------------------------
BAMA_DESVH/301-383--------------------------------------------------------------------------------
Q5NEP7_FRATT/96-176--------------------------------------------------------------------------------
O67326_AQUAE/290-371--------------------------------------------------------------------------------
BAMA_DESVH/131-209--------------------------------------------------------------------------------
Q7UK20_RHOBA/180-256--------------------------------------------------------------------------------
Q7MXJ3_PORGI/386-461--------------------------------------------------------------------------------
Q98K30_RHILO/218-292--------------------------------------------------------------------------------
Q82U03_NITEU/346-420--------------------------------------------------------------------------------
Q5R0Z1_IDILO/93-173--------------------------------------------------------------------------------
Q7MXJ3_PORGI/302-383--------------------------------------------------------------------------------
Q88IV7_PSEPK/195-269--------------------------------------------------------------------------------
Q74AT3_GEOSL/270-348--------------------------------------------------------------------------------
Q5NND8_ZYMMO/397-485--------------------------------------------------------------------------------
Q5FPY9_GLUOX/370-443--------------------------------------------------------------------------------
Q6MAC6_PARUW/256-330--------------------------------------------------------------------------------
Q73G77_WOLPM/274-352--------------------------------------------------------------------------------
Q82U03_NITEU/265-343--------------------------------------------------------------------------------
Q8EGG7_SHEON/271-349--------------------------------------------------------------------------------
BAMA_BUCAI/175-263--------------------------------------------------------------------------------
Q6MKB1_BDEBA/93-170--------------------------------------------------------------------------------
Q65R79_MANSM/88-168--------------------------------------------------------------------------------
Q5LSU6_RUEPO/196-284--------------------------------------------------------------------------------
Q74AT3_GEOSL/179-267--------------------------------------------------------------------------------
Q9A711_CAUCR/345-418--------------------------------------------------------------------------------
Q7VYC2_BORPE/276-354--------------------------------------------------------------------------------
BAMA_HELPY/138-216--------------------------------------------------------------------------------
Q7MPD6_VIBVY/100-183--------------------------------------------------------------------------------
Q7MXJ3_PORGI/45-119--------------------------------------------------------------------------------
Q5NZG7_AROAE/267-345--------------------------------------------------------------------------------
Q9RXD5_DEIRA/97-179--------------------------------------------------------------------------------
Q8DI03_THEEB/90-161--------------------------------------------------------------------------------
Q604T9_METCA/298-376--------------------------------------------------------------------------------
Q886N5_PSESM/91-171--------------------------------------------------------------------------------
Q8EGG7_SHEON/180-268--------------------------------------------------------------------------------
Q5F5H0_NEIG1/248-322--------------------------------------------------------------------------------
Q74AT3_GEOSL/99-176--------------------------------------------------------------------------------
Q89KQ1_BRADU/278-357--------------------------------------------------------------------------------
Q87SW5_VIBPA/101-182--------------------------------------------------------------------------------
A9CJ61_AGRT5/186-274--------------------------------------------------------------------------------
Q8XZI3_RALSO/272-350--------------------------------------------------------------------------------
Q6MMX9_BDEBA/201-289--------------------------------------------------------------------------------
Q7CWM5_AGRT5/240-314--------------------------------------------------------------------------------
Q6MMX9_BDEBA/48-119--------------------------------------------------------------------------------
BAMA_HELPY/394-466--------------------------------------------------------------------------------
Q5R0Z1_IDILO/267-345--------------------------------------------------------------------------------
Q8A1E1_BACTN/46-120--------------------------------------------------------------------------------
Q5E819_VIBF1/104-185--------------------------------------------------------------------------------
Q5LSU6_RUEPO/369-442--------------------------------------------------------------------------------
Q5R0Z1_IDILO/348-422--------------------------------------------------------------------------------
TAMA_ECOLI/189-263--------------------------------------------------------------------------------
Q7NVY6_CHRVO/267-345--------------------------------------------------------------------------------
Q6MAE9_PARUW/309-387--------------------------------------------------------------------------------
Q92LN9_RHIME/217-291--------------------------------------------------------------------------------
O51735_BORBU/103-180--------------------------------------------------------------------------------
Q7UK20_RHOBA/97-179--------------------------------------------------------------------------------
A9CJ61_AGRT5/359-432--------------------------------------------------------------------------------
Q82U03_NITEU/174-262--------------------------------------------------------------------------------
Q9SRL6_ARATH/77-155--------------------------------------------------------------------------------
Q7VRD8_BLOFL/101-181--------------------------------------------------------------------------------
Q6MMX9_BDEBA/292-370--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/392-467--------------------------------------------------------------------------------
Q6LN32_PHOPR/175-263--------------------------------------------------------------------------------
Q604T9_METCA/207-295--------------------------------------------------------------------------------
Q8KC70_CHLTE/372-447--------------------------------------------------------------------------------
Q6ARL5_DESPS/20-91--------------------------------------------------------------------------------
Q7VRD8_BLOFL/184-272--------------------------------------------------------------------------------
Q5FPY9_GLUOX/197-285--------------------------------------------------------------------------------
O66463_AQUAE/72-149--------------------------------------------------------------------------------
Q73JH4_TREDE/358-431--------------------------------------------------------------------------------
Q7UK20_RHOBA/349-427--------------------------------------------------------------------------------
BAMA_BUCAI/266-344--------------------------------------------------------------------------------
Q7P0N3_CHRVO/181-255--------------------------------------------------------------------------------
Q7NVY6_CHRVO/348-422--------------------------------------------------------------------------------
Q6MKB1_BDEBA/419-500--------------------------------------------------------------------------------
Q8DI03_THEEB/242-318--------------------------------------------------------------------------------
Q7VAN9_PROMA/238-314--------------------------------------------------------------------------------
Q7MAB6_WOLSU/344-416--------------------------------------------------------------------------------
O66463_AQUAE/152-225--------------------------------------------------------------------------------
Q7MYW2_PHOLL/190-266--------------------------------------------------------------------------------
Q6MKB1_BDEBA/503-577--------------------------------------------------------------------------------
Q7MXJ3_PORGI/120-199--------------------------------------------------------------------------------
Q5NND8_ZYMMO/317-394--------------------------------------------------------------------------------
Q8EF72_SHEON/112-195--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/107-184--------------------------------------------------------------------------------
Q5NEP7_FRATT/273-351--------------------------------------------------------------------------------
Q7U8Q8_SYNPX/217-301--------------------------------------------------------------------------------
Q886N5_PSESM/346-420--------------------------------------------------------------------------------
Q6ARL5_DESPS/262-340--------------------------------------------------------------------------------
BAMA_DESVH/212-298--------------------------------------------------------------------------------
O84244_CHLTR/104-182--------------------------------------------------------------------------------
Q5SKT2_THET8/83-163--------------------------------------------------------------------------------
Q92Q48_RHIME/278-357--------------------------------------------------------------------------------
Q83DT2_COXBU/182-270--------------------------------------------------------------------------------
O84244_CHLTR/356-435--------------------------------------------------------------------------------
Q98MC3_RHILO/278-357--------------------------------------------------------------------------------
Q7VYC2_BORPE/185-273--------------------------------------------------------------------------------
Q7NVY6_CHRVO/93-173--------------------------------------------------------------------------------
Q7VHH5_HELHP/87-166--------------------------------------------------------------------------------
Q89NX1_BRADU/148-225--------------------------------------------------------------------------------
A9CJ61_AGRT5/277-356--------------------------------------------------------------------------------
Q7NVY6_CHRVO/176-264--------------------------------------------------------------------------------
Q6FCG7_ACIAD/351-425--------------------------------------------------------------------------------
Q6ARL5_DESPS/173-259--------------------------------------------------------------------------------
Q8A1E1_BACTN/203-291--------------------------------------------------------------------------------
Q8XZI3_RALSO/181-269--------------------------------------------------------------------------------
Q8D2H0_WIGBR/178-266--------------------------------------------------------------------------------
O67326_AQUAE/203-287--------------------------------------------------------------------------------
Q7VHH5_HELHP/262-341--------------------------------------------------------------------------------
Q9A711_CAUCR/263-342--------------------------------------------------------------------------------
Q9WYS9_THEMA/270-342--------------------------------------------------------------------------------
Q5E3E7_VIBF1/347-421--------------------------------------------------------------------------------
Q8I576_PLAF7/116-193--------------------------------------------------------------------------------
Q87ME5_VIBPA/266-344--------------------------------------------------------------------------------
BAMA_BUCAI/92-172--------------------------------------------------------------------------------
Q83DT2_COXBU/354-428--------------------------------------------------------------------------------
Q9A711_CAUCR/172-260--------------------------------------------------------------------------------
Q7MAB6_WOLSU/169-259--------------------------------------------------------------------------------
BAMA_HELPY/219-309--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/278-357--------------------------------------------------------------------------------
Q83DT2_COXBU/273-351--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/360-433--------------------------------------------------------------------------------
Q5E3E7_VIBF1/266-344--------------------------------------------------------------------------------
Q6FCG7_ACIAD/96-176--------------------------------------------------------------------------------
Q82VX0_NITEU/204-278--------------------------------------------------------------------------------
Q5E3E7_VIBF1/175-263--------------------------------------------------------------------------------
Q5LSU6_RUEPO/116-193--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/57-131--------------------------------------------------------------------------------
Q8A1E1_BACTN/121-200--------------------------------------------------------------------------------
Q5SKT2_THET8/164-238--------------------------------------------------------------------------------
Q9RXD5_DEIRA/180-256--------------------------------------------------------------------------------
Q7UK20_RHOBA/259-346--------------------------------------------------------------------------------
O67326_AQUAE/18-90--------------------------------------------------------------------------------
O51735_BORBU/277-353--------------------------------------------------------------------------------
Q8EF72_SHEON/198-271--------------------------------------------------------------------------------
Q73JH4_TREDE/277-355--------------------------------------------------------------------------------
Q9RXD5_DEIRA/329-402--------------------------------------------------------------------------------
Q82U03_NITEU/91-171--------------------------------------------------------------------------------
Q886N5_PSESM/174-262--------------------------------------------------------------------------------
BAMA_BUCAI/347-421--------------------------------------------------------------------------------
Q5NZG7_AROAE/93-173--------------------------------------------------------------------------------
Q65R79_MANSM/260-339--------------------------------------------------------------------------------
Q886N5_PSESM/265-343--------------------------------------------------------------------------------
Q7V0C8_PROMP/253-325--------------------------------------------------------------------------------
Q8EJN5_SHEON/337-408--------------------------------------------------------------------------------
Q74AT3_GEOSL/351-424--------------------------------------------------------------------------------
Q8D2H0_WIGBR/348-422--------------------------------------------------------------------------------
Q5NEP7_FRATT/179-270--------------------------------------------------------------------------------
Q8KBW3_CHLTE/43-133--------------------------------------------------------------------------------
BAMA_DESVH/386-459--------------------------------------------------------------------------------
Q6LN32_PHOPR/266-344--------------------------------------------------------------------------------
Q7VYC2_BORPE/102-182--------------------------------------------------------------------------------
Q6ARL5_DESPS/343-416--------------------------------------------------------------------------------
Q604T9_METCA/379-453--------------------------------------------------------------------------------
Q6LMH9_PHOPR/358-429--------------------------------------------------------------------------------
Q92Q48_RHIME/187-275--------------------------------------------------------------------------------
Q9HXY4_PSEAE/265-343--------------------------------------------------------------------------------
Q5NND8_ZYMMO/488-566--------------------------------------------------------------------------------
Q6MAE9_PARUW/137-215--------------------------------------------------------------------------------
P73472_SYNY3/425-496--------------------------------------------------------------------------------
Q5NZG7_AROAE/176-264--------------------------------------------------------------------------------
Q65R79_MANSM/342-416--------------------------------------------------------------------------------
BAMA_DESVH/59-130--------------------------------------------------------------------------------
Q881Y2_PSESM/187-261--------------------------------------------------------------------------------
Q74AT3_GEOSL/27-98--------------------------------------------------------------------------------
Q5NND8_ZYMMO/569-643--------------------------------------------------------------------------------
O51735_BORBU/183-274--------------------------------------------------------------------------------
Q7VYC2_BORPE/357-431--------------------------------------------------------------------------------
Q6MMX9_BDEBA/373-447--------------------------------------------------------------------------------
BAMA_PHOLL/266-344--------------------------------------------------------------------------------
Q9A711_CAUCR/92-169--------------------------------------------------------------------------------
Q9KPW0_VIBCH/266-344--------------------------------------------------------------------------------
Q7VHH5_HELHP/169-259--------------------------------------------------------------------------------
Q8YUR6_NOSS1/395-466--------------------------------------------------------------------------------
A9CJ61_AGRT5/106-183--------------------------------------------------------------------------------
Q7VRD8_BLOFL/356-430--------------------------------------------------------------------------------
Q7MAB6_WOLSU/262-341--------------------------------------------------------------------------------
B9KGV5_ANAMF/358-430--------------------------------------------------------------------------------
C4YX56_9RICK/266-342--------------------------------------------------------------------------------
G1UBA5_HAEDU/89-168--------------------------------------------------------------------------------
O83346_TREPA/202-289--------------------------------------------------------------------------------
BAMA_ECOLI/176-263--------------------------------------------------------------------------------
BAMA_HAEIN/175-259--------------------------------------------------------------------------------
Q2YPP8_BRUA2/234-307--------------------------------------------------------------------------------
Q2YRQ2_BRUA2/108-184--------------------------------------------------------------------------------
Q2YRQ2_BRUA2/278-357--------------------------------------------------------------------------------
Q31PR1_SYNE7/195-269--------------------------------------------------------------------------------
Q5ZY66_LEGPH/369-442--------------------------------------------------------------------------------
Q63T20_BURPS/183-270--------------------------------------------------------------------------------
Q63W94_BURPS/223-295--------------------------------------------------------------------------------
Q6G5C3_BARHE/361-432--------------------------------------------------------------------------------
Q8F3T2_LEPIN/54-124--------------------------------------------------------------------------------
Q8PAW1_XANCP/129-208--------------------------------------------------------------------------------
Q8RHT4_FUSNN/101-171--------------------------------------------------------------------------------
BAMA_YERPE/267-344--------------------------------------------------------------------------------
Q9CJL1_PASMU/262-340--------------------------------------------------------------------------------
Q9CJL1_PASMU/89-168--------------------------------------------------------------------------------
Q9FFG3_ARATH/74-151--------------------------------------------------------------------------------
BAMA_NEIMB/267-343--------------------------------------------------------------------------------
Q9PEI2_XYLFA/272-347--------------------------------------------------------------------------------
Q9ZE03_RICPR/176-263--------------------------------------------------------------------------------

PF08479

Q8XQ41_RALSO/70-145--------------------------------------------------------------------------------
Q8RI18_FUSNN/32-109--------------------------------------------------------------------------------
Q7NU30_CHRVO/77-152--------------------------------------------------------------------------------
Q7N2L1_PHOLL/77-152--------------------------------------------------------------------------------
Q7N9T5_PHOLL/77-152--------------------------------------------------------------------------------
Q6G3U5_BARHE/90-166--------------------------------------------------------------------------------
Q88MW8_PSEPK/83-158--------------------------------------------------------------------------------
Q7N107_PHOLL/69-145--------------------------------------------------------------------------------
Q605Q3_METCA/48-123--------------------------------------------------------------------------------
Q9JY36_NEIMB/87-166--------------------------------------------------------------------------------
Q8YM25_NOSS1/96-171--------------------------------------------------------------------------------
Q7N1B0_PHOLL/77-152--------------------------------------------------------------------------------
Q89H68_BRADU/98-173--------------------------------------------------------------------------------
Q9HVN7_PSEAE/59-134--------------------------------------------------------------------------------
Q8XQZ3_RALSO/84-163--------------------------------------------------------------------------------
Q880E0_PSESM/77-152--------------------------------------------------------------------------------
Q8XYH9_RALSO/79-151--------------------------------------------------------------------------------
Q8DLP0_THEEB/81-156--------------------------------------------------------------------------------
Q8XQX3_RALSO/69-144--------------------------------------------------------------------------------
Q7MRX6_WOLSU/59-134--------------------------------------------------------------------------------
Q9I792_PSEAE/71-146--------------------------------------------------------------------------------
Q8XPV1_RALSO/81-156--------------------------------------------------------------------------------
Q7VLT7_HAEDU/59-128--------------------------------------------------------------------------------
Q7NWR3_CHRVO/87-160--------------------------------------------------------------------------------
Q6FDM4_ACIAD/101-180--------------------------------------------------------------------------------
Q63JI8_BURPS/74-148--------------------------------------------------------------------------------
Q9AAJ4_CAUCR/8-83--------------------------------------------------------------------------------
Q63TR3_BURPS/65-140--------------------------------------------------------------------------------
Q89Q77_BRADU/73-148--------------------------------------------------------------------------------
Q9HVG7_PSEAE/71-146--------------------------------------------------------------------------------
Q6DA64_PECAS/107-183--------------------------------------------------------------------------------
Q8RGK0_FUSNN/41-115--------------------------------------------------------------------------------
Q9PAG8_XYLFA/106-185--------------------------------------------------------------------------------
Q74E11_GEOSL/79-154--------------------------------------------------------------------------------
Q8YWF4_NOSS1/18-93--------------------------------------------------------------------------------
Q7N910_PHOLL/78-154--------------------------------------------------------------------------------
IBPB_HISS2/99-172--------------------------------------------------------------------------------
Q88QC1_PSEPK/91-166--------------------------------------------------------------------------------
Q7NY08_CHRVO/92-167--------------------------------------------------------------------------------
Q9I5N4_PSEAE/47-122--------------------------------------------------------------------------------
B4F0Z8_PROMH/77-150--------------------------------------------------------------------------------
C5BBG6_EDWI9/81-153--------------------------------------------------------------------------------
D3VFR1_XENNA/80-152--------------------------------------------------------------------------------
FHAC_BORPE/92-164--------------------------------------------------------------------------------
HXUB1_HAEIN/73-150--------------------------------------------------------------------------------
Q0WFB2_YERPE/81-154--------------------------------------------------------------------------------
Q6D5C4_PECAS/75-150--------------------------------------------------------------------------------
Q74QU0_YERPE/90-165--------------------------------------------------------------------------------
Q7CJ53_YERPE/77-153--------------------------------------------------------------------------------
Q7N9K7_PHOLL/79-152--------------------------------------------------------------------------------
Q7VX34_BORPE/76-148--------------------------------------------------------------------------------

PF08478

FTSQ_VIBF1/50-120--------------------------------------------------------------------------------
FTSQ_SHEON/52-121--------------------------------------------------------------------------------
DIVIB_BACSU/54-123--------------------------------------------------------------------------------
FTSQ_RHIME/89-157--------------------------------------------------------------------------------
Q5P6Z9_AROAE/37-106--------------------------------------------------------------------------------
O83403_TREPA/55-123--------------------------------------------------------------------------------
DIVIB_CLOTE/54-122--------------------------------------------------------------------------------
FTSQ_ECOLI/55-126--------------------------------------------------------------------------------
Q8D2Z8_WIGBR/41-111--------------------------------------------------------------------------------
Q83N06_TROWT/56-124--------------------------------------------------------------------------------
Q8E185_STRA5/122-193--------------------------------------------------------------------------------
Q5SJC7_THET8/24-91--------------------------------------------------------------------------------
Q5R0N0_IDILO/43-112--------------------------------------------------------------------------------
Q6F706_ACIAD/59-128--------------------------------------------------------------------------------
Q728V1_DESVH/71-139--------------------------------------------------------------------------------
FTSQ_HAEIN/54-124--------------------------------------------------------------------------------
DIVIB_STRR6/153-223--------------------------------------------------------------------------------
Q9CPA8_PASMU/55-125--------------------------------------------------------------------------------
Q7MNU9_VIBVY/53-123--------------------------------------------------------------------------------
Q73IQ7_WOLPM/61-128--------------------------------------------------------------------------------
Q7NQ02_CHRVO/37-106--------------------------------------------------------------------------------
Q5YYX7_NOCFA/42-110--------------------------------------------------------------------------------
Q8DVE1_STRMU/126-197--------------------------------------------------------------------------------
Q82AD6_STRAW/56-125--------------------------------------------------------------------------------
Q8YQH2_NOSS1/56-126--------------------------------------------------------------------------------
Q98KB7_RHILO/92-160--------------------------------------------------------------------------------
FTSQ_COXBU/46-115--------------------------------------------------------------------------------
Q5HQ08_STAEQ/219-287--------------------------------------------------------------------------------
Q8DMI0_THEEB/61-130--------------------------------------------------------------------------------
Q87WY8_PSESM/73-142--------------------------------------------------------------------------------
Q5FUJ1_GLUOX/84-152--------------------------------------------------------------------------------
DIVIB_GEOKA/50-118--------------------------------------------------------------------------------
Q7V8M1_PROMM/59-128--------------------------------------------------------------------------------
DIVIB_LACLA/153-224--------------------------------------------------------------------------------
Q65RZ0_MANSM/55-125--------------------------------------------------------------------------------
Q6AE66_LEIXX/96-164--------------------------------------------------------------------------------
P73457_SYNY3/54-123--------------------------------------------------------------------------------
Q73NF1_TREDE/62-130--------------------------------------------------------------------------------
Q6AJ56_DESPS/51-120--------------------------------------------------------------------------------
Q9RWN7_DEIRA/101-171--------------------------------------------------------------------------------
Q604W1_METCA/56-127--------------------------------------------------------------------------------
Q6NGD0_CORDI/29-97--------------------------------------------------------------------------------
Q7VMY3_HAEDU/61-131--------------------------------------------------------------------------------
Q8CXI4_OCEIH/50-118--------------------------------------------------------------------------------
Q5WFH0_BACSK/51-119--------------------------------------------------------------------------------
Q7U5Q7_SYNPX/51-120--------------------------------------------------------------------------------
FTSQ_BLOFL/45-115--------------------------------------------------------------------------------
FTSQ_VIBCH/52-122--------------------------------------------------------------------------------
Q6N416_RHOPA/110-178--------------------------------------------------------------------------------
FTSQ_NEIG1/37-106--------------------------------------------------------------------------------
Q67Q43_SYMTH/58-125--------------------------------------------------------------------------------
FTSQ_GEOSL/67-135--------------------------------------------------------------------------------
Q9CCE5_MYCLE/151-219--------------------------------------------------------------------------------
FTSQ_CORGL/30-98--------------------------------------------------------------------------------
Q8R9G8_THETN/29-97--------------------------------------------------------------------------------
Q8XJA3_CLOPE/42-109--------------------------------------------------------------------------------
Q7NNV9_GLOVI/69-138--------------------------------------------------------------------------------
Q6A9Q0_PROAC/48-116--------------------------------------------------------------------------------
Q5FKV1_LACAC/77-148--------------------------------------------------------------------------------
Q8FNU2_COREF/30-98--------------------------------------------------------------------------------
DIVIB_CLOAB/41-109--------------------------------------------------------------------------------
Q6LMF8_PHOPR/51-121--------------------------------------------------------------------------------
Q9K9T2_BACHD/50-118--------------------------------------------------------------------------------
FTSQ_CAUCR/94-162--------------------------------------------------------------------------------
B1W0J1_STRGG/62-130--------------------------------------------------------------------------------
B9KHS4_ANAMF/69-137--------------------------------------------------------------------------------
FTSQ_ZYMMO/97-165--------------------------------------------------------------------------------
D4ZDU0_SHEVD/36-105--------------------------------------------------------------------------------
G3XCS0_PROMA/62-129--------------------------------------------------------------------------------
G8AFN1_AZOBR/99-167--------------------------------------------------------------------------------
H7C7L9_BORBU/34-101--------------------------------------------------------------------------------
I6T797_ENTHA/66-137--------------------------------------------------------------------------------
FTSQ_MYCTU/125-192--------------------------------------------------------------------------------
DIVIB_STAA8/195-262--------------------------------------------------------------------------------
Q2YLY9_BRUA2/68-136--------------------------------------------------------------------------------
Q5M4Y0_STRT2/105-175--------------------------------------------------------------------------------
Q5ZSA8_LEGPH/39-107--------------------------------------------------------------------------------
FTSQ_BURPS/37-106--------------------------------------------------------------------------------
Q65JX8_BACLD/54-123--------------------------------------------------------------------------------
DIVIB_BACAN/53-121--------------------------------------------------------------------------------
DIVIB_ENTFA/126-197--------------------------------------------------------------------------------
Q8F8E7_LEPIN/47-113--------------------------------------------------------------------------------
DIVIB_LISMO/51-118--------------------------------------------------------------------------------
Q99YV5_STRP1/126-195--------------------------------------------------------------------------------
Q9PF78_XYLFA/35-103--------------------------------------------------------------------------------
FTSQ_RICPR/73-141--------------------------------------------------------------------------------
S5VEM4_STRCU/60-128--------------------------------------------------------------------------------

PF06898

F6B8F3_DESCC/8-408SFLLGYVALVVRGDSLEKFVNMAASRGIFLWDITRLGQDKVKVRVRIPEVHSLRHIARATGSRFNITERRGLPFVFNRLK
D4JTF7_9FIRM/10-387..FAAYITIKGLGGFQEKFISELITNDIQIYEICQDKDG.FTAVIKPYSYLKTARIARKHGIRLNVTERQGFIFRLLPLR
R5L248_9CLOT/7-384NWFFGYVVFTFSGGFTDGFINRCYHEKINIKDISAENGV.LTARCSIGAYKRLHKIAFRSGGKVKLVKKRGLPFLLHPLK
R7QWQ5_9FIRM/7-391KFFRGFVCVRLSGYAPERFLNLCGNRDIVIWNLERDGDD.YEFYISVQAFRTLRPIAKKTRTKLVVKKRFGFPFWLHRYR
L0FBK0_DESDL/7-397AFLQGRVFFVARGKELARFMNESIRQGIVFYRTQRSERG.LRAQIRIQDFARLKGPARLTHTRVHIIAKYGWPFIAARWW
R6I0K6_9FIRM/6-384DLARGVTKIEASGAQPERILNYCAENGIEFWSASPCRDFSITFCVHASYADSLLARSGKNGLDVKLISETGGRKLKLGAK
L0EFM5_THECK/10-388HAVRGCVTVRIAGSGTERLLSDAAGDGIELLALRRTSPGEIECIVTVGDFFRLRPHLRRTGCRLRIVGKRGLPFQLARIG
U5MNL2_CLOSA/5-371RIKSGQITIEVSALMPEKILNVLWNNGIYTCKVVKINLTTIRFNIAFEDYNETEMLIKKQKLKMKVIGKSGMIVLLLNLK
R6SYS4_9FIRM/4-378....GYIDYVITGDSFTKFFRRIMSKKLPVSKMCEKNGK.LTLRMPAEHCKALERLCDELGLEYTATKRHGSFVLAKRFF
R7F0N3_9BACI/3-369....SRYRVRISGRNPEYFLRKLLSNQISF.KLLRMGRREFEILVCETDYQKLKKI..RTSYKVELVGYTGFLALYHLLL
R7P4H2_9CLOT/3-367....NKIWIKTKCNNYYKLISKIDNLNITVYDSRYSDY..IYLYVTYKDYLTLKKY..LVSYKFSIYKLTGINKLKDILK
Q0AWN4_SYNWW/7-394NQLAGIIKVNLRGERPERIINLALSRGIHIWDIKKTDDG.MHMKVKISGFEALENICEENNYSLEIVKKEGVPFLKGILT
I0JP38_HALH3/8-385DFFQGSMKIKVQGKMIEPFLQACVRRGCVISNIKRVNEHEVIMSIRLSEWKTFRQLRKKYRCKLSILGGRGLPFYYRKIT
R7H622_9FIRM/5-371..VHGKIDLEAKGGKLYGFINALRKHGVLCQNQRCCGDV.FYCRTETREKQLLEELAKQYHVTLQLHERKTLRFWLVRNR
B2A1M5_NATTJ/8-399YYIIGYLEVTVLGIAVEKFLNLALQENILIWDVKKYPRG.LKVKIGVKDFAKVRKVVKNSGCRVKIVRKRGLPFYVKKLK
A5N6N1_CLOK5/11-376HYRKGIVLIEIQSLIPEKFINLMWKNNIYIKNIKKKSITTMTMEINLKDYYNIKNIAQKTGTKIKIIKRRGILFLIIKLK
C8W3N7_DESAS/8-411SFLIGHVSLVVRGESLEKFINMAVSRGIYLWDITRLEGDRVRVKVRLSAINPLRHIARQTGSRFYFQERAGMPFLAARLK
R6MSI1_9FIRM/8-382.WSKGYVDFSASGKFPERFINLTTRNGINVWNLKPTEKG.LTATMQVYDYKNIRSIAYKSKLKMCVTGRHGLPFYAQRYR
C3AQR5_BACMY/11-389TRWLGYVKVRIEGRGAERFINECVRRNLVVWDVKKIAEDTLVFCMLLRDVKRLRPIYRKNECKLYFIGRFGFPFWNKRLL
B8CXJ2_HALOH/7-376NFIQGYLLIEITGNALERFINQIIEKEIILWDVKRENKSRYLAKIDIKNFNKLRPLVRKRMCRVRIMDKCGLPFLITRAK
W6RVC1_9CLOT/10-376LFYEARLTLKIEVIELEELINNLIKSDIDIDSITRVSISSAILSIQYKDFELFKEIFEKYDGTYKVIGKDKRSTTIYILK
D4LTE1_9FIRM/6-388GFRKGAVRIRVQGEQTERFLNLCKAREIKISKLIRTGEQSLEGNMLIADFFRLSPIRRKTGVKIHILEKHGLPFFFYRSK
K0B1J4_CLOA9/8-387NYLKGYVIIKVEGLTLEKFINLSISKNIFLWDIERIDYTTLEAKVSTAGFRELKDVVKAVDCRVSIEGKRGFPFFIYKFK
R5NSB5_9CLOT/8-384SFLAGYVEITAEGYYIERFMNECTRNGILLWGIERKQSTILEAKTSIQEFKTLCNLAKKNNCKIKIKRKEGIPFLIKKYR
R5HMY8_9FIRM/8-391..LFGTVTARITGAQPEDFLNLCARENLVLWRMVQRDLFTLEVQVTARQYARLCQLAQGAQCGVELEKRQGLPYFFLRFR
C0ZB79_BREBN/7-385EWVDGHVTITVRGKRFERMLNMAVRDGIRIWNIRRVGEEVTRCDILIRDYFRLRPLLKETGCRSHVEARDGLPFWLLRIR
R6XDX7_9CLOT/8-386NYILGYVNILVEGYFVEKFINICNKQKIFLWNLKRSKTTIIYANVSIKDFKKLKPIAQKTKCKIKIKSKKGLPFIFNKYK
A8MG63_ALKOO/8-387NYMRGYVNIRIEGLALERFINLCIAKGIYLWDIQRINHTALEGKVSIKGFKELRGIVKKAGCRVSIKRKNGYPFWIHKLK
J7J0E9_DESMD/7-385TFWYGRILFLARGEHLAHFVNQVSKEGIILYHTQKSERG.MRAQIKLADFRRLRRPARRTHTRVHIVAKYGWPFVAARWW
B8I730_CLOCE/8-390NYIIGYVIIIVEGYFLEKFINICTHRQIKLWNVKWNSSSKLTMKISINDFRKLRPVAKKSRCRVHISKKKGLPFLIYKYK
Q97JI9_CLOAB/7-373SFKNTYVVVEVRTANIEKFINLLWRNKIEVMSMIRVNANLIRFKVALKNYRKTIKLVKAVKGKIKVIERHGTGFLFFRIR
R5T3J2_9CLOT/7-380NKIDSIISIKITGKNVYNFINKIIKNKINIYNLDIINRKEAIVKIKYKDYLKLKKM..HTIYHFNIYSYHGKLKIRNYIK
R6C1Q2_9CLOT/6-386RYLKGYVLIKVWGFAPERFFNLCAGKNILLWNIRKEADA.YYMCISLSGFKSLRKIAKKTKTRVVIKKRFGLPFLMPGLL
K4LIU5_9FIRM/7-395RYLHGRVTIQAQGKNLAGFINEALKDRIEFYNGKKLTDS.FLAEINAADFRRLRKAAKKAGIKINIRNRYGFPFVALRWQ
R6UCV3_9CLOT/10-387..MTGIITVQIEGFFTERFINLCRINNIKIWEIRNIVKGVIRFKMNIADFKKLRSITKKTKCKVSIKEKKGLYFTLFKYR
R6N4A7_9CLOT/7-383RWMAGYVLFIGMGGYPEKFMNLAARANITLWQVKNSKGS.FQARVAKSQYRELRRPAKKAGMRLRVKKRKGFPFFMRRYR
I3VX08_THESW/8-382NFLYGYAIIRIEGLSIERFLNIVISKNIYVWDVERTNHTTIVAKISLKGFKLLLPYTKMTNCRVYIVEKRGLPFIVFYLK
B0TAE5_HELMI/7-400SFWIGFLGIRIEGSQLEKFINMAASRGIPLYDLRREPSGRISAKVRMDGFRSLRHVARKSGSRMRIESRYGLPFYASSLK
R5TPA1_9CLOT/8-390HRISGYLFVEMTGFSPERFFNMCSVHEIEIWGVSDTGRS.CRFYMTVKGFKKIKPIVRKSKVRLKVLGKFGLPFFLHRNR
R5QI90_9FIRM/5-375RYMRGYCRVKVREEKAAALLSLLMERKISFTPTKKAGDGLISFYTPYRFPEETEPLCED.......IHRRSFLSDLYRYR
R5KWN8_9CLOT/12-386....GIATVQIEGFFTERFINLCRINNIKIWNIKNIVKGVVRFNINIYDFKKIRKIAQKTKCKVFVKNKKGLYFKFFKYR
N0B454_9BACI/7-385EFYSGIVSVKITGKGIERFINKLIRSGISVWNVKRHGAETVILFMKLNDVKKLRLAARNSGCSISFQQRIGFPFLFKQLL
F8I923_SULAT/7-394RIIGGWVEVRLTGAQIEKVVSLLALNGFRIWRVRRQGES.ISCLIGLSVVEWLDEVTVEHGVSYEIVRQGGLPIRWSELK
D3E517_GEOS4/9-385..LRGYLKLAVRGEHVEAFINSLAEAGTPVWDVTPTGAHSAEFKLLLKDFKGLRPLLKRTGCRTRIKERFGYPFQARRLF
R6H3U2_9CLOT/8-388NYLIGYVRISIEGYYIERFINICRNHKITIWNLKRDKNVKLELNVGIHDVKEISKIVKQTKCKMKINKKKGLPFLFNKYR
R7F7B5_9CLOT/8-387GYLNGFVTIHVEGYFIERFINMCRLQKIYLWNIEKKNDIYLTVNIGIKDFKKIRKIAKKTKCKVGIDRKKGVPFFLHKYK
R7M7L8_9CLOT/8-385NYILGYVTIEIEGYFTERFINICNNQKIFLWNMKRKCSTIVQINIGISDFKKIKRIAKKTKCRVKIQGKKGIPFILYKYK
R6TJX8_9FIRM/7-385NRIQGQVRLRVEAPFPERVLNLCGARNLSFWDVAWDSDKAFTCRMSRRDSRTLRRAVQEMDCTVTVVGREGAPYFLLRFR
Q67S30_SYMTH/7-404RYLLGTLRIEVTGGDIERFLNGCLEEGILLWDLRRTPER.LHATMMLADFFQLRPVARAGRCRVRIRARHGLPFLTRRLR
R5F5D4_9CLOT/9-390..WEGYVRLRLHGYSPERFLNLCNARGLEVWGLICNRDGDYEFFMTVEGYRRVKPLVRKAQVRLHITGRFGLPFFIYRHR
R5Q8Y0_9CLOT/8-386KNLIGYVNIKIEGYFVEKFINKCINNKIFFWNIKREKSTIIYTNVGINEFKKIRKIAKETKCKIEILDKKGLPFILHRYK
R6M0R0_9CLOT/7-380RIFSSNIKIRVSGRNINNFIKRIIKNNIKIVKLTPRSHKEIDLIIDYNDLEEIEKY..KTIYDIKIVRYYGKLHIIKFLK
R5YC97_9FIRM/7-392RFVKGWLKIELYGKDVTRFLNLCSKHGIDFWDLACIDSEHVSCCISLGSIYNLRPFLRKTKVRMRIILRKGMPFLMFRYR
Q8RB55_THETN/13-387NFLRGYVIIKVEGLAIEKFLNLVMVNEVYIWDVERKNYTTLTAKVSTKAFKEVLQYAKKTGCSVFIVSKNGLPFVIFRLR
F4LSY6_TEPAE/8-387NYLSGYVIIKIVGEYGERLLNQAAMKNLYLWDVKRINDNELTAKINVRNFFKLARLAKKSRSRIYVLQRVGLFFTISKLK
R6LHZ6_9FIRM/6-383FFLAGWCRIRITGASPQWILSALATRRVAFREFRKTDDFTAELRILKRDLPAAYAAAQRSMCDLELMQCGGFAATFAWVK
A4XKI6_CALS8/4-376....NQLILKVEGENLNKFLNMLVFNKVLL.DIREKGQNSLVIVVYLADFKKVVNIVKRTNSRIHILEKRGIYFLIREIT
R5T032_9CLOT/3-372...RSIYEVKIEGKDIRRFIQKLYRCNIYFEDIDIYDRV.AYVKLTSENYKKLLDV..KTIYQIKLIRLKGFAKFVDVIK
R5B397_9CLOT/7-382HYLSGYVIIDIKGKNLERFLNRVVQSGGDIWHVRRTGSESVRACVSVATFYALRPIVRQCGVRISIAAKRGAVVSLSRFR
R7DBV9_9FIRM/6-388GFRNGYVRVRIYGEQTERFLNLCRAHEIRISDLRRESELSLTGCLQIRDFFRLAPIHRKTKVKIHILEKHGLPFFFYRSK
R7FM48_9CLOT/8-386NYIIGYIRISIEGYYIERFINICGNEKITIWNLKRNKNVKLELNIGIKNLKKVAKIAKQTKCKMKIIKKKGLPFLFNRYR
B1I691_DESAP/9-398.YLFGYVTMVVNGRTLERFINLATRRGIYFWDIRRLDEDRILIKARLSGVKPLRHIARDTGSRFRIERRFGLPFFLGRAR
R7IV24_9CLOT/8-386KYILGYVRITVEGYYIERFINICTTSKILIWNLKREKGVRLYLNIGIKDFFEAVKIAKKLKCKVKITQKRGIPFLVHKYK
SP4_BACMD/7-385NFVIGTVRIRIVGKGIERFLNNCVRQQIMISNVHKVDGQLATATILLKDVKKIRILIRNADCKIYFIRGRGFPFLTKRVI
C9RAM9_AMMDK/7-391RYLRGYVLLKLEGKKIERFLNMALTRGIKFWDVRYLGKDRVLLRVRWGAVRALRHISRLTSTRLTIQEKMGLPFLIGRLK
R5XPL9_9CLOT/8-386NYILGYVNILVEGFFTERFINTCINKNIFLFNIKRDKSTIIYANVGIFDFKNVVKIAKQSKCRVKIQRKSGLPFLFNRYK
A6LRP5_CLOB8/4-370SLKSGQVTIEINALVPEKILNAFWNSQIYTCNIVKVSLTTVRVTIYYRDYKDAEILIKKYKGKVKIVRTSGIIVLLMKMR
Q892R7_CLOTE/11-377KFRKSNITLEIQSLIPEKIINLAWQSGIEIKNIERKNITTLKLTINLKDYKKLEKIAKKTQCKFKIVERTGIGFLILKLR
R7HMN6_9FIRM/7-380KIFSSSIKIKVTGRNINNFLKRLINNNINIEKVIPISHKEIDLIINYQDLDKVLKL..KTIYNIKIVRYYGKLRIIKRIK
E6U532_ETHHY/8-382QYMLGYVRFRAEGGSPERFLNLVARNGIMLWHIRSKDGV.LYAATLARHFPRLHPLALEAGVTLTREAQKGAPFQARRFS
D9R1A2_CLOSW/7-388HYFFGYLFIEMTGFSPERFLNMCSVHDIELWKVINSGHS.YQLFMSVQGFRKVKPLVRKTKVRLKILKKFGLPFFLHRNK
R7L9N0_9CLOT/9-386.YIFGYLEIKVEGYFIEKFINNCLKSNIFLWNIKRKRTTIMTCNIGVKDFKNIRKILKQTKCRIKIEKKKGLPFTFNKYR
A5D3V9_PELTS/9-406.YLLGHLVILVTGETPEKFVNMAASRGICLWDITRVKDGALLMKVRLSSVRALRHIARRTRCRFRICRRMGLPFYYSRLR
D4L904_9FIRM/7-374RFLRGSVDFTASGKFPERFMNITAKNGVNLWNPVPKKNA.ISASMYLSDYKKIRILARKSRVKTRITAKHGLPFIINRYK
E3E8L2_PAEPS/9-385..LRGTVTLAVEGESVEAFINLLTDHHIPVWNVRPIGTRHAEMNLLLPHVFLLRPLLRRTGCKMHVLKRQGLPFTAVRLA
R7I713_9CLOT/7-390RWCRGYVLVELRGAAQERFFNLCRRHNIYLWNIYTVADQ.YFCCMDLSDFRVIKKIARKAKVRPWIVKRIGLPFCIYRMG
E6TW41_BACCJ/7-385HKISGYVRIKISGPYPELFINRCIDNGINIWDIHSVGKEVLVCSVLLDETPKLRRMARLSDCKIKFIQRKGFPFLWAKLW
X4ZFY3_9BACL/8-384.WLRGAVELHITGDRTEGFINAVTEAGIVIWNVKATGKG.VSLRLLLDDFYALRPLLKQTGCRMHITGRIGLPFVAARLW
R5CSR2_9FIRM/6-384DLARGTVRLEISGAEPERILNFCAQNGIEFWDTDPKADFAMQITIHAADYPLVQSQNGKNGIELRLVAAKGGKNITASMK
E6UAB1_RUMA7/4-383....GSIDYMIRDVDYARLLNRLTKEKMIYSDLHEENGC.LKITISFEHSFRFEKMCHLEGYKPCKTAIHGMLRFYKSLY
R5D9M1_9FIRM/7-386HFLQGQVLVRIECGCPERMLNLCGARGIPFWELTWESPVCLTLRAVGRDLPRLRQAAEDAGGSLHLCRSGGVPVFWRRLR
Q8EPX5_OCEIH/7-397KRIRGYVTVRVSGEKPELFFQKCANEGILVWDAKKISSKDCVAKLKLQDIKKLKQLRRRTLYKISFEERKGLPFGFARFL
R5IHX3_9FIRM/8-382..FLGVSRLSITGASPEWCMQRLAKARIAFHFCAKPDDFTAEVWILRRDEARAAQLVRMGGCDCAVIERGGFSTVFGGLR
Q24SU1_DESHY/7-393EFLQGRVLFVARGNQLPRFINEGIRQGIVFYKTQRSEKG.VRAQVKIQDFRRLKRPARLTHTRVRIVAKYGWPFVAARWW
Q9KD59_BACHD/9-387QLVRGYVRVQIDGVYGERFLNRCIQKNVAIWSIKRMGAERIVCFMDMQDAKKIRPLVKQTECKVTFVERLGYPAFVKKAM
R5XQE7_9CLOT/3-370NYIRGYYVLIVEGIDAEKYLNFICKSRISIYNVKRISNTKIEFCVNRGDLKKIKNTYRGSKFEIKIKQKTGIPFLAKRIY
Q3AEZ9_CARHZ/5-371..LFGEIHFKFQGSEVERFLNLAFSRQVDLREVKYTRDG.LTFKTSLKNFRQVKTIGKKVGGKTKVIAKEGAWFWWKKVL
F6CMU5_DESK7/8-406NFIIGYITITIRGEASEKFINMAAARGIFLWDIARPGEQTMRANVRLNAVRPLRHIARRTRCRFHITRRVGLPFLWMRLA
F2JQA7_CELLD/7-387HYLKGYVIVEVSGYMIEKFLNLALHHHIPMWDVVQKENK.VCFKTPIEAFKCMKPDLKKAHCRAKIVGKKGFPFIAHRYK
U5LCI4_9BACI/7-385AFYSGIITVKAAGSGIERLINSLTRNGIMVWQVKRHGEQAVTFKIKLTDVKRLRASVRKSGCRIEFLHRAGLPFLLKRSL
A8FFB9_BACP2/7-386AYFIGRVEVEIKGNGIERLINECTRQEITMFQVIRRKDS.VRLFIRLSDVHAFRKVQRHHEVTCSFHQKKGFPFLLLWSR
L7VHP9_CLOSH/8-388HYLKGYVIIIVSGLSVEKFINICTRRQILLWDIERLSPTEVIMKMSIRGFKNARSAARKSRCRVRIKAKKGLPYIIWRYK
R6D0A8_9CLOT/8-382RFIRGSVTFEVKGKFAERFFNLLGRNGIPVFSVSPTKDG.FYATTTVKKYFKIRPFVRKTHVRVHVVKRQGLPFLMKRYS
Q65H67_BACLD/7-386SFFSGKIQLKITGKGIERLLNECTRRNIPMFNVKKKKDA.VFLYIPLSDVHAFRKVIRGFDCKCRFIKRKGFPFLVQKSK
D9QV99_ACEAZ/7-405CLIRGYVIVQISGYGKEKLINFLMRSDFRVWNVKHKKDH.FEAKLKMKDFKQIRPYVRRADCKVRIKSKHGLPYWLRKLK
C8WY36_ALIAD/8-383WFLKGSATLWVTGPGARQLVARLQRQGVVVRDVRFTADG.VMLRVSVAALRHLMASRRAYGVRFRVVERHGAPFLGRRLV
Q2RKW7_MOOTA/8-408AYLTGYLVLTISGDDPEAFLNLALARGLTLLDVTRTGKGQILVKMPVSEYRLLRPLARESHCRVRIVDKRGLPFFSRRLR
YQFD_BACSU/7-386SFFSGKVQLELTGRGIERLLNECTRQGIPVFHVKKKKEA.VSLYIQLQDVHAFRRVRSKFKCKARFINRKGFPFLLLKSK
Q5KX07_GEOKA/7-385DTLAGSVRVKARGKGIERLINACVRQGIAVWNVKKHSADTATFFIKLSDVKRLRHVARQSECKLSFVGRTGLPFFWRQAW
R6XTI8_9CLOT/8-386NYILGYVNIKVEGFFIERFINICISKKILLWNMKREKSTILYANIGIQDYKKLKNIAKKTKTRISIQSKKGMPFLLHRYR
R6NIT4_9CLOT/8-386SYVLGYLKLSVEGYYIERFINICKNNKITIWNLKRNKEIELYLNVRISEFKKICEIAKKTKCKIKIKNKKGIPFLLHKYK
R6G2U3_9CLOT/4-369.IKKGKIKVEILVKDIEKILNILWLQNIPASKVKKVNITTLRLEIDYMDYERVCEIVRSVGGKVRVLEGKGPIFLLGNMK
R6QWU5_9CLOT/7-381RWFSGYAKFTAKGKFPERLLNMTMKNGVQLWGMRSDSSS.LAAYVAAREYKLLRPFAKRCELTLKCTKKGGLPFIISQYK
F4A357_MAHA5/8-386HYIFGYVIIRVEGMSLEKFINLCLQRGIHLWDVRRQSYSVLKARISIKGLKQLISISYITHCRIEVLSKRGLPFLFSRLK
R5ITB3_9CLOT/7-378NKLDKIIVVNIKSRNIDRLLKNIYNLNISIYNLVRINYKEINITIKENDLDKIRNL..SVLNEVSVIDYKGKMKAINKMK
R7IQG8_9FIRM/7-393SYLLGAVRIRIVGENKERFVNLCRNSDIYIWDIRNGTE..CTLCITKEDFFKLKPIIRKTFVRIKIMEKYGLPFLVYRYR
F6DMW5_DESRL/8-408SLLTGYVSLMVQGESLEKFVNMAAGRGIFLWDIVRLNNHAIQAKVRISEVRPLRHIAKTTGSRFKIVERRGLPFFSHRLR
R7L3Q3_9FIRM/6-381IRSRTYFEISSDSGDYNKFVNALRCSPVQFFGLEIRKNV.ISGYVRTKDMKRLCSLAEAYRLDVTQSREHGAAVVLKKYK
K0J274_AMPXN/9-396..FKGYVTIKVMGHYPERFFDLCARRNIPVWSIRKQSELECLADVYVDDIHKLRKIRRQTHYKLSFVRKKGMPFFIKRLK
I4DAP4_DESAJ/7-400AFWQGRVYFVARGEQLPRFLNYILQEGVVLYQTQRSERG.MRAQLKLNDFYRLKRAARLTHTRVHIIAKYGWPFVAARWW
D7CNW5_SYNLT/8-391NFLGGFLTVAVKGKYPEKLMNLALARGIFLWDVKRTPEG.ICFRIRNSAYQALQNLTEEHGFELEVINTEGFPFYRQVLQ
R5Y9N3_9FIRM/7-382NLLLGFVDFTFSGGFADGFINDCYNQKINVKNIVRRGDN.IEASCGAAAYKRLHSAAVKNGGRLKIVKKHGLPFLLRPFR
R4KCE0_9FIRM/7-406NYLDGYVTITLPEECLEKFVNMATTRGIYLWGITNAAGNQVALNARLRDVQPLRHVARMTRCRFHIINRSGLPFFIGKLR
R6YI22_9CLOT/2-369...NSYLIIKVEGKIIEKFILRCKKNNINLLKIERISNKEIIIKINSKDYENLNKI..KSIYTLTIINNEGYLKFKEELN
G8M1A5_CLOCD/7-388NYVKGYVIIFVEGYFLEKFVNICTRRQIFLWDIKKRKNSSMSMKVSIKGFKMLRPIAKKTGCRVKIIGRRGVPFVLYRYK
K4LKI1_THEPS/8-398AYLLGYLILVIKGEHPERLINLAYTRGVHLWDLCWIDAGTLTAKVYASSFRTLRHIAKKAGCRLRIRRKRGLPFLLFRLR
G4KWF7_OSCVS/7-385NRLRGQVHLRVESAFPERILNLCAQRKLELRDVRWKSATVFSCVLTRRDFRLLRLLTRKLDCTLHVEKQEGAPFLVGKLR
R6NSX8_9FIRM/7-390KFLYGYVIIKVYGKGAERFINICLRRNIDVWNIKPFDDG.IEMCIYIKDFFHIRQVRKKSNVKIKISQRRGIKHLMRLYR
R6RMK3_9CLOT/7-391LFFKGGVQAEITGLGRERFFNIAARRELFVTGIGTDRDGHVLFWTTGEDYKKMKPAARKAGVRLFLRKKYGLPFFLFRNR
A3DEC5_CLOTH/8-389NYIRGYVIIFVEGYFLEKFVNICTRRQILLWDIQRDRNSKMTLKVSIRGFKMLKPVAKKTGCRVKILEKRGLPFLLNRYR
R6GJ09_9CLOT/6-381RFLWGYVIFTASGAFPERFINLSAKAGVSLFNIKRQGAV.LYCSTMASEYKALRRISKKSGIKIKIKEKHGFPFFVRKYK
D9S2Q3_THEOJ/8-389NCLRGYVIIKIVGPYGERLINQAALHGLYLWDIKRIDEDVLLAKISVHGFFELRPLARKTRCRIYVLQRCGLFFSLYRLK
D4LCN8_RUMC1/4-373....ARVSIRVEGANLSGFMQGLRENGVICADQRCREGA.FSAALPAGHLKKARLLAQEHKVQLTVTERRGLRFSFYRIK
C5D4T1_GEOSW/7-385NLLVGSVRVKAQGKGVERLINACVRNDIAIWNVKKHGDHIATFFILLKDVRRLRVVARKSDCKLYFVGKAGFPFFLKKML
W0EAS0_9FIRM/7-398PFYHGRVIFAARGDQLARFVNEGIRDGVVFYKTQKSERG.LKAQVSIEDFKKLRHAARHTHTRIHILAKYGWPFIALRWW
F9VJJ5_ARTSS/9-374.FINGKIQLRIISKNSEQLLNTIWKREIKVTDVIRENLYSMCLMINSENFKEIKKICDETNSEVSVIKMGKLIKFIYNLK
A0Q1Q5_CLONN/8-374KYKKGTITLEIQTFRPERFINLLWKNGINVKNLRRKTITTLIFEVGLKDYNKIRDIAKRTDTKIKILGRSGVSFLLIKSK
F0SVD9_SYNGF/7-392RYGKGIVYIQISGDKFTDFINKARQDQIVFYNTRITNEK.IFAEVGINDFYRLRRSARNTGIKIRIRTRYGFPFVAARWL
D9SW54_CLOC7/9-375KARSGNLKLRVTVVNPQRLLNLLLNKNIPLKNVQYVDRYTIYITINSIDYEDFKEHAKRVNAKHIIVDGDSTFKILKRLK
G2TNK7_BACCO/7-385TFLQGSVAVKIEGKGIERFINQLTRAGLAVWNVRRQGTMAVTFELRLSDIHQLRKAVRGQDLHVRFLRGRGVPFLWKRTL
Q8XIU3_CLOPE/5-374FLKKGQVKVEIKTFDINKLLNVLWRNGINVENVRKIDVVTLTLNVDYSDYGKLKTYVKRLNGKVKIISSKGMIFFLSRAK
R5HCW7_9MOLU/9-376..FKNKLKIKVKGKNIERFIKRLVTNNIELLKIDYIKYNEVDIIIYKSDYNKILDL..KTIYEVTIVDIYGIIKLQKKLK
R7MJV7_9FIRM/5-378..INEYIKFSAKGKNLYKFINGIHTARIYCFNQYCKSEV.FYGEVYKKNLPLIEQLAQKHGISLEIFEYDTLVSKLKKYR
R5AEU1_9CLOT/3-374....ACVIIEITGKRAERLLDRMRADGIAVYAVRRAARETLELTMPAREFSRLHVLARGSGCRIRIAEKRGESFRIRRLL
R5JAK2_9FIRM/6-375...ISKISLNIKGKNINRFIKKLRTKRIEILSLKYKNPNEADIIIYKKDYETVLKI..KSIYDVTELDVFGLIKIKRKIK
R5JWC6_9CLOT/7-386.WLKGYLQVYVSGNRPERFLSLMKHKEILVWEVEPYENG.YLFFMEQSKFRELDAIRKKAGCKLEIRQKHGLPFWMFRYR
L0KBA1_HALHC/7-398DLLRGYLQLKITGNQFNKLVNLLMLQGVELWNIVRIEDT.FYANINFKDFNRIRSSVRKTDCKVTIYQRKGFPFWIDKLM
R5X7Q5_9FIRM/6-388CFLNGYVEVLICGGQTERFFNLCMARGIVVRNLRQNKDKSFTCIFSVSHFFLLGPIRRKTKVRIHILEKQGLPFWVEKGV
R7NE92_9MOLU/3-369....RYLLVRIKTTKKTNCLLKLNRLNVDIKEIQYESEY.LKFQMLEQDLKKVKKY..LVSYEIEIIDETGIYKLKKELK
D3FY22_BACPE/7-385QAWKGYVRVRVDGAYPERFLNRCIEERLSIWKIKRVGDERIVFYMDIEDAKKIRPLLRKTDCKVTFAERKGTPAVLRKVS
Q5WHE5_BACSK/7-385KSFIGSVTVEVAGQYPERLLNACLKNNIHVWNVRHGGNDNIQFDVALNDIAKIRVLFRHSGCKTTFTKRSGLPFFMKKVK
B2TM04_CLOBB/5-371KLKIGKIKIEVNSLIPEKILNILWQRGINVTKIVKLNITTVRFEIPFDSYKEVEDIVKKTKGKVRIVGKSGIIVLLLSIK
A6TSK6_ALKMQ/8-387NYFRGYVIIKVEGLSLEKFINLCIVREIYLWDIKRTNYTTVEMKVGIKAFKELRKIVRRTGCRVSIIEKSGYPFVAHQLK
G7MCG1_9CLOT/5-371SLKSGMITIEVNALMPEKMLNLLWNNEIYTCNIIKVNLTTIRFTIYFKDYKEAEMLIKKHKGKVKTVRASGIIVLLMKMK
Q182D1_PEPD6/3-370SFIRGYYVIVVEGVGLEQFLNHLIRNGISVYNVTRIKNTKMEFHIDRQDIKDFKNVYRGSKFDIKVKQKTGVPFIIKRVY
B7GKD9_ANOFW/7-385YRMSGNLRIRIVGKGLERLLNEFTRRGIYVWNVRREGEHSLTCYMLLRDIRHVRVAMRKSGCKLYVLERRGAPFWLKASW
R6CV47_9CLOT/2-371...NSYVNISIVGKNPKLFIKRYVLNQISFEDFKEVSHKHVTIKISYDDYLELLSK..NKTYEIYINRKYGIVKYTSYIK
D5XAQ9_THEPJ/8-405SYLMGYLTLLVEGEAVEKLVNMAVSRGIYLWDIRWLGPQKILLKARVSSFRSLRHIIKRTGGKMKIKNKKGLPFATAKVL
A5I631_CLOBH/5-371KYKNANITIEIQSMIPERFINLLWKNGVKVENVVKTNVTTFILDIDLKDYAVMENIARRTGTKVKIVKRKGISFLILFLK
R6CYS5_9FIRM/7-389NYLRGQAVAEVVCTAPERVVNLCAVHGIPFWDLTWLTETSFRVTTTLSGARRLAEVTADIGAQVTVCRKSGAPELWRRCR
R6BC91_9CLOT/8-386KYILGYINIKIEGYFVEKFINKCINENIFFWNVKREKSTIVYINTGIKDFKRLCRIARECKCKIQIKEKKGLPFILNRYR
R4KBT4_CLOPA/9-375EYKNGTITVQLQSKEIERIINVMWSHGIVIKNIKRNSINVITFDTSFNNYYKVKELATRTKSKIKIINRRGMIFLKMKLK
C6CTU6_PAESJ/7-385QWVRGVVTVHIRGGQPERLVNRALEGGLELSSIRWTSGGKLEFELSLGDFFRLRPFLKETGCRAHVVKREGMPFWLVRVE
R5AR68_9FIRM/7-385.ALCGYARLEVCGVHPERVLNACAAAGIACTASEPVDAYTLRITVRACCAETAAELARRCQCEVKTLYRRGLPQLLRRTA
M1LPE2_9CLOT/3-366...SKQITIEVSALKPERILNVLWNNSIYTSNIVKIDLLTIRFNINFNEYKEAESLIKKNNGKVRIVKVSDMIIIFMKLK
R5A1X4_9CLOT/2-368...NSPVKIKINTCS.NRFINYLIYNNIYYSSLIKTSDS....FILITNYENYKKIARR..FETVIIKYYGKMFFVNFIK
R6Z4S5_9CLOT/6-387HALTGMVRVRLTGCSPERFFNLCGQGDVEIWNISCADHE.YECCMTVQGFFACRPLAKKAGIRLKLLKKRGLPFFFYRNR
R5ACZ0_9CLOT/8-391.YLTGWVEFQISGSGP.RFLNAAAKTGVEFWGFRREGEH.TILRGTPSDYKRLRPLFRRCGVRSKIRQKRGFPFLRARIW
A4J7E2_DESRM/8-408SFLMGYVSLVVKGDFLEKFVNMAASRGIFLWDISRIGQDKVKVKVRITDVRPLRHIARATQSGFSIVERRGFPFLIHRLK

PF07244

Q98MC3_RHILO/107-184-------------------------------------------------------------------------------K
Q6ARL5_DESPS/92-170-------------------------------------------------------------------------------P
Q5NEP7_FRATT/354-428-------------------------------------------------------------------------------V
Q5FPE9_GLUOX/347-432-------------------------------------------------------------------------------V
Q8KFQ6_CHLTE/212-301-------------------------------------------------------------------------------V
Q73JH4_TREDE/105-183-------------------------------------------------------------------------------P
O84244_CHLTR/185-272-------------------------------------------------------------------------------G
Q9I0U1_PSEAE/190-268-------------------------------------------------------------------------------Y
Q8EGG7_SHEON/97-177-------------------------------------------------------------------------------P
Q8KFQ6_CHLTE/304-389-------------------------------------------------------------------------------Y
Q9KUB9_VIBCH/347-418-------------------------------------------------------------------------------V
Q73JH4_TREDE/186-274-------------------------------------------------------------------------------S
Q98MC3_RHILO/360-433-------------------------------------------------------------------------------A
Q6MAE9_PARUW/218-306-------------------------------------------------------------------------------G
Q8XZI3_RALSO/98-178-------------------------------------------------------------------------------P
Q8EGG7_SHEON/352-426-------------------------------------------------------------------------------V
Q604T9_METCA/124-204-------------------------------------------------------------------------------P
Q8D271_WIGBR/189-264-------------------------------------------------------------------------------Y
Q82VX0_NITEU/116-201-------------------------------------------------------------------------------A
Q87LW2_VIBPA/354-425-------------------------------------------------------------------------------R
Q6MAE9_PARUW/390-467-------------------------------------------------------------------------------F
Q6LKQ8_PHOPR/351-422-------------------------------------------------------------------------------Y
O84244_CHLTR/275-353-------------------------------------------------------------------------------Y
Q5NZG7_AROAE/348-422-------------------------------------------------------------------------------V
O67326_AQUAE/374-446-------------------------------------------------------------------------------V
Q5NNB2_ZYMMO/333-411-------------------------------------------------------------------------------G
Q7VHH5_HELHP/344-416-------------------------------------------------------------------------------V
Q98MC3_RHILO/187-275-------------------------------------------------------------------------------T
Q6FCG7_ACIAD/270-348-------------------------------------------------------------------------------F
Q6MMX9_BDEBA/120-198-------------------------------------------------------------------------------P
Q8XZI3_RALSO/353-427-------------------------------------------------------------------------------V
Q7MIG8_VIBVY/266-344-------------------------------------------------------------------------------Y
BAMA_HELPY/312-391-------------------------------------------------------------------------------Y
Q8RHT4_FUSNN/251-335-------------------------------------------------------------------------------I
Q6D152_PECAS/230-304-------------------------------------------------------------------------------Y
Q5E2U2_VIBF1/342-414-------------------------------------------------------------------------------L
Q89NX1_BRADU/319-398-------------------------------------------------------------------------------Y
Q92Q48_RHIME/107-184-------------------------------------------------------------------------------Q
Q5R0Z1_IDILO/176-264-------------------------------------------------------------------------------A
Q5E3E7_VIBF1/92-172-------------------------------------------------------------------------------P
Q8D2H0_WIGBR/95-175-------------------------------------------------------------------------------P
Q5FPY9_GLUOX/117-194-------------------------------------------------------------------------------P
Q8KFQ6_CHLTE/132-209-------------------------------------------------------------------------------P
Q83DT2_COXBU/99-179-------------------------------------------------------------------------------P
Q6FCG7_ACIAD/179-267-------------------------------------------------------------------------------A
Q6N5Q8_RHOPA/187-275-------------------------------------------------------------------------------T
Q6ATX4_ORYSJ/67-146-------------------------------------------------------------------------------I
Q7MHW3_VIBVY/361-432-------------------------------------------------------------------------------T
Q7MAB6_WOLSU/88-166-------------------------------------------------------------------------------S
BAMA_DESVH/301-383-------------------------------------------------------------------------------Y
Q5NEP7_FRATT/96-176-------------------------------------------------------------------------------P
O67326_AQUAE/290-371-------------------------------------------------------------------------------Y
BAMA_DESVH/131-209-------------------------------------------------------------------------------P
Q7UK20_RHOBA/180-256-------------------------------------------------------------------------------A
Q7MXJ3_PORGI/386-461-------------------------------------------------------------------------------A
Q98K30_RHILO/218-292-------------------------------------------------------------------------------A
Q82U03_NITEU/346-420-------------------------------------------------------------------------------V
Q5R0Z1_IDILO/93-173-------------------------------------------------------------------------------P
Q7MXJ3_PORGI/302-383-------------------------------------------------------------------------------Y
Q88IV7_PSEPK/195-269-------------------------------------------------------------------------------Y
Q74AT3_GEOSL/270-348-------------------------------------------------------------------------------F
Q5NND8_ZYMMO/397-485-------------------------------------------------------------------------------S
Q5FPY9_GLUOX/370-443-------------------------------------------------------------------------------V
Q6MAC6_PARUW/256-330-------------------------------------------------------------------------------T
Q73G77_WOLPM/274-352-------------------------------------------------------------------------------F
Q82U03_NITEU/265-343-------------------------------------------------------------------------------Y
Q8EGG7_SHEON/271-349-------------------------------------------------------------------------------Y
BAMA_BUCAI/175-263-------------------------------------------------------------------------------I
Q6MKB1_BDEBA/93-170-------------------------------------------------------------------------------R
Q65R79_MANSM/88-168-------------------------------------------------------------------------------P
Q5LSU6_RUEPO/196-284-------------------------------------------------------------------------------I
Q74AT3_GEOSL/179-267-------------------------------------------------------------------------------V
Q9A711_CAUCR/345-418-------------------------------------------------------------------------------V
Q7VYC2_BORPE/276-354-------------------------------------------------------------------------------Y
BAMA_HELPY/138-216-------------------------------------------------------------------------------A
Q7MPD6_VIBVY/100-183-------------------------------------------------------------------------------V
Q7MXJ3_PORGI/45-119-------------------------------------------------------------------------------K
Q5NZG7_AROAE/267-345-------------------------------------------------------------------------------Y
Q9RXD5_DEIRA/97-179-------------------------------------------------------------------------------P
Q8DI03_THEEB/90-161-------------------------------------------------------------------------------V
Q604T9_METCA/298-376-------------------------------------------------------------------------------F
Q886N5_PSESM/91-171-------------------------------------------------------------------------------P
Q8EGG7_SHEON/180-268-------------------------------------------------------------------------------A
Q5F5H0_NEIG1/248-322-------------------------------------------------------------------------------I
Q74AT3_GEOSL/99-176-------------------------------------------------------------------------------P
Q89KQ1_BRADU/278-357-------------------------------------------------------------------------------Y
Q87SW5_VIBPA/101-182-------------------------------------------------------------------------------I
A9CJ61_AGRT5/186-274-------------------------------------------------------------------------------T
Q8XZI3_RALSO/272-350-------------------------------------------------------------------------------Y
Q6MMX9_BDEBA/201-289-------------------------------------------------------------------------------V
Q7CWM5_AGRT5/240-314-------------------------------------------------------------------------------A
Q6MMX9_BDEBA/48-119-------------------------------------------------------------------------------L
BAMA_HELPY/394-466-------------------------------------------------------------------------------V
Q5R0Z1_IDILO/267-345-------------------------------------------------------------------------------Y
Q8A1E1_BACTN/46-120-------------------------------------------------------------------------------Y
Q5E819_VIBF1/104-185-------------------------------------------------------------------------------I
Q5LSU6_RUEPO/369-442-------------------------------------------------------------------------------I
Q5R0Z1_IDILO/348-422-------------------------------------------------------------------------------V
TAMA_ECOLI/189-263-------------------------------------------------------------------------------Y
Q7NVY6_CHRVO/267-345-------------------------------------------------------------------------------Y
Q6MAE9_PARUW/309-387-------------------------------------------------------------------------------Y
Q92LN9_RHIME/217-291-------------------------------------------------------------------------------A
O51735_BORBU/103-180-------------------------------------------------------------------------------S
Q7UK20_RHOBA/97-179-------------------------------------------------------------------------------A
A9CJ61_AGRT5/359-432-------------------------------------------------------------------------------A
Q82U03_NITEU/174-262-------------------------------------------------------------------------------A
Q9SRL6_ARATH/77-155-------------------------------------------------------------------------------V
Q7VRD8_BLOFL/101-181-------------------------------------------------------------------------------P
Q6MMX9_BDEBA/292-370-------------------------------------------------------------------------------Y
Q8KFQ6_CHLTE/392-467-------------------------------------------------------------------------------Y
Q6LN32_PHOPR/175-263-------------------------------------------------------------------------------A
Q604T9_METCA/207-295-------------------------------------------------------------------------------A
Q8KC70_CHLTE/372-447-------------------------------------------------------------------------------P
Q6ARL5_DESPS/20-91-------------------------------------------------------------------------------H
Q7VRD8_BLOFL/184-272-------------------------------------------------------------------------------A
Q5FPY9_GLUOX/197-285-------------------------------------------------------------------------------T
O66463_AQUAE/72-149-------------------------------------------------------------------------------P
Q73JH4_TREDE/358-431-------------------------------------------------------------------------------S
Q7UK20_RHOBA/349-427-------------------------------------------------------------------------------F
BAMA_BUCAI/266-344-------------------------------------------------------------------------------Y
Q7P0N3_CHRVO/181-255-------------------------------------------------------------------------------I
Q7NVY6_CHRVO/348-422-------------------------------------------------------------------------------T
Q6MKB1_BDEBA/419-500-------------------------------------------------------------------------------T
Q8DI03_THEEB/242-318-------------------------------------------------------------------------------V
Q7VAN9_PROMA/238-314-------------------------------------------------------------------------------P
Q7MAB6_WOLSU/344-416-------------------------------------------------------------------------------V
O66463_AQUAE/152-225-------------------------------------------------------------------------------Y
Q7MYW2_PHOLL/190-266-------------------------------------------------------------------------------Y
Q6MKB1_BDEBA/503-577-------------------------------------------------------------------------------V
Q7MXJ3_PORGI/120-199-------------------------------------------------------------------------------P
Q5NND8_ZYMMO/317-394-------------------------------------------------------------------------------P
Q8EF72_SHEON/112-195-------------------------------------------------------------------------------V
Q6N5Q8_RHOPA/107-184-------------------------------------------------------------------------------P
Q5NEP7_FRATT/273-351-------------------------------------------------------------------------------Y
Q7U8Q8_SYNPX/217-301-------------------------------------------------------------------------------V
Q886N5_PSESM/346-420-------------------------------------------------------------------------------A
Q6ARL5_DESPS/262-340-------------------------------------------------------------------------------Y
BAMA_DESVH/212-298-------------------------------------------------------------------------------L
O84244_CHLTR/104-182-------------------------------------------------------------------------------P
Q5SKT2_THET8/83-163-------------------------------------------------------------------------------P
Q92Q48_RHIME/278-357-------------------------------------------------------------------------------Y
Q83DT2_COXBU/182-270-------------------------------------------------------------------------------A
O84244_CHLTR/356-435-------------------------------------------------------------------------------Y
Q98MC3_RHILO/278-357-------------------------------------------------------------------------------Y
Q7VYC2_BORPE/185-273-------------------------------------------------------------------------------A
Q7NVY6_CHRVO/93-173-------------------------------------------------------------------------------P
Q7VHH5_HELHP/87-166-------------------------------------------------------------------------------P
Q89NX1_BRADU/148-225-------------------------------------------------------------------------------A
A9CJ61_AGRT5/277-356-------------------------------------------------------------------------------Y
Q7NVY6_CHRVO/176-264-------------------------------------------------------------------------------A
Q6FCG7_ACIAD/351-425-------------------------------------------------------------------------------V
Q6ARL5_DESPS/173-259-------------------------------------------------------------------------------V
Q8A1E1_BACTN/203-291-------------------------------------------------------------------------------I
Q8XZI3_RALSO/181-269-------------------------------------------------------------------------------A
Q8D2H0_WIGBR/178-266-------------------------------------------------------------------------------V
O67326_AQUAE/203-287-------------------------------------------------------------------------------I
Q7VHH5_HELHP/262-341-------------------------------------------------------------------------------Y
Q9A711_CAUCR/263-342-------------------------------------------------------------------------------Y
Q9WYS9_THEMA/270-342-------------------------------------------------------------------------------K
Q5E3E7_VIBF1/347-421-------------------------------------------------------------------------------M
Q8I576_PLAF7/116-193-------------------------------------------------------------------------------E
Q87ME5_VIBPA/266-344-------------------------------------------------------------------------------Y
BAMA_BUCAI/92-172-------------------------------------------------------------------------------P
Q83DT2_COXBU/354-428-------------------------------------------------------------------------------V
Q9A711_CAUCR/172-260-------------------------------------------------------------------------------S
Q7MAB6_WOLSU/169-259-------------------------------------------------------------------------------I
BAMA_HELPY/219-309-------------------------------------------------------------------------------I
Q6N5Q8_RHOPA/278-357-------------------------------------------------------------------------------Y
Q83DT2_COXBU/273-351-------------------------------------------------------------------------------Y
Q6N5Q8_RHOPA/360-433-------------------------------------------------------------------------------V
Q5E3E7_VIBF1/266-344-------------------------------------------------------------------------------Y
Q6FCG7_ACIAD/96-176-------------------------------------------------------------------------------P
Q82VX0_NITEU/204-278-------------------------------------------------------------------------------F
Q5E3E7_VIBF1/175-263-------------------------------------------------------------------------------A
Q5LSU6_RUEPO/116-193-------------------------------------------------------------------------------P
Q8KFQ6_CHLTE/57-131-------------------------------------------------------------------------------F
Q8A1E1_BACTN/121-200-------------------------------------------------------------------------------P
Q5SKT2_THET8/164-238-------------------------------------------------------------------------------P
Q9RXD5_DEIRA/180-256-------------------------------------------------------------------------------A
Q7UK20_RHOBA/259-346-------------------------------------------------------------------------------E
O67326_AQUAE/18-90-------------------------------------------------------------------------------A
O51735_BORBU/277-353-------------------------------------------------------------------------------F
Q8EF72_SHEON/198-271-------------------------------------------------------------------------------Y
Q73JH4_TREDE/277-355-------------------------------------------------------------------------------F
Q9RXD5_DEIRA/329-402-------------------------------------------------------------------------------G
Q82U03_NITEU/91-171-------------------------------------------------------------------------------P
Q886N5_PSESM/174-262-------------------------------------------------------------------------------A
BAMA_BUCAI/347-421-------------------------------------------------------------------------------Y
Q5NZG7_AROAE/93-173-------------------------------------------------------------------------------P
Q65R79_MANSM/260-339-------------------------------------------------------------------------------Y
Q886N5_PSESM/265-343-------------------------------------------------------------------------------Y
Q7V0C8_PROMP/253-325-------------------------------------------------------------------------------S
Q8EJN5_SHEON/337-408-------------------------------------------------------------------------------H
Q74AT3_GEOSL/351-424-------------------------------------------------------------------------------V
Q8D2H0_WIGBR/348-422-------------------------------------------------------------------------------L
Q5NEP7_FRATT/179-270-------------------------------------------------------------------------------A
Q8KBW3_CHLTE/43-133-------------------------------------------------------------------------------P
BAMA_DESVH/386-459-------------------------------------------------------------------------------V
Q6LN32_PHOPR/266-344-------------------------------------------------------------------------------Y
Q7VYC2_BORPE/102-182-------------------------------------------------------------------------------P
Q6ARL5_DESPS/343-416-------------------------------------------------------------------------------V
Q604T9_METCA/379-453-------------------------------------------------------------------------------V
Q6LMH9_PHOPR/358-429-------------------------------------------------------------------------------L
Q92Q48_RHIME/187-275-------------------------------------------------------------------------------T
Q9HXY4_PSEAE/265-343-------------------------------------------------------------------------------Y
Q5NND8_ZYMMO/488-566-------------------------------------------------------------------------------Y
Q6MAE9_PARUW/137-215-------------------------------------------------------------------------------P
P73472_SYNY3/425-496-------------------------------------------------------------------------------F
Q5NZG7_AROAE/176-264-------------------------------------------------------------------------------A
Q65R79_MANSM/342-416-------------------------------------------------------------------------------Y
BAMA_DESVH/59-130-------------------------------------------------------------------------------N
Q881Y2_PSESM/187-261-------------------------------------------------------------------------------Y
Q74AT3_GEOSL/27-98-------------------------------------------------------------------------------E
Q5NND8_ZYMMO/569-643-------------------------------------------------------------------------------Q
O51735_BORBU/183-274-------------------------------------------------------------------------------Y
Q7VYC2_BORPE/357-431-------------------------------------------------------------------------------V
Q6MMX9_BDEBA/373-447-------------------------------------------------------------------------------V
BAMA_PHOLL/266-344-------------------------------------------------------------------------------Y
Q9A711_CAUCR/92-169-------------------------------------------------------------------------------P
Q9KPW0_VIBCH/266-344-------------------------------------------------------------------------------Y
Q7VHH5_HELHP/169-259-------------------------------------------------------------------------------I
Q8YUR6_NOSS1/395-466-------------------------------------------------------------------------------V
A9CJ61_AGRT5/106-183-------------------------------------------------------------------------------Q
Q7VRD8_BLOFL/356-430-------------------------------------------------------------------------------F
Q7MAB6_WOLSU/262-341-------------------------------------------------------------------------------Y
B9KGV5_ANAMF/358-430-------------------------------------------------------------------------------V
C4YX56_9RICK/266-342-------------------------------------------------------------------------------Y
G1UBA5_HAEDU/89-168-------------------------------------------------------------------------------.
O83346_TREPA/202-289-------------------------------------------------------------------------------.
BAMA_ECOLI/176-263-------------------------------------------------------------------------------.
BAMA_HAEIN/175-259-------------------------------------------------------------------------------.
Q2YPP8_BRUA2/234-307-------------------------------------------------------------------------------.
Q2YRQ2_BRUA2/108-184-------------------------------------------------------------------------------.
Q2YRQ2_BRUA2/278-357-------------------------------------------------------------------------------Y
Q31PR1_SYNE7/195-269-------------------------------------------------------------------------------.
Q5ZY66_LEGPH/369-442-------------------------------------------------------------------------------V
Q63T20_BURPS/183-270-------------------------------------------------------------------------------.
Q63W94_BURPS/223-295-------------------------------------------------------------------------------.
Q6G5C3_BARHE/361-432-------------------------------------------------------------------------------.
Q8F3T2_LEPIN/54-124-------------------------------------------------------------------------------.
Q8PAW1_XANCP/129-208-------------------------------------------------------------------------------.
Q8RHT4_FUSNN/101-171-------------------------------------------------------------------------------.
BAMA_YERPE/267-344-------------------------------------------------------------------------------.
Q9CJL1_PASMU/262-340-------------------------------------------------------------------------------.
Q9CJL1_PASMU/89-168-------------------------------------------------------------------------------P
Q9FFG3_ARATH/74-151-------------------------------------------------------------------------------V
BAMA_NEIMB/267-343-------------------------------------------------------------------------------.
Q9PEI2_XYLFA/272-347-------------------------------------------------------------------------------Y
Q9ZE03_RICPR/176-263-------------------------------------------------------------------------------.

PF08479

Q8XQ41_RALSO/70-145-------------------------------------------------------------------------------I
Q8RI18_FUSNN/32-109-------------------------------------------------------------------------------F
Q7NU30_CHRVO/77-152-------------------------------------------------------------------------------F
Q7N2L1_PHOLL/77-152-------------------------------------------------------------------------------H
Q7N9T5_PHOLL/77-152-------------------------------------------------------------------------------H
Q6G3U5_BARHE/90-166-------------------------------------------------------------------------------F
Q88MW8_PSEPK/83-158-------------------------------------------------------------------------------W
Q7N107_PHOLL/69-145-------------------------------------------------------------------------------F
Q605Q3_METCA/48-123-------------------------------------------------------------------------------F
Q9JY36_NEIMB/87-166-------------------------------------------------------------------------------F
Q8YM25_NOSS1/96-171-------------------------------------------------------------------------------F
Q7N1B0_PHOLL/77-152-------------------------------------------------------------------------------H
Q89H68_BRADU/98-173-------------------------------------------------------------------------------F
Q9HVN7_PSEAE/59-134-------------------------------------------------------------------------------V
Q8XQZ3_RALSO/84-163-------------------------------------------------------------------------------F
Q880E0_PSESM/77-152-------------------------------------------------------------------------------F
Q8XYH9_RALSO/79-151-------------------------------------------------------------------------------F
Q8DLP0_THEEB/81-156-------------------------------------------------------------------------------I
Q8XQX3_RALSO/69-144-------------------------------------------------------------------------------L
Q7MRX6_WOLSU/59-134-------------------------------------------------------------------------------F
Q9I792_PSEAE/71-146-------------------------------------------------------------------------------F
Q8XPV1_RALSO/81-156-------------------------------------------------------------------------------F
Q7VLT7_HAEDU/59-128-------------------------------------------------------------------------------L
Q7NWR3_CHRVO/87-160-------------------------------------------------------------------------------L
Q6FDM4_ACIAD/101-180-------------------------------------------------------------------------------F
Q63JI8_BURPS/74-148-------------------------------------------------------------------------------F
Q9AAJ4_CAUCR/8-83-------------------------------------------------------------------------------I
Q63TR3_BURPS/65-140-------------------------------------------------------------------------------L
Q89Q77_BRADU/73-148-------------------------------------------------------------------------------F
Q9HVG7_PSEAE/71-146-------------------------------------------------------------------------------F
Q6DA64_PECAS/107-183-------------------------------------------------------------------------------F
Q8RGK0_FUSNN/41-115-------------------------------------------------------------------------------L
Q9PAG8_XYLFA/106-185-------------------------------------------------------------------------------F
Q74E11_GEOSL/79-154-------------------------------------------------------------------------------V
Q8YWF4_NOSS1/18-93-------------------------------------------------------------------------------F
Q7N910_PHOLL/78-154-------------------------------------------------------------------------------F
IBPB_HISS2/99-172-------------------------------------------------------------------------------I
Q88QC1_PSEPK/91-166-------------------------------------------------------------------------------L
Q7NY08_CHRVO/92-167-------------------------------------------------------------------------------L
Q9I5N4_PSEAE/47-122-------------------------------------------------------------------------------V
B4F0Z8_PROMH/77-150-------------------------------------------------------------------------------L
C5BBG6_EDWI9/81-153-------------------------------------------------------------------------------L
D3VFR1_XENNA/80-152-------------------------------------------------------------------------------.
FHAC_BORPE/92-164-------------------------------------------------------------------------------.
HXUB1_HAEIN/73-150-------------------------------------------------------------------------------F
Q0WFB2_YERPE/81-154-------------------------------------------------------------------------------L
Q6D5C4_PECAS/75-150-------------------------------------------------------------------------------F
Q74QU0_YERPE/90-165-------------------------------------------------------------------------------.
Q7CJ53_YERPE/77-153-------------------------------------------------------------------------------F
Q7N9K7_PHOLL/79-152-------------------------------------------------------------------------------L
Q7VX34_BORPE/76-148-------------------------------------------------------------------------------.

PF08478

FTSQ_VIBF1/50-120-------------------------------------------------------------------------------L
FTSQ_SHEON/52-121-------------------------------------------------------------------------------L
DIVIB_BACSU/54-123-------------------------------------------------------------------------------S
FTSQ_RHIME/89-157-------------------------------------------------------------------------------F
Q5P6Z9_AROAE/37-106-------------------------------------------------------------------------------F
O83403_TREPA/55-123-------------------------------------------------------------------------------T
DIVIB_CLOTE/54-122-------------------------------------------------------------------------------F
FTSQ_ECOLI/55-126-------------------------------------------------------------------------------L
Q8D2Z8_WIGBR/41-111-------------------------------------------------------------------------------F
Q83N06_TROWT/56-124-------------------------------------------------------------------------------M
Q8E185_STRA5/122-193-------------------------------------------------------------------------------S
Q5SJC7_THET8/24-91-------------------------------------------------------------------------------V
Q5R0N0_IDILO/43-112-------------------------------------------------------------------------------V
Q6F706_ACIAD/59-128-------------------------------------------------------------------------------A
Q728V1_DESVH/71-139-------------------------------------------------------------------------------F
FTSQ_HAEIN/54-124-------------------------------------------------------------------------------K
DIVIB_STRR6/153-223-------------------------------------------------------------------------------A
Q9CPA8_PASMU/55-125-------------------------------------------------------------------------------K
Q7MNU9_VIBVY/53-123-------------------------------------------------------------------------------L
Q73IQ7_WOLPM/61-128-------------------------------------------------------------------------------F
Q7NQ02_CHRVO/37-106-------------------------------------------------------------------------------F
Q5YYX7_NOCFA/42-110-------------------------------------------------------------------------------L
Q8DVE1_STRMU/126-197-------------------------------------------------------------------------------S
Q82AD6_STRAW/56-125-------------------------------------------------------------------------------L
Q8YQH2_NOSS1/56-126-------------------------------------------------------------------------------K
Q98KB7_RHILO/92-160-------------------------------------------------------------------------------F
FTSQ_COXBU/46-115-------------------------------------------------------------------------------L
Q5HQ08_STAEQ/219-287-------------------------------------------------------------------------------S
Q8DMI0_THEEB/61-130-------------------------------------------------------------------------------R
Q87WY8_PSESM/73-142-------------------------------------------------------------------------------R
Q5FUJ1_GLUOX/84-152-------------------------------------------------------------------------------L
DIVIB_GEOKA/50-118-------------------------------------------------------------------------------G
Q7V8M1_PROMM/59-128-------------------------------------------------------------------------------N
DIVIB_LACLA/153-224-------------------------------------------------------------------------------S
Q65RZ0_MANSM/55-125-------------------------------------------------------------------------------K
Q6AE66_LEIXX/96-164-------------------------------------------------------------------------------L
P73457_SYNY3/54-123-------------------------------------------------------------------------------R
Q73NF1_TREDE/62-130-------------------------------------------------------------------------------S
Q6AJ56_DESPS/51-120-------------------------------------------------------------------------------F
Q9RWN7_DEIRA/101-171-------------------------------------------------------------------------------V
Q604W1_METCA/56-127-------------------------------------------------------------------------------R
Q6NGD0_CORDI/29-97-------------------------------------------------------------------------------M
Q7VMY3_HAEDU/61-131-------------------------------------------------------------------------------T
Q8CXI4_OCEIH/50-118-------------------------------------------------------------------------------S
Q5WFH0_BACSK/51-119-------------------------------------------------------------------------------S
Q7U5Q7_SYNPX/51-120-------------------------------------------------------------------------------K
FTSQ_BLOFL/45-115-------------------------------------------------------------------------------G
FTSQ_VIBCH/52-122-------------------------------------------------------------------------------L
Q6N416_RHOPA/110-178-------------------------------------------------------------------------------F
FTSQ_NEIG1/37-106-------------------------------------------------------------------------------L
Q67Q43_SYMTH/58-125-------------------------------------------------------------------------------F
FTSQ_GEOSL/67-135-------------------------------------------------------------------------------L
Q9CCE5_MYCLE/151-219-------------------------------------------------------------------------------M
FTSQ_CORGL/30-98-------------------------------------------------------------------------------L
Q8R9G8_THETN/29-97-------------------------------------------------------------------------------F
Q8XJA3_CLOPE/42-109-------------------------------------------------------------------------------F
Q7NNV9_GLOVI/69-138-------------------------------------------------------------------------------R
Q6A9Q0_PROAC/48-116-------------------------------------------------------------------------------L
Q5FKV1_LACAC/77-148-------------------------------------------------------------------------------A
Q8FNU2_COREF/30-98-------------------------------------------------------------------------------F
DIVIB_CLOAB/41-109-------------------------------------------------------------------------------F
Q6LMF8_PHOPR/51-121-------------------------------------------------------------------------------L
Q9K9T2_BACHD/50-118-------------------------------------------------------------------------------S
FTSQ_CAUCR/94-162-------------------------------------------------------------------------------F
B1W0J1_STRGG/62-130-------------------------------------------------------------------------------.
B9KHS4_ANAMF/69-137-------------------------------------------------------------------------------F
FTSQ_ZYMMO/97-165-------------------------------------------------------------------------------F
D4ZDU0_SHEVD/36-105-------------------------------------------------------------------------------L
G3XCS0_PROMA/62-129-------------------------------------------------------------------------------.
G8AFN1_AZOBR/99-167-------------------------------------------------------------------------------F
H7C7L9_BORBU/34-101-------------------------------------------------------------------------------.
I6T797_ENTHA/66-137-------------------------------------------------------------------------------S
FTSQ_MYCTU/125-192-------------------------------------------------------------------------------.
DIVIB_STAA8/195-262-------------------------------------------------------------------------------S
Q2YLY9_BRUA2/68-136-------------------------------------------------------------------------------F
Q5M4Y0_STRT2/105-175-------------------------------------------------------------------------------.
Q5ZSA8_LEGPH/39-107-------------------------------------------------------------------------------F
FTSQ_BURPS/37-106-------------------------------------------------------------------------------F
Q65JX8_BACLD/54-123-------------------------------------------------------------------------------S
DIVIB_BACAN/53-121-------------------------------------------------------------------------------S
DIVIB_ENTFA/126-197-------------------------------------------------------------------------------S
Q8F8E7_LEPIN/47-113-------------------------------------------------------------------------------.
DIVIB_LISMO/51-118-------------------------------------------------------------------------------S
Q99YV5_STRP1/126-195-------------------------------------------------------------------------------.
Q9PF78_XYLFA/35-103-------------------------------------------------------------------------------.
FTSQ_RICPR/73-141-------------------------------------------------------------------------------F
S5VEM4_STRCU/60-128-------------------------------------------------------------------------------.

PF06898

F6B8F3_DESCC/8-408KRKLLAIGSVVFLVTLYILSSFVWFIDV..TG..TD.KLSKAEVQRIAAEAGLKRGVLKQQL.DTKLVEKNIRDKIPA.V
D4JTF7_9FIRM/10-387KRWGLVTGALCCCAVIVLLSQFVWRIDI..IG..NS.EVTDTQICAVMEKNGLMPGCSRKSF.DEWVCEQSAMAEISR.L
R5L248_9CLOT/7-384GRWGVFCGMLFFVLLVSFMGGFIWNITV..IG..NQ.TLETSKIVDYLAQNGFKTGVRWSET.DKENLEFAVMADFDR.V
R7QWQ5_9FIRM/7-391RRKLFFGGILLFFLILILLSQFIWNIEI..NG..NS.YITDETVLAYLKEQDLSFGTPKKKI.DAEKLEESFRMAFDD.V
L0FBK0_DESDL/7-397RRKFLLGGILLIGITLAILSQMILSISV..SG..NT.TISSVEIFDSAEKHGLRTWTWQDSV.DLSKVSKTLVEEFPD.A
R6I0K6_9FIRM/6-384RRAVFLLAFVLCVSLAAVSSLFLWRIEI..SG..ND.KLSDAEILRKLAECGVDYGAYWPAL.SSDEIRSRIVSEMPE.I
L0EFM5_THECK/10-388RRKFFAAGLVLFFIGLYLLSSLIWRIEI..EG..NE.RLTDEQILAAARAEGLHVFQWSFRLPGAEELSRRLNTVLPG.T
U5MNL2_CLOSA/5-371RRMSLVIGAGVFFLVIYCLSNYIWAIDI..QT..KN.NLSPFEVRQQLTAVGIKPGLKKSQI.NVYDIERKLEDLNDQ.I
R6SYS4_9FIRM/4-378GRGGLVIGTAAVMLSCFYLSNVVVRFDILSDD.....ENIRKGVMSVLKEEGVETGTYIPSI.DLIVTERALKQKVEG.I
R7F0N3_9BACI/3-369KKYYLVIGAFLFCLILYILSSFCFQVTILEND.....AEFREVLKNELERYGIAPLHLQVSYAKKEEIEQKILETYPKEL
R7P4H2_9CLOT/3-367CEKIFIISLLIGLITLILLSNMIFKIEIIHEN.....KDIRDLIKEELDNYDIKVLHFKKSYKDLNKIRKEILDKYPDKL
Q0AWN4_SYNWW/7-394RRLGFWVGAVIFIAALYFMASFIWFIDV..SG..NQ.KVDKSRIIMTAARYGIYPGAPRWTF.SRSEVEGAMLRDLSE.L
I0JP38_HALH3/8-385QRKALMAAFMLSVVVVFLLANTLWSIKV..EG..LT.PELEANVEKKLKTYGVSPGKLTIGMDDPNDIQRKLLDDIPD.L
R7H622_9FIRM/5-371FRFGIPIGLLLAAAFLFYTSNVVMKIEI..QG..NQ.TVTEEEILTVLAQEGVERGSWMPSL.RYAHCERQLQIKLSP.L
B2A1M5_NATTJ/8-399ERKLLTGGIIFTLVVLSYLSSYIWFIDI..TG..ND.RVNDEEIHEILAKHDLQQGVKRSAV.DIHEIEDDIIATHDE.I
A5N6N1_CLOK5/11-376KRITLVTGIILFIGIIYYLSTFIWSIEI..TS..DK.GLPPYIIRQQLKNYGIKPGINKSKV.NIYKIEEELMKNNDS.I
C8W3N7_DESAS/8-411RRKMLLAGAIIFVVSLYSLTSFIWFIEV..TG..TS.KISNEAVLRAAKNAGLKRGVLKWNL.DTAEFERDIREQLPE.I
R6MSI1_9FIRM/8-382QRVGLLIGAIIGIVLIAVLSKFIWYIDAPPTK.....SLSTSQILSALEEDNVKVGSYINSI.DTENTERRLILKNEQ.I
C3AQR5_BACMY/11-389KNSGFLIGFLIFFFGMIALSNMVWKIEI..TG..AK.PETEYILIKELDKMGIKKGRLQFQMPNVEDVQRHLTDNINA.I
B8CXJ2_HALOH/7-376QNYFLLVGFLILFLILYVGSNFLLFIGI..EG..LE.KIPEERIINILKEEGVRPGILKNRV.NPERLESIILKEEPR.L
W6RVC1_9CLOT/10-376SRISLVIGIVIFFLSLMLFNEIIWSIDI..KT..EK.NISPFEIRNLLYKEGIKEGTFKRKI.NYEDLEEKLKSDHSK.I
D4LTE1_9FIRM/6-388KRKAFFIGIFACALLLAVLSGRVWEIDV..LG..NV.RNSTQEILDFLKEEGIVHGMQRSKI.SCSAIAAAIRENYND.I
K0B1J4_CLOA9/8-387YRKMLLLGLVFSIFIIGYLTSFIWTIDI..VG..NE.NIKDEVIRKNLESINVKQGIRKKDL.DIEDIKSKILINVDE.L
R5NSB5_9CLOT/8-384KRKVFLIGLILVILSIYSLSKFIWNVEV..EG..NE.RISKDEIINVFKEDGLKPGIVKSKV.NVQEIINKIRMERTD.I
R5HMY8_9FIRM/8-391RRYALLAGVALCLVLFAIGSRTVLTIDV..TG..NE.TVTREEIISQLRLCGVSVGTYGPGI.PIREVENRMMMAMDA.L
C0ZB79_BREBN/7-385RRSGLAIGAALFFIGLYMLSSFVWSVEV..SG..TK.MVDPRRVIQAAEQVGIKEGAWKVKLKEPLVLQKELLSLLPE.A
R6XDX7_9CLOT/8-386KRKIFVIGLAMVLITIFTLSKFIWNIEV..IG..NE.KINADEIIQIANENNLKIGKFKNKV.DTKKIINKLRLERDD.I
A8MG63_ALKOO/8-387KRKMLLVGAFFCFTLLIFSSTFIFSIEV..SG..NH.QLERGKIIGILNDLGLKPGANRYKI.NIKDIETQMLLDMEE.L
J7J0E9_DESMD/7-385RRKGLLIGIVIIASVLTILSQLVLSISV..TG..NK.NLVAADVIERAEKLGLRTWVYSKDL.DLNGIAKSLQEQLPD.A
B8I730_CLOCE/8-390NRKAFIIGSAACIITFFIISSFIWDVSV..TG..NE.KVSTEIILGKLYENGIKPGAFKFSI.NPDNVIDNIMLGIND.L
Q97JI9_CLOAB/7-373NRLSILVGIAAFIACVFYLSTFIWQIDI..VT..EK.NIAPYDVRQDLREIGVQPGMKKSSL.DVYKIEEKLMQKNNN.I
R5T3J2_9CLOT/7-380KNYIFYTAIILGLILLFILSKMIFSIEVIHSN.....KDIRDLIYKELNYHGINTFTFKKDYHKLESIENKILSDNKDKL
R6C1Q2_9CLOT/6-386KRKAFLFGLCLACFFWFVSTRFVWEISI..TG..NN.SLTDDRFTTFLQEEGIFVGCQKKNV.DIESLEKEARKTFPE.I
K4LIU5_9FIRM/7-395KRKGLIFGVFIIIAALTVLSQYVLSISV..EG..NS.RVSANQIIAEAGKAGLNKWVLKSSL.DLDQMSKQVQESMPD.L
R6UCV3_9CLOT/10-387KRKLIFVFLFLIIVFSIAFSTFIWDIDI..VG..NE.RVSKEIIISKLKDSGLYIGRNKIGL.DKKEVVNELRAMENE.L
R6N4A7_9CLOT/7-383HRLGLLAGIALFFATIWFLSLHVWVINV..SG..ND.EITEEQVISVMDEIGIRPGVRTSGL.DAELLEQAAMVKLKD.V
I3VX08_THESW/8-382RRKMLVLGAVACVVLAYLFSMFIWSIEI..DG..GQ.NISEASIISELDKLGLKAGVLKPSI.DIHKIQQEFLMDEKD.V
B0TAE5_HELMI/7-400RQRSLVIGVISFVLTILIMSTFVWDVEV..IG..ND.RVDKQQLLQAAAEKGIRLGRWRPLI.DVREAEQAIMGAVPG.L
R5TPA1_9CLOT/8-390KRKLYAAGLASFFVLLYILSIFIWDIEF..EG..NH.MYTYDTLLKYCETEEIRYGMVKSRI.DCDALEESLRSAFPE.I
R5QI90_9FIRM/5-375KRAGLALGFILAAALIFVSTLFVWDIRI..VG..AE.NTEEEEIFAALERRGFRIGAYIPSL.DKERIAMEITKDDGR.F
R5KWN8_9CLOT/12-386KRKIVVLLVALAIFVSIASSTFIWNIDI..DG..NS.YISTDELRKALKESGIFIGSCKIGI.DKKEVVNNVRVNVPD.I
N0B454_9BACI/7-385RNSGIFVGAFLFLFIVLFLSNMVWRVEI..SG..AN.PATEYKIYKQLDKMGIKTGRLQFFIDDVETIQRKLTNNIQA.L
F8I923_SULAT/7-394RQPWIWAGFLGALALVLYASLHIWVVDVTATN..LS.PAETQALLKAARSAGLAPGVWRNRL.DIPRIRQAMEHQLPRQY
D3E517_GEOS4/9-385KRKAFVIGVVAFFMILLTLSSMVWNVEV..EG..NE.TIASEDVLDAAKQEGIYPFQWIFKLQSMDKLSGNLTVRLPG.T
R6H3U2_9CLOT/8-388KRKLFFGFLLLIIIMLGITSNFVWNIQIVKQD..EN.NLDLNSIYQDIAEAGLTVGVKKSKI.NTKEIINKIRTKRND.I
R7F7B5_9CLOT/8-387KRKFFLAMFLIIILALFILSKFIWNIEIKITG..DD..LTEEKILSSLNENGLFIGERKSDI.DIKEIVNNIRLARSD.I
R7M7L8_9CLOT/8-385KRKIFALLFLLVIIAMFTLSNFIWNIEV..VG..NN.KISKDEIIKSLSDNKFKIGMSKFDL.NTKETINKIRLERND.L
R6TJX8_9FIRM/7-385RRYVLLAGLGLCAAAMVYGSFFIWDFQV..EG..NE.TVPDEEILRALEQNGVGIGTFSFSL.DPEGLRNQVLLEIPE.L
Q67S30_SYMTH/7-404RRPFLLAGALGGLAALVWAGSHLWVVDVRING..PG.YLDPRAILAVAAEAGLRQGAWKARI.DLDHVTQHLKSRVEE.L
R5F5D4_9CLOT/9-390KRWYYGAGIMAFFLVLYVMSLFIWDIQF..EG..NY.RYTYDTLVRFLDTQDIDYGMLKARI.NCEDLEASMRTSFPE.I
R5Q8Y0_9CLOT/8-386KRKVFLIVIILVFALLFGLSRFIWNIKI..EG..LD.KIEKREIETILNDNGLTTGKLKSAI.NKQKIINEIRMRRDD.I
R6M0R0_9CLOT/7-380KNRFILLFLLLSMIIIFILSNMIFSVEVIHSN.....SKIIKLVTEELKDRGIKKYAFAKSYSEVEKIEKEILNNNKDNL
R5YC97_9FIRM/7-392KRKIFFAILAAMLVFTTILSTRIWRIEI..IG..NT.SIGEETLLSYLRKHDISYGTQKESI.DNDAMELSLRQDFDP.I
Q8RB55_THETN/13-387KRKGIVLGFLLSVLLVYLFSTFIWEIDVKTVN.....GLKEEEVAKKLSEMGLKSGVSKFKI.DINKLEKEFLLNNEE.V
F4LSY6_TEPAE/8-387KRKAFLFGALLFVVAIYLMSSFIWNIEIKCSD.....NDLSTSIIQDLREWGLREGTFKYGL.DKQYYLNKLLTKYKN.I
R6LHZ6_9FIRM/6-383KRPLFPLLLALAILMGTSLPRFVWFYEV..TG..NE.RVPAQKILRELDALGVGFGTYGKSI.QPQWVKNHMLFRIPE.L
A4XKI6_CALS8/4-376TFK..LISILFCILLLFLFSLFIFDVKI..KSHDSN.KLVDDKIVQTLKNYNIKPFTLKMKI.DQEKLSKKLLADLEE.L
R5T032_9CLOT/3-372RNRVFFVGLVISYIYLLLLSNIIFSVDVIHSK.....AYIRELLYSELKSHGISKYNIVKSYKTKEKIEKEILSNNKDKL
R5B397_9CLOT/7-382FRKALLYGWMVVLALIIAASRYVWIVDV..SG..CD.RVDADKLIASLKDMGVGIGTHKRAV.ATYSLGQRLMATDER.I
R7DBV9_9FIRM/6-388KRKAFFLGLLLCAGLLLFLSGRLWEIDV..EG..NV.RNSTPEILDFLEQKGIRHGMAKERL.SCSEIAAEIRKKYPD.I
R7FM48_9CLOT/8-386KRKLFFVFLLVIIIGLGISSNFVWNIQIVEED..KG.SIE..NLYQDVVESGLEIGKMKSKI.NTKDIINKVRLKRND.I
B1I691_DESAP/9-398RRKTLALGVVFFLTALYVLSSFVWFVEV..EG..NV.KVGEHEILQAAREAGFYRGAPKWRF.EVFAVEEKIKERLPA.V
R7IV24_9CLOT/8-386KRKIFVITLLVVTILIGISTKYVWNINI..QI..DS.NMEMIGIEEDVKEAGLNVGMKKEKI.NVQEIANKIRLKRND.I
SP4_BACMD/7-385KNSGFALGFLSFFIILGLLSNMVWKVEI..SG..AE.PQTEHQMTKQLAKIGVKRGEFQFLLESPEKIQRYLTDNMNN.I
C9RAM9_AMMDK/7-391RRRAFLGGALFFLALIYFLSLFVWRVEV..TG..AQ.KLSPAEILKVAAQAGLKPGVLHRQV.NGKEVERVLKEQLPQ.L
R5XPL9_9CLOT/8-386KRKIFAIALVSIICVIIYLSNFIWNIEI..VG..TD.KINQNELIKTINSEGLTIGKLKRKV.DLKSIINKIRLDRKD.I
A6LRP5_CLOB8/4-370RKISLVIGMGLFFAVIYILSNYIWAIDI..ET..QR.NLSPFEVRQQLSSIGIKPGLNKSQV.NVYQIEKKMEDLNSQ.I
Q892R7_CLOTE/11-377RRRALILGCILFAIIIYYLSTYIWRIDI..IT..EK.NLSPYEIRMELLNYGVKEGVKKKNI.DIYKLEEEIMKNNDS.I
R7HMN6_9FIRM/7-380KDIFILSSLLISLLLIYTLSNIIFKIEVIHSN.....NNIIKLVTKELEDNGIKKYKFVKNYQEIEKIKKKILEENKDTL
E6U532_ETHHY/8-382RHLGILVGLAVFLALVWFFSSFVWEVDV..AG..NQ.SVSSAQVEHVLADLGLRPGAFSMFL.QVRYIQNGLLLRIPE.L
D9R1A2_CLOSW/7-388KRKLYAAGFASFFLILYSLSLFIWDIEF..DG..NR.MYTYDTLIKFCESEEIRYGMRKSKI.DCDVLEESFRSKFPE.I
R7L9N0_9CLOT/9-386KRKIFALLIFIILIIIAILSNFVWNIQI..EG..TE.KISKDELIQTLKEEGLSIGKFKPGI.ETREIINKVRLDRDD.I
A5D3V9_PELTS/9-406RRKALVLGAVFFIGTLYLLSSFVWFIEV..KG..NE.RLSAAEILEAAAEAGLVRGAPKWRF.DAAGVEAKIQEKFPI.V
D4L904_9FIRM/7-374KRTGLFAGAVCGIILCIFLSNFIWSVKI..SG..TE.EISNTYLESLLGDNGISVGVWKNNL.DTDQIERNIQLKCDD.I
E3E8L2_PAEPS/9-385KRKFFLAGLALFWIGLLLMSSLIWDIEV..KG..ND.KLPTESILKAARQEGLYPFQWSFRLSSQDKLSRALMQKLPE.A
R7I713_9CLOT/7-390KQKGVILGFVSGIMLMYGLSLFLWDISF..TG..QS.YYTEEQLLSYLNTIQIHTGIPIHRI.NCQDIEEQIRISYPN.I
E6TW41_BACCJ/7-385KRNGLLFGAAAFFALLYILSNMVWGIEI..EG..AS.APVEHDLREAVTDLGIKQGAFQFRLPPPEEIQSIVTDKITD.A
X4ZFY3_9BACL/8-384KRKFFATGLLLFGIVLVMLSSLVWTVRV..EG..ND.RLASEDVLDAARKEGIYPYQWIWRMDSPDKLSKHLAARLPG.V
R5CSR2_9FIRM/6-384RRFVLCIGVGVCIVLLAISSLFVWRIDI..TG..ND.TISDGVILRALSECGLKNGVFWPAL.SSDEVRSDMLMKLPD.I
E6UAB1_RUMA7/4-383TRPGLIFGALLSALLMAYYSNVILTITV..DT..DD.PAIYGKVMDVLDTDGVKPGAYLPDI.DLVLEERSLKRQIDD.I
R5D9M1_9FIRM/7-386RRYVLLAGAVLALVLMFGGNLVIWDFQV..SG..ND.TVPTETILRALEDYGITVGSPGLHI.DQETMRNHVLLALPE.V
Q8EPX5_OCEIH/7-397KKRFLVIGILVGVLFFLFLSNLLWSVNI..TG..VP.KEIEEKIKVQLDSYGIHSGVWLFSVDSPKDIQRNLLDDVPE.L
R5IHX3_9FIRM/8-382KRPALLILLAAAIAAGIVVPKYVFFYEV..EG..NE.AVPSAQILRELRELGVGFGTYGPSI.KPQELKNQMLLRIPK.L
Q24SU1_DESHY/7-393RRKFLLAGIMIIGVALAVLSQMILSISV..SG..NT.TISSQEIFDSAEKHGLKTWTRQDSV.DLNEVSKLLVEEFPD.A
Q9KD59_BACHD/9-387NRVGFVGGIGLAIVLMFILSNIVWSIEI..KG..AS.PKVEHELRQLVEELGVKRGAFQFTLPSVEDLQREVTEQLSG.A
R5XQE7_9CLOT/3-370RYKTMVFSAIVSLFLLLLTTQFVTDIYI..DC..PE.GIDKKVLRQELEECGLKPGVYKKTI.NRKIIRDHIMQEIDE.V
Q3AEZ9_CARHZ/5-371KRPGIIAGLFLLLGIIYSLTGFIWFIEI..DGFSGR....QREILDILKARKVKPFVRKKAV.DEKMLKREILAQMPE.I
F6CMU5_DESK7/8-406RRKALAFGAVLFVLGLYLLSSFVWTIEV..TG..NS.RVPTKEILSVASAAGLNRGVPKWRL.DCPAVERALKANLPA.I
F2JQA7_CELLD/7-387KRRFFVAGIVVFIAMLWLLSSFVWLVEV..EG..TE.RINSLDIIKSLEKKGYETGKLKSKM.NLREAETYLLQQYPD.I
U5LCI4_9BACI/7-385KNSGFLFGAASFLVILILLSNMVWGIEI..KG..AD.PATEYKIRRQLDEMGIRKGKLQFFVKNVEGIQRELSNEVDE.I
A8FFB9_BACP2/7-386KNIGFTLGIVFFLATILALSNMVWKIDI..KG..AN.PETEHQMRKHLDEIGVQKGRFQFLMGTPEKIQKSLTANIQS.I
L7VHP9_CLOSH/8-388KRKGFVAGLIVFAVLIYLMTSIIWSVEI..TG..NY.NLSRETLMQQLNEMGIFRGATKRSI.NPKHVADKLMLNNRG.L
R6D0A8_9CLOT/8-382KRIGLLTGVLVFALVLLLSGEFVWEIRV..NG..NE.LVSEQEILQSLEEMGLKRGVWKNSL.DVQKLALSLRREYHE.I
Q65H67_BACLD/7-386RNSGFTFGVAAFFIIMFLLSNMLWKIDI..TG..AN.PETEHQIRQQLDQIGVKKGRFQFSMLTPEKIQQALTKRVEN.I
D9QV99_ACEAZ/7-405VRKSLLVGVVVAVMMLYLLSSFIWSVEI..HG..LS.ELSEEKIVNLLKDSGFEYGMLKHTV.DIEELEKKIESHRK..I
C8WY36_ALIAD/8-383RRKAFAVGAVAFVAILYALSSIVWRVEI..VG..AEGEDQEAELRQAAAEAGLQVGQWKSHLAPPVELAERMVARAPN.Y
Q2RKW7_MOOTA/8-408GRQLLLAGVLFFLVAIYILSACVWVVDVRPEKGTLR.QVTPDQVIAAARAEGLKPGAWKGRI.DIRALEYGLEQRLPQ.L
YQFD_BACSU/7-386LNIGFTIGFAIFFILLFLLSNMVWKIDV..TG..AK.PETEHQMRQHLNEIGVKKGRLQFLMMSPEKIQKSLTNGIDN.I
Q5KX07_GEOKA/7-385RNSGFWLGLLLFIAIVFLLSNIVWKIEI..KG..AA.PETEHQIARELKRMGVERGVFQFLLDDPETLQKKLTERVPD.I
R6XTI8_9CLOT/8-386KRKIFVGLLAIIFIALFMMSKFIWNIEV..KG..NT.RISKIEILEELSKNGLKIGTYKGKI.NANSVINKIRLDRED.I
R6NIT4_9CLOT/8-386KRKIFLILLILITCFIGFSSNFVWNVEIKEEN..GQ.KLE..NIEKDIENAGLKTGILKSKV.KTKEVINNIRLQRKD.V
R6G2U3_9CLOT/4-369KRYSIVIAVVVFFAIIFFLSTYIWSIDI..TV..GK.NVTPFEIREQLKEIGISPGVRKASL.DEKEIEKKLESLNSE.I
R6QWU5_9CLOT/7-381IRSGLLVGAILYIAISIILSGYIWNININTSG.....SINEYELREELRSLGLYEGAKISDI.NIQDIEQQATIDMDN.I
F4A357_MAHA5/8-386RRYMFIAGFILFFVIIYILSSFIWTVEI..SG..NA.RVSGQRILEELADSGLKPGIRREGL.SINDIENDMLIKMPE.L
R5ITB3_9CLOT/7-378INRSFIFSIIIGVILLILLSNMIFTIEVSHTD.....NYLKELVLKELNKYGIKEYRFKKSFDELTDIKNKILEDNKKII
R7IQG8_9FIRM/7-393KRVPFCFGIATSFVMIYVLSLFIWDMQV..DG..NY.TYSSYEILRFLKEEGVSTGVKKAQV.NCDAVEKSIRNHYFD.I
F6DMW5_DESRL/8-408QRKLLAIGAVVFLVTLYLLSSFVWFIDV..TG..TD.KLSPQQIKGIASQAGLRPGMAKWNL.DVKAVEKEIRDQLPS.V
R7L3Q3_9FIRM/6-381KRYGLVIGFMLSVGITAFLNDRVMMIEI..GG..NE.TISDSRIISLLEDTGISIGSRISDI.DLRQAERRIKGMDKD.V
K0J274_AMPXN/9-396NFHQLLISLFIACLVFLYLTQSILFIQI..EG..VP.TEMEKQLLTSLNNYGIKKGKLKLLMDKPDQIQSKILTDYPN.I
I4DAP4_DESAJ/7-400RRKGLIAGAAVIAVGLTILSQLVLIISV..TG..NK.NIQTSDILQRAEKLGLKTWIYSKGL.DLNQIAKNLQEELPD.A
D7CNW5_SYNLT/8-391RRRMLMWGAGLFVLALYLLSSFIWVIEV..NG..NV.NLSTETILKAAARHGLYEGAMKWNL.AKTDVEDGILKDLLQ.L
R5Y9N3_9FIRM/7-382ARWGIFAGILFFVAFNSFMGGFIWNVTV..VG..GT.ALQQGKIVDYLAQNGFKTGARWSDT.DKENLEFSVLADFDD.V
R4KCE0_9FIRM/7-406RRRALLGGALCFVIALYALSSFIWFIDI..TG..NQ.SVTEDKIARVAREAGLYRGAPKRSL.DTAELEKTIMQQVND.L
R6YI22_9CLOT/2-369KNKVFIIMAILGLLFLIYLSNTIFSVNIISMN.....KDLNEKIIKELDSYGIKKYHLKKSYDSIEKIKKKITDKYKDSI
G8M1A5_CLOCD/7-388RRKTFVAGAVLFVLLFYFMTSFVWSIEV..TG..NE.KLETEVIMDKVYQLGVKPGVLKYRI.NPHDVANSLRFDIKD.L
K4LKI1_THEPS/8-398RRRMLLVGAVVFCLILYCLSSFIWTVEV..SG..TR.RISQQKVKELAAEAGLRPGSIRFQV.QRDEVVDHLLRELPE.I
G4KWF7_OSCVS/7-385RRQALVACLIVCALALFFGSFFIWDITV..DG..AV.TVPEEEILRALEKNGVGFGTFGFSI.DGEDLRNHILLEIPE.L
R6NSX8_9FIRM/7-390KRYLFLIGFALCIIFFAVSAQFIWVVEI..NG..VE.NSDINGIISTLDSIGIKSGALKAKLPDGMESKAAIINNNDH.I
R6RMK3_9CLOT/7-391KRKPLAAGFICFFLLLYGLSFFIWDISF..EG..NL.RFTDQMLLHYMETLPVACGMRKSAV.SCEELEESLRNQFAE.I
A3DEC5_CLOTH/8-389HRKTFLLGAAVFVVLFYIMTSFVWSVEV..VG..NK.KIETDGILKCLEKYGVKPGVLKYRI.NPEEVANGVILDIDG.L
R6GJ09_9CLOT/6-381KRKGIFVGILCFGLTLYFLSLYIWSIDV..QG..AT.TLDKNELSNLIGGLGVSAGTLKSEI.DTPMLEKTIMKNFDN.I
D9S2Q3_THEOJ/8-389RRKALIGGVLFFIAIMYILSSIVWSVQV..NT..QD.ETLKLSILKDLEEWGLKPGVFKHNI.DKKYYLDKILFNYKN.I
D4LCN8_RUMC1/4-373FRYGAVLGVLGILLVFFWVSNLIVKVEV..TG..NA.AVPEAQIRRVLEEIGIDQGAWIPGI.DFRMCETKLRLAIPE.L
C5D4T1_GEOSW/7-385TNSGFLVGVCFFFVIVFFLSNMVWGIEI..KG..AK.PETEYRILKELKQMGVEKGALQFLIDDPETIQKKLTDRMDV.V
W0EAS0_9FIRM/7-398RRKTLMAGIFIIGMSLIALSQMVLSIQV..TG..VK.MIPEEQLLQSAEMHGLKTWVWQKDV.NTREIVKALVEEFPD.A
F9VJJ5_ARTSS/9-374VYFTLSIGIGVSIGIIMFLSMFIWRIDI..EG..DK.HVSPYEIRQAIKDLGVHKGMLKFKI.DTDKLEEEIVANNKN.L
A0Q1Q5_CLONN/8-374KRKTLLIGIGIFVGIIYYLSGFIWNVNI..IT..EN.NVTPYEIRSQLKDMGIKPGIRKNKI.NVYNIEEQIVRKNGA.I
F0SVD9_SYNGF/7-392RRKGLIAGIFVFLLSLIVTSQFVLTVSI..EG..NN.NISSQQIAVKAGELGIKKWAYKNSL.DLNGLNEKMLESIPE.L
D9SW54_CLOC7/9-375ERKIIMTFPIIFIVVIYLLSSRVWIINI..KT..QN.HLAPFEVRGILKDLGIKEGIKKANL.NVFKLQEEIMSKNEN.I
G2TNK7_BACCO/7-385KNAGFLFGFFLFLAVITVLSNMVWGVEI..KG..AT.PKTEHEIRKQLDKLGIQTGHSQFFLDDIETIQRKLTNNLPD.V
Q8XIU3_CLOPE/5-374KSISIFVGVLIFLVGLYIYSGFIWRIDI..ET..KK.NIAPFEIRTMLNDFDIKPGVKKSSV.NVYGLERKLENGHGD.I
R5HCW7_9MOLU/9-376LNMFLLLFSLFGIFIIVFLSNVIFKIEVVHNS.....SDVRKFILNELETYNIKERTFKKSFNELQTIKNSILEKYKDKI
R7MJV7_9FIRM/5-378LRFGIVIGILAFIFTCFYFSNTVMTIEV..NG..NS.RVKESVILSVLNDMGVKKGTCLNDI.NYSKCERELRIRIDK.I
R5AEU1_9CLOT/3-374QRKTLLLGLAAALACIVIASTRILFIRV..SG..CS.RVAEQTVLRALAAEGLTVGAGNRGW.DLPELNERLRTYDDR.I
R5JAK2_9FIRM/6-375ISKHLIILTIIAFAIFLFFTHVIFDVEVIHSN.....KDIRNLLLNELKAEGIKKLSFKKSYNEISKIKEKILNKYPDKI
R5JWC6_9CLOT/7-386KRKLLVLGALIGCGLVYWGSLFIWDVNV..HG..TY.FYTDAQVADYIEQNAVQLGCRKAEV.DCHQLEEELREVFPE.I
L0KBA1_HALHC/7-398GRKVLAIGIVFVIVSIYIMSHFVLFIEI..KG..TK.ELKEEEIISLLNQVEIYPGVLKSSI.PLHDLTDFIIENKPR.V
R5X7Q5_9FIRM/6-388KRKAFFLGIFLCGMLLLMLSGRIWNIHI..EG..NR.ANSTPEILKFLEDQGVSHGMKKKSL.NCSAIAASIREEYPQ.T
R7NE92_9MOLU/3-369KNNLIIIGIIFASIVFLILSNVIVKINVIHEN.....SELRELIMDSLKEKGVTTLSFKKSYDEYEAIIESIKEEYPDQI
D3FY22_BACPE/7-385LRAGFVAGLAACLAVIIVLSNMVWKVEV..EG..AS.PHVEHELRQVVAEMGIKPWTFQFSLPSVEQIQRDVTEQVSG.A
Q5WHE5_BACSK/7-385IRAGFAIGMVAFFMLMLFSSSMVWGIHI..KG..AS.PHVEQELREVIDEIGIKRGAFQFKLPQPDEVQRIVTEYIDE.A
B2TM04_CLOBB/5-371RKLSLCIGAGVFLLVLYVLSNYIWAIDI..QT..RN.NLSPFEVRKELTSIGIKPGLKKSDI.NVYNIEKKMEDLDSE.V
A6TSK6_ALKMQ/8-387KRKMLLLGAFFSLLLLIFTASFIFTIEL..IG..ND.KIQEEEILEALNESGLKIGSNRYLI.DRNEIEEELMIRFSD.L
G7MCG1_9CLOT/5-371KRISLVIGAMLFFVVIYLLSNYIWAIDI..QT..ER.NLSPFEIRQQLSSIGIRPGLSKSSV.NVYQLEKKMEDLNDQ.I
Q182D1_PEPD6/3-370KHKGMWICALVSLFLLMSTSQFVTDVYI..QS..PE.GIKKEALRNELYKVGVRPGVYKKSI.DRKEVRDHMMSKFND.V
B7GKD9_ANOFW/7-385KNSGIVVGLVAFICIVFLLSNMIWRIEI..TG..AN.PAVEHTVRQQLKKIGIERGALQFVIPSPETIQRTLMNHMDT.V
R6CV47_9CLOT/2-371ENYTFVISLIIGFLFLFLISNTILEINVVHNN.....SDLRNLIYDELKDNNISCFHFVPSFKKRKKIINKIVSDNKDKI
D5XAQ9_THEPJ/8-405RRKMMVVGALTCVAVLYILSSFVWFIDV..AG..NK.KVSTDIILKTAEKAGLYTGTAKWKL.DSSEVEKRIKTELSG.I
A5I631_CLOBH/5-371RRFSLVIGIFIFSFIIYFMSTFIWDIDI..TS..TN.GVTPYEIRQQLKKYGIKPGINKNTI.DVYKIEEKLIKDIDN.I
R6CYS5_9FIRM/7-389RRYVLLAAALVLPLLLAVGSAFIWDFEV..TG..ND.TVPTESVLQALERCGVRVGTRGVGL.DQDELRNRVLPLLPD.V
R6BC91_9CLOT/8-386KRKIFAFFVILIAILLIVTSKFVWNIRV..EG..NN.KINQSEIVSMLEQKGLKVGTLKSRV.NSQEIINEIRLKRAD.I
R4KBT4_CLOPA/9-375NRIAMVLGIFIFIGIISYLSNYIWGIDI..TT..EK.NIAPYEIRDELKNIGIAPGINKKNI.NVYDIEEKLKTNNEN.I
C6CTU6_PAESJ/7-385KRKFFAIGIGLFFVGIYLLSSLVWSIEV..KG..NV.KLTEEQILTAAKKEGIFPMQWSFKLKDKDLLSKELVTDLPG.T
R5AR68_9FIRM/7-385RYRGACAGLLVAVLAVLTSSLFIWRIDV..TG..NE.TLTTGQILRCLDECGVRPGTYWPAL.SNDLVRNDMILHLPE.L
M1LPE2_9CLOT/3-366KKFSLVIGAVMFFGVIYILSNYIWAIDI..ET..QR.NLSPFEIRQQLFSIGIKPGLSKSQI.NVYDIEKKMENINDQ.I
R5A1X4_9CLOT/2-368TNKYMILSIIISLLLLRLLTSTIFEININTED.....QELKKEIFSSLNENGIDIYKKKKTFSELNIIKNNILKSNEDIL
R6Z4S5_9CLOT/6-387KRKLWAAGFFSFFMILYLCSLFIWDIEF..QG..NL.RHSDQELLNFLKTEEISCGVRKGGI.DCEELEGRIRSRYPD.V
R5ACZ0_9CLOT/8-391KHKGMVLGALGGTAIYIFLSGFCWGVTV..TG..TE.VLTKTHVLETAAEKGVFVGASLRDL.DPKEAALAIQNALPE.A
A4J7E2_DESRM/8-408KRKLLVMGGIVFLIALYVLSSFVWFITV..TG..NE.KLTDAEIKKIAAEVGLTPGAAKWDL.DPKLIERTIREKIPA.V

PF07244

Q98MC3_RHILO/107-184VVNQ..VL-FQ.G...........----------------NK.KL......KDN-A.LAAAV.....Q.L..........
Q6ARL5_DESPS/92-170LVSS..VL-FV.G...........----------------LK.EL......KQE-D.VQAVA.....N.I..........
Q5NEP7_FRATT/354-428YVNR..IN-FF.G..........N----------------N..VT......NDY-V.FRRQL.....Q.Y..........
Q5FPE9_GLUOX/347-432VIGP..IS-MT.G..........L----------------A..HT......KQR-Y.LMNRL.....E.L..........
Q8KFQ6_CHLTE/212-301VIEK..IR-FH.G...........----------------NT.AF......KES-K.LRGVL..................
Q73JH4_TREDE/105-183AVNN..IV-FT.G...........----------------NN.NI......RKA-D.LLSAI.....K.V..........
O84244_CHLTR/185-272RIKK..LT-IS.G...........----------------IT.RT......EAS-D.LGDIV.....L.TKQYSTTTSWF
Q9I0U1_PSEAE/190-268TFGK..VS-FD.G..........D----------------S..II......EEE-L.LRRMV.....P.F..........
Q8EGG7_SHEON/97-177TISA..VT-FE.G...........----------------NK.DI......KDE-Q.LQESLD..GSG.V..........
Q8KFQ6_CHLTE/304-389HIRN..IT-WI.G..........N----------------TK.DF......ATT-QILDTTF.....G.I..........
Q9KUB9_VIBCH/347-418QVDE..IV-LQ.N..........N----------------T..HY......SDL-L.LLNRL.....N.L..........
Q73JH4_TREDE/186-274VITK..IL-FE.G...........----------------NS.KF......PEK-A.LKKVLVSKEAWLL..........
Q98MC3_RHILO/360-433YIER..IE-IR.G..........N----------------D..RT......RDY-V.IRREF.....D.V..........
Q6MAE9_PARUW/218-306KIQE..ID-FV.N...........----------------FS.EK......EEH-E.ILSQM.....M.TKKYNIFLSWF
Q8XZI3_RALSO/98-178AISQ..LE-FI.G...........----------------IK.EF......DKD-T.LRRSLR..GVG.V..........
Q8EGG7_SHEON/352-426YVRS..IN-FT.G..........N----------------T..VT......EDE-V.MRREL.....R.Q..........
Q604T9_METCA/124-204SISS..VK-ID.G...........----------------NH.DI......GSE-D.LLKALK..GIG.L..........
Q8D271_WIGBR/189-264RFGK..IN-FY.G...........----------------S..KI......HKS-Y.LKNIS.....N.N..........
Q82VX0_NITEU/116-201AVT...IE-FQ.G...........----------------AL.AADEPAYRARA-EQLRAEW.....P.L..........
Q87LW2_VIBPA/354-425VVDE..IV-IV.N..........N----------------T..HY......SDV-L.LTNRL.....E.L..........
Q6MAE9_PARUW/390-467YVGL..VR-VF.G...........----------------NL.ST......KTS-VILHETL.......M..........
Q6LKQ8_PHOPR/351-422YIDN..IV-LN.N..........H----------------T..LL......SDP-A.LLALL.....D.L..........
O84244_CHLTR/275-353TLGH..VH-IE.G...........----------------FT.AL......SKR-L.LDKQL.....L.V..........
Q5NZG7_AROAE/348-422YVRR..IN-VG.G..........N----------------T..KT......RDE-V.VRREM.....R.Q..........
O67326_AQUAE/374-446YVKK..IK-IK.G..........N----------------Y..ET......RDY-V.IRREM.....R.V..........
Q5NNB2_ZYMMO/333-411SYGS..II-VS.N...........----------------NKHIV......LDA-KHISHIA.....R.F..........
Q7VHH5_HELHP/344-416KIND..VL-IS.G..........N----------------S..RT......ADR-I.IRREI.....L.L..........
Q98MC3_RHILO/187-275QIAA..IN-FV.G...........----------------NS.AY......SSR-R.LSDVI.....N.T..........
Q6FCG7_ACIAD/270-348KFGQ..TK-FL.G...........----------------DA.LY......KPQ-E.LEALK.....I.Y..........
Q6MMX9_BDEBA/120-198SVVE..IT-YE.G...........----------------NS.EV......KSE-D.IADAT.....G.I..........
Q8XZI3_RALSO/353-427YVRR..VN-VV.G..........N----------------S..KT......RDE-V.VRREM.....R.Q..........
Q7MIG8_VIBVY/266-344SVKE..VN-FR.G...........----------------EL.IG......KEE-E.FKALV.....P.F..........
BAMA_HELPY/312-391RISDILIE-ID.............----------------NP.VV......PLK-T.LEKAL.....K.V..........
Q8RHT4_FUSNN/251-335EVKK..MV-TK.QKGNRRTPNDDV----------------L..KT......KDY-V.IDREI.....E.I..........
Q6D152_PECAS/230-304RFGA..VN-FQ.G...........----------------A..QI......RDD-Y.LQNLV.....P.F..........
Q5E2U2_VIBF1/342-414YVNK..IT-IK.N..........D----------------S..LY......TES-M.LLDRL.....N.L..........
Q89NX1_BRADU/319-398RVGS..VD-FR.S...........----------------TVPGF......DPA-A.LRSYS.....R.V..........
Q92Q48_RHIME/107-184LVNQ..VV-FN.G...........----------------NR.KI......KDD-K.LQGVV.....R.T..........
Q5R0Z1_IDILO/176-264EIAQ..IN-IV.G...........----------------NK.AF......ADE-L.LLDTF.....E.L..........
Q5E3E7_VIBF1/92-172TIAN..IS-FS.G...........----------------NK.AI......KEE-Q.MQQNLE..ASS.I..........
Q8D2H0_WIGBR/95-175IINN..IF-FS.G...........----------------NI.SL......EKN-N.IKNILK..SKN.I..........
Q5FPY9_GLUOX/117-194IVNR..IV-FE.G...........----------------NH.AL......KDE-D.LRKEI.....S.L..........
Q8KFQ6_CHLTE/132-209VLQS..VE-FQ.G...........----------------NH.KF......KTK-E.LLNTA.....N.L..........
Q83DT2_COXBU/99-179IISL..IR-IS.G...........----------------NK.AI......STK-K.LRPILN..KLN.I..........
Q6FCG7_ACIAD/179-267KVVE..IN-LI.G...........----------------NT.VF......SDD-D.IKQAF.....A.I..........
Q6N5Q8_RHOPA/187-275GVKS..IE-FV.G...........----------------NK.AY......SSY-R.LKDVI.....K.T..........
Q6ATX4_ORYSJ/67-146RVHD..VI-IK.G..........N----------------A..KT......KEE-L.IEAEV.....A.E..........
Q7MHW3_VIBVY/361-432RVDQ..IV-VI.N..........N----------------T..HY......SDG-L.LTRRL.....D.L..........
Q7MAB6_WOLSU/88-166TIAN..IE-IN.G..........Y----------------GS.GQ......EQE-A.LYKEI.....G.I..........
BAMA_DESVH/301-383KLGK..IG-FD.G...........----------------EL.ID......TDE-R.LLKVV.....K.LDD......HK
Q5NEP7_FRATT/96-176IIAG..FS-FS.G...........----------------NK.KL......SKD-N.LEKVFT..DAG.I..........
O67326_AQUAE/290-371KLKE..IK-IE.G...........----------------NT.LF......AYS-ELVDNILK..KNE............
BAMA_DESVH/131-209RIDN..IV-IE.G...........----------------SD.KV......GHD-D.ILAAM.....S.S..........
Q7UK20_RHOBA/180-256MVSK..VI-YH.G...........----------------NY.RM......NDR-E.LSGRS.....G.I..........
Q7MXJ3_PORGI/386-461NINK..VI-IK.G..........N----------------T..VV......YED-V.VRREL.....Y.T..........
Q98K30_RHILO/218-292GYGA..TT-VE.G...........----------------TE.KV......DRD-F.TEYMT.....G.L..........
Q82U03_NITEU/346-420YVRR..IN-IS.G..........N----------------E..RT......RDE-V.IRREF.....R.Q..........
Q5R0Z1_IDILO/93-173TIAE..IT-FE.G...........----------------NS.DI......KDE-Q.LQESLV..DNN.I..........
Q7MXJ3_PORGI/302-383YIKD..VN-FV.G...........----------------NS.QY......PSE-Y.LERVL.....G.I..........
Q88IV7_PSEPK/195-269RLGA..VT-FG.G..........D----------------T..PL......DED-L.LQRMV.....S.F..........
Q74AT3_GEOSL/270-348RTGA..IG-YK.G...........----------------DL.LE......KEE-D.LTKVL.....R.L..........
Q5NND8_ZYMMO/397-485KVRQ..IN-II.G...........----------------NK.HF......SDA-Q.LRKAM.....A.T..........
Q5FPY9_GLUOX/370-443YVER..ID-IN.G..........N----------------T..IT......HDD-V.IRRNL.....P.M..........
Q6MAC6_PARUW/256-330YFGP..IK-IN.G..........C----------------D..RV......KKS-F.FYKKL.....H.W..........
Q73G77_WOLPM/274-352GNNE..VN-IE.T...........----------------...EI......QDL-S.LKEEILDFITE............
Q82U03_NITEU/265-343TVSD..IK-LA.G...........----------------EL.LV......PEE-E.LRKLI.....K.L..........
Q8EGG7_SHEON/271-349KVKD..VN-LT.G...........----------------DL.MG......REE-L.MKSIL.....P.I..........
BAMA_BUCAI/175-263KINS..IK-IL.G...........----------------VQ.AF......SKE-K.ILSLF.....K.L..........
Q6MKB1_BDEBA/93-170RISQ..VQ-WE.G...........----------------NK.TI......STS-E.AASLF.....G.V..........
Q65R79_MANSM/88-168VIAD..VT-ID.G...........----------------NS.SI......PTD-A.LKQNLD..ANG.F..........
Q5LSU6_RUEPO/196-284EIER..VS-FV.G...........----------------NR.VF......SDR-R.LRRIL.....E.T..........
Q74AT3_GEOSL/179-267LIKS..IR-FE.G...........----------------NK.AF......NAS-K.LRGVM.....E.T..........
Q9A711_CAUCR/345-418YVDR..ID-IV.G..........N----------------T..RT......LDY-V.LRREL.....E.V..........
Q7VYC2_BORPE/276-354KVRE..VK-LA.G...........----------------NL.MG......LDS-E.INNLV.....E.I..........
BAMA_HELPY/138-216RIAG..VE-IK.G..........Y----------------GT.EK......EKD-G.LKSQM.....G.I..........
Q7MPD6_VIBVY/100-183RVETFDVR-IE.G...........----------------E..AS......NDK-D.FLQLLE...KSPL..........
Q7MXJ3_PORGI/45-119TIAS..IE-IE.G...........----------------MR.SF......DDF-V.LRNLS.....G.L..........
Q5NZG7_AROAE/267-345TVSA..VR-FA.G...........----------------DL.IL......PEE-E.YRKLA.....A.I..........
Q9RXD5_DEIRA/97-179VIKD..VQ-AT.G...........----------------...LTFLPADAFKQ-S.VAELL.....N.I..........
Q8DI03_THEEB/90-161LIAE..VV-VE.G...........----------------AT.PE......LEQ-L.VYQVI.....S.T..........
Q604T9_METCA/298-376KVEQ..VR-LT.G...........----------------KT.IV......PPE-Q.LVPLV.....R.I..........
Q886N5_PSESM/91-171SVAS..IE-IE.G...........----------------NK.AI......STE-D.LMKGLK..QSG.L..........
Q8EGG7_SHEON/180-268EIRQ..IN-VV.G...........----------------NH.EF......TDA-E.LIGML.....E.L..........
Q5F5H0_NEIG1/248-322AFGD..FE-IT.G...........----------------TQ.RY......PEQ-T.VSGLA.....R.F..........
Q74AT3_GEOSL/99-176IIRE..VR-IE.G...........----------------NK.EL......STD-K.VRDAL.....G.L..........
Q89KQ1_BRADU/278-357RVGA..LD-FR.S...........----------------SIPNF......DPN-S.MRAYS.....R.V..........
Q87SW5_VIBPA/101-182KVMD..VV-IS.G...........----------------E..AK......EDE-E.FTNLIA..KSP.L..........
A9CJ61_AGRT5/186-274KIGR..ID-FI.G...........----------------NN.SY......SDG-R.LAAVI.....N.T..........
Q8XZI3_RALSO/272-350KVSD..IK-LT.G...........----------------EL.LS......KQA-E.MEKLI.....K.L..........
Q6MMX9_BDEBA/201-289KVKK..IT-FL.G...........----------------NN.HM......GDS-S.LKSKM.....L.T..........
Q7CWM5_AGRT5/240-314PLGA..VT-VT.G...........----------------EK.TV......DGD-F.IRRYS.....R.L..........
Q6MMX9_BDEBA/48-119IVKN..IE-VA.G..........N----------------R..KI......EKD-A.ILTKI.....V.T..........
BAMA_HELPY/394-466YIND..VI-IS.G..........N----------------Q..RT......SDR-I.IRREL.....L.L..........
Q5R0Z1_IDILO/267-345KISE..TD-VI.G...........----------------DL.KG......HDE-L.VGKIA.....K.I..........
Q8A1E1_BACTN/46-120EIAD..IK-VE.G...........----------------VK.NY......EDY-V.LIGLS.....G.L..........
Q5E819_VIBF1/104-185YVSD..IV-IS.G...........----------------E..AA......ADE-D.FINAVD...NSGL..........
Q5LSU6_RUEPO/369-442FVER..ID-IE.G..........N----------------T..TT......LDQ-V.IRRQF.....R.T..........
Q5R0Z1_IDILO/348-422YVRH..IN-FE.G..........N----------------G..AT......KDR-V.LRREM.....R.Q..........
TAMA_ECOLI/189-263RFGH..VT-FE.G...........----------------S..QI......RDE-Y.LQNLV.....P.F..........
Q7NVY6_CHRVO/267-345TVSD..VR-LA.G...........----------------DL.KV......PEA-E.LMKLM.....Q.V..........
Q6MAE9_PARUW/309-387YFGR..LS-FE.G...........----------------NQ.II......CDE-E.IDRLF.....G.I..........
Q92LN9_RHIME/217-291PVGN..LT-VS.G...........----------------AR.TV......DPD-F.VKDYS.....R.L..........
O51735_BORBU/103-180LVNS..VV-FSDS...........----------------SR.VF......WNS-E.LVEKV.....N.I..........
Q7UK20_RHOBA/97-179VVAE..VR-LV.G...........----------------NQ.VI......STT-D.ILAEL.....Q.T..........
A9CJ61_AGRT5/359-432YVER..IE-IR.G..........N----------------T..RT......RDY-V.IRREF.....D.I..........
Q82U03_NITEU/174-262RIKQ..IN-IV.G...........----------------NH.VF......PED-D.LVDLF.....S.L..........
Q9SRL6_ARATH/77-155RVHD..VI-IG.G..........N----------------E..KT......KDH-I.IEAEV.......D..........
Q7VRD8_BLOFL/101-181IIHS..IE-FS.G...........----------------NK.II......KTE-M.IQSILN..SKN.I..........
Q6MMX9_BDEBA/292-370NVGD..VD-FA.G...........----------------DL.LF......PKS-E.LREVI.....K.I..........
Q8KFQ6_CHLTE/392-467TLNI..IN-IK.G..........N----------------T..KT......KDH-V.IRREL.....Y.T..........
Q6LN32_PHOPR/175-263KIQQ..IN-FI.G...........----------------ND.VF......TDA-E.LSSKF.....N.L..........
Q604T9_METCA/207-295RIKQ..IN-II.G...........----------------NN.AF......SDD-D.LTQDF.....E.L..........
Q8KC70_CHLTE/372-447RIEK..IE-VTGG...........----------------PANAI......PEK-EISDTFL.....P............
Q6ARL5_DESPS/20-91RIAA..IS-PQ.G..........N----------------A..RV......DSG-A.ILRKI.....N.S..........
Q7VRD8_BLOFL/184-272NVKQ..IK-IF.G...........----------------NY.IF......SQK-K.LLKQF.....S.I..........
Q5FPY9_GLUOX/197-285LIKK..IV-FV.G...........----------------NH.AF......SEA-R.LSQVI.....S.S..........
O66463_AQUAE/72-149IIKE..IK-IK.G...........----------------NV.FL......RDE-D.VKNVL.....G.I..........
Q73JH4_TREDE/358-431HVEN..II-IK.G..........N----------------T..KT......KDN-V.ILREI.....L.L..........
Q7UK20_RHOBA/349-427KVGD..VQ-IV.G...........----------------NE.YV......TEE-S.LRKRL.....E.L..........
BAMA_BUCAI/266-344KISN..FF-VN.G...........----------------N..LF......PYQ-KLITNLI.....N.I..........
Q7P0N3_CHRVO/181-255GFGK..IT-VN.G...........----------------VK.RY......PEK-V.ALGMA.....D.F..........
Q7NVY6_CHRVO/348-422YVRR..VN-VA.G..........N----------------S..KT......RDE-V.IRREL.....R.Q..........
Q6MKB1_BDEBA/419-500VVES..VT-FT.G...........----------------NQ.AF......TPE-E.LLKVT.....R.L..........
Q8DI03_THEEB/242-318TYRF..LN-KE.GEP.......TK----------------Q..RT......RDF-V.ISREM.....D.T..........
Q7VAN9_PROMA/238-314IFTE..VE-IIPS...........----------------NS.LL......TQS-I.IRDIF.....K.T..........
Q7MAB6_WOLSU/344-416KIND..VL-VS.G..........N----------------T..RT......LDR-V.VRREI.....L.L..........
O66463_AQUAE/152-225FLED..IQ-FE.G...........----------------VK.KL......QKK-E.LIKAS.....G.L..........
Q7MYW2_PHOLL/190-266HFGQ..VR-YR.G...........----------------S..QI......RED-Y.LNHLV.....P.F..........
Q6MKB1_BDEBA/503-577RVAS..II-LE.G..........N----------------T..FT......TDY-V.IHKEL.....E.F..........
Q7MXJ3_PORGI/120-199RISK..VT-FS.G...........----------------VK.KS......ERE-D.LEMKI.....G.L..........
Q5NND8_ZYMMO/317-394IINR..IV-LE.G...........----------------NK.RL......KED-K.IRPEI.....K.L..........
Q8EF72_SHEON/112-195KIQWVDIN-FS.G...........----------------E..ML......DDR-A.FDKWLA..DVN.I..........
Q6N5Q8_RHOPA/107-184VIGR..LA-FE.G...........----------------NK.KI......KDE-Q.LSAEI.....Q.S..........
Q5NEP7_FRATT/273-351KVGS..VS-LT.G...........----------------KF.IL......PKS-E.LESLV.....K.I..........
Q7U8Q8_SYNPX/217-301EVEF..LN-SE.GTSTDENGDPIR----------------G..KT......KEW-V.ITREI.....S.V..........
Q886N5_PSESM/346-420YVNR..IN-YR.G..........N----------------T..KS......EDE-V.LRREM.....R.Q..........
Q6ARL5_DESPS/262-340RIGL..ID-FS.G...........----------------DL.MI......DKK-T.LAKLV.....S.V..........
BAMA_DESVH/212-298YIKK..VK-IE.G...........----------------LK.EL......SES-E.VKDIL.....A.LSERG.MFSWF
O84244_CHLTR/104-182VIRE..IN-IS.G...........----------------NE.AI......PTH-K.ILKTL.....E.L..........
Q5SKT2_THET8/83-163PIAA..VR-VE.............----------------TE.AF......PEE-R.LLTFLEQNFAI............
Q92Q48_RHIME/278-357DFGP..VN-IE.S...........----------------TVEGI......DAE-E.LRGLV.....Q.S..........
Q83DT2_COXBU/182-270KVGS..IQ-FV.G...........----------------NR.AF......SAR-T.LRNQF.....K.L..........
O84244_CHLTR/356-435KIGL..IK-IK.G..........N----------------T..HT......KHD-V.ILHET.....S.L..........
Q98MC3_RHILO/278-357NFGD..IS-VE.S...........----------------TIPEV......DSK-S.LESVV.....E.T..........
Q7VYC2_BORPE/185-273KIRE..IR-VV.G...........----------------SK.AF......SEG-E.LLDQF.....D.L..........
Q7NVY6_CHRVO/93-173VITQ..LN-IN.G...........----------------AK.EF......SKD-Q.LKKALK..DNG.F..........
Q7VHH5_HELHP/87-166KVAS..VE-IK.G..........Y----------------GS.EQ......EKE-T.LYSQI.....G.I..........
Q89NX1_BRADU/148-225VIGR..VA-FE.G...........----------------NR.KI......KDE-Q.LSAEV.....Q.S..........
A9CJ61_AGRT5/277-356DFGN..VA-VE.S...........----------------TVPGV......DGS-E.LQGLV.....E.T..........
Q7NVY6_CHRVO/176-264RIRE..IR-IV.G...........----------------AN.AF......AQS-K.LLDEF.....S.L..........
Q6FCG7_ACIAD/351-425KVRR..IN-IV.G..........N----------------T..KT......ADD-V.LRREM.....R.Q..........
Q6ARL5_DESPS/173-259YVEE..IS-FE.G...........----------------NK.NF......DAG-E.LEDIL.....E.T..........
Q8A1E1_BACTN/203-291KVHA..IH-IT.G...........----------------NS.AI......KTS-K.LKKVM.....K.KTNEKGKLLNL
Q8XZI3_RALSO/181-269KIRQ..IN-IV.G...........----------------NK.AF......SEG-D.LRDEM.....Q.L..........
Q8D2H0_WIGBR/178-266LIKE..IN-FI.G...........----------------NN.KF......SKK-N.LINKIE..LCE.Y..........
O67326_AQUAE/203-287YTSD..IE-IE.G...........----------------NK.HF......SDR-K.LKGLM.....E.L..........
Q7VHH5_HELHP/262-341KVSE..IK-II.L...........----------------HVPVI......EEK-E.LRKVL.....K.V..........
Q9A711_CAUCR/263-342KFGK..IT-VE.T...........----------------ELKKL......DGN-L.LAQIL.....P.V..........
Q9WYS9_THEMA/270-342KFKE..IL-FH.G...........----------------NT.IF......TDQ-E.LLRAS.....G.L..........
Q5E3E7_VIBF1/347-421YVRD..IR-FV.G..........N----------------T..ST......KDE-V.LRREM.....R.Q..........
Q8I576_PLAF7/116-193MINN..VI-IK.N...........----------------ST.VI......NAE-I.LNELM..................
Q87ME5_VIBPA/266-344TVKD..VK-FR.G...........----------------DL.IG......EEA-T.FERLV.....P.F..........
BAMA_BUCAI/92-172IISN..VI-VS.G...........----------------NH.II......ASS-V.LDPYL.....KKLN........I
Q83DT2_COXBU/354-428YVRR..IS-FF.G..........N----------------Q..RT......DQE-V.LRREM.....R.Q..........
Q9A711_CAUCR/172-260GVLG..IN-FL.G...........----------------NA.EY......SDN-D.LRDVI.....V.T..........
Q7MAB6_WOLSU/169-259IIRK..VN-YN.G...........----------------AE.KL......SAS-K.LEIPT.......V..........
BAMA_HELPY/219-309YIKQ..SI-YE.G...........----------------SA.KL......KRR-M.IESLS.......A..........
Q6N5Q8_RHOPA/278-357RVGS..VT-FE.S...........----------------AIPTL......DGN-S.MRSFS.....R.V..........
Q83DT2_COXBU/273-351HLSG..YT-IT.G...........----------------ET.YG......FKD-Q.LYRLV.....K.L..........
Q6N5Q8_RHOPA/360-433YIER..IN-VV.G..........N----------------T..RT......RDY-V.IRREF.....D.I..........
Q5E3E7_VIBF1/266-344TVSG..VK-FQ.G...........----------------EL.IG......KEE-E.FKKLI.....P.F..........
Q6FCG7_ACIAD/96-176VISK..IE-FK.G...........----------------NK.LI......PKE-A.LTEGLK..KMG.V..........
Q82VX0_NITEU/204-278RYGE..LQ-IT.G...........----------------LE.RY......KPD-V.VQNSV.....P.F..........
Q5E3E7_VIBF1/175-263KIQQ..IN-FI.G...........----------------NE.VF......TDE-Q.LLSRF.....N.L..........
Q5LSU6_RUEPO/116-193TINR..IN-FE.G...........----------------NR.RV......KDE-T.LEGAI.....G.S..........
Q8KFQ6_CHLTE/57-131TVRE..IT-FS.G...........----------------LQ.TI......KES-E.LLKSL.....P.I..........
Q8A1E1_BACTN/121-200RIAD..VR-YH.G...........----------------VK.KS......ERT-D.FESKL.....G.M..........
Q5SKT2_THET8/164-238EVKA..VR-LL.G...........----------------VS.LL......PEE-E.LRKGL.....E............
Q9RXD5_DEIRA/180-256PLSR..IE-VT.G...........----------------AT.LL......PQA-T.VQNIF.....RPL..........
Q7UK20_RHOBA/259-346RIED..IQ-IE.G...........----------------AS.IV......SES-R.LKKVI.....Q............
O67326_AQUAE/18-90EIEK..II-IK.G...........----------------NK.YI......PDE-L.IRGLL.....S.V..........
O51735_BORBU/277-353RFGK..LE-IS.G...........----------------NS.VF......SLE-E.LKSFI.....T.F..........
Q8EF72_SHEON/198-271HFGQ..VS-FE.G...........----------------H..TL......EPD-I.LTKLI.....P.F..........
Q73JH4_TREDE/277-355TYAG..VD-FE.G...........----------------NY.IF......STK-E.LSEKF.....K.L..........
Q9RXD5_DEIRA/329-402PVKS..IA-FV.G...........----------------NT.KV......PTA-Q.LQAAI.....K.T..........
Q82U03_NITEU/91-171AIAQ..IS-IN.G...........----------------AK.EF......DKD-K.LKEGLK..QAG.L..........
Q886N5_PSESM/174-262SIQH..IN-VV.G...........----------------NT.VF......SDE-D.LTDLF.....E.L..........
BAMA_BUCAI/347-421FVKR..IY-FT.G...........----------------NE.IT......QDR-V.LRRKI.....K.Q..........
Q5NZG7_AROAE/93-173AIAQ..ID-FV.G...........----------------VK.EF......DKE-A.LKKGLR..EVG.L..........
Q65R79_MANSM/260-339TIKD..AR-IV.G...........----------------DV.AG......MQD-E.LQPIL.....KTI..........
Q886N5_PSESM/265-343SVKS..VK-LS.G...........----------------DL.KV......PED-Q.VKSLL.....L.V..........
Q7V0C8_PROMP/253-325VVDG..KP-RK.G...........----------------...KT......KDW-V.IKREL.....K.T..........
Q8EJN5_SHEON/337-408VIED..IV-FD.N..........Q----------------S..KV......SLN-L.LKETL.....E.L..........
Q74AT3_GEOSL/351-424FFDR..IN-VS.G..........N----------------T..KT......RDK-V.IRREL.....K.V..........
Q8D2H0_WIGBR/348-422YVNH..IN-FS.G..........N----------------E..YT......KEH-V.IRRNL.....K.Q..........
Q5NEP7_FRATT/179-270IIDS..IN-FV.G...........----------------NK.SF......ADS-D.LDSSV.....A.F..........
Q8KBW3_CHLTE/43-133EVKS..IK-IT.G...........----------------NK.AL......TTE-E.IREVM.....STS..........
BAMA_DESVH/386-459YINR..VL-VE.G..........N----------------Q..KT......RDN-V.VLREM.....R.I..........
Q6LN32_PHOPR/266-344QVKD..VT-FR.G...........----------------DL.SK......DNK-D.LNELV.....T.I..........
Q7VYC2_BORPE/102-182TIAS..IS-FN.G...........----------------MR.EF......DSK-A.ITKSLA..QVG.F..........
Q6ARL5_DESPS/343-416YIDR..IT-IN.G..........N----------------V..RT......RDN-V.IRREL.....R.I..........
Q604T9_METCA/379-453YVRR..IN-FQ.G..........N----------------T..KT......RDE-V.LRREM.....R.Q..........
Q6LMH9_PHOPR/358-429YIDE..VR-LV.N..........N----------------S..QY......SDQ-A.LLDRL.....D.L..........
Q92Q48_RHIME/187-275KITQ..IN-FV.G...........----------------NE.VY......SDG-R.LQSVI.....A.T..........
Q9HXY4_PSEAE/265-343TIRD..VK-LT.G...........----------------DL.KV......PEE-E.VKRLL.....L.V..........
Q5NND8_ZYMMO/488-566KFGD..IT-LD.S...........----------------QIRDV......KAE-N.FKSLV.....K.I..........
Q6MAE9_PARUW/137-215TIRN..IH-WC.G...........----------------NH.RV......STN-R.LQKEL.....G.I..........
P73472_SYNY3/425-496DSED..EP-VQ.G...........----------------...RT......RDF-I.ITREM.....R.L..........
Q5NZG7_AROAE/176-264KIRQ..IE-II.G...........----------------NK.AF......KDS-E.VLGLF.....Q.L..........
Q65R79_MANSM/342-416SVRQ..IR-FE.G..........N----------------T..VT......ADS-T.LRQEM.....R.Q..........
BAMA_DESVH/59-130AIAD..VK-VR.G..........T----------------K..VL......DPD-V.VLMRL.....S.T..........
Q881Y2_PSESM/187-261SLGK..VM-FS.G..........N----------------T..PF......DED-L.LKRMV.....P.F..........
Q74AT3_GEOSL/27-98KIID..VR-VK.G..........N----------------R..RV......ETA-A.ITNAL.....S.L..........
Q5NND8_ZYMMO/569-643YIER..VD-IS.G..........N----------------T..TT......RDK-V.IRREF.....R.L..........
O51735_BORBU/183-274VVKG..ID-FE.G...........----------------NL.SF......KSS-T.LRKSLASRVVSLF..........
Q7VYC2_BORPE/357-431YVRR..IQ-IG.G..........N----------------T..RT......RDE-V.VRREM.....R.Q..........
Q6MMX9_BDEBA/373-447YFGK..IN-MV.G..........N----------------S..KT......RDK-V.IRREL.....K.V..........
BAMA_PHOLL/266-344KISG..ID-LN.G...........----------------NM.AG......YQS-E.ITKLA.....A.I..........
Q9A711_CAUCR/92-169IINQ..VV-FE.G...........----------------NS.SL......KED-K.LKDEV.....Q.I..........
Q9KPW0_VIBCH/266-344TVSK..VQ-FR.G...........----------------EL.MG......KEA-E.FTSLI.....P.F..........
Q7VHH5_HELHP/169-259IIKK..AE-YD.G...........----------------RE.KL......KVS-E.VEELS.......A..........
Q8YUR6_NOSS1/395-466NEQG..QP-IR.G...........----------------...RT......QDY-I.ITREV.....E.L..........
A9CJ61_AGRT5/106-183LVNQ..VV-FN.G...........----------------NR.KI......KDD-K.LAGIV.....Q.T..........
Q7VRD8_BLOFL/356-430YVRE..VQ-FE.G...........----------------NN.FT......QDF-V.IRREI..................
Q7MAB6_WOLSU/262-341EVSK..VE-IVLE...........----------------EP.VV......GVE-E.LMDEV.....R.L..........
B9KGV5_ANAMF/358-430YIHR..IN-IL.G...........----------------NN.RT......LDH-V.MRRKL.....G.I..........
C4YX56_9RICK/266-342SFGN..IT-ID.N..........K----------------LT.NI......DIT-P.LNKIV.....N.I..........
G1UBA5_HAEDU/89-168LINN..LT-IK.G...........----------------NN.AI......PKN-A.LEQNLK..ANL.I..........
O83346_TREPA/202-289VVSR..IQ-FK.G...........----------------NK.AF......TES-V.LKKVL.....S.T..........
BAMA_ECOLI/176-263EIQQ..IN-IV.G...........----------------NH.AF......TTD-E.LISHF.....Q.L..........
BAMA_HAEIN/175-259.LAS..LT-FK.G...........----------------NE.SV......SSS-T.LQEQM.....E.L..........
Q2YPP8_BRUA2/234-307YYGP..VS-VV.G...........----------------TA.RM......DPQ-F.VAWMT.....G.L..........
Q2YRQ2_BRUA2/108-184VVNN..VL-FQ.G...........----------------NK.KI......KDP-D.LARAV.....Q.L..........
Q2YRQ2_BRUA2/278-357TFGD..VS-VE.S..........T----------------VD.GV......DTQ-A.LDRLV.....K.T..........
Q31PR1_SYNE7/195-269VLSK..IE-LD.G...........----------------AR.VL......PDS-V.IQETF.....K.D..........
Q5ZY66_LEGPH/369-442YVRR..IN-FH.G...........----------------NT.KT......GDY-V.LRNVI.....R.Q..........
Q63T20_BURPS/183-270KIRQ..IN-FI.G...........----------------NK.AF......KTS-T.LRDEM.....Q.LSTPN.WFSWY
Q63W94_BURPS/223-295TIGA..LD-VS.G...........----------------VR.RY......PEK-I.VHDVN.....P.L..........
Q6G5C3_BARHE/361-432YVQR..IE-IR.G...........----------------NE.KT......RDY-V.IRREI.....D.L..........
Q8F3T2_LEPIN/54-124TIKE..VK-FK.G...........----------------NK.NT......PDA-D.LESMI.....E.I..........
Q8PAW1_XANCP/129-208AINK..LT-VT.G...........----------------NK.DI......KSE-E.LLKGLG..DIG.L..........
Q8RHT4_FUSNN/101-171VLSS..VK-FT.G...........----------------NK.RV......TTS-E.LLDIT.....Q.L..........
BAMA_YERPE/267-344KLNS..VI-VS.G...........----------------NL.AG......HQS-E.AEKLT.....K.I..........
Q9CJL1_PASMU/262-340TVKS..AR-IL.G...........----------------DV.GG......MSA-E.LAPIL.....DAI..........
Q9CJL1_PASMU/89-168VISN..VV-ID.G...........----------------NK.SI......PDE-A.IKQNLD..ANG.F..........
Q9FFG3_ARATH/74-151RVHD..VI-VK.G...........----------------NE.KT......KDH-V.IEAEV.....D.V..........
BAMA_NEIMB/267-343.WGK..VS-IE.G..........D----------------TN.EV......PKA-E.LEKLL.....T.M..........
Q9PEI2_XYLFA/272-347KISS..IK-VT.G...........----------------NT.VL......PQE-K.IEKLV.....I.P..........
Q9ZE03_RICPR/176-263VIKS..IY-FS.G...........----------------NE.HY......SDS-E.LKSIV.....L.T..........

PF08479

Q8XQ41_RALSO/70-145PVRH--VR.VT-G-------....----------------AR-LY------PTA.V-LEALV-----A-D----------
Q8RI18_FUSNN/32-109HISQ--IN.LE-D-------....----------------NE-RL------LNEIE-KENIL-----G-K----------
Q7NU30_CHRVO/77-152TLSR--VS.LE-G-------....----------------AP-AG------WLA.W-LQPLA-----D-A----------
Q7N2L1_PHOLL/77-152TIRY--IQ.FE-G-------....----------------VE-SL------SQS.V-REKLI-----Q-S----------
Q7N9T5_PHOLL/77-152TIHR--IE.FD-G-------....----------------AK-SL------PLP.I-KQHLI-----H-P----------
Q6G3U5_BARHE/90-166PIHD--II.VD-G-------....----------------VY-HL------KKS.S-IAAVT-----G-P----------
Q88MW8_PSEPK/83-158AVDG--VR.VA-G-------....----------------MH-RL------SNS.A-LAPTI-----R-A----------
Q7N107_PHOLL/69-145PITH--VR.LA-G-------....----------------TE-NF------PHWLP-FRLVA-----Q-Q----------
Q605Q3_METCA/48-123DVWE--YR.VE-G-------....----------------NS-VL------DQR.V-VEKTV-----Y-G----------
Q9JY36_NEIMB/87-166AINE--VV.LE-G-------EHHA----------------RF-QF------ALK.R-ALRET-----G-F----------
Q8YM25_NOSS1/96-171RVDR--IE.VV-G-------....----------------SQ-VF------PPE.K-FTPIT-----D-P----------
Q7N1B0_PHOLL/77-152TIQQ--IE.FV-G-------....----------------AE-SL------SKS.V-KQNVI-----H-P----------
Q89H68_BRADU/98-173VLRG--LN.VS-G-------....----------------AR-AV------SRD.R-IAAVY-----Q-P----------
Q9HVN7_PSEAE/59-134LVKR--FQ.LS-G-------....----------------NR-QF------DDR.R-LLALL-----H-D----------
Q8XQZ3_RALSO/84-163RIDR--IT.LT-G-------DAAE----------------RF-QW------ALP.A-ADPSD-----D-P----------
Q880E0_PSESM/77-152TISR--IE.LK-G-------....----------------AD-SL------SPA.E-RDALI-----K-P----------
Q8XYH9_RALSO/79-151PIQG--IV.LE-D-------....----------------NV-..------.FN.W-LPYLL-----Q-P----------
Q8DLP0_THEEB/81-156PVQK--II.VE-G-------....----------------ST-LF------GPA.E-FDPIL-----K-P----------
Q8XQX3_RALSO/69-144TPSK--FQ.IE-G-------....----------------VK-AL------PFP.E-IAAHF-----A-P----------
Q7MRX6_WOLSU/59-134ITRS--IH.DE-G-------....----------------IT-LL------QEE.K-KQSLY-----R-Q----------
Q9I792_PSEAE/71-146EIRR--IE.LE-G-------....----------------AG-HL------GES.A-RRQLL-----A-P----------
Q8XPV1_RALSO/81-156DIHR--IE.LT-G-------....----------------NT-VL------DAD.T-VERVT-----Q-P----------
Q7VLT7_HAEDU/59-128PYKG--IK.FQ-G-------....----------------IT-LI------DPL.P-YL...-----.-P----------
Q7NWR3_CHRVO/87-160PVSG--LK.LA-G-------....----------------IR-LL------SRE.E-VTAL.-----G-P----------
Q6FDM4_ACIAD/101-180EIKD--IH.LQ-G-------EKAE----------------HF-LF------ALN.E-ITQGT-----H-N----------
Q63JI8_BURPS/74-148PITQ--IE.VR-G-------....----------------.G-AR------HSR.E-IDRIV-----E-R----------
Q9AAJ4_CAUCR/8-83ILKH--VN.FP-G-------....----------------AT-VV------PPH.D-LQPAW-----Q-N----------
Q63TR3_BURPS/65-140TPSS--FQ.VE-G-------....----------------VK-SI------PFE.E-ISQRF-----T-P----------
Q89Q77_BRADU/73-148RLRK--VE.FD-A-------....----------------SK-FI------TPA.E-LDEIA-----K-K----------
Q9HVG7_PSEAE/71-146KLRE--IR.IE-G-------....----------------NT-RY------DKA.V-LESYY-----Q-H----------
Q6DA64_PECAS/107-183PIKK--VE.LQ-G-------....----------------TE-DF------PGWLP-LQRLA-----D-Q----------
Q8RGK0_FUSNN/41-115NVTS--ID.LE-G-------....----------------NT-IF------EDF.Q-IDALL-----R-K----------
Q9PAG8_XYLFA/106-185PIQK--IF.LE-G-------DKAA----------------RF-QW------ALT.A-ANPPH-----D-P----------
Q74E11_GEOSL/79-154FISH--IV.TD-P-------....----------------SE-IL------TED.D-LRQVV-----A-P----------
Q8YWF4_NOSS1/18-93LVKK--IE.VL-G-------....----------------AT-VL------KN..E-IAKLI-----E-P----------
Q7N910_PHOLL/78-154PITR--VV.LE-G-------....----------------TE-HF------PHWLP-LKRLA-----Q-Q----------
IBPB_HISS2/99-172TKIT--ID.FG-G-------....----------------EE-IF------L...D-FDEVT-----K-H----------
Q88QC1_PSEPK/91-166VLQK--VR.FE-G-------....----------------GT-VF------PLG.D-LREHY-----Q-P----------
Q7NY08_CHRVO/92-167LVQD--IV.LE-G-------....----------------NT-VF------DNK.T-LLELV-----A-D----------
Q9I5N4_PSEAE/47-122DINE--YV.VR-G-------....----------------NT-VL------DNR.A-IEAAV-----Y-P----------
B4F0Z8_PROMH/77-150PIKG--VY.IQ-G-------....----------------IT-LL------TEK.D-LNSL.-----S-P----------
C5BBG6_EDWI9/81-153PISG--VY.LT-G-------....----------------IT-LL------SLR.D-LRAL.-----D-A----------
D3VFR1_XENNA/80-152AITG--VY.LQ-G-------....----------------IT-LL------SIR.D-LNTL.-----S-A----------
FHAC_BORPE/92-164..HA--VD.LD-F-------....----------------GV-EG------RLF.D-PAPLV-----Q-D----------
HXUB1_HAEIN/73-150PLKQ--VQILD-R-------...N----------------NQ-EV------VTD.E-LAHIL-----K-N----------
Q0WFB2_YERPE/81-154PITG--VF.LQ-G-------....----------------NT-LL------SSQ.D-LNQI.-----D-H----------
Q6D5C4_PECAS/75-150TINE--IH.YR-N-------....----------------SS-LL------SEK.D-KNTLN-----K-D----------
Q74QU0_YERPE/90-165AINN--VE.LI-N-------....----------------LD-AF------PNAAH-LKEKA-----E-E----------
Q7CJ53_YERPE/77-153VIDR--VT.LS-G-------....----------------TE-PL------PRWLP-LQRIA-----N-Q----------
Q7N9K7_PHOLL/79-152PLTG--VY.LK-G-------....----------------IS-LL------SVR.D-LSTL.-----S-A----------
Q7VX34_BORPE/76-148..RN--FD.VA-G-------....----------------VH-AL------PFD.Q-VAAFL-----T-P----------

PF08478

FTSQ_VIBF1/50-120PLSH--MI-IQ-G---------------------------QLKHI------TAD-D-IREAI-----D-S----------
FTSQ_SHEON/52-121PIEA--VA-IK-G---------------------------ERTYT------TDK-D-IQIAL-----Q-D----------
DIVIB_BACSU/54-123KVST--IS-VT-G---------------------------.NENV------SKK-E-IIDLS-----D-I----------
FTSQ_RHIME/89-157AIED--VR-VS-G---------------------------.NAQT------SEI-D-ILQQL-----G-L----------
Q5P6Z9_AROAE/37-106PLRE--VV-VL-T---------------------------PPAQV------TTA-Q-LEYVA-----R-T----------
O83403_TREPA/55-123SFAK--VE-FS-G---------------------------.NVTI------SPE-Y-LMKAA-----G-L----------
DIVIB_CLOTE/54-122NVKI--VE-VK-D---------------------------.NKSI------KKE-S-IIKSS-----Q-I----------
FTSQ_ECOLI/55-126PLSK--LV-LT-G---------------------------ERHYT------RND-D-IRQSI-----L-A----------
Q8D2Z8_WIGBR/41-111PISH--II-IK-G---------------------------NMNFT------PQE-D-IRQIF-----L-N----------
Q83N06_TROWT/56-124SLRS--IR-VA-G---------------------------.NMQV------KTD-D-IVA..-----A-L----------
Q8E185_STRA5/122-193KQKT--IT-VS-G---------------------------.NQHT------PDD-I-LIEKT-----N-I----------
Q5SJC7_THET8/24-91PVEE--VR-VE-G---------------------------.LRHL------SRE-A-VLQTL-----R-L----------
Q5R0N0_IDILO/43-112PLAE--LS-VQ-G---------------------------ELHYT------ASE-E-VRQAL-----.-T----------
Q6F706_ACIAD/59-128KIAD--LS-IV-G---------------------------TRSVV------EQN-Q-LQQHI-----Q-P----------
Q728V1_DESVH/71-139AIRD--VE-IS-G---------------------------.NLML------SKD-E-ILATA-----G-L----------
FTSQ_HAEIN/54-124PISA--FA-LV-G---------------------------QNTFT------TAD-D-IKESL-----L-K----------
DIVIB_STRR6/153-223TMKD--IR-VE-G---------------------------.TVQT------TAD-D-IRQAS-----G-I----------
Q9CPA8_PASMU/55-125PISA--FI-LT-G---------------------------TPTFT------TYD-D-IRDVV-----L-K----------
Q7MNU9_VIBVY/53-123PLSK--II-LQ-G---------------------------DLQYV------TAD-D-VQHAF-----G-S----------
Q73IQ7_WOLPM/61-128SIDE--VV-VS-G---------------------------.NKFT------NKK-D-ILS..-----L-T----------
Q7NQ02_CHRVO/37-106PVKK--IR-IQ-G---------------------------DMNRV------TAE-Q-LKFIA-----E-H----------
Q5YYX7_NOCFA/42-110SVRT--VD-VE-G---------------------------.LRAV------PED-E-VMAQL-----Q-V----------
Q8DVE1_STRMU/126-197RQKE--IT-VS-G---------------------------.NKNA------IES-Q-LIEEL-----G-I----------
Q82AD6_STRAW/56-125RVER--VS-VS-G---------------------------.TRVL------TEG-Q-VREAA-----D-V----------
Q8YQH2_NOSS1/56-126TPEQ--VL-MK-S---------------------------DNQLL------SQE-A-IKSLL-----V-L----------
Q98KB7_RHILO/92-160AVDQ--VK-VV-G---------------------------.NRQT------SEI-D-ILDRL-----E-L----------
FTSQ_COXBU/46-115PFRQ--IK-IT-V---------------------------SSDHI------KMA-E-LKDIV-----V-H----------
Q5HQ08_STAEQ/219-287KISN--VN-IK-G---------------------------.NNNV------STS-K-IKKEL-----N-V----------
Q8DMI0_THEEB/61-130GPEQ--VL-IR-G---------------------------.NQLL------KTE-A-LQAQL-----P-L----------
Q87WY8_PSESM/73-142PIAR--IN-VQ-G---------------------------DLSYI------SQQ-A-VQQRI-----A-P----------
Q5FUJ1_GLUOX/84-152PIRH--IV-IN-G---------------------------.RGMT------SEA-S-IQEAL-----G-T----------
DIVIB_GEOKA/50-118AVGH--VE-VS-G---------------------------.NRHL------TAE-R-IISLS-----G-I----------
Q7V8M1_PROMM/59-128NAKQ--IH-VQ-G---------------------------.SRNI------QTN-T-VIKAG-----A-L----------
DIVIB_LACLA/153-224KIST--FS-VS-G---------------------------.NANE------SSE-Q-VALAS-----G-I----------
Q65RZ0_MANSM/55-125PISS--FA-LV-G---------------------------TPQYT------TNA-D-VRDMI-----L-K----------
Q6AE66_LEIXX/96-164ALKN--IE-VT-G---------------------------.TERL------DPQ-A-IRQKL-----G-D----------
P73457_SYNY3/54-123SDRQ--VE-FL-G---------------------------.NKLV------SRE-T-LYEDL-----D-L----------
Q73NF1_TREDE/62-130SIAA--VN-IS-G---------------------------.CSDL------SSI-E-VKKLA-----G-I----------
Q6AJ56_DESPS/51-120RVEE--VK-FS-G---------------------------.QHRM------SSA-D-LYRQT-----G-I----------
Q9RWN7_DEIRA/101-171PVRQ--VV-VS-G---------------------------.NTHL------AAD-E-VRRLA-----G-L----------
Q604W1_METCA/56-127RVQT--VR-VK-G---------------------------AFRYI------DPA-S-VEDTV-----R-E----------
Q6NGD0_CORDI/29-97TVQK--IE-ID-G---------------------------.AVRS------SAE-E-VETAS-----G-I----------
Q7VMY3_HAEDU/61-131PIRS--FA-LT-H---------------------------KTRFT------HNA-D-IREKL-----S-I----------
Q8CXI4_OCEIH/50-118HIRT--IE-VN-G---------------------------.NTFL------NEE-K-IIKYS-----E-L----------
Q5WFH0_BACSK/51-119GVKT--IH-ID-G---------------------------.NQLV------AEE-T-ILKAS-----G-L----------
Q7U5Q7_SYNPX/51-120GSDQ--VV-VR-G---------------------------.DTTF------NST-I-VSEVA-----Q-F----------
FTSQ_BLOFL/45-115PLSY--II-VT-G---------------------------NRFFT------TND-D-INYII-----L-K----------
FTSQ_VIBCH/52-122PLSK--LV-LQ-G---------------------------DLHYV------SAL-D-VQRVL-----A-R----------
Q6N416_RHOPA/110-178RIKQ--VA-IA-G---------------------------.RKQL------TQD-E-ILAIG-----G-I----------
FTSQ_NEIG1/37-106PVKQ--VS-LK-G---------------------------.NLVY------SDK-K-ALGSL-----A-K----------
Q67Q43_SYMTH/58-125RLER--VQ-IG-G---------------------------.NERL------SQA-E-VMAIA-----G-V----------
FTSQ_GEOSL/67-135PLKE--IE-VS-K---------------------------.LQRL------KRD-D-VIAQA-----G-V----------
Q9CCE5_MYCLE/151-219SVRN--IV-VT-G---------------------------.IETV------TRE-E-VLDAA-----G-V----------
FTSQ_CORGL/30-98KVGN--IE-VT-G---------------------------.ATRT------DPD-Q-VLEVS-----G-I----------
Q8R9G8_THETN/29-97KIKS--IK-VV-G---------------------------.NQIL------SYN-D-IKEIS-----K-I----------
Q8XJA3_CLOPE/42-109NIKK--VN-VN-N---------------------------.NNVI------TKE-S-VIGEN-----D-I----------
Q7NNV9_GLOVI/69-138SAGA--VR-IV-G---------------------------.YERL------QLD-Q-LQRVL-----K-L----------
Q6A9Q0_PROAC/48-116CVNT--IE-VH-G---------------------------.TRLV------TAS-Q-VEQVA-----K-I----------
Q5FKV1_LACAC/77-148NIST--VK-VV-G---------------------------.TTDL------PVK-E-IVKIS-----K-I----------
Q8FNU2_COREF/30-98KVES--IE-IN-G---------------------------.AVRT------DTE-V-AREVS-----G-I----------
DIVIB_CLOAB/41-109NIKY--IN-VE-G---------------------------.NKII------KSD-N-IIENS-----K-L----------
Q6LMF8_PHOPR/51-121PLSQ--LV-IQ-G---------------------------DLDYL------TTD-D-VRQAI-----W-H----------
Q9K9T2_BACHD/50-118HIRS--IK-VE-G---------------------------.NQFV------DDE-T-IIEAS-----K-L----------
FTSQ_CAUCR/94-162RLKT--VH-IR-G---------------------------.ASAT------AQA-D-ILKAS-----G-L----------
B1W0J1_STRGG/62-130RVEK--VG-TS-G---------------------------.VEVL------TRE-E-VEAVA-----A-V----------
B9KHS4_ANAMF/69-137STRE--VV-IR-G---------------------------.NSVV------STA-E-ILN..-----M-I----------
FTSQ_ZYMMO/97-165SVRH--VE-IV-G---------------------------.LHHM------DRQ-A-IYDIA-----S-T----------
D4ZDU0_SHEVD/36-105PIEA--VA-VK-G---------------------------ERIHT------SDK-E-IRTAL-----Q-D----------
G3XCS0_PROMA/62-129.SNQ--IH-IK-G---------------------------.AANT------PNR-E-IVKAM-----G-I----------
G8AFN1_AZOBR/99-167AIAD--VL-VE-G---------------------------.RTET------DPA-S-ILRVL-----G-V----------
H7C7L9_BORBU/34-101LIRY--IS-IN-N---------------------------.DISL------SKE-D-IIKIS-----G-I----------
I6T797_ENTHA/66-137RLQG--IT-VS-G---------------------------.NQMI------TSQ-I-AIADS-----H-L----------
FTSQ_MYCTU/125-192SARE--IV-II-G---------------------------.IGAV------SRE-E-VLDAA-----R-V----------
DIVIB_STAA8/195-262KIAH--VN-IN-G---------------------------.NNHV------STS-K-INKVL-----G-V----------
Q2YLY9_BRUA2/68-136AIED--IK-VV-G---------------------------.NNET------SDI-D-ILGQL-----N-L----------
Q5M4Y0_STRT2/105-175KQKI--LT-VS-G---------------------------.TKNA------LPE-D-VKVAS-----G-I----------
Q5ZSA8_LEGPH/39-107PITT--IK-VA-A---------------------------TYEHI------THK-E-LENVL-----A-K----------
FTSQ_BURPS/37-106ALRE--IR-ID-G---------------------------DTEHI------NAP-T-VRAGV-----V-G----------
Q65JX8_BACLD/54-123KVSK--VE-IK-G---------------------------.NKNV------SKE-Q-IISLS-----S-I----------
DIVIB_BACAN/53-121NIKK--IS-VF-G---------------------------.NHYM------TDE-Q-VMKES-----G-V----------
DIVIB_ENTFA/126-197RLSE--VT-VS-G---------------------------.NKSV------ESQ-A-IIQQS-----K-L----------
Q8F8E7_LEPIN/47-113.LNK--LI-IT-G---------------------------.HEKL------KTE-E-IVRML-----E-I----------
DIVIB_LISMO/51-118KLDK--IA-VS-G---------------------------.NKQL------TEN-E-VRKES-----G-L----------
Q99YV5_STRP1/126-195KKKE--FS-VR-G---------------------------.NHQT------NLD-E-LIKAS-----K-V----------
Q9PF78_XYLFA/35-103PLAK--LR-VS-G---------------------------DFKRV------SPE-E-LRAAV-----L-P----------
FTSQ_RICPR/73-141RLEN--VI-IE-G---------------------------.QQNV------DEL-T-ILKVL-----N-A----------
S5VEM4_STRCU/60-128RLER--VS-VS-G---------------------------.TRML------TPA-D-VREAA-----S-V----------

PF06898

F6B8F3_DESCC/8-408AWVG--VR-VE-GTRVVIEIAERK..LVPVEPNKG.....PAHIV------ATKAGLIKEVLVLRGQAAV----------
D4JTF7_9FIRM/10-387SWVA--VE-RQ-GSRVSVKVAETNDPEPAEIPIET.....PCNVI------SDFDGQLIYTEIYKGKLQT----------
R5L248_9CLOT/7-384AWIS--IN-RI-GCLAQVEIRETT..PKPEIENNNL....ITNVT------AKKDGVIVKVTALGGWPAV----------
R7QWQ5_9FIRM/7-391IWTS--VK-IS-GTKMTIDLQENIKNKERERPNDGK....AYDII------AEKDAVIDTVITRQGAPQI----------
L0FBK0_DESDL/7-397AWIG--IR-RY-GTRVEIKVVQKI..RPQVPGE.......AGNLV------ASKAGLVQQVMVIQGTPLI----------
R6I0K6_9FIRM/6-384AWLS--LN-VR-SSKAEIIVHERI..DKPDIVNEKS....PCDII------ASKSGVIRKMSVLEGESAA----------
L0EFM5_THECK/10-388AWVG--VE-KR-GTLVTIRIVETT..EP.EPRTLLS....PRHLI------AKEDAVVTRITATRGRPVV----------
U5MNL2_CLOSA/5-371MWIR--VR-IQ-GSTLKLVIEEKV..NPPSTEKTL.....PNSVV------AKMDGEIKRVYTTSGNAAV----------
R6SYS4_9FIRM/4-378SWAG--IT-RK-GDTLIIDVIETE..GDTKRESNRY....PSNLV------ACENGVIEKVEVYDGQLKI----------
R7F0N3_9BACI/3-369EWIE--IS-LQ-GTHYVVHVERR...KINDETSEVA....PRNLV------AKKDALITKIEAENGEVMK----------
R7P4H2_9CLOT/3-367DWME--FV-VN-GLNLSVKVEER...IITDINKDNS....VCDII------AKKSGVISDIYVESGEVQV----------
Q0AWN4_SYNWW/7-394AYVK--ID-IQ-GVKATIEVVEKI..FPREEISG......PCHIV------AAKEGVVEEVLVLAGEAQV----------
I0JP38_HALH3/8-385LWIG--VN-KK-GTSYQLYGVEKTRHDTNKNLR.......PSDLV------AEKKGMIVKTFIEKGRPLV----------
R7H622_9FIRM/5-371CWAA--MR-HT-GNRLVVEVREAT..EKPEMYLDRQ....PCNLV------AAKPAQIVDLSIRDGQVMR----------
B2A1M5_NATTJ/8-399LWAG--IN-IR-GTRAEVNINEKE..EEPEQIEG......PSNII------AKTDAYIVDTMVYSGYPAV----------
A5N6N1_CLOK5/11-376MWIK--VR-IE-GSKLAVKTIERK..SPPNIVKEDS....PCNLV------ANKDGKVLRIYTTLGTPVV----------
C8W3N7_DESAS/8-411SWTG--IE-IK-GTKAIIEIVEKK..LPETSENQ......PAHIV------ASKEGLVKEVLVLVGNPLV----------
R6MSI1_9FIRM/8-382GWIS--LN-IT-GSTMSVNIEEKA..PKPDTPDFKT....PCNIK------ANNDGVITSIKTSRGETKV----------
C3AQR5_BACMY/11-389TWAG--LE-IK-GTTYHFKIVEKN..EP.EKEKEQK....PQNLV------AKKEAIITKTFVETGKPVV----------
B8CXJ2_HALOH/7-376AWVD--VK-WQ-GSRLFIETVEKK......IVEKTE....PGHLI------AAKSGVIKEIIVLKGKAVV----------
W6RVC1_9CLOT/10-376SWVS--IR-PY-GSKLLIDVREKQ..LPPSLIKDDT....KKDLV------AKKDGIISRVYTSNGTALV----------
D4LTE1_9FIRM/6-388TWVS--AR-IE-GTRLVLTVKEGI..FTEAVKTDEK...NPCNLT------ADQNGVIVRMITRAGYPKL----------
K0B1J4_CLOA9/8-387SYLS--LN-IK-GVKLTVEVKERD..TESKIVEDES....PCNII------AGKKAVIEKVVAKNGKSVV----------
R5NSB5_9CLOT/8-384AWIG--VE-IK-GTNAIIKVVEAD..EKPEIVDENE....YTNIV------ASKDAVVERVFAQNGTIMV----------
R5HMY8_9FIRM/8-391SYFS--LN-LH-GTRAEVIVREGD..PAPEIRAETV....PTDVV------SSATGVITHIEPWVGDAQF----------
C0ZB79_BREBN/7-385SWVG--IE-IQ-GTKVMLQVVEKE..APVKPLATG.....PRHLV------AKKRAVVHKILPEVGRSQV----------
R6XDX7_9CLOT/8-386AWIG--IE-IK-GTNAIIKIVESI..PKPNIIDDEE....FCNIV------ATKDAIIKKISAQNGTPVV----------
A8MG63_ALKOO/8-387AWVG--IE-IK-GIKARVEIAEKR..LAPDIIDKNT....PCNVV------ASKKGVIEKVIARNGDPKV----------
J7J0E9_DESMD/7-385AWIG--IE-RQ-GTSIQIRVSEKT..RPSIPDE.......VGNLV------ASRAGIVKEIMVIDGTPLI----------
B8I730_CLOCE/8-390SRIS--VS-VR-GTRVFVDVSERV..KPPDLIDKKI....PCNLI------AAKDGVIYSIVAKEGLETV----------
Q97JI9_CLOAB/7-373MWAR--VR-VY-GSKLKVKIVERQ..EIPDVKPNNE....ARDVL------AKKSGQILRVYTTSGTAIV----------
R5T3J2_9CLOT/7-380EWIE--IN-IS-GTKYIVKVLER...KLNNNNVDDN....IYNVV------ASKNAIISKVKASHGVILK----------
R6C1Q2_9CLOT/6-386TWIS--AK-FS-GTELAISIKEAD..GASQSAREEG....FADLY------AEKEGTIVSMVVRSGVPMV----------
K4LIU5_9FIRM/7-395VWMT--ME-ER-GTNIKIRVVEKT..LPQTVLF.......QGDLL------AAKTGYVEDVIVIQGQALI----------
R6UCV3_9CLOT/10-387SWVG--IE-ID-GTRAIVKVVEKT..RMDEKNIQQT...SIGDIK------ATKSGVITKLVSESGTSKF----------
R6N4A7_9CLOT/7-383SWMA--IN-FQ-GSVVNVELKERD..APPEAIPMEE....PCNLK------SSYPGQIVRLEVISGVTVV----------
I3VX08_THESW/8-382AWIG--ID-IK-GTKAIVKVVKKT..APPAVIDENV....PCNII------AKKDGIIYKMTVLEGDALK----------
B0TAE5_HELMI/7-400EWVG--IT-AK-GTRVVIEVQEKVLPKKPAVDG.......PCNII------ATKDGIIQRLMVLVGEGKV----------
R5TPA1_9CLOT/8-390TWVS--AR-VS-GTRLLVKIKENE..VLSEIPAKDE...SPCDIV------ASKDGVITSMIVRQGVPAV----------
R5QI90_9FIRM/5-375SWFK--IN-MR-GTVATIDIHERT..GRDGIEALTP....PSNLI------AACDAQIELLDVSGGATVV----------
R5KWN8_9CLOT/12-386SWAG--FE-FD-GTKAVLKVVEKT..KLNEKDKQNT...NIGNIV------VEKSGIITKIVPENGTAVF----------
N0B454_9BACI/7-385TWVG--VE-LK-GTTFHLQVVEKK..EPEQPKV.VG....PQNLV------AKKEAVITKIYVEKGKQLV----------
F8I923_SULAT/7-394SWIG--IH-VH-GAVAQIDAIPVH..RRPPAHL.......FPRLV------ADAGGTVTAVYVYMGAPDV----------
D3E517_GEOS4/9-385SWVG--VE-RN-GTRIRIQIVEAA..VP.EKPPLQS....PRHLI------STQDAVITHMYAEKGVPKV----------
R6H3U2_9CLOT/8-388SWMG--IE-IK-GTNVVVKVVKAT..EKPDIINEED....YCNIV------AEKPGIITKINAQNGTIAV----------
R7F7B5_9CLOT/8-387AWIG--IE-LK-GTNAIVEVVEAE..EKPEIIAQDE....YCNIV------SDKEGKIVKINANTGTAMV----------
R7M7L8_9CLOT/8-385AWIG--IE-IQ-GTNAIVKIVEAD..MKPEIIQEDE....YCNIV------ATKDAMIVKVNAQNGVPVV----------
R6TJX8_9FIRM/7-385SWLT--VN-VS-GCRATVQVRERV..KKPEMVDERT....PTNVV------ARRAGLVLTIQSTEGVNMV----------
Q67S30_SYMTH/7-404SWAV--VR-VD-GTRAVIEVVEKGAVTPPDQAQ.......CVHLV------ARKAGVVEQVIPLQGEPLV----------
R5F5D4_9CLOT/9-390TWVS--AR-VS-GTRLLIHIKENE..VLSTIPEKDE...TPCDIV------ASQPGVITSMVVRQGVAQV----------
R5Q8Y0_9CLOT/8-386SWVG--IS-IE-GTNATVKVVEAN..SKPEIINDED....YCSII------STKDAQIVKVSAQNGIPVV----------
R6M0R0_9CLOT/7-380EWLE--II-RN-GTKYTVRVEER...IINKEIDDNK....NYDIV------SSKNAVIRVIEAESGEKVR----------
R5YC97_9FIRM/7-392IWAS--VY-EE-GTKLVVCVQEKIASDRIEPEETTG....YTDLV------AKQDAVVSSIITRNGVPLV----------
Q8RB55_THETN/13-387AWIG--IN-VR-GTKAFVKVVGKT..KPQKVLSKEE....PCNII------AKRDGIIYKMTVLEGEAVK----------
F4LSY6_TEPAE/8-387SWAE--IE-IR-GSKLIVELVKKQ..LPPELEENT.....PCDII------ASKDGIIEEIINFRGEALV----------
R6LHZ6_9FIRM/6-383QWLT--VT-QN-GACATVVVRERP..EAEPVDDRKT....ARNVV------AARAGLVTRVSVLAGSSLC----------
A4XKI6_CALS8/4-376MWVK--VK-KE-GGLLIVEYVKKE.....EGDLKNK....WGKIF------AKSSGVIQKLILKSGNALV----------
R5T032_9CLOT/3-372EWIE--IE-RS-GVKYIIKVEER...IIKNPKEDEA....PRDIV------AKKDGIIMRLNASHGEIRK----------
R5B397_9CLOT/7-382AWAG--VS-IS-GVVLKIEISEAGE.TKPDTSQSTE....PTSLY------AAKDGIVTELKVIDGKAKV----------
R7DBV9_9FIRM/6-388TWVS--AK-LE-GTRLLLTVREGI..FIQTTEEKDK...SACDIM------AERDGEIIKMITRSGLPRK----------
R7FM48_9CLOT/8-386AWMG--IE-LK-GTNAIVKVVKAT..AKPEIVDDNE....YCNIV------SDKQGIITKINAQNGTIAV----------
B1I691_DESAP/9-398AWVG--LE-IR-GTRALITVAEKKF.LPPDHDG.......PSDIL------AAKAGLVRDVLVLSGQAVV----------
R7IV24_9CLOT/8-386SWIG--IE-LK-GTNAIVRVVKAK..EAPEIVDEKE....YSNII------AKKSGVITKIIAQNGTAMV----------
SP4_BACMD/7-385TWVG--VE-VR-GTSYHFQVVEKN..EP.KPQQKTP....YQHLI------AKKKAIITNLFVEKGQPLV----------
C9RAM9_AMMDK/7-391AWVG--VE-VR-GTQAIIKVVEKK..LPEPAAG.......PAHIV------ARKAGLIKELLVLEGTPKV----------
R5XPL9_9CLOT/8-386AWIG--ID-LK-GTNAIVKVVEAD..AKPEIIKEDE....YCNIV------SDKEASIIKVNAQNGTVLV----------
A6LRP5_CLOB8/4-370MWIR--VR-IE-GSTLKLVIKEKV..NPPSTEKTL.....YNQVV------AKMDGEVKRVYTNSGNPAV----------
Q892R7_CLOTE/11-377MWIR--IR-TE-GSLLKITASERQ..SPPKVILMDD....PCNLV------AKKDGEVVRVYTTAGTALV----------
R7HMN6_9FIRM/7-380EWLE--II-RE-GTKYTIRVEER...IINNKPKDNK....IYNIV------ASKNAVIKNIYAESGEKVR----------
E6U532_ETHHY/8-382SGVT--IN-LH-GSTAYVRVRERR..YPPDIVPQAV....PCNVK------AAWDGQIVRMEVQAGKPMV----------
D9R1A2_CLOSW/7-388TWVS--AR-VS-GTRLLVKIKENE..VLSEIPVKDE...TPCDIV------AEKNGVITSMIVRSGVPMV----------
R7L9N0_9CLOT/9-386AWIG--IE-IT-GTNAIVKVVEAE..EKPEIVDEDE....YCNIV------ATKDGVVTKIMAQNGTPLV----------
A5D3V9_PELTS/9-406SWAG--VY-VK-GTRVTVEVNERV..VPAEEDRR......PAHVV------AAKAGLVREILVVSGHPAV----------
D4L904_9FIRM/7-374RWMS--IN-IT-GSLVTVEVKETY..KKPKLDTSKN....PCNVK------AVKDGVITRIQAYNGRPVV----------
E3E8L2_PAEPS/9-385SWIG--VE-RQ-GTLVTIQVVEAS..QP.TPPSLYS....PRHLI------SKADAVVTEIFAEQGRPVV----------
R7I713_9CLOT/7-390GWVS--TE-LE-GTKLSISIVETR..LPTKKTLDDN....ACHMI------ASEKGKIVNIVTRQGVPLV----------
E6TW41_BACCJ/7-385TWIG--VT-KK-GTTYHFQVVEKQ..LA.EKEPKEA....PGHIV------AKQKAVVYDLFVEEGKPVV----------
X4ZFY3_9BACL/8-384SWIG--IE-RN-GTFVKIQIVEAK..LP.EAKPLNS....PRHLI------SRTDAVITDIYAEQGRPVV----------
R5CSR2_9FIRM/6-384AWLS--VN-VH-NSCVEVVIHERI..AKPDIVNETE....RTDVK------AAKSGYITKLSVLEGKALV----------
E6UAB1_RUMA7/4-383SWVG--IS-RT-GSGIAIDVIENI..RSDRGITVGM....PCHLV------ACEDGIIEEIELIDGQLMK----------
R5D9M1_9FIRM/7-386SWLA--VN-VR-GCVAHVQVVERH..RPPKAADRST....VTNIV------ARRAGLITKVEALEGQAMV----------
Q8EPX5_OCEIH/7-397LWAG--VE-LR-GTTLYLEGVEKL..IV.EELDPGE....PGNIV------AAKEGVITRMYVSKGEPVK----------
R5IHX3_9FIRM/8-382QWLT--VQ-QS-GMCARVVVRERP..DKAPVLDRKV....PTDVI------ASRAGVLTRVEAVAGNCLC----------
Q24SU1_DESHY/7-393AWVG--IS-KH-GTRVEIKVVQKV..RPQVPGE.......AGNLV------ASKAGLVQQVMVIQGTPLV----------
Q9KD59_BACHD/9-387TWIG--VR-QN-GTTYQFEVVEQQ..LPEEAER.IS....PRHLV------AKKKAIVHSVFVEHGQPKV----------
R5XQE7_9CLOT/3-370AYLS--IN-VK-GTNVFVTITKKD..DENTQTAKSN....YCNII------ASKNGIIEKVIARSGEAVV----------
Q3AEZ9_CARHZ/5-371SWVG--IE-KK-GVRLIITGKMRQ.....EYRQKYK....KADIV------AKRDGIIKEILVFRGSLRV----------
F6CMU5_DESK7/8-406SWTG--VY-VR-GTRVTIEVVEKT..IPEEKNQS......PAHIV------AIKAGVIKEVLVFSGHAAV----------
F2JQA7_CELLD/7-387VWTG--IT-YE-GTRMMVRVAESV..PKPEMSEMNEK...PKMLI------AKRDALVTYIAVEKGKPLI----------
U5LCI4_9BACI/7-385TWVG--VE-LK-GTTYHFQVVEKN..EPDKPEL.LS....PRHLV------AKKKAVILDMFVEEGKPVV----------
A8FFB9_BACP2/7-386TWVG--VE-LN-GTTFQMKVVEKN..EP.EKEKYTS....PQHIV------AKKKAVITRMYVEKGEPLA----------
L7VHP9_CLOSH/8-388AWVG--VE-LK-GTKLIISVREGI..EPPRVVPMDQ....PCNVV------AERDGIVISVRAKNGLEKV----------
R6D0A8_9CLOT/8-382GWAA--VN-LI-GSVAEIEIGERD..EGDEVVEDSS....PCNVV------ASRGGQIVSMEVYDGQKAV----------
Q65H67_BACLD/7-386TWVG--IE-LN-GTALHMKVVEKN..EP.DKEKYIG....PRHIV------AKKGATISKMFVEKGEPLV----------
D9QV99_ACEAZ/7-405AWAD--IE-LQ-GTKLDVEIVEKV..LVEEKDRTDK....VVDVV------AKKTGLIEEIIVLKGKPVV----------
C8WY36_ALIAD/8-383VWVG--VE-VK-GSVAVVRGIPKIPGVPQASQQ.......PCNIV------ATRPGVILDVQASRGRVMV----------
Q2RKW7_MOOTA/8-408AWVG--VS-FH-GTRAEIKVVEKI..PPPAGDDYEL....PASII------AAKDGVIKQILVMNGEGRV----------
YQFD_BACSU/7-386TWVG--VD-LK-GTTIHMKVVEKN..EP.EKEKYVS....PRNIV------AKKKATITRMFVQKGQPMA----------
Q5KX07_GEOKA/7-385TWVG--VE-WK-GTSLHFRVVEKE..IP.EPKKPIP....PRHLV------AKKEAVIADLFVEEGQPLV----------
R6XTI8_9CLOT/8-386AWIG--ID-IE-GTNAIVEIKETS..KAPEIINENE....YCNII------SNKEGMITKINVQNGTAVV----------
R6NIT4_9CLOT/8-386AWIG--IE-LK-GTNAIVKLVKAD..EKPEIIDENE....YCSIV------SNKSGIITKISAQTGTANV----------
R6G2U3_9CLOT/4-369LWLR--VR-VE-GSTLKVVITEKV..NPPVKDEGK.....YGNLV------ADMDGQIKRVYTYSGRAAV----------
R6QWU5_9CLOT/7-381AWIS--IN-IT-GTLVNIELSPRVDKKAPTDKT.......PSNII------ASSDGVITGIEAGEGKPSV----------
F4A357_MAHA5/8-386SWIG--IE-LR-GTKAIVRIVEAV..MPPERIDIDQ....PCDII------ASKDGVISKITVMQGQSVV----------
R5ITB3_9CLOT/7-378EWLE--IE-VS-GTKYIVKIEER...KINNKKKDNT....YQDII------STRDAVIKNIVASNGVVVC----------
R7IQG8_9FIRM/7-393TWVS--VE-IT-GTRLIVHIKENEEEIRRASENTDEASGESYDLV------ATKQAVVTSVVMRGGTAAV----------
F6DMW5_DESRL/8-408AWAG--IT-VE-GTRVTIEIAERK..LVTEDVNKG.....PAHII------AGKAGLIKEVLVLKGQAMV----------
R7L3Q3_9FIRM/6-381GWIG--IR-HT-GSRVVVEISELT..EPPEMQSKNT....PCNIV------ASRDAQIKNVRLYSGMLVP----------
K0J274_AMPXN/9-396LWVG--IT-PN-GVNYQLEVITK...KQPEVKERQQ....RTHIY------AKKDGVISEMFVAKGRPLV----------
I4DAP4_DESAJ/7-400AWVG--ME-RN-GTEIKIKISEKI..RPSIPKE.......AGNLV------ASHAGLVKEIMVIQGIPQV----------
D7CNW5_SYNLT/8-391SYVE--VN-IK-GVKAQIKVVEKV..LPNQPEG.......PCHIV------ARKDGIIESVLVLKGQALV----------
R5Y9N3_9FIRM/7-382AWIS--IN-KF-GCLAQIEIRQTT..PKPAITNNTV....ITNVK------AKKAGIIVSVTALGGWQAV----------
R4KCE0_9FIRM/7-406AWVG--VS-VD-GTRVLIKVVEKV..LPPDNGEH......PVDIV------ALKDGLIKEILVLSGHPLV----------
R6YI22_9CLOT/2-369EWIE--IT-DI-GTKYEVKIVER...KKQSNNVSTE....YTNIV------AKKSGVIKKIYAEDGLKMV----------
G8M1A5_CLOCD/7-388SWVS--VV-IK-GTKVKIEVAEGV..EKPKLVDKNT....PCDIV------AAKDGVIKSIIVKAGLEAV----------
K4LKI1_THEPS/8-398AYAE--VN-V.-GPRSRIRISEKQ..LPEPGVG.......YCHIV------AEKEGVIESVLTLAGQPLV----------
G4KWF7_OSCVS/7-385SWLT--VN-VS-GCRAYVQVRERV..MAPELANRRA....PCNVT------ARRDGLVLEVHAFLGKKCV----------
R6NSX8_9FIRM/7-390AWAW--VY-IE-GAKARVEIYEQI..IPPNILDKDT....PCDIV------AACDGIINHMVVKNGEEVL----------
R6RMK3_9CLOT/7-391TWVS--AE-IK-GTRLTVRIKENE..AMLSPVEPDR...TPCDLT------AEKDGVIERCVVRNGLLKV----------
A3DEC5_CLOTH/8-389SYVN--VL-VR-GTKVKVEVAEGV..KRPSIIPLNV....PCDIV------AKKDGVIKSVIVKIGQAQV----------
R6GJ09_9CLOT/6-381AWVS--VN-IK-GSTLSFELKERV..IPPQIIPKTA....PCNVK------SNSDGQITRMEIYQGTPEV----------
D9S2Q3_THEOJ/8-389AWAE--IE-IR-GTRVIIDLVSKE..MPPRIEDDT.....PCNIV------ASKDGVIEEVIPFRGEAVV----------
D4LCN8_RUMC1/4-373RWAG--IR-HT-GGRVVVDVAEAT..PQPGMLHDRV....PCNYV------ATRDACIQSIMPACGMVLR----------
C5D4T1_GEOSW/7-385TWIG--VE-LK-GTTLYFQVVEKN..QPKEPEK.IG....VRHLV------AKKKAVITDMFVEEGQSLV----------
W0EAS0_9FIRM/7-398AWIG--IE-HQ-GTRININVKEKI..RPVVQTE.......RGNLV------ANKTGIIHELMVIQGTPLV----------
F9VJJ5_ARTSS/9-374LWSK--VR-VQ-GSTLQIEVIESF..KPPVIEVDSS....LGDIV------ADKDGEIVRVYTQSGTSVV----------
A0Q1Q5_CLONN/8-374MWSR--VR-VE-GVKLKVKIAERQ..EPPEIEKKES....PSNVV------ASKDGEIRRIYSTSGTAVV----------
F0SVD9_SYNGF/7-392SWVS--IE-EK-GTEVKIRVAEKT..LPEKILL.......GGDLI------AGKTGIVQDLMVIHGQPAV----------
D9SW54_CLOC7/9-375SWIK--IR-ID-GSTLNVEVTEKK..TPPAIEQIRD....SGDVV------AKKDGVITRLYSTTGTCVV----------
G2TNK7_BACCO/7-385TWVG--VE-LR-GTTYHFTVVEKN..MP.EPVKHPG....PQHLV------ASQKAVVENMFVEKGKPVV----------
Q8XIU3_CLOPE/5-374MWVN--AR-IE-GGTLKIKVEEKV..SPKIKEENENKE..FKNIV------ASMDGEIKRIYTTSGTAVV----------
R5HCW7_9MOLU/9-376EWLE--IE-SL-GTKYIVRLQERL..TIPKNTESNK.....VHIV------SSKDAIIKNVVAKKGEILK----------
R7MJV7_9FIRM/5-378SWTA--IR-RT-GNRIVVDVTEIV..DIPEMLKKRT....PCNII------SDKNAQITNVSVLDGQLMR----------
R5AEU1_9CLOT/3-374AWIG--LA-LD-GTVLRVKVVETA..VKNDAWDDDA....PADVV------AQKSGVITEIVATGGRASV----------
R5JAK2_9FIRM/6-375EWLE--IE-EI-GTKYTVRVEER...TIVKEDESNT....PRNII------AAKDGVLKKVIAEKGDIVK----------
R5JWC6_9CLOT/7-386AWVS--CE-IK-GTQLNVEIKETL..EGTETIQTDA...TPQDIV------AAKDGVIVEMITRNGTPVV----------
L0KBA1_HALHC/7-398SWAN--VY-FQ-GTKLIVQIVEKE..LLDTEIN.......PSDII------AEKSGVIKELIVLRGSPQV----------
R5X7Q5_9FIRM/6-388AWVS--AR-TE-GTRLVITVKEGD..FQNKKKKEKA...EPCNLT------ATESGTVVKIITRAGVPRI----------
R7NE92_9MOLU/3-369EWLE--ID-VE-GMVINVRVEER...IINNYEKDYS....TCHIV------ASKSGIIKSIKSTKGVVEV----------
D3FY22_BACPE/7-385TWVG--VR-QK-GTTYQFEVVEQK..LPEEAER.VS....PRHLV------AKKKAIIHDIFVEHGQAQV----------
Q5WHE5_BACSK/7-385TWIG--VR-KK-GTTFEFEVVEQV..RQEAPEL.LS....PRHLV------AAKKAVIHKMFVEDGKAVK----------
B2TM04_CLOBB/5-371MWVR--AR-IE-GSTLRVIVAEKV..NPPVTEKIS.....PEQVL------AKMDGEVKRVFTFSGNPSV----------
A6TSK6_ALKMQ/8-387AWVG--IE-IR-GIQARVEIVEKT..TPPVRVERDT....PSHVV------ARKNAVIERIVAKNGDAVV----------
G7MCG1_9CLOT/5-371MWIR--VR-IE-GSTLKLVIKEKV..NPPSTEKTL.....YNQVV------ASMDGEVKRVYTNSGNPSV----------
Q182D1_PEPD6/3-370AYLS--IN-VK-GTNIFVTVTKKA..ESLKSTDQSN....YCNVI------ALKNGIIEKVIPRSGKSVI----------
B7GKD9_ANOFW/7-385TWIG--VE-WR-GTTLYCRVVEKK..QPTETKS.NT....PQHLV------AKKKAVITYMFVEQGQAVV----------
R6CV47_9CLOT/2-371EWLE--IE-RY-GSKLTIKVTER...KLNKEKEDDK....PRHIV------AKKDGVIMKIEASNGVILK----------
D5XAQ9_THEPJ/8-405SWVG--IN-IT-GTKAIIRVAEKV..TPPVEDDR......PAHIV------ANKTGLIEEVLVLSGVAAA----------
A5I631_CLOBH/5-371MWVK--AR-IE-GGKLVVKAEERQ..SPPTIVKEDE....PCNLV------AKKDGEVQRVYTTSGSAIV----------
R6CYS5_9FIRM/7-389VYLA--VN-VK-GCTAHVQVVERV..RPPHLYRDSD....VQNIV------AARDGLITKIEALDGVTCA----------
R6BC91_9CLOT/8-386AWIG--IS-IE-GTNAIVKIVEAE..AKPEIINEED....YCNII------ATKDAQIVKISAQNGIPVV----------
R4KBT4_CLOPA/9-375MWVR--VR-IQ-GSKLKVTATERQ..SPPEVINDDS....PCNLV------AKKDGQIVRIYTKAGTAVV----------
C6CTU6_PAESJ/7-385TWVG--VE-KK-GTRIVIQVVEST..EA.EKAELQS....PRHLV------ASNDAVITEIYTEKGRPVV----------
R5AR68_9FIRM/7-385RWLT--VN-VH-GSRAEVIVREKD..PLPDITPDDT....PVSIY------ASATGVILSMDVYAGEARV----------
M1LPE2_9CLOT/3-366LWIR--TR-VE-GSTLKIIIKEKV..NPPLTEKTL.....YNQVI------AKMDGEVKRVYSSSGNAIV----------
R5A1X4_9CLOT/2-368EWIE--IV-EK-GCSYTINLTKRV..KKKSDMETNT....PSDIV------ASKDGLIKYITNYSGTKLK----------
R6Z4S5_9CLOT/6-387TWVS--AR-VK-GTRLYVHIKEND..VVLTVPEKDQ...TPADLA------AAENGTIVSMVVRSGIPMV----------
R5ACZ0_9CLOT/8-391TWLS--VN-TD-GCFVEVALQEAL..PAPEVVDDRE....WSNIV------ASRAGTVISVEAERGRPEV----------
A4J7E2_DESRM/8-408AWAG--VY-VK-GTRVIIEIAERK..LVTERPNKE.....PAHIV------ARKAGLIKEVLVLNGQAMV----------

PF07244

Q98MC3_RHILO/107-184KP--R............GTFS..QATL......DSDVE------------------------------------------
Q6ARL5_DESPS/92-170KE--H............RIIN..PAQI......SAAKE------------------------------------------
Q5NEP7_FRATT/354-428YE--Q............SQYN..KEAI......DKSQR------------------------------------------
Q5FPE9_GLUOX/347-432KE--G............ELYR..PSRI......EAARQ------------------------------------------
Q8KFQ6_CHLTE/212-301KE--TSQNSWWRKIFGQPKLD..KDKF......EEDKN------------------------------------------
Q73JH4_TREDE/105-183KK--G............DIFN..EVNI......KNAER------------------------------------------
O84244_CHLTR/185-272TG--A............GVYH..PDMV......EQDLF------------------------------------------
Q9I0U1_PSEAE/190-268KA--G............QPYD..SELI......AELNQ------------------------------------------
Q8EGG7_SHEON/97-177KV--G............ESLD..RTML......TGIEK------------------------------------------
Q8KFQ6_CHLTE/304-389KK--G............DLYN..AKKINERLNFSQDHS------------------------------------------
Q9KUB9_VIBCH/347-418EP--A............QKLS..TEEI......EASIE------------------------------------------
Q73JH4_TREDE/186-274QK--G.............FFR..EDAL......QADKN------------------------------------------
Q98MC3_RHILO/360-433SE--G............DAFN..QVLI......QRAKK------------------------------------------
Q6MAE9_PARUW/218-306SE--E............GTYN..EDAI......QQDRL------------------------------------------
Q8XZI3_RALSO/98-178AE--A............RYYD..KSLI......DRAEQ------------------------------------------
Q8EGG7_SHEON/352-426ME--G............AWLN..SAQV......EQSKA------------------------------------------
Q604T9_METCA/124-204AE--G............KVFD..RQIL......DKVEQ------------------------------------------
Q8D271_WIGBR/189-264YY--N............KLYN..IELI......SDLNN------------------------------------------
Q82VX0_NITEU/116-201TP--G............KVFR..SARW......EDAKS------------------------------------------
Q87LW2_VIBPA/354-425ET--G............RKIE..TAEI......EKAVE------------------------------------------
Q6MAE9_PARUW/390-467IP--G............EIFN..TIKL......KATEQ------------------------------------------
Q6LKQ8_PHOPR/351-422PV--D............RVIS..TEEL......EQAVE------------------------------------------
O84244_CHLTR/275-353GP--N............SLYC..PDKI......WTGAQ------------------------------------------
Q5NZG7_AROAE/348-422ME--G............AWYD..AEEI......NRSRT------------------------------------------
O67326_AQUAE/374-446QE--N............ELAL..KKGI......ERSKT------------------------------------------
Q5NNB2_ZYMMO/333-411KE--G............QRYD..SQMV......DDLRQ------------------------------------------
Q7VHH5_HELHP/344-416AP--G............DTYS..LSDL......KESEN------------------------------------------
Q98MC3_RHILO/187-275KR--SSWVS...FILRDDVYD..EDKL......RADQE------------------------------------------
Q6FCG7_ACIAD/270-348KD--G............DTYS..QEKV......NAVKQ------------------------------------------
Q6MMX9_BDEBA/120-198KP--Y............QLLN..MAKV......KEAVE------------------------------------------
Q8XZI3_RALSO/353-427ME--S............SWFD..GEKL......QLSQN------------------------------------------
Q7MIG8_VIBVY/266-344EA--G............ETYN..GSAV......TTLEE------------------------------------------
BAMA_HELPY/312-391KR--K............DVFN..IEHL......RADAQ------------------------------------------
Q8RHT4_FUSNN/251-335QP--G............KIFN..VKEY......DATVD------------------------------------------
Q6D152_PECAS/230-304HE--G............DVYT..SEDL......GELNR------------------------------------------
Q5E2U2_VIBF1/342-414EE--G............RSYS..ADEL......EEHIR------------------------------------------
Q89NX1_BRADU/319-398NA--G............SLYN..VELV......EKSVE------------------------------------------
Q92Q48_RHIME/107-184QP--L............GPYS..EATV......ETDIQ------------------------------------------
Q5R0Z1_IDILO/176-264RD--SLPWW...NFIGEKRYQ..KQQL......SGDLE------------------------------------------
Q5E3E7_VIBF1/92-172RV--G............EALD..RTTL......SNIEK------------------------------------------
Q8D2H0_WIGBR/95-175KI--G............NPLY..PSAS......QEIKI------------------------------------------
Q5FPY9_GLUOX/117-194RP--R............AVFS..SQTT......AADRQ------------------------------------------
Q8KFQ6_CHLTE/132-209NP--G............RRIS..NQEL......LNAEN------------------------------------------
Q83DT2_COXBU/99-179SE--G............QPYD..PTKL......HEIEV------------------------------------------
Q6FCG7_ACIAD/179-267KE--SGWSS...IVTRNDRYA..REKM......AASLE------------------------------------------
Q6N5Q8_RHOPA/187-275RE--SNLLS...FLGNGDVYD..PDRV......EADRD------------------------------------------
Q6ATX4_ORYSJ/67-146LL--R............AAPT..VQDL......LRNAS------------------------------------------
Q7MHW3_VIBVY/361-432ET--G............RVLK..TGEI......EAAIE------------------------------------------
Q7MAB6_WOLSU/88-166KK--G............DVYD..ESKV......ERARK------------------------------------------
BAMA_DESVH/301-383KD--N............QYFA..LDVM......QTDDK------------------------------------------
Q5NEP7_FRATT/96-176YV--G............NVYN..PNTM......FLLKQ------------------------------------------
O67326_AQUAE/290-371RK--G............RYFR..REVI......EKIKN------------------------------------------
BAMA_DESVH/131-209KT--G............SVLN..DKLL......AQDLQ------------------------------------------
Q7UK20_RHOBA/180-256TE--G............DPLS..EFAI......ETGKR------------------------------------------
Q7MXJ3_PORGI/386-461KP--G............QLFS..REDI......INSIR------------------------------------------
Q98K30_RHILO/218-292KR--G............KQYS..PQEI......SDARD------------------------------------------
Q82U03_NITEU/346-420ME--G............GWHS..TEQI......NRSRQ------------------------------------------
Q5R0Z1_IDILO/93-173VT--G............EPLD..RTTI......SGIEK------------------------------------------
Q7MXJ3_PORGI/302-383KS--G............DVYN..QRRLAK..RLNEDED------------------------------------------
Q88IV7_PSEPK/195-269KP--G............TPYD..SELV......AELNN------------------------------------------
Q74AT3_GEOSL/270-348KS--G............DVFS..RANL......RTDVM------------------------------------------
Q5NND8_ZYMMO/397-485KQ--ARFWR...FMSSGASYD..PDKL......AYDQQ------------------------------------------
Q5FPY9_GLUOX/370-443AE--G............DPYT..PFDR......KYSKL------------------------------------------
Q6MAC6_PARUW/256-330NQ--G............ELYD..PKKL......EKTQE------------------------------------------
Q73G77_WOLPM/274-352EN--D............KIFN..RVKI......NNTVE------------------------------------------
Q82U03_NITEU/265-343EP--G............GIFV..REKL......TESIK------------------------------------------
Q8EGG7_SHEON/271-349KA--G............DMYN..GGDV......TFAEE------------------------------------------
BAMA_BUCAI/175-263QD--YHSWW...NLLSKSTYS..PKEL......NNDLE------------------------------------------
Q6MKB1_BDEBA/93-170KA--D............DVFD..QQTL......IEGGE------------------------------------------
Q65R79_MANSM/88-168KA--G............EVLN..REKL......EAFRQ------------------------------------------
Q5LSU6_RUEPO/196-284KQ--AGFLR...TFIRSDTFI..ADRI......EFDKQ------------------------------------------
Q74AT3_GEOSL/179-267KE--KWFLS...WLTGAGTYK..DEVV......KNDAN------------------------------------------
Q9A711_CAUCR/345-418AE--G............DAYN..RVLV......DRSKN------------------------------------------
Q7VYC2_BORPE/276-354KP--G............EVFS..AAKA......NNSAK------------------------------------------
BAMA_HELPY/138-216KK--G............DTFD..EQKL......EHAKT------------------------------------------
Q7MPD6_VIBVY/100-183KQ--G............AILN..HGDY......DTLKS------------------------------------------
Q7MXJ3_PORGI/45-119AV--G............DEVLIPGDAM......SAAVN------------------------------------------
Q5NZG7_AROAE/267-345KP--G............EIFS..REKL......TETTK------------------------------------------
Q9RXD5_DEIRA/97-179AP--G............AVLN..TQRL......EQAKE------------------------------------------
Q8DI03_THEEB/90-161RP--G............STTT..RTQL......QQDTN------------------------------------------
Q604T9_METCA/298-376GP--E............DIFS..RKLA......TETQK------------------------------------------
Q886N5_PSESM/91-171AE--G............EIFQ..RATL......EGVRN------------------------------------------
Q8EGG7_SHEON/180-268KD--YVAWW...DLFGERRYQ..KQKL......QADLE------------------------------------------
Q5F5H0_NEIG1/248-322QP--G............TPYD..LDLL......LDFQQ------------------------------------------
Q74AT3_GEOSL/99-176KA--N............TIFS..QKEL......TLAGK------------------------------------------
Q89KQ1_BRADU/278-357NV--G............SLYN..VESV......EKSVE------------------------------------------
Q87SW5_VIBPA/101-182KV--G............RILN..QGEY......DSLKS------------------------------------------
A9CJ61_AGRT5/186-274KK--SNMLS...FLTRKDVYN..EDKL......RADEE------------------------------------------
Q8XZI3_RALSO/272-350KQ--G............DVFS..SAKL......SATTK------------------------------------------
Q6MMX9_BDEBA/201-289QE--GGFFS...GISGSGQYK..QEMF......ERDVQ------------------------------------------
Q7CWM5_AGRT5/240-314NG--G............EPYS..PEKL......RKAAD------------------------------------------
Q6MMX9_BDEBA/48-119KV--G............ESYS..AQHI......REDVQ------------------------------------------
BAMA_HELPY/394-466GP--K............DKYN..LTKL......RNSEN------------------------------------------
Q5R0Z1_IDILO/267-345EK--G............TLYN..AAQV......TYIED------------------------------------------
Q8A1E1_BACTN/46-120SV--G............QTITVPGDEI......TGAIK------------------------------------------
Q5E819_VIBF1/104-185NL--G............QVIN..HGRY......ESLKS------------------------------------------
Q5LSU6_RUEPO/369-442VE--G............DPFN..PREI......RESAE------------------------------------------
Q5R0Z1_IDILO/348-422LE--G............AWLS..DSNI......EQGKV------------------------------------------
TAMA_ECOLI/189-263KE--G............DEYE..SKDL......AELNR------------------------------------------
Q7NVY6_CHRVO/267-345KR--G............DTFN..NEKV......TESVK------------------------------------------
Q6MAE9_PARUW/309-387RQ--G............EFFS..IESI......RETIE------------------------------------------
Q92LN9_RHIME/217-291NH--G............RPYS..PENI......RKAAE------------------------------------------
O51735_BORBU/103-180KT--N............EPLN..LASV......NKGIG------------------------------------------
Q7UK20_RHOBA/97-179RK--G............RFYS..EETV......LSDVS------------------------------------------
A9CJ61_AGRT5/359-432SE--G............DAFN..QTII......TAAKR------------------------------------------
Q82U03_NITEU/174-262KT--PGFMT...WFTKDDQYS..KQKL......SADLE------------------------------------------
Q9SRL6_ARATH/77-155AV--R............EATT..LQEL......LEASR------------------------------------------
Q7VRD8_BLOFL/101-181KI--G............STLN..DYFI......FEANN------------------------------------------
Q6MMX9_BDEBA/292-370DD--N............GVFA..YDVL......QKDIS------------------------------------------
Q8KFQ6_CHLTE/392-467IP--G............DTFS..RKNV......VRSIR------------------------------------------
Q6LN32_PHOPR/175-263KA--DIPWW...NFLADEKYQ..KQVL......AGDLE------------------------------------------
Q604T9_METCA/207-295ST--SNLLS...FYTKDDQYS..KQKL......SADLE------------------------------------------
Q8KC70_CHLTE/372-447IT--G............KLYT..SEIA......TGSLE------------------------------------------
Q6ARL5_DESPS/20-91KA--G............DIYD..PATL......RQDLK------------------------------------------
Q7VRD8_BLOFL/184-272YK--QIKWN...NIFHRNVYK..KQKF......FYDLE------------------------------------------
Q5FPY9_GLUOX/197-285KE--TIWYR...FFSSSDEYN..PERV......KYDAE------------------------------------------
O66463_AQUAE/72-149EE--G............IPLI..EDNP......KTYEE------------------------------------------
Q73JH4_TREDE/358-431KE--G............DVFS..KTKL......INSFR------------------------------------------
Q7UK20_RHOBA/349-427KA--N............DTFS..GTKM......RKDIG------------------------------------------
BAMA_BUCAI/266-344NP--N............EFYN..RDKI......DIIVN------------------------------------------
Q7P0N3_CHRVO/181-255NP--G............SPYS..QDKV......LAYQS------------------------------------------
Q7NVY6_CHRVO/348-422LE--G............APYN..AANV......KRSKE------------------------------------------
Q6MKB1_BDEBA/419-500RP--G.............PLK..LGQI......EEAVA------------------------------------------
Q8DI03_THEEB/242-318QP--G............VVLN..QKTV......QADLR------------------------------------------
Q7VAN9_PROMA/238-314DF--G............KTLN..LNVL......KLRMN------------------------------------------
Q7MAB6_WOLSU/344-416AP--G............EMYE..ATKV......KNSKN------------------------------------------
O66463_AQUAE/152-225VI--G............SIFD..IDKV......EDAEE------------------------------------------
Q7MYW2_PHOLL/190-266SE--G............DFYT..SEQL......AELNR------------------------------------------
Q6MKB1_BDEBA/503-577DK--G............DLLT..PSNL......EESVA------------------------------------------
Q7MXJ3_PORGI/120-199RE--G............IQMT..RNNE......DKVRQ------------------------------------------
Q5NND8_ZYMMO/317-394AP--R............QIFT..RDAV......RADVS------------------------------------------
Q8EF72_SHEON/112-195KP--G............DTLN..HGMY......SDVKS------------------------------------------
Q6N5Q8_RHOPA/107-184KP--R............GTLS..RPMV......QGDAL------------------------------------------
Q5NEP7_FRATT/273-351KQ--G............EVFS..KSKL......VQTVE------------------------------------------
Q7U8Q8_SYNPX/217-301QP--G............DTFN..RNKL......EKDIK------------------------------------------
Q886N5_PSESM/346-420ME--G............GWAS..TYLI......DQSKT------------------------------------------
Q6ARL5_DESPS/262-340RN--E............PYLN..RGLM......RDDIM------------------------------------------
BAMA_DESVH/212-298TG--T............GVLK..DELL......ERDSA------------------------------------------
O84244_CHLTR/104-182YK--N............DLFD..RELF......FKNFD------------------------------------------
Q5SKT2_THET8/83-163GK--G............ATYN..PVRA......QEAAE------------------------------------------
Q92Q48_RHIME/278-357RE--G............TVYK..AKDI......QSTMS------------------------------------------
Q83DT2_COXBU/182-270TT--PGLFT...WISHRDRYS..QVKL......EEDLQ------------------------------------------
O84244_CHLTR/356-435FP--G............DTFD..RLKL......EGTET------------------------------------------
Q98MC3_RHILO/278-357HK--G............DVYN..AKDV......EDSII------------------------------------------
Q7VYC2_BORPE/185-273TT--PGWLT...WYTNTDKYS..REKL......EGDIE------------------------------------------
Q7NVY6_CHRVO/93-173AE--S............LIFD..QALL......DGAVQ------------------------------------------
Q7VHH5_HELHP/87-166KK--G............DSYD..ETKL......NRAKL------------------------------------------
Q89NX1_BRADU/148-225KP--R............GAFS..RAIV......QSDTL------------------------------------------
A9CJ61_AGRT5/277-356RQ--G............ASYS..AKEV......QQSME------------------------------------------
Q7NVY6_CHRVO/176-264TT--GGWLS...WITKDDQYS..KQKL......TGDLE------------------------------------------
Q6FCG7_ACIAD/351-425ME--G............ALAS..NEKI......DLSKI------------------------------------------
Q6ARL5_DESPS/173-259KE--KSWLT...WLTAAGLLD..MEKI......KQDGN------------------------------------------
Q8A1E1_BACTN/203-291FR--T............KKFV..PENF......EADKQ------------------------------------------
Q8XZI3_RALSO/181-269ST--PNWLS...WYTKNDLYS..KQKL......TADLE------------------------------------------
Q8D2H0_WIGBR/178-266NS--SLSF......FQKCIYQ..KHKL......IKTKN------------------------------------------
O67326_AQUAE/203-287KE--PNIFL....FRLHPAFS..EETL......KEDVK------------------------------------------
Q7VHH5_HELHP/262-341KK--G............TYFN..IEEV......RADVE------------------------------------------
Q9A711_CAUCR/263-342RT--G............QLYE..DERI......EQATD------------------------------------------
Q9WYS9_THEMA/270-342ST--D............ETYT..NSQI......LLAMN------------------------------------------
Q5E3E7_VIBF1/347-421ME--G............AWLN..SKSI......ETGKN------------------------------------------
Q8I576_PLAF7/116-193KQ--N............KLLTIRYKDI......NTIIN------------------------------------------
Q87ME5_VIBPA/266-344ED--N............ETYN..GSLV......TSMEE------------------------------------------
BAMA_BUCAI/92-172ET--G............KSFN..NFFT......NVLTK------------------------------------------
Q83DT2_COXBU/354-428YE--G............SLYS..LSKI......EESKR------------------------------------------
Q9A711_CAUCR/172-260KE--SRWYK...ILTSNDNYD..PDRI......EYDRE------------------------------------------
Q7MAB6_WOLSU/169-259NK--EREFMGWMWGFNDGKLK..VGEL......EHDSF------------------------------------------
BAMA_HELPY/219-309NK--QRDFMGWMWGLNDGKLR..LDQL......EYDSM------------------------------------------
Q6N5Q8_RHOPA/278-357NV--G............SLYN..AEAL......EKSVE------------------------------------------
Q83DT2_COXBU/273-351KR--G............DIFS..RQVI......INTNK------------------------------------------
Q6N5Q8_RHOPA/360-433SE--G............DAYN..RALV......DRAER------------------------------------------
Q5E3E7_VIBF1/266-344EN--G............EVYN..GSAV......TSLEE------------------------------------------
Q6FCG7_ACIAD/96-176VE--G............DVLK..SSAL......QTIET------------------------------------------
Q82VX0_NITEU/204-278RP--G............DPYR............REQLL------------------------------------------
Q5E3E7_VIBF1/175-263NV--DVAWW...NFLADEKYQ..KQVL......AGDIE------------------------------------------
Q5LSU6_RUEPO/116-193QS--R............RVFT..PEQA......ERDAA------------------------------------------
Q8KFQ6_CHLTE/57-131KI--N............DRITVPGQEI......PGVLQ------------------------------------------
Q8A1E1_BACTN/121-200VK--G............MQIT..PNTV......DRAKT------------------------------------------
Q5SKT2_THET8/164-238AL--K............GSFD..FAKY......QEALR------------------------------------------
Q9RXD5_DEIRA/180-256QT--S............KRFT..TQAF......FAASD------------------------------------------
Q7UK20_RHOBA/259-346SR--GPMMGI..MSYINNVAD..MKKI......DADVN------------------------------------------
O67326_AQUAE/18-90RK--G............SEFS..LERI......RKDIR------------------------------------------
O51735_BORBU/277-353SE--G............DIFN..DSKF......EQDFV------------------------------------------
Q8EF72_SHEON/198-271KE--D............ASYS..TRRV......SALNR------------------------------------------
Q73JH4_TREDE/277-355KK--G............DVFN..LRKF......ETGFG------------------------------------------
Q9RXD5_DEIRA/329-402KP--G............DVYS..PQLA......QDDFM------------------------------------------
Q82U03_NITEU/91-171SE--S............RIFS..RSLL......EKAEQ------------------------------------------
Q886N5_PSESM/174-262KT--SNWLS...FFKNDDKYA..REKL......SGDLE------------------------------------------
BAMA_BUCAI/347-421ME--G............KYFN............TKLVE------------------------------------------
Q5NZG7_AROAE/93-173AE--S............RIFD..RSLL......ERAEQ------------------------------------------
Q65R79_MANSM/260-339HV--G............EMYR..RGEL......QSVEE------------------------------------------
Q886N5_PSESM/265-343QP--G............QVFS..RKVM......TTTSE------------------------------------------
Q7V0C8_PROMP/253-325IP--G............SIFN..RTIL......EADIK------------------------------------------
Q8EJN5_SHEON/337-408KP--G............QNIT..KDEL......NEAIK------------------------------------------
Q74AT3_GEOSL/351-424AE--G............ETYS..STGL......KQSKQ------------------------------------------
Q8D2H0_WIGBR/348-422LE--R............STLE..ISNI......YKDIS------------------------------------------
Q5NEP7_FRATT/179-270EV--PSIWNLWGFLAPFDSYS..PDGM......NQSVQ------------------------------------------
Q8KBW3_CHLTE/43-133TR--NSFFGTGLFAGARRPFI..ADDF......EKDIS------------------------------------------
BAMA_DESVH/386-459AD--G............DMFE..GAKL......RRSNE------------------------------------------
Q6LN32_PHOPR/266-344KE--G............DIYN..GAQV......TALED------------------------------------------
Q7VYC2_BORPE/102-182GE--G............RIFD..QSML......ERAEY------------------------------------------
Q6ARL5_DESPS/343-416VE--G............GLFD..SAAL......RKSNK------------------------------------------
Q604T9_METCA/379-453ME--A............AWAS..TAKI......ERSKT------------------------------------------
Q6LMH9_PHOPR/358-429HS--G............EKMS..SEQL......AESVR------------------------------------------
Q92Q48_RHIME/187-275KE--SGIFS...FLTRKDVYN..PDKL......RADEE------------------------------------------
Q9HXY4_PSEAE/265-343QK--G............QVFS..RKVM......TTTSD------------------------------------------
Q5NND8_ZYMMO/488-566KK--G............QWYN..AKLV......EDTID------------------------------------------
Q6MAE9_PARUW/137-215GC--F............VTFE..RQAF......NQAFH------------------------------------------
P73472_SYNY3/425-496KP--G............DVFN..RNRA......QTDLQ------------------------------------------
Q5NZG7_AROAE/176-264TT--PGWLT...WYTKNDQYS..RQKL......AADLE------------------------------------------
Q65R79_MANSM/342-416QE--G............SWLS..SQLV......ELGKV------------------------------------------
BAMA_DESVH/59-130RK--G............DPID..PAAI......NKEIK------------------------------------------
Q881Y2_PSESM/187-261KE--N............TPYD..SQMI......AELTQ------------------------------------------
Q74AT3_GEOSL/27-98KT--G............DLLY..AEKV......DADVR------------------------------------------
Q5NND8_ZYMMO/569-643AE--G............DVFN..LLRV......KRSRD------------------------------------------
O51735_BORBU/183-274SD--G............KYLK...SNV......DKDKR------------------------------------------
Q7VYC2_BORPE/357-431QE--A............AWYD..AGDI......KVSRD------------------------------------------
Q6MMX9_BDEBA/373-447HE--G............ELYN..ETRR......RQSLE------------------------------------------
BAMA_PHOLL/266-344EP--G............SLYN..GTQV......TKMEN------------------------------------------
Q9A711_CAUCR/92-169RP--R............GIFT..RAKV......QADVQ------------------------------------------
Q9KPW0_VIBCH/266-344EI--G............ETYN..GSAV......TRLEE------------------------------------------
Q7VHH5_HELHP/169-259NR--AKQFMGWLWGRNDGKLK..LADL......EYDSP------------------------------------------
Q8YUR6_NOSS1/395-466KP--G............QVFN..RNTV......QKDLQ------------------------------------------
A9CJ61_AGRT5/106-183QP--M............GPFN..QAIV......TADIA------------------------------------------
Q7VRD8_BLOFL/356-430KQ--L..................EQSL......LNYHY------------------------------------------
Q7MAB6_WOLSU/262-341TE--G............KRFN..IEKL......RKDME------------------------------------------
B9KGV5_ANAMF/358-430HE--G............DVYS..TGAV......RQSRK------------------------------------------
C4YX56_9RICK/266-342KQ--G............KVFN..MKKV......DDIAE------------------------------------------
G1UBA5_HAEDU/89-168VA--G............EVYD..KAKL......EAFKQ------------------------------------------
O83346_TREPA/202-289QE--ARF.......LTSGVFK..ENAL......EADKA------------------------------------------
BAMA_ECOLI/176-263RD--EVPWW...NVVGDRKYQ..KQKL......AGDLE------------------------------------------
BAMA_HAEIN/175-259QP--DSWW.....KLWGNKFE..GAQF......EKDLQ------------------------------------------
Q2YPP8_BRUA2/234-307KP--G............QEYD..PDDI......ENAKK------------------------------------------
Q2YRQ2_BRUA2/108-184KP--R............APFD..MATM......EADKE------------------------------------------
Q2YRQ2_BRUA2/278-357RT--G............KPYS..AKEI......EDSVL------------------------------------------
Q31PR1_SYNE7/195-269DY--G............KILN..LQTL......QARIR------------------------------------------
Q5ZY66_LEGPH/369-442DE--G............GLLS..LHNI......KESER------------------------------------------
Q63T20_BURPS/183-270TK--N............DLYS..KEKL......TGDLE------------------------------------------
Q63W94_BURPS/223-295AA--G............EIYD..AKRI......TELQR------------------------------------------
Q6G5C3_BARHE/361-432NE--G............DAYN..QTLV......QRAKR------------------------------------------
Q8F3T2_LEPIN/54-124KV--G............KILT..KRIL......DRDLK------------------------------------------
Q8PAW1_XANCP/129-208TE--G............GTFD..RLSL......DRVTQ------------------------------------------
Q8RHT4_FUSNN/101-171KA--G............EYFS..RSRV......EDAQR------------------------------------------
BAMA_YERPE/267-344EP--G............ELFN..GSKV......TRMED------------------------------------------
Q9CJL1_PASMU/262-340QL--N............GLFR..RANV......LEVEQ------------------------------------------
Q9CJL1_PASMU/89-168KV--G............DVLN..RAKL......EEFRK------------------------------------------
Q9FFG3_ARATH/74-151VR--Q............ATTL..QELL.......KASK------------------------------------------
BAMA_NEIMB/267-343KP--G............KWYE..RQQM......TAVLG------------------------------------------
Q9PEI2_XYLFA/272-347KT--G............DIFS..RVLL......EYSSA------------------------------------------
Q9ZE03_RICPR/176-263KE--SRWFR...FLESNDTYD..PDRV......EYDKE------------------------------------------

PF08479

Q8XQ41_RALSO/70-145LN--G------------GTRT--LADL------SRGAA------------------------------------------
Q8RI18_FUSNN/32-109YI--D------------KDLG--STDI------TNLIT------------------------------------------
Q7NU30_CHRVO/77-152GL--A------------GCVD--LARI------NGLTA------------------------------------------
Q7N2L1_PHOLL/77-152YL--S------------RCLT--LPDI------NELVR------------------------------------------
Q7N9T5_PHOLL/77-152YL--S------------HCLS--LQDI------NTLVR------------------------------------------
Q6G3U5_BARHE/90-166YV--G------------RCIG--LSDI------QFLIK------------------------------------------
Q88MW8_PSEPK/83-158LT--P------------ACMG--IADI------NRLLK------------------------------------------
Q7N107_PHOLL/69-145GE--N------------HCLG--DKGI------SRLIT------------------------------------------
Q605Q3_METCA/48-123FL--G------------PGKS--IGDV------ESARA------------------------------------------
Q9JY36_NEIMB/87-166QA--G------------KCLH--AGNI------NQIMS------------------------------------------
Q8YM25_NOSS1/96-171FV--G------------REVS--FAEL------LQVRD------------------------------------------
Q7N1B0_PHOLL/77-152YL--S------------HCLT--LQEI------NELVR------------------------------------------
Q89H68_BRADU/98-173YL--G------------KKVS--QADL------AAIAG------------------------------------------
Q9HVN7_PSEAE/59-134LP--G------------QELN--LSQL------HAAAA------------------------------------------
Q8XQZ3_RALSO/84-163AT--G------------RCLG--TAGI------NLVMK------------------------------------------
Q880E0_PSESM/77-152FQ--N------------KCLG--VAQL------NDLLK------------------------------------------
Q8XYH9_RALSO/79-151VN--G------------QCVG--KQGL------EAIEL------------------------------------------
Q8DLP0_THEEB/81-156LE--G------------QQVT--LAEL------QRATD------------------------------------------
Q8XQX3_RALSO/69-144MA--G------------HDVT--VAQL------LQAAS------------------------------------------
Q7MRX6_WOLSU/59-134YV--G------------KCNT--LTDL------TNLAR------------------------------------------
Q9I792_PSEAE/71-146YQ--G------------RCLG--VGQL------NALLK------------------------------------------
Q8XPV1_RALSO/81-156FL--N------------RALG--TNRI------NLLLR------------------------------------------
Q7VLT7_HAEDU/59-128KK--N------------ECLN--QSRL------NQLSQ------------------------------------------
Q7NWR3_CHRVO/87-160PR--G------------TCLD--IAEL------NRFSR------------------------------------------
Q6FDM4_ACIAD/101-180II--G------------RCLG--VQGL------NQALD------------------------------------------
Q63JI8_BURPS/74-148YR--G------------ATMG--QAEI------FALLR------------------------------------------
Q9AAJ4_CAUCR/8-83FV--G------------KPVA--LADL------KTIAR------------------------------------------
Q63TR3_BURPS/65-140LV--G------------KDIT--IGQL------IETAN------------------------------------------
Q89Q77_BRADU/73-148YV--G------------KDVD--IASL------LQLVA------------------------------------------
Q9HVG7_PSEAE/71-146ML--G------------EQVS--LAEL------VDLAN------------------------------------------
Q6DA64_PECAS/107-183AV--N------------QCLG--GKGI------NLLMS------------------------------------------
Q8RGK0_FUSNN/41-115YV--G------------KD..--.KDI------YALIN------------------------------------------
Q9PAG8_XYLFA/106-185AI--G------------RCLG--TAGI------NIVIS------------------------------------------
Q74E11_GEOSL/79-154LE--G------------KEVS--IREL------LAMVD------------------------------------------
Q8YWF4_NOSS1/18-93FE--K------------RQVT--FADL------IQLRS------------------------------------------
Q7N910_PHOLL/78-154GE--N------------QCLG--TQGI------NILMT------------------------------------------
IBPB_HISS2/99-172YL--N------------QPLS--AKTV------FALTK------------------------------------------
Q88QC1_PSEPK/91-166LI--G------------RETT--LGEL------QQYTQ------------------------------------------
Q7NY08_CHRVO/92-167AK--G------------KELN--LDQL------KELAT------------------------------------------
Q9I5N4_PSEAE/47-122FL--G------------PQRS--LGDI------EGARD------------------------------------------
B4F0Z8_PROMH/77-150LP--D------------QCIK--SADI------NRLVK------------------------------------------
C5BBG6_EDWI9/81-153LP--A------------HCIR--SRDI------NHLAK------------------------------------------
D3VFR1_XENNA/80-152LP--D------------SCIT--SNNI------NELSA------------------------------------------
FHAC_BORPE/92-164YL--N------------RPLD--NEQL------FLLVK------------------------------------------
HXUB1_HAEIN/73-150YV--G------------KEVS--LSDL------SNLAN------------------------------------------
Q0WFB2_YERPE/81-154IL--G------------ECIS--EDDI------NILAK------------------------------------------
Q6D5C4_PECAS/75-150YI--N------------RCIN--VNNI------NQLIH------------------------------------------
Q74QU0_YERPE/90-165AH--G------------RCLG--EQGL------SVLVA------------------------------------------
Q7CJ53_YERPE/77-153AL--G------------QCLG--GQGI------NQLMS------------------------------------------
Q7N9K7_PHOLL/79-152LS--P------------ACIS--SHDI------NRLSH------------------------------------------
Q7VX34_BORPE/76-148LA--G------------KEIT--VAQL------VQQVD------------------------------------------

PF08478

FTSQ_VIBF1/50-120MD.SI------------GTFM..TQDV------NKLQD------------------------------------------
FTSQ_SHEON/52-121LM.Q.------------RSFF..SADI------TLVQQ------------------------------------------
DIVIB_BACSU/54-123NS.GD------------TEFW..SLDK------QKTEK------------------------------------------
FTSQ_RHIME/89-157DG..T------------TSLV..ALDI------EEARR------------------------------------------
Q5P6Z9_AROAE/37-106AI..R------------GNFF..SVDL------EQVRG------------------------------------------
O83403_TREPA/55-123TG..K------------EKWM..SLDG------FTISE------------------------------------------
DIVIB_CLOTE/54-122SN..E------------NNIF..YLNL------NNVKN------------------------------------------
FTSQ_ECOLI/55-126LG.EP------------GTFM..TQDV------NIIQT------------------------------------------
Q8D2Z8_WIGBR/41-111LK.LS------------KNFV..KKDI------EFIKI------------------------------------------
Q83N06_TROWT/56-124RGEFN------------KPLA..FVDP------ETVRK------------------------------------------
Q8E185_STRA5/122-193QKNDY------------FFSL..IFKH------KAIEQ------------------------------------------
Q5SJC7_THET8/24-91AP..G------------DPWL..WVWG------NRLRP------------------------------------------
Q5R0N0_IDILO/43-112AE.PL------------GSFF..TADV------DDLRR------------------------------------------
Q6F706_ACIAD/59-128II..K------------DNYF..TSDL------EQIRD------------------------------------------
Q728V1_DESVH/71-139VE..G------------ANSI..ALNI------ADVED------------------------------------------
FTSQ_HAEIN/54-124MG.EL------------KGFW..GQDV------APIQE------------------------------------------
DIVIB_STRR6/153-223QDSDY------------TINL..LLDK------AKYEK------------------------------------------
Q9CPA8_PASMU/55-125MG.DL------------KGFF..GQDI------DAVRE------------------------------------------
Q7MNU9_VIBVY/53-123IT.HI------------GTFM..SQDV------SVLQE------------------------------------------
Q73IQ7_WOLPM/61-128DR..T------------QPIL..YISL------SKLAG------------------------------------------
Q7NQ02_CHRVO/37-106EL..S------------GTFF..TLDI------DKTRA------------------------------------------
Q5YYX7_NOCFA/42-110PE..G------------RSLL..RVDT------DAMAR------------------------------------------
Q8DVE1_STRMU/126-197KKSDY------------LTTL..LFQA------NRFER------------------------------------------
Q82AD6_STRAW/56-125SL..G------------SPLI..SVGI------DEIEA------------------------------------------
Q8YQH2_NOSS1/56-126SY..P------------QSLW..RIQP------AAIAD------------------------------------------
Q98KB7_RHILO/92-160DG..W------------TSLI..GFDA------EAARE------------------------------------------
FTSQ_COXBU/46-115HI..Q------------GGFF..SFNA------SALQT------------------------------------------
Q5HQ08_STAEQ/219-287TS..R------------SRMY..TFSK------NKAIR------------------------------------------
Q8DMI0_THEEB/61-130QY..P------------ESLL..RLRP------QEIIH------------------------------------------
Q87WY8_PSESM/73-142YV..A------------SSFF..KIDL------AAMRT------------------------------------------
Q5FUJ1_GLUOX/84-152SV..G------------RPIF..GFSV------EAARQ------------------------------------------
DIVIB_GEOKA/50-118TK..R------------TSFW..KVNE------QNVEK------------------------------------------
Q7V8M1_PROMM/59-128HF..P------------QPLL..GFNP------KELEQ------------------------------------------
DIVIB_LACLA/153-224QTSDS------------IFNI..LNNK------EKIEA------------------------------------------
Q65RZ0_MANSM/55-125MG.EL------------KGFF..GQDV------DVIRE------------------------------------------
Q6AE66_LEIXX/96-164QL..G------------RPLP..LLDQ------AAISS------------------------------------------
P73457_SYNY3/54-123EY..P------------QAVW..QLST------QALGD------------------------------------------
Q73NF1_TREDE/62-130ES..N------------TKWL..SIDS------SEISK------------------------------------------
Q6AJ56_DESPS/51-120LR.YQ------------NSLF..SVDA------DVVAA------------------------------------------
Q9RWN7_DEIRA/101-171PA.GE------------SPFG..WLYY------GRWKA------------------------------------------
Q604W1_METCA/56-127KLVTG------------NTYF..GVPL------AEIRQ------------------------------------------
Q6NGD0_CORDI/29-97AK..G------------TNIV..RVAA------HDAAG------------------------------------------
Q7VMY3_HAEDU/61-131EP.AL------------KGYF..GQDI------QLIKQ------------------------------------------
Q8CXI4_OCEIH/50-118TT..D------------TNIW..TINT------NSVEQ------------------------------------------
Q5WFH0_BACSK/51-119EE..G------------MNIW..HLSE------GEREK------------------------------------------
Q7U5Q7_SYNPX/51-120NF..P------------QLLW..EINP------SELEQ------------------------------------------
FTSQ_BLOFL/45-115SG.VL------------GTFI..TQDV------NIIQK------------------------------------------
FTSQ_VIBCH/52-122LD.HI------------GTFM..SQDI------NVLQE------------------------------------------
Q6N416_RHOPA/110-178TG..R------------SSLL..FLDA------AAVRD------------------------------------------
FTSQ_NEIG1/37-106EY.IH------------GNIL..RTDI------NGAQE------------------------------------------
Q67Q43_SYMTH/58-125MP..G------------DLKW..EVTA------ERVRQ------------------------------------------
FTSQ_GEOSL/67-135RP..G------------DSML..GLRL------RDIGS------------------------------------------
Q9CCE5_MYCLE/151-219QL..G------------TPLL..QINT------NQVAD------------------------------------------
FTSQ_CORGL/30-98VE..G------------ENLF..RVDA------TAAGQ------------------------------------------
Q8R9G8_THETN/29-97QA..G------------TNIF..KVNP------KQVEK------------------------------------------
Q8XJA3_CLOPE/42-109LN..Q------------.NIF..LLNT------SALKK------------------------------------------
Q7NNV9_GLOVI/69-138DY..P------------QPIL..SVRP------EQLQQ------------------------------------------
Q6A9Q0_PROAC/48-116PK..G------------QPLA..RVNT------DDVAA------------------------------------------
Q5FKV1_LACAC/77-148KA..S------------DKVFDYLFQQ------KDLSQ------------------------------------------
Q8FNU2_COREF/30-98TA..G------------DNLL..RIDA------TGAAH------------------------------------------
DIVIB_CLOAB/41-109KK..G------------NNIF..YLNL------NKYKD------------------------------------------
Q6LMF8_PHOPR/51-121LD.HL------------SSFM..TQDV------DDIQA------------------------------------------
Q9K9T2_BACHD/50-118SN..E------------TSIW..SISD------EQLKA------------------------------------------
FTSQ_CAUCR/94-162YL..D------------QPTL..GMDL------ADVRD------------------------------------------
B1W0J1_STRGG/62-130PV..G------------APLV..SVDT------DAMER------------------------------------------
B9KHS4_ANAMF/69-137NK..D------------SSII..LLSL------RTLRS------------------------------------------
FTSQ_ZYMMO/97-165QQ..N------------LAMP..LVDL------NAIRD------------------------------------------
D4ZDU0_SHEVD/36-105LM..Q------------RSFF..SADV------NQVQE------------------------------------------
G3XCS0_PROMA/62-129NL..P------------TSLL..EINP------KQLEN------------------------------------------
G8AFN1_AZOBR/99-167QR..G------------DPIL..AVTL------SDAKE------------------------------------------
H7C7L9_BORBU/34-101KP..N------------TYYH..NANV------RIYEE------------------------------------------
I6T797_ENTHA/66-137AI..D------------GNVWSQYFHK------NQYLD------------------------------------------
FTSQ_MYCTU/125-192RP..A------------TPLL..QIDT------QQVAD------------------------------------------
DIVIB_STAA8/195-262KN..D------------SRMY..TFSK------KNAIN------------------------------------------
Q2YLY9_BRUA2/68-136DG..E------------TSLV..GLSA------EEARQ------------------------------------------
Q5M4Y0_STRT2/105-175LDTDY------------ITHV..FFNQ------EEIAS------------------------------------------
Q5ZSA8_LEGPH/39-107YL..D------------ASFF..LLSV------KGLQS------------------------------------------
FTSQ_BURPS/37-106RL..K------------GNFF..TVDL------DLARV------------------------------------------
Q65JX8_BACLD/54-123HK.GQ------------TEFW..SLSK------QKAAE------------------------------------------
DIVIB_BACAN/53-121TY..D------------TSYF..RVTA------HKAEE------------------------------------------
DIVIB_ENTFA/126-197ET..G------------SGLWEQYSNR------NYFSA------------------------------------------
Q8F8E7_LEPIN/47-113QP..G------------TSFD..SLDL------DLLEK------------------------------------------
DIVIB_LISMO/51-118EI..G------------EFVI..GISN------GKTED------------------------------------------
Q99YV5_STRP1/126-195KASDY------------WLTL..LTSP------GQYER------------------------------------------
Q9PF78_XYLFA/35-103YV..R------------SGFF..AVRL------PQVQD------------------------------------------
FTSQ_RICPR/73-141NK..S------------SPIF..SLKL------DEISN------------------------------------------
S5VEM4_STRCU/60-128PV..G------------APLV..SVDT------EAVEA------------------------------------------

PF06898

F6B8F3_DESCC/8-408KE--G------------DTVLPGQILI------SGEIK.............EEVKPEETNQPLPEGQEPPEPKYISHFVQ
D4JTF7_9FIRM/10-387TV--G------------SGIAKGQLII------SGTVN....................DNGGHIV............YVH
R5L248_9CLOT/7-384QA--G------------DAVTTGDLLI------SGVYE................PEEYSQPQKNH............FAR
R7QWQ5_9FIRM/7-391TA--G------------TQVKKGDVLI------LGRLE...............ILGDGGEVTNYQ............YCV
L0FBK0_DESDL/7-397HE--G------------EIVKPGQVLI------QAPAT................VENLSATPRTDRQLQQKDFIPETVPA
R6I0K6_9FIRM/6-384IV--G------------NAVAKGDVLV------RVLMS....................SETGDER............YVH
L0EFM5_THECK/10-388KK--N------------QRVKKGDVLI------SGILG.....................GDGLHV............NVP
U5MNL2_CLOSA/5-371VP--G------------DIVKTGDVLI------LPVQG.....................REGFEK............EVK
R6SYS4_9FIRM/4-378PV--G------------SGVTKGDIVV------GGEII.........TSKSSWIDGKENVETKTS............YAR
R7F0N3_9BACI/3-369KI--N------------DYVKQGEVIL------SGAIM....................RDEEVKN............LLA
R7P4H2_9CLOT/3-367QI--N------------DYVKEKDTLV------KGIIN....................YNNEDKR............YTC
Q0AWN4_SYNWW/7-394EV--G------------KAVSKGDILI------SGVVY........PQKNPFMEGVEEELEEKPS............LVR
I0JP38_HALH3/8-385TV--N------------DVVKKGQKLA------TGQLV......................EDKDI............LVH
R7H622_9FIRM/5-371LI--G------------DAVQEGELLV------SGILA....................DDKGHTT............LHH
B2A1M5_NATTJ/8-399EP--G------------DAVRKDDVLI------YGRVV.....................PSGTELGELEEEELTEYPGTQ
A5N6N1_CLOK5/11-376KI--G------------DDVKKGQILV------KGEQG.....................QESATY............SVA
C8W3N7_DESAS/8-411KE--G------------DTVFAGQILI------SGVIP..........PTLKEKEIPEQPLSSEQKELLEKESGEPKIVH
R6MSI1_9FIRM/8-382MK--G------------SGVVKGDLLV------SGIVE....................TKQETIE............YVH
C3AQR5_BACMY/11-389MK--N------------DYVQKGQLLV------SGMFG.....................KEDNPT............IVS
B8CXJ2_HALOH/7-376EE--G------------DTVLSGQPLI------IKRDK.......................................NER
W6RVC1_9CLOT/10-376KA--G------------DVVKNGDSLI------SYIEG.....................DESHSY............EVV
D4LTE1_9FIRM/6-388HV--G------------EECHIGDVLV------SGCLE...............LKNDSQEVVRYE............GVH
K0B1J4_CLOA9/8-387EK--G------------DIVKKGQLIV------TGVIQ...................DEGMDSPL............LVH
R5NSB5_9CLOT/8-384KS--E------------DEVKKGDVLI------AGWME....................GKYTGKY............YVN
R5HMY8_9FIRM/8-391QE--G------------EAVCEGDVLI------SGRME.............MDTVTPTEHDLGTM............LVH
C0ZB79_BREBN/7-385VS--N------------QLVEKGQVLI------SGIIG.....................NDDRQQ............AVS
R6XDX7_9CLOT/8-386KE--G------------EIVKKGTVLI------AGWLE....................GKYTGTR............YVH
A8MG63_ALKOO/8-387SE--G------------DIVKEGDILI------SGIIE...................RDFMETDK............YVH
J7J0E9_DESMD/7-385HE--G------------ETVRAGQVLI------KSPQV.................NNMSSAKNAP............VSV
B8I730_CLOCE/8-390KI--G------------DTVTKGQLLV------TGTIE.................NVKNPEAPPL............MVH
Q97JI9_CLOAB/7-373KA--G------------DVVKKGQVLI------KGEAG.....................QDDKVY............KVH
R5T3J2_9CLOT/7-380NT--N------------DYVRKGEVII------SSNVI....................LPNGSVN............LTN
R6C1Q2_9CLOT/6-386KI--G------------DRVDVGTLLV------SGEVP...............VYNDDETIRKYR............ETY
K4LIU5_9FIRM/7-395AE--G------------QLVTAGQVLI------KAAGG.......MTEYSFDVSGQNRAKQNATD............APA
R6UCV3_9CLOT/10-387KA--L------------DYVNKGDTLI------EGNVY...................DRNEQIIG............EVP
R6N4A7_9CLOT/7-383EE--G------------DAVTQGQLLV------SGVFE...................DLLEGKSH............YQH
I3VX08_THESW/8-382KV--G------------DTVKTGDVLV------SGVIE....................RPNTNTR............FVH
B0TAE5_HELMI/7-400VE--G------------ERVVKDQVLI------SGLIF..................QHKPTIRSQAEDKPEPPKLIDKVQ
R5TPA1_9CLOT/8-390SV--G------------DEVKKGDVLV------SGTLH...............VIGDSEEIMNTH............YVH
R5QI90_9FIRM/5-375KT--G------------QTVKKGELLV------SGVID....................SQALGYR............LVR
R5KWN8_9CLOT/12-386KP--G------------SFVEAGTVVI------EGVIY....................SKYIDPI............KVP
N0B454_9BACI/7-385SV--H------------EHVVPGQLLV------SGVIG.....................KEGQEV............QVS
F8I923_SULAT/7-394LV--G------------EKVTRGQVLI------SGVVS...........AVPNAAGDQPSTEESI............VTP
D3E517_GEOS4/9-385GI--N------------SRVKKGDILI------SGVLG.....................DEENSE............RVV
R6H3U2_9CLOT/8-388KV--G------------DTVNKGTTLI------NGWME....................GKYTGIR............YVH
R7F7B5_9CLOT/8-387KP--G------------DVVKEGTLLI------GGWME....................GKYTGTR............FAR
R7M7L8_9CLOT/8-385KE--G------------DVVTKGTVLI------EGWLE....................GQYTGIR............YVH
R6TJX8_9FIRM/7-385LP--G------------TSVEEGQLLI------SGVED....................TDTVGAR............ILA
Q67S30_SYMTH/7-404KK--G------------DVVQPGEMLV------ECALR....YWAGGRPVVIPGTPPPPRTDLAR............TVV
R5F5D4_9CLOT/9-390CV--G------------DQVEEGQVLV------SGRVP...............IIGDNEEEINAY............MVH
R5Q8Y0_9CLOT/8-386KE--G------------DIVTKGDTLI------AGWIE....................GKYTGTR............YVH
R6M0R0_9CLOT/7-380DI--N------------TYVKKGETII------SAYIT....................TPSEEKI............LST
R5YC97_9FIRM/7-392KA--K------------DKVKAGDILV------CARQE...............ILDDNGEVKEYF............YQN
Q8RB55_THETN/13-387KV--G------------DTVKTGDILI------SGIIE....................KPGLDTM............FVH
F4LSY6_TEPAE/8-387EP--G------------QTVSKGDVLI------TGKIV..................LDQEQDQVL............LVH
R6LHZ6_9FIRM/6-383KP--G------------DVVREGQLLV------SAYAD.....................FGYKTQ............VSG
A4XKI6_CALS8/4-376KE--G------------DTVIAGQLLI------DNRVV....................TKDGNEY............YED
R5T032_9CLOT/3-372KI--N------------DYVKKGEVII------SGAIT....................KNDEVKN............KIT
R5B397_9CLOT/7-382NV--G------------DAVVKGQELV------SGILR....................NDEFGFI............TTA
R7DBV9_9FIRM/6-388KV--G------------DLCKKGEILV------SGILE...............LKDDSQEVVKYE............AVH
R7FM48_9CLOT/8-386KV--G------------DTVNVGTTLI------NGWME....................GKYTGLR............YVH
B1I691_DESAP/9-398RE--G------------DTVFPGQLLI------SGEIW...................PPEALDPQGAILNVEPR...LVR
R7IV24_9CLOT/8-386NI--G------------DEVEENQILI------AGQME....................GKYTGIR............NVH
SP4_BACMD/7-385KV--N------------DFVNEGEVLV------SGIIG.....................NEKNKK............VVA
C9RAM9_AMMDK/7-391KE--G------------DTVLPGQVLI------AGEEM...............VVPQGESELRPV............CVR
R5XPL9_9CLOT/8-386KE--G------------DVVKKGTPLI------AGWME....................GKYTGTR............YVH
A6LRP5_CLOB8/4-370VP--G------------DIVKKGDDLI------LPIQG.....................REGFQM............EVK
Q892R7_CLOTE/11-377KE--E------------DIVKKGDILV------KGQQG.....................KEGEEY............AVH
R7HMN6_9FIRM/7-380SI--N------------TYVKKGDIII------SSDIT....................LPNNEKI............PKT
E6U532_ETHHY/8-382QA--G------------EAVTAGQMLI------SGMIQ....................DKDGALR............IVH
D9R1A2_CLOSW/7-388AI--G------------DTVEQGQVLV------SGVLP...............IIGDSEEVVNTH............YVR
R7L9N0_9CLOT/9-386KN--G------------DLIKKGTVLI------GGWLE....................GKYTGTR............YVH
A5D3V9_PELTS/9-406KE--G------------DTVAPGQVLI------SGEIP..............PPEERPEPGEDNKQGRVPKKVQPFRYVH
D4L904_9FIRM/7-374TK--G------------SGVVNGQILV------SGLDE....................TKQGDMR............YLR
E3E8L2_PAEPS/9-385HK--N------------TRVKKGAILI------SGTLG.....................DEENQQ............QVV
R7I713_9CLOT/7-390KK--G------------DKVKKGQILI------SGVLG...............LQNDDGTLKKKE............AVH
E6TW41_BACCJ/7-385EI--N------------QLVEKGEMLV------SGLIG.....................KEGEEE............QVA
X4ZFY3_9BACL/8-384QR--N------------ARVKKGEILI------SGIIG.....................DEANMQ............AVV
R5CSR2_9FIRM/6-384SI--G------------DTVSMGDTLI------SGTMD....................SETAADR............QVH
E6UAB1_RUMA7/4-383CL--G------------SGVTKGEIVV------SGKIV.........TDDRKHTEHDDISDSNTR............YVR
R5D9M1_9FIRM/7-386LP--G------------ATVTEGQLLI------SGVSE....................TEHIGAR............FVH
Q8EPX5_OCEIH/7-397QI--N------------DYVKPGDLLV------SGDLS.....................YEENQDEDESDSEKRKTPPIT
R5IHX3_9FIRM/8-382AP--G------------QAVAGGELLV------SAYTD.....................FGFKTQ............VTA
Q24SU1_DESHY/7-393HE--G------------EIVKPGQVLI------QAPRA................IHNPSARPRTDRQLQQKDYIPEIVPA
Q9KD59_BACHD/9-387KV--N------------DYVEKGDMLV------SGFIG.....................KEGKEQ............IVP
R5XQE7_9CLOT/3-370SV--G------------DIVKKGDLLI------QGA.........................................NTS
Q3AEZ9_CARHZ/5-371KP--G------------QKVTAGEVLI------SGVDE....................................RGKTIV
F6CMU5_DESK7/8-406KE--G------------DTVVPGQILI------SGIIP..............PLQEQKPEQPGTETQGERPVPRQPTYVH
F2JQA7_CELLD/7-387KA--G------------DIVKKGELLV------AGEMP..................RGEEDDSLY............YTA
U5LCI4_9BACI/7-385SV--N------------DHVIPGQLLV------SGIIG.....................QDDQTQ............TVP
A8FFB9_BACP2/7-386AV--D------------EHVKKGQMLV------SGLIG.....................SEDQQK............TVG
L7VHP9_CLOSH/8-388KE--G------------DTVKKGQVLI------SGVME..................SKNPEAGTR............YVH
R6D0A8_9CLOT/8-382NK--G------------DTVKQGDLVV------SGVVV....................SSKGKNI............LRH
Q65H67_BACLD/7-386TV--N------------QHVEKGQMLV------SGLIG.....................SEEEKQ............KVG
D9QV99_ACEAZ/7-405KE--G------------ELVQAGERLI------SGTRK...YYPQVPQQEELSTEEKEELEPKIE............KMA
C8WY36_ALIAD/8-383KP--H------------QLVQPGQVLI------SGLLT...................................DGGPSVP
Q2RKW7_MOOTA/8-408AV--G------------DTVRRGEVLI------SGLIL.....PPEPEKKPGENQPQQQPRPEPR............LVR
YQFD_BACSU/7-386AI--H------------DHVEKGQLLV------SGLIG.....................SEDHQQ............EVA
Q5KX07_GEOKA/7-385SV--N------------DYVQKGQLLV------SGIIG.....................AEGRTK............FVP
R6XTI8_9CLOT/8-386KE--G------------DIVKEGDTLV------LGYLE....................GKYTGIR............YVH
R6NIT4_9CLOT/8-386KV--G------------DIVKENDVLI------NGWME....................GKFTGIR............YVH
R6G2U3_9CLOT/4-369KN--S------------DVVKKGEVVI------EGVDG.....................NEGGEY............VVR
R6QWU5_9CLOT/7-381KI--G------------EAVVKGQMLV------SGILE....................YDVGGFK............LKH
F4A357_MAHA5/8-386KV--G------------QTVKKGQLLI------TGVIE....................KEGMDTR............YVH
R5ITB3_9CLOT/7-378DI--N------------DYVKKGDTLI------SGSIY....................LNDTLKG............YTK
R7IQG8_9FIRM/7-393KI--D------------MQVQPGDILV------YGRYD...............IVDDNKETVRTQ............YLR
F6DMW5_DESRL/8-408KE--G------------DTVLPGQVLI------SGETQ.............EEIKPEPSTQPLPEGQEPPEPKYISHFVQ
R7L3Q3_9FIRM/6-381MV--G------------DGVKKGDIIV------SGVVD....................TKYGRSF............YVH
K0J274_AMPXN/9-396EV--N------------DFVKKGQLLV------TGQLN..........HLNQNDEDDNTENQDEQ............LIE
I4DAP4_DESAJ/7-400HE--G------------ELVRVGQVLI------AKAPA..............LGLPSTPNPSSAKINPAKSTTPNPPAAA
D7CNW5_SYNLT/8-391KE--G------------ETVAKGDVLI------SGIVF..........PETRLDGEDGQGVMHPQ............IVT
R5Y9N3_9FIRM/7-382EP--G------------EAVSPGDLLI------SGVYE..................GGENAAKNH............FAH
R4KCE0_9FIRM/7-406RE--G------------DTVTSGQVLI------SALIP.PPEIEEESKPNAAEGEAEKEQQLTLQ............YVH
R6YI22_9CLOT/2-369EP--N------------TYVNKGDVII------SGAIT....................KDEEVKK............YVH
G8M1A5_CLOCD/7-388KV--G------------ETVKKGQVLI------SGTVP..................VKNQEDNPR............ILH
K4LKI1_THEPS/8-398RE--G------------DVVRKGQVLI------SGEIS......PAPPGQDEQQGEQLPPRQEPR............FVQ
G4KWF7_OSCVS/7-385LP--G------------DTVEKEQILI------SGIED....................LDTFGAR............ITT
R6NSX8_9FIRM/7-390ND--G------------DAVKTGDVIV------SGKVA............................TYKEGYPEEYIYVH
R6RMK3_9CLOT/7-391RA--G------------DPVAAGDLLV------AGTIP...............IYDDSENLVSSH............EIR
A3DEC5_CLOTH/8-389KE--G------------DTVKKGQLLV------SGSIP..................IKGAEDNPK............RVH
R6GJ09_9CLOT/6-381KY--G------------DAVIKGQLLI------NGFVE....................DDFGVCN............VRH
D9S2Q3_THEOJ/8-389KP--G------------DTVSKGDVLI------SGSVT................LVGSDNTKDHM............LVR
D4LCN8_RUMC1/4-373QV--G------------DGVKAGDVLI------SGVLE....................EETGAVS............YFH
C5D4T1_GEOSW/7-385SV--N------------DHVTKGQLLV------SGIIG.....................KEGQTK............LVP
W0EAS0_9FIRM/7-398HE--G------------ETVKAGQVLI------EAPVS................LDNPTAQPKPGIASKPNPTLPQAIPA
F9VJJ5_ARTSS/9-374KA--G------------DIVKKGDILI------GGYQG.....................KEGNVY............EVA
A0Q1Q5_CLONN/8-374KE--G------------DIVKKGDILV------KGEQG.....................REESTY............LVH
F0SVD9_SYNGF/7-392KE--G------------DLVKTGQLLI------QGTLS.....................NVNEYRFDLGGGENKTKEIPI
D9SW54_CLOC7/9-375KV--G------------DTVKKGQVII------AGNQG.....................KEGSTY............EVQ
G2TNK7_BACCO/7-385KI--N------------QYVKKGQLLV------SGVIG.....................NDKEKY............PVA
Q8XIU3_CLOPE/5-374KE--G------------DVVKKGDILI------IPQQG.....................IEGGEY............EVD
R5HCW7_9MOLU/9-376TK--N------------EHVKKGEVVI------TGEVK....................LNDEIKE............ITG
R7MJV7_9FIRM/5-378IV--G------------DYVRSGDILV------SGIIQ....................DSNGHIT............MHH
R5AEU1_9CLOT/3-374AV--G------------DAVEAGDVLI------RGDLT...................REDAQLPL............IVR
R5JAK2_9FIRM/6-375DM--N------------DYVKKGDMIV------NGELI....................FNEKVTG............KVR
R5JWC6_9CLOT/7-386KN--G------------MTVARGDILI------SGVIH...............IYDDYDEVLETD............MVA
L0KBA1_HALHC/7-398EE--G------------MVVQRGDVLI------SREVK.......VKKKAEATTNKEEIDEFKIK............KVK
R5X7Q5_9FIRM/6-388RP--G------------ETCKTGDVLI------SGCLE...............LKNDSQEVTRYE............YVH
R7NE92_9MOLU/3-369SI--N------------DYVKKGDILI------NGSIK....................LNDEVKE............NVC
D3FY22_BACPE/7-385KP--N------------DFVEKGDMLV------SGEIG.....................KEGKTE............IVA
Q5WHE5_BACSK/7-385KT--N------------DFVEEGELLV------SGFIG.....................AEGKEQ............TVA
B2TM04_CLOBB/5-371KP--G------------DIVKTGDILI------LPIQG.....................KEGFEK............EVK
A6TSK6_ALKMQ/8-387KQ--G------------DIVSEGDLLI------TGVIE...................REQMENPM............IVH
G7MCG1_9CLOT/5-371SP--G------------DIVKEGDELI------SPIQG.....................REGFEK............EVK
Q182D1_PEPD6/3-370KS--G------------DIVQKGDVLL------NGA.........................................NTK
B7GKD9_ANOFW/7-385EV--N------------DHVVPGQLLV------SGFIG.....................KEGQTE............IVP
R6CV47_9CLOT/2-371KK--N------------DYVSKGETIV------SGDII....................KDETVKG............QVR
D5XAQ9_THEPJ/8-405KE--G------------EMVKKGDLLI------SGIIESEIEAPIEKENPEQLLEGEKQKVIRRR............FVR
A5I631_CLOBH/5-371QN--G------------DIVKKGDILI------KGEQG.....................KEGETY............EVH
R6CYS5_9FIRM/7-389AV--G------------ETVQAGQVLL------SGVAD.....................SPRGCR............YMR
R6BC91_9CLOT/8-386KQ--D------------DVVTKGDILI------AGWID....................GKYTGTR............YVH
R4KBT4_CLOPA/9-375KQ--G------------DIVRKGQLIV------KGEQG.....................NEGSTY............QVH
C6CTU6_PAESJ/7-385KK--N------------MKVKKGQTLI------SGTIG.....................GGAYTQ............SVV
R5AR68_9FIRM/7-385VP--G------------AAVEPGDVLV------SGAVT....................DLGGGVR............PVC
M1LPE2_9CLOT/3-366AP--G------------DIVKKGDELI------LPIQG.....................REGFER............EVK
R5A1X4_9CLOT/2-368DV--N------------DYVKKGDVLI------TGNII....................KNDEVVD............KVK
R6Z4S5_9CLOT/6-387RP--G------------DTVEKGQVLV------SGTIP...............ITDDGGTVVSEY............TVR
R5ACZ0_9CLOT/8-391EL--G------------ETVEAGQLLI------AGLYQ...........QEVEPYSPVPEELYQI............LGA
A4J7E2_DESRM/8-408QE--G------------ETVLPGSILI------SGEIK.............EEVKPDPSNQPLPEGQEPPEPQYISHFVR

PF07244

Q98MC3_RHILO/107-184-----------------------------------------------AV..KA---------------------------
Q6ARL5_DESPS/92-170-----------------------------------------------AI..IS---------------------------
Q5NEP7_FRATT/354-428-----------------------------------------------......---------------------------
Q5FPE9_GLUOX/347-432-----------------------------------------------......---------------------------
Q8KFQ6_CHLTE/212-301-----------------------------------------------LL..VE---------------------------
Q73JH4_TREDE/105-183-----------------------------------------------AL..KD---------------------------
O84244_CHLTR/185-272-----------------------------------------------AI..TN---------------------------
Q9I0U1_PSEAE/190-268-----------------------------------------------......---------------------------
Q8EGG7_SHEON/97-177-----------------------------------------------GL..QD---------------------------
Q8KFQ6_CHLTE/304-389-----------------------------------------------DV..SS---------------------------
Q9KUB9_VIBCH/347-418-----------------------------------------------......---------------------------
Q73JH4_TREDE/186-274-----------------------------------------------AI..KL---------------------------
Q98MC3_RHILO/360-433-----------------------------------------------......---------------------------
Q6MAE9_PARUW/218-306-----------------------------------------------II..TN---------------------------
Q8XZI3_RALSO/98-178-----------------------------------------------EL..KR---------------------------
Q8EGG7_SHEON/352-426-----------------------------------------------......---------------------------
Q604T9_METCA/124-204-----------------------------------------------EL..RR---------------------------
Q8D271_WIGBR/189-264-----------------------------------------------......---------------------------
Q82VX0_NITEU/116-201-----------------------------------------------AL..LS---------------------------
Q87LW2_VIBPA/354-425-----------------------------------------------......---------------------------
Q6MAE9_PARUW/390-467-----------------------------------------------RL....---------------------------
Q6LKQ8_PHOPR/351-422-----------------------------------------------......---------------------------
O84244_CHLTR/275-353-----------------------------------------------KI..RS---------------------------
Q5NZG7_AROAE/348-422-----------------------------------------------......---------------------------
O67326_AQUAE/374-446-----------------------------------------------......---------------------------
Q5NNB2_ZYMMO/333-411-----------------------------------------------......---------------------------
Q7VHH5_HELHP/344-416-----------------------------------------------......---------------------------
Q98MC3_RHILO/187-275-----------------------------------------------LL..RR---------------------------
Q6FCG7_ACIAD/270-348-----------------------------------------------LL..LR---------------------------
Q6MMX9_BDEBA/120-198-----------------------------------------------KI..QK---------------------------
Q8XZI3_RALSO/353-427-----------------------------------------------......---------------------------
Q7MIG8_VIBVY/266-344-----------------------------------------------NI..KR---------------------------
BAMA_HELPY/312-391-----------------------------------------------IL..KT---------------------------
Q8RHT4_FUSNN/251-335-----------------------------------------------......---------------------------
Q6D152_PECAS/230-304-----------------------------------------------......---------------------------
Q5E2U2_VIBF1/342-414-----------------------------------------------......---------------------------
Q89NX1_BRADU/319-398-----------------------------------------------DM..QI---------------------------
Q92Q48_RHIME/107-184-----------------------------------------------AI..RD---------------------------
Q5R0Z1_IDILO/176-264-----------------------------------------------TL..ES---------------------------
Q5E3E7_VIBF1/92-172-----------------------------------------------GL..ED---------------------------
Q8D2H0_WIGBR/95-175-----------------------------------------------SL..KN---------------------------
Q5FPY9_GLUOX/117-194-----------------------------------------------KI..LN---------------------------
Q8KFQ6_CHLTE/132-209-----------------------------------------------RI..EK---------------------------
Q83DT2_COXBU/99-179-----------------------------------------------GL..EQ---------------------------
Q6FCG7_ACIAD/179-267-----------------------------------------------SL..RA---------------------------
Q6N5Q8_RHOPA/187-275-----------------------------------------------LI..RR---------------------------
Q6ATX4_ORYSJ/67-146-----------------------------------------------IA..SA---------------------------
Q7MHW3_VIBVY/361-432-----------------------------------------------......---------------------------
Q7MAB6_WOLSU/88-166-----------------------------------------------SI..MA---------------------------
BAMA_DESVH/301-383-----------------------------------------------LL..SD---------------------------
Q5NEP7_FRATT/96-176-----------------------------------------------SL..LN---------------------------
O67326_AQUAE/290-371-----------------------------------------------RI..RE---------------------------
BAMA_DESVH/131-209-----------------------------------------------KV..TE---------------------------
Q7UK20_RHOBA/180-256-----------------------------------------------RL..LD---------------------------
Q7MXJ3_PORGI/386-461-----------------------------------------------......---------------------------
Q98K30_RHILO/218-292-----------------------------------------------......---------------------------
Q82U03_NITEU/346-420-----------------------------------------------......---------------------------
Q5R0Z1_IDILO/93-173-----------------------------------------------GL..ED---------------------------
Q7MXJ3_PORGI/302-383-----------------------------------------------AV..GN---------------------------
Q88IV7_PSEPK/195-269-----------------------------------------------......---------------------------
Q74AT3_GEOSL/270-348-----------------------------------------------TL..TD---------------------------
Q5NND8_ZYMMO/397-485-----------------------------------------------KL..RQ---------------------------
Q5FPY9_GLUOX/370-443-----------------------------------------------......---------------------------
Q6MAC6_PARUW/256-330-----------------------------------------------......---------------------------
Q73G77_WOLPM/274-352-----------------------------------------------KI..NK---------------------------
Q82U03_NITEU/265-343-----------------------------------------------LI..SD---------------------------
Q8EGG7_SHEON/271-349-----------------------------------------------MY..SK---------------------------
BAMA_BUCAI/175-263-----------------------------------------------HL..KN---------------------------
Q6MKB1_BDEBA/93-170-----------------------------------------------KL..RQ---------------------------
Q65R79_MANSM/88-168-----------------------------------------------GI..QE---------------------------
Q5LSU6_RUEPO/196-284-----------------------------------------------VL..RD---------------------------
Q74AT3_GEOSL/179-267-----------------------------------------------LI..AD---------------------------
Q9A711_CAUCR/345-418-----------------------------------------------......---------------------------
Q7VYC2_BORPE/276-354-----------------------------------------------AI..TN---------------------------
BAMA_HELPY/138-216-----------------------------------------------AL..KT---------------------------
Q7MPD6_VIBVY/100-183-----------------------------------------------SI..RN---------------------------
Q7MXJ3_PORGI/45-119-----------------------------------------------......---------------------------
Q5NZG7_AROAE/267-345-----------------------------------------------AV..AD---------------------------
Q9RXD5_DEIRA/97-179-----------------------------------------------AL..AQ---------------------------
Q8DI03_THEEB/90-161-----------------------------------------------......---------------------------
Q604T9_METCA/298-376-----------------------------------------------GI..SD---------------------------
Q886N5_PSESM/91-171-----------------------------------------------EL..QR---------------------------
Q8EGG7_SHEON/180-268-----------------------------------------------TI..KT---------------------------
Q5F5H0_NEIG1/248-322-----------------------------------------------......---------------------------
Q74AT3_GEOSL/99-176-----------------------------------------------RV..KK---------------------------
Q89KQ1_BRADU/278-357-----------------------------------------------EM..QI---------------------------
Q87SW5_VIBPA/101-182-----------------------------------------------GI..RN---------------------------
A9CJ61_AGRT5/186-274-----------------------------------------------AL..RQ---------------------------
Q8XZI3_RALSO/272-350-----------------------------------------------AI..TD---------------------------
Q6MMX9_BDEBA/201-289-----------------------------------------------IL..RF---------------------------
Q7CWM5_AGRT5/240-314-----------------------------------------------......---------------------------
Q6MMX9_BDEBA/48-119-----------------------------------------------......---------------------------
BAMA_HELPY/394-466-----------------------------------------------......---------------------------
Q5R0Z1_IDILO/267-345-----------------------------------------------MI..SR---------------------------
Q8A1E1_BACTN/46-120-----------------------------------------------......---------------------------
Q5E819_VIBF1/104-185-----------------------------------------------TL..QN---------------------------
Q5LSU6_RUEPO/369-442-----------------------------------------------......---------------------------
Q5R0Z1_IDILO/348-422-----------------------------------------------......---------------------------
TAMA_ECOLI/189-263-----------------------------------------------......---------------------------
Q7NVY6_CHRVO/267-345-----------------------------------------------AL..SD---------------------------
Q6MAE9_PARUW/309-387-----------------------------------------------TL..TD---------------------------
Q92LN9_RHIME/217-291-----------------------------------------------......---------------------------
O51735_BORBU/103-180-----------------------------------------------KL..EE---------------------------
Q7UK20_RHOBA/97-179-----------------------------------------------RLNDMG---------------------------
A9CJ61_AGRT5/359-432-----------------------------------------------......---------------------------
Q82U03_NITEU/174-262-----------------------------------------------TL..RS---------------------------
Q9SRL6_ARATH/77-155-----------------------------------------------VA..NS---------------------------
Q7VRD8_BLOFL/101-181-----------------------------------------------DI..QD---------------------------
Q6MMX9_BDEBA/292-370-----------------------------------------------EL..TA---------------------------
Q8KFQ6_CHLTE/392-467-----------------------------------------------......---------------------------
Q6LN32_PHOPR/175-263-----------------------------------------------IL..RS---------------------------
Q604T9_METCA/207-295-----------------------------------------------RL..RS---------------------------
Q8KC70_CHLTE/372-447-----------------------------------------------KL..IR---------------------------
Q6ARL5_DESPS/20-91-----------------------------------------------......---------------------------
Q7VRD8_BLOFL/184-272-----------------------------------------------SL..RV---------------------------
Q5FPY9_GLUOX/197-285-----------------------------------------------LL..RR---------------------------
O66463_AQUAE/72-149-----------------------------------------------IL..EK---------------------------
Q73JH4_TREDE/358-431-----------------------------------------------......---------------------------
Q7UK20_RHOBA/349-427-----------------------------------------------EI..VY---------------------------
BAMA_BUCAI/266-344-----------------------------------------------KI..TR---------------------------
Q7P0N3_CHRVO/181-255-----------------------------------------------......---------------------------
Q7NVY6_CHRVO/348-422-----------------------------------------------......---------------------------
Q6MKB1_BDEBA/419-500-----------------------------------------------RL..KN---------------------------
Q8DI03_THEEB/242-318-----------------------------------------------......---------------------------
Q7VAN9_PROMA/238-314-----------------------------------------------KL..KD---------------------------
Q7MAB6_WOLSU/344-416-----------------------------------------------......---------------------------
O66463_AQUAE/152-225-----------------------------------------------NL..EN---------------------------
Q7MYW2_PHOLL/190-266-----------------------------------------------......---------------------------
Q6MKB1_BDEBA/503-577-----------------------------------------------......---------------------------
Q7MXJ3_PORGI/120-199-----------------------------------------------IV..QK---------------------------
Q5NND8_ZYMMO/317-394-----------------------------------------------RI..IE---------------------------
Q8EF72_SHEON/112-195-----------------------------------------------QL..VT---------------------------
Q6N5Q8_RHOPA/107-184-----------------------------------------------RI..AE---------------------------
Q5NEP7_FRATT/273-351-----------------------------------------------GI..KT---------------------------
Q7U8Q8_SYNPX/217-301-----------------------------------------------......---------------------------
Q886N5_PSESM/346-420-----------------------------------------------......---------------------------
Q6ARL5_DESPS/262-340-----------------------------------------------NI..TD---------------------------
BAMA_DESVH/212-298-----------------------------------------------AI..TA---------------------------
O84244_CHLTR/104-182-----------------------------------------------AL..RT---------------------------
Q5SKT2_THET8/83-163-----------------------------------------------AL..AR---------------------------
Q92Q48_RHIME/278-357-----------------------------------------------EI..SK---------------------------
Q83DT2_COXBU/182-270-----------------------------------------------QL..SE---------------------------
O84244_CHLTR/356-435-----------------------------------------------......---------------------------
Q98MC3_RHILO/278-357-----------------------------------------------AL..TE---------------------------
Q7VYC2_BORPE/185-273-----------------------------------------------RL..RS---------------------------
Q7NVY6_CHRVO/93-173-----------------------------------------------EL..KR---------------------------
Q7VHH5_HELHP/87-166-----------------------------------------------VI..RT---------------------------
Q89NX1_BRADU/148-225-----------------------------------------------RI..AE---------------------------
A9CJ61_AGRT5/277-356-----------------------------------------------AI..SK---------------------------
Q7NVY6_CHRVO/176-264-----------------------------------------------KL..KA---------------------------
Q6FCG7_ACIAD/351-425-----------------------------------------------......---------------------------
Q6ARL5_DESPS/173-259-----------------------------------------------RL..LA---------------------------
Q8A1E1_BACTN/203-291-----------------------------------------------LI..ID---------------------------
Q8XZI3_RALSO/181-269-----------------------------------------------AL..RS---------------------------
Q8D2H0_WIGBR/178-266-----------------------------------------------IL..KN---------------------------
O67326_AQUAE/203-287-----------------------------------------------KI..EE---------------------------
Q7VHH5_HELHP/262-341-----------------------------------------------SI..RQ---------------------------
Q9A711_CAUCR/263-342-----------------------------------------------AL..TF---------------------------
Q9WYS9_THEMA/270-342-----------------------------------------------RL..VD---------------------------
Q5E3E7_VIBF1/347-421-----------------------------------------------......---------------------------
Q8I576_PLAF7/116-193-----------------------------------------------II..NN---------------------------
Q87ME5_VIBPA/266-344-----------------------------------------------GI..KR---------------------------
BAMA_BUCAI/92-172-----------------------------------------------TI..KD---------------------------
Q83DT2_COXBU/354-428-----------------------------------------------......---------------------------
Q9A711_CAUCR/172-260-----------------------------------------------QL..RK---------------------------
Q7MAB6_WOLSU/169-259-----------------------------------------------RM..KD---------------------------
BAMA_HELPY/219-309-----------------------------------------------RI..QD---------------------------
Q6N5Q8_RHOPA/278-357-----------------------------------------------EM..QI---------------------------
Q83DT2_COXBU/273-351-----------------------------------------------AI..GD---------------------------
Q6N5Q8_RHOPA/360-433-----------------------------------------------......---------------------------
Q5E3E7_VIBF1/266-344-----------------------------------------------NI..KR---------------------------
Q6FCG7_ACIAD/96-176-----------------------------------------------EL..EQ---------------------------
Q82VX0_NITEU/204-278-----------------------------------------------AF..QA---------------------------
Q5E3E7_VIBF1/175-263-----------------------------------------------AL..RS---------------------------
Q5LSU6_RUEPO/116-193-----------------------------------------------TI..AE---------------------------
Q8KFQ6_CHLTE/57-131-----------------------------------------------YL....---------------------------
Q8A1E1_BACTN/121-200-----------------------------------------------LI..KR---------------------------
Q5SKT2_THET8/164-238-----------------------------------------------AI..AK---------------------------
Q9RXD5_DEIRA/180-256-----------------------------------------------AL..QA---------------------------
Q7UK20_RHOBA/259-346-----------------------------------------------VL..AS---------------------------
O67326_AQUAE/18-90-----------------------------------------------......---------------------------
O51735_BORBU/277-353-----------------------------------------------KI..KE---------------------------
Q8EF72_SHEON/198-271-----------------------------------------------......---------------------------
Q73JH4_TREDE/277-355-----------------------------------------------DV..AN---------------------------
Q9RXD5_DEIRA/329-402-----------------------------------------------AL..RN---------------------------
Q82U03_NITEU/91-171-----------------------------------------------EL..KR---------------------------
Q886N5_PSESM/174-262-----------------------------------------------RL..RS---------------------------
BAMA_BUCAI/347-421-----------------------------------------------LG..KK---------------------------
Q5NZG7_AROAE/93-173-----------------------------------------------EL..KR---------------------------
Q65R79_MANSM/260-339-----------------------------------------------QI..KA---------------------------
Q886N5_PSESM/265-343-----------------------------------------------LI..TR---------------------------
Q7V0C8_PROMP/253-325-----------------------------------------------......---------------------------
Q8EJN5_SHEON/337-408-----------------------------------------------......---------------------------
Q74AT3_GEOSL/351-424-----------------------------------------------......---------------------------
Q8D2H0_WIGBR/348-422-----------------------------------------------......---------------------------
Q5NEP7_FRATT/179-270-----------------------------------------------GL..TN---------------------------
Q8KBW3_CHLTE/43-133-----------------------------------------------LI..RK---------------------------
BAMA_DESVH/386-459-----------------------------------------------......---------------------------
Q6LN32_PHOPR/266-344-----------------------------------------------AV..KR---------------------------
Q7VYC2_BORPE/102-182-----------------------------------------------EL..KE---------------------------
Q6ARL5_DESPS/343-416-----------------------------------------------......---------------------------
Q604T9_METCA/379-453-----------------------------------------------......---------------------------
Q6LMH9_PHOPR/358-429-----------------------------------------------......---------------------------
Q92Q48_RHIME/187-275-----------------------------------------------LL..RQ---------------------------
Q9HXY4_PSEAE/265-343-----------------------------------------------LI..TR---------------------------
Q5NND8_ZYMMO/488-566-----------------------------------------------TL..TE---------------------------
Q6MAE9_PARUW/137-215-----------------------------------------------KL..KA---------------------------
P73472_SYNY3/425-496-----------------------------------------------......---------------------------
Q5NZG7_AROAE/176-264-----------------------------------------------NL..RS---------------------------
Q65R79_MANSM/342-416-----------------------------------------------......---------------------------
BAMA_DESVH/59-130-----------------------------------------------......---------------------------
Q881Y2_PSESM/187-261-----------------------------------------------......---------------------------
Q74AT3_GEOSL/27-98-----------------------------------------------......---------------------------
Q5NND8_ZYMMO/569-643-----------------------------------------------......---------------------------
O51735_BORBU/183-274-----------------------------------------------QL..ES---------------------------
Q7VYC2_BORPE/357-431-----------------------------------------------......---------------------------
Q6MMX9_BDEBA/373-447-----------------------------------------------......---------------------------
BAMA_PHOLL/266-344-----------------------------------------------DI..KN---------------------------
Q9A711_CAUCR/92-169-----------------------------------------------RI..IE---------------------------
Q9KPW0_VIBCH/266-344-----------------------------------------------SV..KK---------------------------
Q7VHH5_HELHP/169-259-----------------------------------------------RI..QD---------------------------
Q8YUR6_NOSS1/395-466-----------------------------------------------......---------------------------
A9CJ61_AGRT5/106-183-----------------------------------------------RI..KE---------------------------
Q7VRD8_BLOFL/356-430-----------------------------------------------VLQDQE---------------------------
Q7MAB6_WOLSU/262-341-----------------------------------------------SM..KE---------------------------
B9KGV5_ANAMF/358-430-----------------------------------------------......---------------------------
C4YX56_9RICK/266-342-----------------------------------------------KI..GE---------------------------
G1UBA5_HAEDU/89-168-----------------------------------------------AL..VD---------------------------
O83346_TREPA/202-289-----------------------------------------------AV..HS---------------------------
BAMA_ECOLI/176-263-----------------------------------------------TL..RS---------------------------
BAMA_HAEIN/175-259-----------------------------------------------SI..RD---------------------------
Q2YPP8_BRUA2/234-307-----------------------------------------------......---------------------------
Q2YRQ2_BRUA2/108-184-----------------------------------------------AI..KA---------------------------
Q2YRQ2_BRUA2/278-357-----------------------------------------------SV..TE---------------------------
Q31PR1_SYNE7/195-269-----------------------------------------------TL..NT---------------------------
Q5ZY66_LEGPH/369-442-----------------------------------------------......---------------------------
Q63T20_BURPS/183-270-----------------------------------------------NV..RS---------------------------
Q63W94_BURPS/223-295-----------------------------------------------......---------------------------
Q6G5C3_BARHE/361-432-----------------------------------------------......---------------------------
Q8F3T2_LEPIN/54-124-----------------------------------------------......---------------------------
Q8PAW1_XANCP/129-208-----------------------------------------------EL..TR---------------------------
Q8RHT4_FUSNN/101-171-----------------------------------------------......---------------------------
BAMA_YERPE/267-344-----------------------------------------------DI..KK---------------------------
Q9CJL1_PASMU/262-340-----------------------------------------------RI..KS---------------------------
Q9CJL1_PASMU/89-168-----------------------------------------------GI..VE---------------------------
Q9FFG3_ARATH/74-151-----------------------------------------------VA..NF---------------------------
BAMA_NEIMB/267-343-----------------------------------------------EI..QN---------------------------
Q9PEI2_XYLFA/272-347-----------------------------------------------AI..IN---------------------------
Q9ZE03_RICPR/176-263-----------------------------------------------LL..RE---------------------------

PF08479

Q8XQ41_RALSO/70-145-----------------------------------------------RI--TR---------------------------
Q8RI18_FUSNN/32-109-----------------------------------------------DL--TN---------------------------
Q7NU30_CHRVO/77-152-----------------------------------------------AL--TN---------------------------
Q7N2L1_PHOLL/77-152-----------------------------------------------KV--SN---------------------------
Q7N9T5_PHOLL/77-152-----------------------------------------------QT--TN---------------------------
Q6G3U5_BARHE/90-166-----------------------------------------------QL--TK---------------------------
Q88MW8_PSEPK/83-158-----------------------------------------------AI--TQ---------------------------
Q7N107_PHOLL/69-145-----------------------------------------------QL--QD---------------------------
Q605Q3_METCA/48-123-----------------------------------------------AL--EK---------------------------
Q9JY36_NEIMB/87-166-----------------------------------------------LA--QN---------------------------
Q8YM25_NOSS1/96-171-----------------------------------------------AI--TK---------------------------
Q7N1B0_PHOLL/77-152-----------------------------------------------KV--SN---------------------------
Q89H68_BRADU/98-173-----------------------------------------------AI--SD---------------------------
Q9HVN7_PSEAE/59-134-----------------------------------------------RI--GD---------------------------
Q8XQZ3_RALSO/84-163-----------------------------------------------RV--QN---------------------------
Q880E0_PSESM/77-152-----------------------------------------------TI--TD---------------------------
Q8XYH9_RALSO/79-151-----------------------------------------------QV--NN---------------------------
Q8DLP0_THEEB/81-156-----------------------------------------------AI--TK---------------------------
Q8XQX3_RALSO/69-144-----------------------------------------------EV--TK---------------------------
Q7MRX6_WOLSU/59-134-----------------------------------------------QL--TG---------------------------
Q9I792_PSEAE/71-146-----------------------------------------------AV--TD---------------------------
Q8XPV1_RALSO/81-156-----------------------------------------------RL--TE---------------------------
Q7VLT7_HAEDU/59-128-----------------------------------------------DI--TQ---------------------------
Q7NWR3_CHRVO/87-160-----------------------------------------------AL--TA---------------------------
Q6FDM4_ACIAD/101-180-----------------------------------------------LV--QN---------------------------
Q63JI8_BURPS/74-148-----------------------------------------------DL--MN---------------------------
Q9AAJ4_CAUCR/8-83-----------------------------------------------NA--EA---------------------------
Q63TR3_BURPS/65-140-----------------------------------------------GV--TK---------------------------
Q89Q77_BRADU/73-148-----------------------------------------------DI--NA---------------------------
Q9HVG7_PSEAE/71-146-----------------------------------------------RL--TA---------------------------
Q6DA64_PECAS/107-183-----------------------------------------------AL--QN---------------------------
Q8RGK0_FUSNN/41-115-----------------------------------------------EL--EN---------------------------
Q9PAG8_XYLFA/106-185-----------------------------------------------RV--QN---------------------------
Q74E11_GEOSL/79-154-----------------------------------------------RI--ND---------------------------
Q8YWF4_NOSS1/18-93-----------------------------------------------DI--TE---------------------------
Q7N910_PHOLL/78-154-----------------------------------------------RI--QN---------------------------
IBPB_HISS2/99-172-----------------------------------------------EL--TQ---------------------------
Q88QC1_PSEPK/91-166-----------------------------------------------RL--TQ---------------------------
Q7NY08_CHRVO/92-167-----------------------------------------------RI--TH---------------------------
Q9I5N4_PSEAE/47-122-----------------------------------------------AL--QA---------------------------
B4F0Z8_PROMH/77-150-----------------------------------------------EL--TQ---------------------------
C5BBG6_EDWI9/81-153-----------------------------------------------QL--TA---------------------------
D3VFR1_XENNA/80-152-----------------------------------------------EI--TN---------------------------
FHAC_BORPE/92-164-----------------------------------------------AL--SA---------------------------
HXUB1_HAEIN/73-150-----------------------------------------------EI--SE---------------------------
Q0WFB2_YERPE/81-154-----------------------------------------------EV--TR---------------------------
Q6D5C4_PECAS/75-150-----------------------------------------------DV--SN---------------------------
Q74QU0_YERPE/90-165-----------------------------------------------NL--QQ---------------------------
Q7CJ53_YERPE/77-153-----------------------------------------------QL--QN---------------------------
Q7N9K7_PHOLL/79-152-----------------------------------------------EL--TH---------------------------
Q7VX34_BORPE/76-148-----------------------------------------------RI--TE---------------------------

PF08478

FTSQ_VIBF1/50-120-----------------------------------------------ALLS.L---------------------------
FTSQ_SHEON/52-121-----------------------------------------------ALEA.L---------------------------
DIVIB_BACSU/54-123-----------------------------------------------KIQQ.N---------------------------
FTSQ_RHIME/89-157-----------------------------------------------LIGE.L---------------------------
Q5P6Z9_AROAE/37-106-----------------------------------------------VFEK.L---------------------------
O83403_TREPA/55-123-----------------------------------------------RLAS.V---------------------------
DIVIB_CLOTE/54-122-----------------------------------------------NIMS.N---------------------------
FTSQ_ECOLI/55-126-----------------------------------------------QIEQRL---------------------------
Q8D2Z8_WIGBR/41-111-----------------------------------------------QIEK.M---------------------------
Q83N06_TROWT/56-124-----------------------------------------------KLAK.F---------------------------
Q8E185_STRA5/122-193-----------------------------------------------RLAAED---------------------------
Q5SJC7_THET8/24-91-----------------------------------------------LLE..N---------------------------
Q5R0N0_IDILO/43-112-----------------------------------------------RVEQ.L---------------------------
Q6F706_ACIAD/59-128-----------------------------------------------KALE.I---------------------------
Q728V1_DESVH/71-139-----------------------------------------------RLAS.S---------------------------
FTSQ_HAEIN/54-124-----------------------------------------------QIEA.L---------------------------
DIVIB_STRR6/153-223-----------------------------------------------QIKS.N---------------------------
Q9CPA8_PASMU/55-125-----------------------------------------------QIET.M---------------------------
Q7MNU9_VIBVY/53-123-----------------------------------------------SVEA.L---------------------------
Q73IQ7_WOLPM/61-128-----------------------------------------------NIQSVS---------------------------
Q7NQ02_CHRVO/37-106-----------------------------------------------AFGK.L---------------------------
Q5YYX7_NOCFA/42-110-----------------------------------------------RV.AAL---------------------------
Q8DVE1_STRMU/126-197-----------------------------------------------NLKSKD---------------------------
Q82AD6_STRAW/56-125-----------------------------------------------RLRQKL---------------------------
Q8YQH2_NOSS1/56-126-----------------------------------------------SLKK.Q---------------------------
Q98KB7_RHILO/92-160-----------------------------------------------RISG.L---------------------------
FTSQ_COXBU/46-115-----------------------------------------------ALMS.L---------------------------
Q5HQ08_STAEQ/219-287-----------------------------------------------NLKQ.N---------------------------
Q8DMI0_THEEB/61-130-----------------------------------------------VLETTL---------------------------
Q87WY8_PSESM/73-142-----------------------------------------------ELEQ.M---------------------------
Q5FUJ1_GLUOX/84-152-----------------------------------------------RLDE.L---------------------------
DIVIB_GEOKA/50-118-----------------------------------------------KLTR.H---------------------------
Q7V8M1_PROMM/59-128-----------------------------------------------TLLRKL---------------------------
DIVIB_LACLA/153-224-----------------------------------------------TIEQKF---------------------------
Q65RZ0_MANSM/55-125-----------------------------------------------QIES.M---------------------------
Q6AE66_LEIXX/96-164-----------------------------------------------DLAA.F---------------------------
P73457_SYNY3/54-123-----------------------------------------------ELAK.N---------------------------
Q73NF1_TREDE/62-130-----------------------------------------------KLVS.Y---------------------------
Q6AJ56_DESPS/51-120-----------------------------------------------RLED.L---------------------------
Q9RWN7_DEIRA/101-171-----------------------------------------------KGLLTS---------------------------
Q604W1_METCA/56-127-----------------------------------------------AVTT.I---------------------------
Q6NGD0_CORDI/29-97-----------------------------------------------SVTQ.L---------------------------
Q7VMY3_HAEDU/61-131-----------------------------------------------KLLE.M---------------------------
Q8CXI4_OCEIH/50-118-----------------------------------------------AIAK.D---------------------------
Q5WFH0_BACSK/51-119-----------------------------------------------AITS.L---------------------------
Q7U5Q7_SYNPX/51-120-----------------------------------------------TLRENL---------------------------
FTSQ_BLOFL/45-115-----------------------------------------------QIKQ.M---------------------------
FTSQ_VIBCH/52-122-----------------------------------------------SVQS.I---------------------------
Q6N416_RHOPA/110-178-----------------------------------------------KLKA.N---------------------------
FTSQ_NEIG1/37-106-----------------------------------------------AYRR.Y---------------------------
Q67Q43_SYMTH/58-125-----------------------------------------------RLLA.D---------------------------
FTSQ_GEOSL/67-135-----------------------------------------------QLAK.N---------------------------
Q9CCE5_MYCLE/151-219-----------------------------------------------QV.AAI---------------------------
FTSQ_CORGL/30-98-----------------------------------------------NIVE.L---------------------------
Q8R9G8_THETN/29-97-----------------------------------------------NLLE.N---------------------------
Q8XJA3_CLOPE/42-109-----------------------------------------------KILS.N---------------------------
Q7NNV9_GLOVI/69-138-----------------------------------------------RLLEAL---------------------------
Q6A9Q0_PROAC/48-116-----------------------------------------------RVTR.M---------------------------
Q5FKV1_LACAC/77-148-----------------------------------------------KLSRKY---------------------------
Q8FNU2_COREF/30-98-----------------------------------------------AIAE.M---------------------------
DIVIB_CLOAB/41-109-----------------------------------------------NIMQ.D---------------------------
Q6LMF8_PHOPR/51-121-----------------------------------------------ALEA.L---------------------------
Q9K9T2_BACHD/50-118-----------------------------------------------NVES.L---------------------------
FTSQ_CAUCR/94-162-----------------------------------------------RVQG.V---------------------------
B1W0J1_STRGG/62-130-----------------------------------------------RLRQKL---------------------------
B9KHS4_ANAMF/69-137-----------------------------------------------RIKSHS---------------------------
FTSQ_ZYMMO/97-165-----------------------------------------------RLLR.F---------------------------
D4ZDU0_SHEVD/36-105-----------------------------------------------ALEA.L---------------------------
G3XCS0_PROMA/62-129-----------------------------------------------NLQKNL---------------------------
G8AFN1_AZOBR/99-167-----------------------------------------------KLES.L---------------------------
H7C7L9_BORBU/34-101-----------------------------------------------NLKK.D---------------------------
I6T797_ENTHA/66-137-----------------------------------------------TLKKEQ---------------------------
FTSQ_MYCTU/125-192-----------------------------------------------RVAT.I---------------------------
DIVIB_STAA8/195-262-----------------------------------------------DLEE.N---------------------------
Q2YLY9_BRUA2/68-136-----------------------------------------------SIDK.L---------------------------
Q5M4Y0_STRT2/105-175-----------------------------------------------TVEKTN---------------------------
Q5ZSA8_LEGPH/39-107-----------------------------------------------ELNS.M---------------------------
FTSQ_BURPS/37-106-----------------------------------------------AFEQ.M---------------------------
Q65JX8_BACLD/54-123-----------------------------------------------KIEQ.N---------------------------
DIVIB_BACAN/53-121-----------------------------------------------NLTK.R---------------------------
DIVIB_ENTFA/126-197-----------------------------------------------NIQKKF---------------------------
Q8F8E7_LEPIN/47-113-----------------------------------------------KLSR.L---------------------------
DIVIB_LISMO/51-118-----------------------------------------------ALKK.N---------------------------
Q99YV5_STRP1/126-195-----------------------------------------------PILRTI---------------------------
Q9PF78_XYLFA/35-103-----------------------------------------------AIER.L---------------------------
FTSQ_RICPR/73-141-----------------------------------------------NLKK.S---------------------------
S5VEM4_STRCU/60-128-----------------------------------------------RLRRKL---------------------------

PF06898

F6B8F3_DESCC/8-408AKGMVRARVWYEGYGECSLSETREKFS..GQQKTSVRIKFGSK....EIIISG..PKDSPYQHF....EVKQIVKALPKW
D4JTF7_9FIRM/10-387ADGLLKAQCEQTEEFFLPFEQTRSMKT..DEKYYSTYLMFGSF....ALPLPWEHYEAENMDGF....TYSEDTYNVSIL
R5L248_9CLOT/7-384AHGSVIAKTNSRITVNIPREQSEKICT...SEKQYKTLYFFGL....EIPLSIKKEEENTVCEY.........QKKYIVF
R7QWQ5_9FIRM/7-391SDADITGVTTYPYEDSFPLAYEKKVPT..GDVKKQYAISAFGY....YLFIPS...LSHGYEHA....EKYTSEYQIHIC
L0FBK0_DESDL/7-397AKGFVRGRVWYSAEATVPYQEELIEES..GKVAKGWGIKFGTR....VIMVTI...PESPYPLV....NEEVQYHGVDLW
R6I0K6_9FIRM/6-384SMAQVIADTWYEISAQTPLLEERKTEK..SGRNTAFSLVIGKK....RINFFS..DSRNKCDSC....DKINKLKYISLG
L0EFM5_THECK/10-388AEGTVRGLVWHEYDITSPLVRKAKTYT..GERRTVWHAVLGDR....SLKVSG..FGEPPFAKY.....ESVLRQENAAW
U5MNL2_CLOSA/5-371PSGTVIANTFYEKFMEIQISGDKLERT..GKKDGDIYLNIFGK....KIYLKK...AINRFESY....DKIEEKNG....
R6SYS4_9FIRM/4-378SKGKILGTFERTVTFTQPFEDKTEKTT..GKRDTKRFFTVFDA....DIPLFF.....SKPEGY....WKNEQRYSPLSL
R7F0N3_9BACI/3-369AKGRVLGEVWYEAHIEVPFHYYEEKET..GKIQMVLTLQFLNH....TIHLGL........SSY.....DTASREDIFKI
R7P4H2_9CLOT/3-367AKADIYITTWYTVSISFPMEKDIDTKT..NKKRYNLTYEINDN....KHNIFK.....NRLNNY......TREYKKILDI
Q0AWN4_SYNWW/7-394ARGRVKARVWYQGYGECRLRTEKMLLS..GKESSEIKLEIGGK....TIPLKKAKTKDYDFSIC....EIKQKE......
I0JP38_HALH3/8-385AEGEVIAETWYKVDQNLPMTQVLQLTD..GLEVREYQLKIGSL....TLPIWG..WWKGKGSQF.....RSENEETNWEW
R7H622_9FIRM/5-371ASGSVIGEYQETQTFFCSYAQSIRTKT..GRCKENQSLNFFSC....SIPIGK...EQNPYTDY.....NCQVTENFFSL
B2A1M5_NATTJ/8-399ARGIVKGRVHYKGYSEKGLTEVKKERT..GDKFTRYGLYFNGE....TRYLDL...KEIPYVEY....DKKKTMRKL...
A5N6N1_CLOK5/11-376AGGYVICRTLYEDTETVNINSIKKQRT..GKKIQNYYIRLGGK....KLYFKK...NDNKFNNY....DKIEESKF....
C8W3N7_DESAS/8-411AKGTVRARVWYESSAEAAIIEQGQKAT..GKTVSRFGIKIGAK....EIILMG..KQKIPFKQY....KVSSRVKKLPSW
R6MSI1_9FIRM/8-382ASAEIMADVIYKKEYTLPKSYDYYSIT..DNRTDRYMCGFLNF....KFPCSI......SFLSY..DDSVFVKNKEKLYF
C3AQR5_BACMY/11-389AKGIVYGETWYESEVTVPLKTTFQVYT..GNSYNEHYLRLGSV....KIKIWG..FQHDKYKRS.....RTENVKHDVKL
B8CXJ2_HALOH/7-376ARGIVRAYVWYEAEGKVPVNYKEVKYT..GKSKTIYRLKFGEY....GLSIPW...NKPDWKSY....RIRKEIKSLPEW
W6RVC1_9CLOT/10-376PKGVVMAKTFYEDKIIVPYKEKNREKT..GKYITNKYIIIAGN....KICVKK...SENKFEKY....DKIEENYG....
D4LTE1_9FIRM/6-388ADADIYIKRKKAYYREIPLEYQAEEYD..GKERKNYFFKTGNI....YLELGG.....SAENNW....QNTMEEEILRLT
K0B1J4_CLOA9/8-387ADGKVIGLTTRSEIVKEPLMKNIKEET..GKIHISREVKINGK....SLEFMN...GDIPFKNY....VEKKEIKRPLKN
R5NSB5_9CLOT/8-384SNGEVLGKVRYEQNEKIYKKEKKKVRT..GKKERKYALKFNNF....KINFYK...KLSKFEKY....DTIYSSKKIELF
R5HMY8_9FIRM/8-391AEGKVLAQTWHTLTAQISLKAQVKTYT..GEEIRHYSLSLMGK....RVKFYQ..NSGIPYENY....DTISEQRAWTPI
C0ZB79_BREBN/7-385ARGKVQGEVWYISNTSVPLKQALHRLT..GEKLQHQYLLVGPY....AVYVWP..FEKQSFAQA.....EMAEQRFLPSY
R6XDX7_9CLOT/8-386ATGSVQGKVWYTQKERIYFKQQKKEQT..GNVENKYSLNINNF....KINFNK...GVSKFKNY....DTIETNKKVKLF
A8MG63_ALKOO/8-387SYGEVFAKTYYEGMESKNLIEIKKEKT..GKTFKRRMFKFGNL....ELSINN...AEIPYNTY....ILEKESKKPFQW
J7J0E9_DESMD/7-385ARGFVRARVWYSAEGQIPLVEDKVEES..GRVAKGRGIKIGSR....VIMLTA...QSSPFEQS....REEVITQSIKLW
B8I730_CLOCE/8-390SMGAVKARTWYEASNQVEQTLVKTRRT..GLEKERYSVIFFTK....KINLFH...RKITYNNI....EHIEYKKKLSIG
Q97JI9_CLOAB/7-373ADGSIIAKTFNENIAKVMLTTHIRKRT..GKKVQNYYVRIGNK....KFYLKK...SENKFNKY....DKIVDDKC....
R5T3J2_9CLOT/7-380ASGTVYGEVWYEVEATHPYIYKEESAT..GKKKEVYVIKFLNK....RFSIFD.......FNHF.....DTFKYSEKVIL
R6C1Q2_9CLOT/6-386ADADIVISRKENIYETLSFVREKKVYT..GREKKKYVFRFFGK....EILLGK....EGGFPYY....TMVEETKDVSII
K4LIU5_9FIRM/7-395AKGFVRARVWYSADKIIPLEEDRTEKT..ANRTNGWGIKINNR....VIMIMN...QDSPYSDS....IQETCTYALPDW
R6UCV3_9CLOT/10-387AKGYARVDNIYTFEKEYMYKVCNKEYT..NKKRTTFGITINSKEN..MINYLN......KLKKY....DITKNSKEFEIF
R6N4A7_9CLOT/7-383ASGKVIARTRRQLSVEVPLTQTVQVPT..EETVVRKKLELFGL....ELPLTL...NPEPGEEY.....EAEEEKEQVRL
I3VX08_THESW/8-382SMGTILARVWYEGYADVNLVQQKYKRT..GRKITMTKISMGSS....TLTLSS...RKIDFKNY.........DREVRNL
B0TAE5_HELMI/7-400ARGEAWAKVSYDQWIEEPVVLEGTVPT..GAVSEQWRIKWGNK....EIIIKG..PPSNPYPVG....VEEVSLRTPSLW
R5TPA1_9CLOT/8-390SDADITARTEYHITRQIPLFKRVDVET..GNVRRGKYAKVFQY....SLMLMR...PKQEGTTW....KVTMEEDQLHLF
R5QI90_9FIRM/5-375ARGSVYGRTTLEYDVKIPVRYRQKLRS..NTVLGEKSIIFFGK....SIKVFK..NDRISAEFY.....DIIERKTRVTL
R5KWN8_9CLOT/12-386AKGIVKINSEYTFKKEYNYDEIIKSKN..GVVKYTIGVSINSKEN..MLNYLN......KGKKY....DITKSSKAINLF
N0B454_9BACI/7-385SKGEIMGETWFKSSVELPLNSTFQVFN..GNEKRKYFIKVGNV....SIPIWG..YGKTRFSEY.....ETDLTNHRIRF
F8I923_SULAT/7-394AEGEVWARVRYQATVLQPWQRTLTVFS..GRRAVRRMWVIDG.....QYVVTLPNAETPPFQHF....QIVRHVANWR.W
D3E517_GEOS4/9-385AKGEVRGLVWHEYDIEIPLVKTHKVYT..GEGKKRSYIVFGDR....AVQLWG..YGEIPYSQQ.....ETLTFYDPLTW
R6H3U2_9CLOT/8-388ARGEIQAKVWYEKSKKICYNTTERRKT..DNLENKYAIKINNF....EINLSK...KLPKFEIY....DTITEEKKIKLF
R7F7B5_9CLOT/8-387ATGEIEAVVWYTEKATVSFKETKVEKT..GKMEKKYAININNF....RINLYK...RLSNFEKY....DTIYATKKLKLF
R7M7L8_9CLOT/8-385ANGEVQAKVWYSEKVKEPLKQTKEIQT..GMEESKYSVKINNF....EINLSK...GVPKFQNY....DTIETSKKLKLF
R6TJX8_9FIRM/7-385GRGSVTARTWYTLTTRMPLAAETKSYT..GRKKTGWSLIFGTH....RVKFYG..NSSIEGAEY....DKITTRYPWTLL
Q67S30_SYMTH/7-404AQAAVKARVAYRQYYEYPAVEQVKEPT..GRRHVQWVLNWNGR....SIILRG..RGPVPFAEY....EVTTRTLAPGQW
R5F5D4_9CLOT/9-390ADADIVARTVKQYEKTFPLLHQERVHT..GRRRRGWYMKAGAW....SFTFLT...PVRGQGEW....DYSMEEKQLRLF
R5Q8Y0_9CLOT/8-386AEGEVTAKVWYSQKEKIMLNQVIERNT..ENVENKYKLKINNF....SINFFK...TLSKFEKY....DTIETSKKLKIF
R6M0R0_9CLOT/7-380ARGKVIGEVWYIIDINYPYYHHEVKYT..GNKKKVLVFNFINK....RISLFD.......FKKY.....KTFDKNIKSIF
R5YC97_9FIRM/7-392ADADVIGKVTYDYEDWIPQTRILSKST..GRTHTRYCVRMLNR....QVITPD...LYAAFSDS....ESIEDMQQLCLM
Q8RB55_THETN/13-387ADGEVLARTWYEISVEEELKRTRWVKT..GEKIVATKIIIGSN....TITFTS...RKIEFEKF.........KKEEKNL
F4LSY6_TEPAE/8-387AKGIVNARVWYQKAVKVPLVKTKMIPT..GNSKKSLVLQLGKH....ILNFQL...GDIAYDYY..........NKKTIN
R6LHZ6_9FIRM/6-383ALAEIYAKTWHRACTVLPETAERKQYT..GTQSRCVSLVLGRK....RWTLFG......DSGFFTGNGDKMKITHTLTLP
A4XKI6_CALS8/4-376AIAEIVATTFYSVSRDFSLPAYQKVYT...SQKKVPFIVIGKHEFIPKIVVTN...............NENCDKIKIREY
R5T032_9CLOT/3-372ADGFVYAEVWYKTDVNMPYYYREEKLT..GKSKTRLKFQFFNK....KICILC.......FNKY.....KTYKESETLLF
R5B397_9CLOT/7-382ARGAVSANVIYVVSAKAGPTIEKLSLS..GTGAYYNAVKLFGI....CIADEP......EYASY......TDETVCEYEL
R7DBV9_9FIRM/6-388ADADIYIKRQKAYYHEIPMIYETYEWT..GKKKKGIYLKAGRF....YLEIAD.....RTKNGW....YQIAEEQKMYLT
R7FM48_9CLOT/8-386AKGEIQAKVWHTKNKKILYNATEKTET..GNIENKYQIKINNF....EINLSK...RLSKFKIY....DTIVLENKFKIF
B1I691_DESAP/9-398ARGIVNARVWYEAYGESALVEHAQRPT..GREERRVAVRLMGR....QVVVSG..PRKDPFPSF....EASETVWTGPGW
R7IV24_9CLOT/8-386SLGEVEAIVKYSKTEKIPLKTIEKVAT..GKKETKYKLKISNF....RINFYK...TLSKFEIY....DTIETEKKFKIF
SP4_BACMD/7-385AKGKVYGETWYKSEVEVPLKTDFQVLT..GNGYTKHYLDFQAF....KMPLWA..FNKEKYTSK.....VTEKVEH