Sequence alignment for CL0191

PF07244

Q5NND8_ZYMMO/246-316-------------GTIK..SLS-V.V.G.........T..........E.RLEP-----D...TVL....S.YT.....K
Q5NND8_ZYMMO/317-394-------------PIIN..RIV-L.E.G.........N..........K.RLKE-----D...KIR....P.EI.....K
Q5NND8_ZYMMO/397-485-------------SKVR..QIN-I.I.G.........N..........K.HFSD-----A...QLR....K.AM.....A
Q5NND8_ZYMMO/488-566-------------YKFG..DIT-L.D.S.........Q........I.R.DVKA-----E...NFK....S.LV.....K
Q5NND8_ZYMMO/569-643-------------QYIE..RVD-I.S.G.........N..........T.TTRD-----K...VIR....R.EF.....R
BAMA_HELPY/70-137-------------MKVK..SIS-Y.V.G....................L.SYMS-----D...MLA....N.EI....VK
BAMA_HELPY/138-216-------------ARIA..GVE-I.K.G.........Y........G.T.EKEK-----D...GLK....S..Q....MG
BAMA_HELPY/219-309-------------IYIK..QSI-Y.E.G.........S........A.K..LKR-----R...MIE....S..L....SA
BAMA_HELPY/312-391-------------YRIS..DIL-I.EID.........N........P...VVPL-----K...TLE....K..A....LK
BAMA_HELPY/394-466-------------VYIN..DVI-I.S.G.........N..........Q.RTSD-----R...IIR....R.EL....L.
O30912_NEIME/23-90-------------FTIQ..DIR-V.E.G..................L.Q.RTEP-----S...TVF....N.YL.....P
O30912_NEIME/91-171-------------PTIG..SLN-I.T.G.........A........K.M..LQN-----D...AIK....K..N....LE
O30912_NEIME/174-262-------------AKIT..DIE-F.E.G.........N..........Q.VYSD-----R...KLM....R.QM.....S
O30912_NEIME/265-344-------------FRWG..KVS-I.E.G.........D........T.N.EVPK-----A...ELE....K..L....LT
O30912_NEIME/347-421-------------IYVN..EIH-I.T.G.........N..........N.KTRD-----E...VVR....R.EL.....R
O32625_HAEIF/22-89-------------FVAK..DIR-V.D.G.......................VQG-----DLEQQIR....A.SL.....P
O32625_HAEIF/90-170-------------SIIS..DVK-I.K.G.........N........S.I..IPT-----E...ALK....Q..N....LD
O32625_HAEIF/173-259-------------AKLA..SLT-F.K.G.........N..........E.SVSS-----S...TLQ....E.QM.....E
O32625_HAEIF/262-341-------------YDLR..SAR-I.I.G.........N........L...GGMS-----A...ELE....P..L....LS
O32625_HAEIF/344-418-------------LTVH..QLR-F.E.G....................NTVSAD-----S...TLR....Q.EM.....R
O51735_BORBU/30-102-------------KIIK..GIN-F.E.G.........L..........K.NKKE-----R...DFI....N..I....LK
O51735_BORBU/103-180-------------SLVN..SVV-FSD.S.........S........R.V..FWN-----S...ELV....E..K....VN
O51735_BORBU/183-274-------------YVVK..GID-F.E.G.........N........L.S..FKS-----S...TLRKSLAS.RV....VS
O51735_BORBU/277-353-------------FRFG..KLE-I.S.G.........N........S.V..FSL-----E...ELK....S..F....IT
O51735_BORBU/356-429-------------AHIE..SIT-VSK.N....................K.NTAS-----H...VIL....R.EI.....P
O66463_AQUAE/72-149-------------PIIK..EIK-I.K.G.........N........V.F..LRD-----E...DVK....N..V....LG
O66463_AQUAE/152-225-------------YFLE..DIQ-F.E.G..................V.K.KLQK-----K...ELI....K.AS.....G
O67326_AQUAE/18-90-------------AEIE..KII-I.K.G....................N.KYIP-----D...ELI....RGLL.....S
O67326_AQUAE/203-287-------------IYTS..DIE-I.E.G..................N.K.HFSD-----R...KLK....G..L....ME
O67326_AQUAE/290-371-------------YKLK..EIK-I.E.G.........N........T...LFAY-----S...ELV....D..NIL.KKN
O67326_AQUAE/374-446-------------VYVK..KIK-I.K.G.........N..........Y.ETRD-----Y...VIR....R.EM.....R
O68454_TREPL/31-105-------------KPIS..AIS-F.E.G..................L.E.YIAR-----G...QLD....T.IF.....S
O68454_TREPL/106-182-------------PSVK..GIK-M.V.G.........N..........S.QIRS-----G...DLL....S.KI....L.
O68454_TREPL/185-273-------------TVVS..RIQ-F.K.G.........N........K.A..FTE-----S...VLK....K..V....LS
O68454_TREPL/276-354-------------YRYG..GVT-I.V.G.........N........Q.I..FST-----E...ELQ....A..K....IR
O68454_TREPL/357-430-------------SHVE..HII-I.K.G..................T.K.NTKD-----E...VIL....R.EM....L.
O84244_CHLTR/104-182-------------PVIR..EIN-I.S.G.........N..........E.AIPT-----H...KIL....K.TL.....E
O84244_CHLTR/185-272-------------GRIK..KLT-I.S.G.........I........T.R..TEA-----S...DLG....D..I....VL
O84244_CHLTR/275-353-------------YTLG..HVH-I.E.G..................F.T.ALSK-----R...LLD....K.QL....L.
O84244_CHLTR/356-435-------------YKIG..LIK-I.K.G.........N..........T.HTKH-----D...VIL....H.ET.....S
BAMA_SHIFL/24-91-------------FVVK..DIH-F.E.G..................LQRVAVGA-----A...LLS.......M.....P
BAMA_SHIFL/92-172-------------PTIA..SIT-F.S.G.........N........K.S..VKD-----D...MLK....Q..N....LE
BAMA_SHIFL/175-263-------------AEIQ..QIN-I.V.G.........N........H.A..FTT-----D...ELI....S..H....FQ
BAMA_SHIFL/266-344-------------YKLS..GVE-V.S.G.........N........L...AGHS-----A...EIE....Q..L....TK
BAMA_SHIFL/347-421-------------FYVR..KIR-F.E.G.........N..........D.TSKD-----A...VLR....R.EM.....R
YTFM_ECOLI/189-263-------------YRFG..HVT-F.E.G....................S.QIRD-----E...YLQ....N.LV.....P
BAMA_BUCAI/24-91-------------FIVK..DIQ-F.K.G..................L.K.NFSQ-----N...EAL....K.NI.....P
BAMA_BUCAI/92-172-------------PIIS..NVI-V.S.G....................N.HIIA-----S...SVLDPYLK.KL.....N
BAMA_BUCAI/175-263-------------IKIN..SIK-I.L.G.........V........Q.A..FSK-----E...KIL....S..L....FK
BAMA_BUCAI/266-344-------------YKIS..NFF-V.N.G.........N........L...FPYQ-----K...LIT....N..L....IN
BAMA_BUCAI/347-421-------------YFVK..RIY-F.T.G.........N..........E.ITQD-----R...VLR....R.KI.....K
P73472_SYNY3/260-331-------------VLVS..EVL-V.T.G......................TTPE-----L...ELLV..YN.AI.....R
P73472_SYNY3/425-496-------------FDSE..DEP-V.Q.G......................RTRD-----F...IIT....R.EM.....R
Q44629_BRUAO/39-106-------------AVVS..RIE-V.R.G.........N..........T.RVDA-----Q...TIR....D.NI.....D
Q44629_BRUAO/107-184-------------SVVN..NVL-F.Q.G.........N..........K.KIKD-----P...DLA....P.CR.....Q
Q44629_BRUAO/361-434-------------AYIQ..RIE-I.R.G.........N..........D.KTRD-----Y...VIR....R.EF.....D
Q51930_PASMD/21-88-------------FVVK..DIR-V.D.G..................V.Q.AGTE-----G...SVL....A.TL.....P
Q51930_PASMD/89-169-------------PVIS..NVV-I.V.G.........N........K.S..IPD-----E...AIK....Q..N....LD
Q51930_PASMD/172-247-------------ALFK..EIT-F.E.G....................NEAFSS-----G...KLA....D.QM.....E
Q51930_PASMD/341-414-------------YTVR..QIR-F.E.G.........N..........T.SSAD-----S...TLR....Q.EM.....R
Q57CY5_BRUAB/278-357-------------YTFG..DVS-V.E.S.........T........V.D.GVDT-----Q...ALD....R..L....VK
Q57FW8_BRUAB/233-307-------------AYYG..PVS-V.V.G..................T.A.RMDP-----Q...FVA....W.MT.....G
Q5DZL2_VIBF1/357-428-------------AIID..KVE-V.E.N..................R.S.HYES-----D...KLE....R..F....IQ
Q5E2U2_VIBF1/342-414-------------LYVN..KIT-I.KND....................S.LYTE-----S...MLL....D.RL.....N
Q5E3E7_VIBF1/24-91-------------FVID..DIR-F.E.G.................LQRV.ALGA-----A...LLK...TP.........
Q5E3E7_VIBF1/92-172-------------PTIA..NIS-F.S.G.........N........K.A..IKE-----E...QMQ....Q..N....LE
Q5E3E7_VIBF1/175-263-------------AKIQ..QIN-F.I.G.........N........E.V..FTD-----E...QLL....S..R....FN
Q5E3E7_VIBF1/266-344-------------YTVS..GVK-F.Q.G.........E........L...IGKE-----E...EFK....K..L....IP
Q5E3E7_VIBF1/347-421-------------MYVR..DIR-F.V.G.........N..........T.STKD-----E...VLR....R.EM.....R
Q5E819_VIBF1/104-185-------------IYV..SDIV-I.S.G..................E.A.AADE-----D...FIN.......AVD.NSG
Q5F5H0_NEIG1/248-322-------------IAFG..DFE-I.T.G..................T.Q.RYPE-----Q...TVS....G.LA.....R
Q5FGI9_EHRRG/23-91-------------TKVK..QVQ-I.N.G.........N..........H.RLDY-----K...TIY....FYSK......
Q5FGI9_EHRRG/92-170-------------PIVN..DII-F.Y.G.........N........K.E..FNK-----K...TLQ....N.DI....LK
Q5FGI9_EHRRG/173-260-------------SRIK..NIK-F.V.G.........N........K.F..FSS-----M...VLK....K..A....IL
Q5FGI9_EHRRG/346-418-------------VYIN..NIN-ITN.N....................Q.NTID-----R...VIR....Q.KL.....N
Q5FPE9_GLUOX/347-432-------------VVIG..PIS-M.T.G..................L.A.HTKQ-----R...YLM....N.RL.....E
Q5FPY9_GLUOX/49-116-------------NIIQ..AIS-V.K.G.........N..........T.RIET-----S...TVL....S.YM....V.
Q5FPY9_GLUOX/117-194-------------PIVN..RIV-F.E.G..................NHA..LKD-----E...DLR....K.EI.....S
Q5FPY9_GLUOX/197-285-------------TLIK..KIV-F.V.G.........N........H.A..FSE-----A...RLS....Q..V....IS
Q5FPY9_GLUOX/370-443-------------VYVE..RID-I.N.G.........N..........T.ITHD-----D...VIR....R.NL.....P
Q5GTM8_WOLTR/28-96-------------TQIK..DIK-C.I.G....................NERVGD-----Q...TIK....F.YI.....K
Q5GTM8_WOLTR/97-175-------------PLIN..KVI-L.K.G.........N........K.Q..FKS-----K...ELL....N.NV....IQ
Q5GTM8_WOLTR/274-352-------------FGSN..KVN-V.E.AE.......IQ........D.P.DLKE-----K...VLE.......L....IT
Q5GTM8_WOLTR/355-427-------------IYIN..QIT-I.D.G.........N..........D.RTLD-----K...VIR....S.KL.....S
Q5GUR4_XANOR/127-208-------------VRTS..HIS-I.T.G..........W......AEQD.RYLG-----Q...DLK....Q..F.....E
Q5H1E9_XANOR/59-126-------------FVAS..DIR-V.D.G..................L.Q.RIAS-----G...TVF....T.YL.....P
Q5H1E9_XANOR/127-207-------------PAIN..KLT-V.T.G.........N........K.D..IKS-----E...ELL....K..G....LG
Q5H1E9_XANOR/210-298-------------AKIR..HVN-L.I.G.........T........E.K..FAN-----E...DIL....D..N....WE
Q5H1E9_XANOR/301-379-------------YKIS..EIK-V.T.G.........D........T...VLPQ-----A...DIE....R..L....VI
Q5H1E9_XANOR/382-456-------------VTVR..RIL-Y.K.G.........N..........S.RTSD-----E...VLR....R.EM.....R
Q5HX37_CAMJR/18-85-------------ATIK..DIK-F.I.G..................L.N.HLSN-----T...SAI....N.IA.....G
Q5HX37_CAMJR/86-164-------------PTIA..KVS-I.T.G.........I........A.S..NDR-----K...QVE....S..I....LG
Q5HX37_CAMJR/167-257-------------IIID..NVH-L.S.G.........A........K.K..FSY-----S...DIE....P..A....VV
Q5HX37_CAMJR/260-340-------------YKIK..SIS-I...E.........N........P...LFDD-----KQNAQTV....K..D....LR
Q5HX37_CAMJR/343-415-------------VYIR..NVI-I.S.G.........N..........S.RTVD-----R...VIR....R.EL.....Y
Q5LSU6_SILPO/48-115-------------YRFN..TVQ-V.D.G.........N..........Q.RIET-----S...TII....S.RM.....G
Q5LSU6_SILPO/116-193-------------PTIN..RIN-F.E.G..................NRR..VKD-----E...TLE....G.AI.....G
Q5LSU6_SILPO/196-284-------------IEIE..RVS-F.V.G.........N........R.V..FSD-----R...RLR....R..I....LE
Q5LSU6_SILPO/369-442-------------IFVE..RID-I.E.G.........N..........T.TTLD-----Q...VIR....R.QF.....R
Q5N4G5_SYNP6/1-77-------------MLVS..EVQ-I.V.G..................VAG.NPDE-----A...QLL....D.AIYG.AIR
Q5N4G5_SYNP6/78-153-------------PVLS..KIE-L.D.G..................A.R.VLPD-----S...VIQ....E.TF.....K
Q5N4G5_SYNP6/165-242-------------AEGR..STD-E.E.G.........N........PIRGKTRP-----F...IVT....R.EY.....S
Q5NEP7_FRATT/28-95-------------FILD..NVS-I.N.G..................L.E.GLQS-----D...VVK....S.RI.....G
Q5NEP7_FRATT/96-176-------------PIIA..GFS-F.S.G.........N........K.K..LSK-----D...NLE....K..V....FT
Q5NEP7_FRATT/179-270-------------AIID..SIN-F.V.G.........N........K.S..FAD-----S...DLD....S..S....VA
Q5NEP7_FRATT/273-351-------------YKVG..SVS-L.T.G.........K........F...ILPK-----S...ELE....S..L....VK
Q5NEP7_FRATT/354-428-------------VYVN..RIN-F.F.G.........N..........N.VTND-----Y...VFR....R.QL.....Q
Q5NNB2_ZYMMO/333-411-------------GSYG..SII-V.S.N.........N........K.H.IVLD-----A...KHI....S.HI....AR
Q5NZG7_AROAE/25-92-------------FVVK..DIR-V.E.G..................I.Q.RTEA-----G...TVF....N.YL.....P
Q5NZG7_AROAE/93-173-------------PAIA..QID-F.V.G..................V.K.EFDK-----E...ALK....K.GL.....R
Q5NZG7_AROAE/176-264-------------AKIR..QIE-I.I.G.........N..........K.AFKD-----S...EVL....G.LFQ...L.
Q5NZG7_AROAE/267-345-------------YTVS..AVR-F.A.G.........D........L...ILPE-----E...EYR....K..L....AA
Q5NZG7_AROAE/348-422-------------VYVR..RIN-V.G.G..................N.T.KTRD-----E...VVR....R.EM....RQ
Q5P9S8_ANAMM/28-95-------------AGVT..RVK-V.I.G.........N..........E.RLDS-----G...TVQ....F.YA.....K
Q5P9S8_ANAMM/96-174-------------PVVR..SIK-I.V.G.........N........R.M..FSD-----K...NLE....S.DV....LK
Q5P9S8_ANAMM/177-268-------------TRIG..EIR-F.V.G.........N..........K.AFSS-----S...ELKAIVYS.KE....YK
Q5P9S8_ANAMM/355-427-------------VYIH..RIN-I.L.G.........N..........N.RTLD-----H...VMR....R.KL.....G
Q5R0Z1_IDILO/25-92-------------FVVE..DIE-V.K.G..................LQR.VALG-----A...ALT......YI.....P
Q5R0Z1_IDILO/93-173-------------PTIA..EIT-F.E.G.........N..........S.DIKD-----E...QLQ....E..SLV.DNN
Q5R0Z1_IDILO/176-264-------------AEIA..QIN-I.V.G.........N........K.A..FAD-----E...LLL....D..T....FE
Q5R0Z1_IDILO/267-345-------------YKIS..ETD-V.I.G.........D........L...KGHD-----E...LVG....K..I....AK
Q5R0Z1_IDILO/348-422-------------VYVR..HIN-F.E.G.........N..........G.ATKD-----R...VLR....R.EM.....R
Q5SKT2_THET8/83-163-------------PPIA..AVR-V.E.T....................E.AFPE-----ERLLTFL....EQNF....A.
Q5SKT2_THET8/164-238-------------PEVK..AVR-L.L.G..................V.S.LLPE-----E...ELR....K.GL.....E
Q5SKT2_THET8/375-450-------------LKIGGYRLE-W.QGG....................H.RTRD-----E...VVL....R.EL.....P
Q5UCE9_LEPIR/114-187-------------AYVE..NVI-I.K.G.........N..........K.KTQD-----R...VIR....R.EL....L.
Q5WVP5_LEGPL/184-255-------------YYFG..QVQ-F.D.P....................T.YISP-----Q...LLH....R.FV.....P
Q5WZ37_LEGPL/30-97-------------FIVK..GIR-V.N.G..................L.Q.RVST-----G...TVL....N.YM.....P
Q5WZ37_LEGPL/98-178-------------ATIG..SIT-V.V.G.........N........K.E..IPS-----D...KMK....A..F....LK
Q5WZ37_LEGPL/181-269-------------SRIK..EIK-I.I.G.........N........H.D..FKA-----N...ELL....P..E....LT
Q5WZ37_LEGPL/272-350-------------YHFS..GYD-V.V.G.........K........T...ILPK-----E...KID....S..L....IQ
Q5WZ37_LEGPL/353-427-------------VYVR..RIN-F.H.G.........N..........T.KTGD-----Y...VLR....N.VI.....R
Q604T9_METCA/56-123-------------FVIR..DIR-I.E.G..................L.Q.RISE-----G...TVF....N.YL.....P
Q604T9_METCA/124-204-------------PSIS..SVK-I.D.G.........N........H.D..IGS-----E...DLL....K..A....LK
Q604T9_METCA/207-295-------------ARIK..QIN-I.I.G..................N.N.AFSD-----D...DLT....Q.DF....EL
Q604T9_METCA/298-376-------------FKVE..QVR-L.T.G.........K........T...IVPP-----E...QLV....P..L....VR
Q604T9_METCA/379-453-------------VYVR..RIN-F.Q.G.........N..........T.KTRD-----E...VLR....R.EM.....R
Q62CQ1_BURMA/318-390-------------IRIT..SIE-IRTNG....................A.SVPK-----Q...IVR....N.AL.....H
Q62JD2_BURMA/31-98-------------FVVQ..DIK-I.E.G..................L.Q.RVEA-----G...SVF....A.YL.....P
Q62JD2_BURMA/99-179-------------PAIA..SID-F.T.G..................I.K.EFDK-----D...NLN....K.AL.....K
Q62JD2_BURMA/182-270-------------AKIR..QIN-F.I.G..................N.K.AFKT-----S...TLR....D.EM....QL
Q62JD2_BURMA/273-351-------------YTVS..SVK-L.A.G.........N........L...LDRQ-----A...ELE....K..L....VK
Q62JD2_BURMA/354-428-------------VYVR..RIN-I.V.G.........N..........T.RTRD-----E...VVR....R.EM.....R
Q62LE4_BURMA/222-296-------------FTIG..ALD-V.S.G..................V.R.RYPE-----K...IVH....DVNP......
Q64Z23_BACFR/5-84-------------PRIS..DIR-Y.H.G..................V.K.KSER-----E...DLQ....T.KL.....G
Q64Z23_BACFR/87-175-------------VKVH..AIT-F.A.G....................NHAIKT-----S...KLK....R..V......
Q64Z23_BACFR/178-259-------------YYLR..NVT-W.V.G.........N..........T.LYPS-----E...QLN....Y.ML.....R
Q64Z23_BACFR/262-337-------------ASIN..KIK-I.N.G.........N..........D.RLYE-----N...VVR....R.EL.....R
Q65R79_MANSM/21-87-------------FVVQ..DIR-V.D.G..................VQA.GSEG-----K...VLA....G..L.....P
Q65R79_MANSM/88-168-------------PVIA..DVT-I.D.G.........N........S.S..IPT-----D...ALK....Q..N....LD
Q65R79_MANSM/260-339-------------YTIK..DAR-I.V.G.........D........V...AGMQ-----D...ELQ....P..I....LK
Q65R79_MANSM/342-416-------------YSVR..QIR-F.E.G.........N..........T.VTAD-----S...TLR....Q.EM.....R
BAMA_YERPS/266-344-------------FKLN..SVI-V.S.G.........N........L...AGHQ-----S...EAE....K..L....TK
BAMA_YERPS/347-421-------------FYVR..HIR-F.E.G.........N..........D.TSKD-----S...VLR....R.EM.....R
Q66F88_YERPS/190-264-------------YRFG..KVI-F.Q.G....................S.QIRE-----D...YLQ....N.LV.....P
Q68XK8_RICTY/26-94-------------DVIR..KIT-I.K.G.........N..........H.RIER-----S...TIE....S.YL.....K
Q68XK8_RICTY/95-172-------------PFIS..SVV-F.S.G....................NSKIKT-----N...ILA....K.EI.....Y
Q68XK8_RICTY/175-263-------------TGIK..SIY-F.S.G.........N........E.H..YSD-----S...ELK....S..I....VL
Q68XK8_RICTY/266-344-------------YRFG..NVT-I.D.N.........K........L.T.NINM-----K...YLN....K..I....VN
Q68XK8_RICTY/347-420-------------VYIN..KIN-I.I.N....................NLKTED-----H...VIR....R.AF.....K
Q6ARL5_DESPS/20-91-------------HRIA..AIS-P.Q.G.........N..........A.RVDS-----G...AIL....R.KI.....N
Q6ARL5_DESPS/92-170-------------PLVS..SVL-F.V.G.........L........K.E..LKQ-----E...DVQ....A..V....AN
Q6ARL5_DESPS/173-259-------------VYVE..EIS-F.E.G.........N..........K.NFDA-----G...ELE....D.IL.....E
Q6ARL5_DESPS/262-340-------------YRIG..LID-F.S.G.........D........L...MIDK-----K...TLA....K..L....VS
Q6ARL5_DESPS/343-416-------------VYID..RIT-I.N.G.........N..........V.RTRD-----N...VIR....R.EL.....R
Q6ATX4_ORYSJ/67-146-------------IRVH..DVI-I.K.G.........N..........A.KTKE-----E...LIE....A.EV.....A
Q6D152_ERWCT/230-304-------------YRFG..AVN-F.Q.G....................A.QIRD-----D...YLQ....N.LV.....P
Q6FCG7_ACIAD/28-95-------------FIAR..EVK-I.E.G..................L.V.RLTP-----S...NVY....N.ML.....P
Q6FCG7_ACIAD/96-176-------------PVIS..KIE-F.K.G.........N........K.L..IPK-----E...ALT....E..G....LK
Q6FCG7_ACIAD/179-267-------------AKVV..EIN-L.I.G.........N..........T.VFSD-----D...DIK....Q.AFA...IK
Q6FCG7_ACIAD/270-348-------------FKFG..QTK-F.L.G.........D........A...LYKP-----Q...ELE....A..L....KI
Q6FCG7_ACIAD/351-425-------------VKVR..RIN-I.V.G.........N..........T.KTAD-----D...VLR....R.EM.....R
Q6G1J3_BARQU/107-184-------------EIVN..QVL-F.Q.G.........N..........K.SLKD-----P...DLK....R.FI.....S
Q6G1J3_BARQU/187-275-------------TKIS..NIT-F.K.G.........N........N.A..FRS-----S...RLR....D..V....IS
Q6G1J3_BARQU/278-357-------------YKIA..DVQ-V.E.S.........D........I.D.GIDV-----H...SMK....G..I....LK
Q6G1J3_BARQU/360-433-------------AYVQ..RIE-I.R.G.........N..........E.KTRD-----Y...IIR....R.EI.....D
Q6LHU2_PHOPR/343-412-------------YSFT..NII-I.I.N....................QTALSD-----N...SLY....Q.WL.....A
Q6LKQ8_PHOPR/351-422-------------YYID..NIV-L.N....................NHT.LLSD-----P...ALL....A.LL.....D
Q6LMH9_PHOPR/358-429-------------LYID..EVR-L.V.N....................NSQYSD-----Q...ALL....D.RL.....D
Q6LN32_PHOPR/24-91-------------FVVD..DIR-F.E.G..................LQR.VTMG-----A...ALL....K..M.....P
Q6LN32_PHOPR/175-263-------------AKIQ..QIN-F.I.G.........N........D.V..FTD-----A...ELS....S..K....FN
Q6LN32_PHOPR/266-344-------------YQVK..DVT-F.R.G.........D........L...SKDN-----K...DLN....E..L....VT
Q6MAC6_PARUW/256-330-------------TYFG..PIK-I.N.G..................C.D.RVKK-----S...FFY....K.KL.....H
Q6MAE9_PARUW/137-215-------------PTIR..NIH-W.C.G.........N..........H.RVST-----N...RLQ....K.EL......
Q6MAE9_PARUW/218-306-------------GKIQ..EID-F.V.N.........F........S.E..KEE-----H...EIL....S.QM....MT
Q6MAE9_PARUW/309-387-------------YYFG..RLS-F.E.G.........N........Q...IICD-----E...EID....R..L....FG
Q6MAE9_PARUW/390-467-------------FYVG..LVR-V.F.G.........N..........L.STKT-----S...VIL....HETL......
Q6MKB1_BDEBA/93-170-------------RRIS..QVQ-W.E.G.........N........K...TIST-----S...EAA....S..L....FG
Q6MKB1_BDEBA/419-500-------------TVVE..SVT-F.T.G..................NQA.FTPE-----E...LLKV..TR.........
Q6MKB1_BDEBA/503-577-------------VRVA..SII-L.E.G....................NTFTTD-----Y...VIH....K.EL.....E
Q6MMX9_BDEBA/48-119-------------LIVK..NIE-V.A.G.........N..........R.KIEK-----D...AIL....TKIV......
Q6MMX9_BDEBA/120-198-------------PSVV..EIT-Y.E.G.........N..........S.EVKS-----E...DIA....D.AT.....G
Q6MMX9_BDEBA/201-289-------------VKVK..KIT-F.L.G.........N........N.H..MGD-----S...SLK....S..K....M.
Q6MMX9_BDEBA/292-370-------------YNVG..DVD-F.A.G.........D........L...LFPK-----S...ELR....E..V....IK
Q6MMX9_BDEBA/373-447-------------VYFG..KIN-M.V.G.........N..........S.KTRD-----K...VIR....R.EL.....K
Q6N5Q8_RHOPA/39-106-------------QSAS..SIA-V.E.G.........N..........R.RVEA-----E...TIR....S.YF.....K
Q6N5Q8_RHOPA/107-184-------------PVIG..RLA-F.E.G..................N.K.KIKD-----E...QLS....AEI......Q
Q6N5Q8_RHOPA/187-275-------------TGVK..SIE-F.V.G.........N........K.A..YSS-----Y...RLK....D..V....IK
Q6N5Q8_RHOPA/278-357-------------YRVG..SVT-F.E.S.........A........I.P.TLDG-----N...SMR....S..F....SR
Q6N5Q8_RHOPA/360-433-------------VYIE..RIN-V.V.G.........N..........T.RTRD-----Y...VIR....R.EF.....D
Q6Q8T1_9GAMM/23-90-------------FLVS..DIR-I.I.G..................L.Q.RVST-----G...SIF....N.VI.....P
Q6Q8T1_9GAMM/91-171-------------PSIS..EID-I.S.G.........N..........K.ALKT-----E...QLI....E.SL.....D
Q6Q8T1_9GAMM/174-262-------------AKIE..KIN-I.I.G.........N..........E.IYTN-----E...ELL....D.GF.....E
Q6Q8T1_9GAMM/265-343-------------YTIN..DVD-V.V.G.........E........I...PFDE-----D...VYI....D..I....VN
Q6Q8T1_9GAMM/346-420-------------TYTR..KIL-F.T.G.........N..........D.ITQD-----Y...VLR....R.EM.....R
BAMA_DESVH/59-130-------------NAIA..DVK-V.R.G....................T.KVLD-----P...DVV....LMRL.....S
BAMA_DESVH/131-209-------------PRID..NIV-I.E.G.........S........D.K..VGH-----D...DIL....A..A....MS
BAMA_DESVH/212-298-------------LYIK..KVK-I.E.G..................L.K.ELSE-----S...EVK....D.........
BAMA_DESVH/301-383-------------YKLG..KIG-F.D.G.........E........L...IDTD-----E...RLL....K..V....VK
BAMA_DESVH/386-459-------------VYIN..RVL-V.E.G.........N..........Q.KTRD-----N...VVL....R.EM.....R
Q72RW5_LEPIC/53-124-------------KTIK..EVK-F.K.G.........N..........K.NTPD-----A...DLE....S.MI.....E
Q72RW5_LEPIC/125-204-------------PIVR..EIE-F.V.G..................ADE.VFPA-----D....LR....D.KL.....P
Q72RW5_LEPIC/207-299-------------IPVS..KIN-V.Y.G.........N........E.S..IET-----S...EIL....S..I....ME
Q73G77_WOLPM/28-96-------------VQVK..DVK-C.I.G.........N..........E.RVSN-----Q...TIG....F.YI.....K
Q73G77_WOLPM/274-352-------------FGNN..EVN-I.E.TE.......IQ........D.L.SLKE-----E...ILD.......F....IT
Q73JH4_TREDE/30-104-------------KPVL..EIQ-F.K.G..................L.Q.NIAS-----S...ELD....E.IF.....K
Q73JH4_TREDE/105-183-------------PAVN..NIV-F.T.G.........N........N.N..IRK-----A...DLL....S..A....IK
Q73JH4_TREDE/186-274-------------SVIT..KIL-F.E.G.........N........S.K..FPE-----K...ALK....K..V....LV
Q73JH4_TREDE/277-355-------------FTYA..GVD-F.E.G.........N........Y.I..FST-----K...ELS....E..K....FK
Q73JH4_TREDE/358-431-------------SHVE..NII-I.K.G..................N.T.KTKD-----N...VIL....R.EI....L.
Q74AT3_GEOSL/27-98-------------EKII..DVR-V.K.G.........N..........R.RVET-----A...AIT....N.AL.....S
Q74AT3_GEOSL/99-176-------------PIIR..EVR-I.E.G.........N..........K.ELST-----D...KVR....D.AL.....G
Q74AT3_GEOSL/179-267-------------VLIK..SIR-F.E.G.........N..........K.AFNA-----S...KLR....G.VM.....E
Q74AT3_GEOSL/270-348-------------FRTG..AIG-Y.K.G.........D........L...LEKE-----E...DLT....K..V....LR
Q74AT3_GEOSL/351-424-------------VFFD..RIN-V.S.G.........N..........T.KTRD-----K...VIR....R.EL.....K
Q7CWM5_AGRT5/240-314-------------APLG..AVT-V.T.G..................E.K.TVDG-----D...FIR....R.YS.....R
Q7MAB6_WOLSU/20-87-------------PTVK..NIQ-Y.E.G..................L.I.HISP-----MIANEIS....K.........
Q7MAB6_WOLSU/88-166-------------STIA..NIE-I.N.G.........Y........G.S.GQEQ-----E...ALY....K..E....IG
Q7MAB6_WOLSU/169-259-------------IIIR..KVN-Y.N.G.........A........E.K..LSA-----S...KLE....I..P....TV
Q7MAB6_WOLSU/262-341-------------YEVS..KVE-I.VLE.........E........P...VVGV-----E...ELM....D..E....VR
Q7MAB6_WOLSU/344-416-------------VKIN..DVL-V.S.G.........N..........T.RTLD-----R...VVR....R.EI....L.
Q7MHW3_VIBVY/361-432-------------TRVD..QIV-VIN.N....................T.HYSD-----G...LLT....R.RL.....D
Q7MIG8_VIBVY/24-91-------------FVVQ..DIK-I.E.G..................LQR.VALG-----A...ALL....K..M.....P
Q7MIG8_VIBVY/266-344-------------YSVK..EVN-F.R.G.........E........L...IGKE-----E...EFK....A..L....VP
Q7MPD6_VIBVY/100-183-------------VRVETFDVR-I.E.G..................E.A.SNDK-----D...FLQ.......LLE.KSP
Q7MXJ3_PORGI/45-119-------------KTIA..SIE-I.E.G..................M.R.SFDD-----F...VLR....NLSG......
Q7MXJ3_PORGI/120-199-------------PRIS..KVT-F.S.G..................V.K.KSER-----E...DLE....M.KI.....G
Q7MXJ3_PORGI/302-383-------------YYIK..DVN-F.V.G.........N..........S.QYPS-----E...YLE....R..V....LG
Q7MXJ3_PORGI/386-461-------------ANIN..KVI-I.K.G.........N..........T.VVYE-----D...VVR....R.EL.....Y
Q7MYW2_PHOLL/190-266-------------YHFG..QVR-Y.R.G....................S.QIRE-----D...YLN....H.LV.....P
BAMA_PHOLL/266-344-------------YKIS..GID-L.N.G.........N........M...AGYQ-----S...EIT....K..L....AA
Q7NJG9_GLOVI/85-160-------------VLVA..EVR-V.V.A.......................SKG-----KLGDTLE....G.RVYN.AIR
Q7NVY6_CHRVO/25-92-------------FVIK..DIR-V.E.G..................L.Q.RTEP-----G...TVF....N.YL.....P
Q7NVY6_CHRVO/93-173-------------PVIT..QLN-I.N.G..................A.K.EFSK-----D...QLK....K.AL.....K
Q7NVY6_CHRVO/176-264-------------ARIR..EIR-I.V.G..................A.N.AFAQ-----S...KLL....D.EF.....S
Q7NVY6_CHRVO/267-345-------------YTVS..DVR-L.A.G.........D........L...KVPE-----A...ELM....K..L....MQ
Q7NVY6_CHRVO/348-422-------------TYVR..RVN-V.A.G.........N..........S.KTRD-----E...VIR....R.EL.....R
Q7P0N3_CHRVO/181-255-------------IGFG..KIT-V.N.G..................V.K.RYPE-----K...VAL....G.MA.....D
Q7P3C7_FUSNV/76-147-------------IVIS..SVK-F.T.G....................NSRVTT-----S...ELL....D.IT.....Q
Q7P3C7_FUSNV/148-222-------------PIVK..SIV-I.T.G.........N........H.T..IPT-----S...TIM....S..A....LT
Q7PAV1_RICSI/266-344-------------YSFG..NIT-I.D.N.........K........L.T.NIDI-----T...PLN....K..I....VN
Q7U8Q8_SYNPX/59-135-------------VLIS..EVL-I.E.G.........I........G.G.HPEE-----E...RLQVAAYG.AM....Q.
Q7U8Q8_SYNPX/217-301-------------VEVE..FLN-S.E.G.........TSTDENGDPIRG.KTKE-----W...VIT....R.EI.....S
Q7UK20_RHOBA/97-179-------------AVVA..EVR-L.V.G.........N..........Q.VIST-----T...DIL....A.EL.....Q
Q7UK20_RHOBA/180-256-------------AMVS..KVI-Y.H.G.........N........Y.R..MND-----R...ELS....G..R....SG
Q7UK20_RHOBA/259-346-------------ERIE..DIQ-I.E.G.........A........S.I..VSE-----S...RLK....K..V....IQ
Q7UK20_RHOBA/349-427-------------FKVG..DVQ-I.V.G.........N........E...YVTE-----E...SLR....K..R....LE
Q7V0C8_PROMP/84-160-------------VLIS..EII-I.E.G..................WEN.HPEG-----R...KLELAAYD.SM.....T
Q7V0C8_PROMP/253-325-------------SVVD..GKP-R.K.G......................KTKD-----W...VIK....R.EL.....K
Q7V5X2_PROMM/98-174-------------VLIT..EVI-I.E.G.........I........A.G.HPEQ-----E...RVELAAYD.AM....V.
Q7VAN9_PROMA/161-237-------------VLIS..EVV-I.K.G..................LEN.HPDE-----D...RLRYAAYD.AM.....N
Q7VAN9_PROMA/238-314-------------PIFT..EVE-I.IPS.........N..........S.LLTQ-----S...IIR....D.IF.....K
Q7VHH5_HELHP/19-86-------------KDIS..AIK-Y.E.G....................L.SSIS-----N...VLA....D.EI....IG
Q7VHH5_HELHP/87-166-------------PKVA..SVE-I.K.G.........Y........G.S.EQEK-----E...TLY....S..Q....IG
Q7VHH5_HELHP/169-259-------------IIIK..KAE-Y.D.G.........R........E.K..LKV-----S...EVE....E..L....SA
Q7VHH5_HELHP/262-341-------------YKVS..EIK-I.ILH.........V........P...VIEE-----K...ELR....K..V....LK
Q7VHH5_HELHP/344-416-------------VKIN..DVL-I.S.G.........N..........S.RTAD-----R...IIR....R.EI.....L
Q7VQ47_CHLPN/108-186-------------PSIR..NIH-I.S.G.........N..........Q.VVPE-----H...KIL....K.TL.....Q
Q7VQ47_CHLPN/189-276-------------GKIK..QLT-F.S.G.........I........S.R..SEK-----S...DIQ....E..F....IQ
Q7VQ47_CHLPN/279-357-------------YTLG..HVH-I.Q.G..................F.E.VLPK-----R...LIE....K.QS.....Q
Q7VRD8_BLOFL/32-100-------------FIVK..KIF-F.H.G..................LHR.MSSD-----A...ILY....Q..L.....P
Q7VRD8_BLOFL/101-181-------------PIIH..SIE-F.S.G.........N........K.I..IKT-----E...MIQ....S..I....LN
Q7VRD8_BLOFL/184-272-------------ANVK..QIK-I.F.G.........N........Y.I..FSQ-----K...KLL....K..Q....FS
Q7VRD8_BLOFL/356-430-------------FYVR..EVQ-F.E.G.........N..........N.FTQD-----F...VIR....R.EI.....K
Q7VYC2_BORPE/34-101-------------FVVR..DIR-V.E.G..................I.Q.RTDA-----G...TVF....G.YL.....P
Q7VYC2_BORPE/102-182-------------PTIA..SIS-F.N.G.........M........R.E..FDS-----K...AIT....K..S....LA
Q7VYC2_BORPE/185-273-------------AKIR..EIR-V.V.G..................S.K.AFSE-----G...ELL....D.QFD...L.
Q7VYC2_BORPE/276-354-------------YKVR..EVK-L.A.G.........N........L...MGLD-----S...EIN....N..L....VE
Q7VYC2_BORPE/357-431-------------VYVR..RIQ-I.G.G..................N.T.RTRD-----E...VVR....R.EM....RQ
Q823D8_CHLCV/106-184-------------PCIR..KVC-I.T.G.........N..........E.VVPN-----H...KIL....K.TL.....Q
Q823D8_CHLCV/187-274-------------GKIK..KLE-I.C.G..................L.N.RCEK-----S...DVK......ELILTKQH
Q823D8_CHLCV/277-355-------------YTLG..HVH-I.E.G..................F.N.VLPR-----R...LIE....K.QL....A.
Q82U03_NITEU/23-90-------------LVVR..DIR-V.E.G..................I.Q.RTEA-----G...TVF....S.YL.....P
Q82U03_NITEU/91-171-------------PAIA..QIS-I.N.G..................A.K.EFDK-----D...KLK....E.GL.....K
Q82U03_NITEU/174-262-------------ARIK..QIN-I.V.G..................N.H.VFPE-----D...DLV....D.LF....SL
Q82U03_NITEU/265-343-------------YTVS..DIK-L.A.G.........E........L...LVPE-----E...ELR....K..L....IK
Q82U03_NITEU/346-420-------------VYVR..RIN-I.S.G.........N..........E.RTRD-----E...VIR....R.EF.....R
Q82VX0_NITEU/116-201-------------AAVT...IE-F.Q.G..................A.L.AADE-----P...AYRARAEQ..LRA.EWP
Q82VX0_NITEU/204-278-------------FRYG..ELQ-I.T.G..................L.E.RYKP-----D...VVQ....N.SV.....P
Q83DT2_COXBU/31-98-------------FVVR..SIQ-I.Q.G..................L.Q.GISA-----D...TVR....S.YL.....P
Q83DT2_COXBU/99-179-------------PIIS..LIR-I.S.G.........N........K.A..IST-----K...KLR....P..I....LN
Q83DT2_COXBU/182-270-------------AKVG..SIQ-F.V.G.........N..........R.AFSA-----R...TLR....N.QFK...L.
Q83DT2_COXBU/273-351-------------YHLS..GYT-I.T.G.........E........T...YGFK-----D...QLY....R..L....VK
Q83DT2_COXBU/354-428-------------VYVR..RIS-F.F.G.........N..........Q.RTDQ-----E...VLR....R.EM.....R
Q87EI1_XYLFT/272-350-------------YKIS..SIK-V.T.G.........N........T...VLPQ-----E...KIE....K..L....VI
Q87LW2_VIBPA/354-425-------------RVVD..EIV-I.V.N....................NTHYSD-----V...LLT....N.RL.....E
Q87ME5_VIBPA/266-344-------------YTVK..DVK-F.R.G.........D........L...IGEE-----A...TFE....R..L....VP
Q87SW5_VIBPA/101-182-------------IKVM..DVV-I.S.G....................E.AKED-----E...EFT....N..LIA.KSP
Q881Y2_PSESM/187-261-------------YSLG..KVM-F.S.G.........N..........T.PFDE-----D...LLK....R.MV.....P
Q886N5_PSESM/23-90-------------FTIS..DIR-V.N.G..................L.Q.RVSA-----G...SVF....G.AL.....P
Q886N5_PSESM/91-171-------------PSVA..SIE-I.E.G.........N..........K.AIST-----E...DLM....K.GL.....K
Q886N5_PSESM/174-262-------------ASIQ..HIN-V.V.G.........N........T.V..FSD-----E...DLT....D..L....FE
Q886N5_PSESM/265-343-------------YSVK..SVK-L.S.G.........D........L...KVPE-----D...QVK....S..L....LL
Q886N5_PSESM/346-420-------------AYVN..RIN-Y.R.G.........N..........T.KSED-----E...VLR....R.EM.....R
Q88EF1_PSEPK/356-425-------------PVIT..AIR-I.END....................S.KVSD-----D...VIR....S.YI.....R
Q88IV7_PSEPK/195-269-------------YRLG..AVT-F.G.G..................D.T.PLDE-----D...LLQ....R..M....VS
Q89KQ1_BRAJA/278-357-------------YRVG..ALD-F.R.S.........S........I.P.NFDP-----N...SMR....A..Y....SR
Q89NX1_BRAJA/79-147-------------AQVS.QGIV-V.E.G.........N..........R.RVEA-----E...TVR....S.YF.....R
Q89NX1_BRAJA/148-225-------------AVIG..RVA-F.E.G.........N..........R.KIKD-----E...QLS....A.EV.....Q
Q89NX1_BRAJA/319-398-------------YRVG..SVD-F.R.S.........T........V.P.GFDP-----A...ALR....S..Y....SR
Q8A1E1_BACTN/46-120-------------YEIA..DIK-V.E.G.........V........K.N..YED-----Y...VLI....G..L....SG
Q8A1E1_BACTN/121-200-------------PRIA..DVR-Y.H.G..................V.K.KSER-----T...DFE....S..K....LG
Q8A1E1_BACTN/203-291-------------IKVH..AIH-I.T.G.........N..........S.AIKT-----S...KLK....K..V......
Q8A1E1_BACTN/378-447-------------ATIN..KIN-I.S.G.........N..........D.RLYE-----N...VVR....R.EL.....R
Q8D271_WIGBR/189-264-------------YRFG..KIN-F.Y.G....................S.KIHK-----S...YLK....N.........
Q8D2H0_WIGBR/27-94-------------FLVK..KII-F.K.G..................FKH.VNTE-----H...ILL....K.TP......
Q8D2H0_WIGBR/95-175-------------PIIN..NIF-F.S.G.........N........I.S..LEK-----N...NIK....N..I....LK
Q8D2H0_WIGBR/178-266-------------VLIK..EIN-F.I.G.........N........N.K..FSK-----K...NLI....N..K....IE
Q8D2H0_WIGBR/348-422-------------LYVN..HIN-F.S.G.........N..........E.YTKE-----H...VIR....R.NL.....K
Q8DI03_THEEB/90-161-------------VLIA..EVV-V.E.G....................A.TPEL-----E...QLV....Y.QV....IS
Q8DI03_THEEB/242-318-------------VTYR..FLN-K.E.G.........E........PTKQRTRD-----F...VIS....R.EM.....D
Q8EF72_SHEON/112-195-------------VKIQWVDIN-F.S.G..................E.M.LDDR-----A...FDK.......WLA.DVN
Q8EF72_SHEON/198-271-------------YHFG..QVS-F.E.G....................H.TLEP-----D...ILT....K.LI.....P
Q8EGG7_SHEON/29-96-------------FEVT..DIQ-V.E.G..................LQRVALGA-----A...LLS.......L.....P
Q8EGG7_SHEON/97-177-------------PTIS..AVT-F.E.G.........N..........K.DIKD-----E...QLQ....E..SLD.GSG
Q8EGG7_SHEON/180-268-------------AEIR..QIN-V.V.G.........N........H.E..FTD-----A...ELI....G..M....LE
Q8EGG7_SHEON/271-349-------------YKVK..DVN-L.T.G.........D........L...MGRE-----E...LMK....S..I....LP
Q8EGG7_SHEON/352-426-------------VYVR..SIN-F.T.G.........N..........T.VTED-----E...VMR....R.EL.....R
Q8EJN5_SHEON/337-408-------------HVIE..DIV-F.D.N.........Q..........S.KVSL-----N...LLK....E..T....LE
Q8GBX8_PASMD/261-340-------------YTVK..CAR-I.L.G.........D........V...GGMS-----A...ELA....P..I....LD
Q8I576_PLAF7/116-193-------------EMIN..NVI-I.KNS....................T.VINA-----E...ILN......EL......
BAMA_BUCAP/24-91-------------WIIE..NIQ-F.K.G..................L.K.YFSK-----D...EVL....K.NI....F.
BAMA_BUCAP/92-172-------------PIIS..NIT-F.S.G.........N........K.I..IKD-----S...ILK....K..Y....LT
BAMA_BUCAP/175-263-------------VEIN..HIK-I.I.G.........N........N.H..FPR-----D...KIL....S..L....FK
BAMA_BUCAP/266-344-------------YKIS..NFF-L.N.G.........N........L...LQYY-----Q...SIK....N..F....IN
BAMA_BUCAP/347-421-------------YFVN..KIN-F.R.G.........N..........E.LTQD-----I...VLR....R.EM.....K
Q8KBW3_CHLTE/43-133-------------PEVK..SIK-I.T.G.........N........K.A..LTT-----E...EIR....E..V....MS
Q8KC70_CHLTE/372-447-------------PRIE..KIE-V.T.GG.......PA........N.A..IPE-----K...EIS....D..T....FL
Q8KFQ6_CHLTE/57-131-------------FTVR..EIT-F.S.G..................LQT.IKES-----E...LLK....SLPI.....K
Q8KFQ6_CHLTE/132-209-------------PVLQ..SVE-F.Q.G.........N..........H.KFKT-----K...ELL....NTAN......
Q8KFQ6_CHLTE/212-301-------------VVIE..KIR-F.H.G.........N........T.A..FKE-----S...KLR....G..V....LK
Q8KFQ6_CHLTE/304-389-------------YHIR..NIT-W.I.G..................NTK.DFAT-----T...QIL....DTTF.....G
Q8KFQ6_CHLTE/392-467-------------YTLN..IIN-I.K.G.........N..........T.KTKD-----H...VIR....R.EL.....Y
Q8LEH7_ARATH/74-152-------------VRVH..DVI-V.K.G.........N..........E.KTKD-----H...VIE....A.EVD...V.
Q8PEY4_XANAC/199-273-------------YDMG..KVR-F.D.Y....................D.YFRD-----G...LFD....P.LV.....Y
Q8RHT4_FUSNN/4-75-------------LPIK..SVE-V.V.N.........N..........Q.QVPA-----S...LIK....N.TL.....K
Q8RHT4_FUSNN/251-335-------------IEVK..KMV-T.K.QKGNRRTPNDD........V.L.KTKD-----Y...VID....R.EI.....E
A9CJ61_AGRT5/38-105-------------AVIS..KID-V.R.G..................A.E.RSGA-----D...SVR....S.NI.....T
A9CJ61_AGRT5/106-183-------------QLVN..QVV-F.N.G..................NRK..IKD-----D...KLA....G.IV.....Q
A9CJ61_AGRT5/186-274-------------TKIG..RID-F.I.G.........N........N.S..YSD-----G...RLA....A..V....IN
A9CJ61_AGRT5/277-356-------------YDFG..NVA-V.E.S.........T........V.P.GVDG-----S...ELQ....G..L....VE
A9CJ61_AGRT5/359-432-------------AYVE..RIE-I.R.G.........N..........T.RTRD-----Y...VIR....R.EF.....D
Q8XZI3_RALSO/30-97-------------FVIK..DIR-V.E.G..................V.Q.RVEP-----G...TVF....G.YL.....P
Q8XZI3_RALSO/98-178-------------PAIS..QLE-F.I.G..................I.K.EFDK-----D...TLR....R.SL.....R
Q8XZI3_RALSO/181-269-------------AKIR..QIN-I.V.G..................N.K.AFSE-----G...DLR....D.EM....QL
Q8XZI3_RALSO/272-350-------------YKVS..DIK-L.T.G.........E........L...LSKQ-----A...EME....K..L....IK
Q8XZI3_RALSO/353-427-------------VYVR..RVN-V.V.G.........N..........S.KTRD-----E...VVR....R.EM.....R
Q8YUR6_NOSS1/221-296-------------VLVS..EVL-V.RPQ..................S.G.QLTP-----ELETQVY....N..V....IR
Q8YUR6_NOSS1/395-466-------------VNEQ..GQP-I.R.G......................RTQD-----Y...IIT....R.EV.....E
Q92LN9_RHIME/217-291-------------APVG..NLT-V.S.G..................A.R.TVDP-----D...FVK....D..Y....SR
Q92Q48_RHIME/39-106-------------AVIN..RVE-V.R.G..................A.T.RVSA-----E...TVR....A.NI.....T
Q92Q48_RHIME/107-184-------------QLVN..QVV-F.N.G.........N..........R.KIKD-----D...KLQ....G.VV.....R
Q92Q48_RHIME/187-275-------------TKIT..QIN-F.V.G.........N........E.V..YSD-----G...RLQ....S..V....IA
Q92Q48_RHIME/278-357-------------YDFG..PVN-I.E.S.........T........V.E.GIDA-----E...ELR....G..L....VQ
Q92Q48_RHIME/360-431-------------AYVE..RIE-I.R.G.........N..........T.RTRD-----Y...VIR....R.EF.....D
Q93PM2_HAEDC/20-87-------------FVVK..DIR-I.D.G..................VQT.ETGN-----A...IIA......SL.....P
Q93PM2_HAEDC/88-168-------------PLIN..NLT-I.K.G.........N........N.A..IPK-----N...ALE....Q..N....LK
Q93PM2_HAEDC/171-259-------------AYVK..KIN-F.E.G.........N..........N.AFSY-----D...ELI....K.EL.....E
Q93PM2_HAEDC/262-341-------------YNIS..EMR-I.I.G.........D........T...QKLD-----N...ELN....Q..L....LT
Q93PM2_HAEDC/344-418-------------IYVR..KIR-F.E.G.........N..........D.VTAD-----S...TLR....R.EM.....R
Q98K30_RHILO/218-292-------------AGYG..ATT-V.E.G....................T.EKVD-----R...DFT....E.YM....TG
Q98MC3_RHILO/39-106-------------AVVS..RVE-V.S.G.........N..........Q.RVDA-----D...TIR....N.YI.....T
Q98MC3_RHILO/107-184-------------KVVN..QVL-F.Q.G.........N..........K.KLKD-----N...ALA....A.AV.....Q
Q98MC3_RHILO/187-275-------------TQIA..AIN-F.V.G.........N........S.A..YSS-----R...RLS....D..V....IN
Q98MC3_RHILO/278-357-------------YNFG..DIS-V.E.S.........T........I.P.EVDS-----K...SLE....S..V....VE
Q98MC3_RHILO/360-433-------------AYIE..RIE-I.R.G..................N.D.RTRD-----Y...VIR....R.EF....D.
Q9A711_CAUCR/24-91-------------GVVQ..RIL-V.Q.G.........N..........E.RIEQ-----G...TVL....S.YL.....P
Q9A711_CAUCR/92-169-------------PIIN..QVV-F.E.G.........N..........S.SLKE-----D...KLK....D.EV.....Q
Q9A711_CAUCR/172-260-------------SGVL..GIN-F.L.G.........N........A.E..YSD-----N...DLR....D..V....IV
Q9A711_CAUCR/263-342-------------YKFG..KIT-V.E.T.........E........L.K.KLDG-----N...LLA....Q..I....LP
Q9A711_CAUCR/345-418-------------VYVD..RID-I.V.G.........N..........T.RTLD-----Y...VLR....R.EL.....E
Q9HXY4_PSEAE/265-343-------------YTIR..DVK-L.T.G.........D........L...KVPE-----E...EVK....R..L....LL
Q9HYQ6_PSEAE/333-404-------------PVID..AIR-V.ENN....................S.KVSD-----E...VIR....H.YI.....R
Q9I0U1_PSEAE/190-268-------------YTFG..KVS-F.D.G.........D..........S.IIEE-----E...LLR....R.MV.....P
Q9KPW0_VIBCH/266-344-------------YTVS..KVQ-F.R.G.........E........L...MGKE-----A...EFT....S..L....IP
Q9KUB9_VIBCH/347-418-------------VQVD..EIV-L.QNN....................T.HYSD-----L...LLL....N.RL.....N
Q9RXD5_DEIRA/97-179-------------PVIK..DVQ-A.T.G..................L.T.FLPA-----D...AFKQSVAE.LL.....N
Q9RXD5_DEIRA/180-256-------------APLS..RIE-V.T.G.........A........T.L..LPQ-----A...TVQ....N.IF....RP
Q9RXD5_DEIRA/329-402-------------GPVK..SIA-F.V.G.........N..........T.KVPT-----A...QLQ....A.AI.....K
Q9RXD5_DEIRA/407-477-------------Y.....ELA-W.Q.G..................Q.H.RTKD-----R...VIL....R.EL.....P
BAMA_PHOLU/175-263-------------AKIQ..QIN-I.V.G.........N........K.S..FSS-----D...ELL....N..R....FQ
Q9SRL6_ARATH/77-155-------------VRVH..DVI-I.G.G..................N.E.KTKD-----H...IIE..............
Q9WYS9_THEMA/19-89-------------IYIS..EVD-F.K.G..................L.N.TLNS-----E...FIV....Q.........
Q9WYS9_THEMA/90-164-------------PVVKDWKLE-I.E.G..................P.G.LVDK-----K...ELE....E.LV.....K
Q9WYS9_THEMA/270-342-------------KKFK..EIL-F.H.G.........N..........T.IFTD-----Q...ELL....R.AS.....G

PF08479

Q8XQ41_RALSO/70-145-------------IPVR--HVR.V-T-G--------------------....AR.....L---YPT----A.VLEALVAD
Q7W7Z0_BORPA/73-148-------------IVPR--NFD.V-A-G--------------------....VH.....A---LPF----D.QVAAFLTP
Q8RI18_FUSNN/32-109-------------FHIS--QIN.L-E-D--------------------....NE.....R---LLN----EIEKENILGK
Q7NU30_CHRVO/77-152-------------FTLS--RVS.L-E-G--------------------....AP.....A---GWL----A.WLQPLADA
Q7N2L1_PHOLL/77-152-------------HTIR--YIQ.F-E-G--------------------....VE.....S---LSQ----S.VREKLIQS
Q7N9T5_PHOLL/77-152-------------HTIH--RIE.F-D-G--------------------....AK.....S---LPL----P.IKQHLIHP
HLYB_SERMA/79-152-------------LPIA--GVY.L-Q-G--------------------....VT.....L---LSP----A.DLSAL.SG
Q6G3U5_BARHE/90-166-------------FPIH--DII.V-D-G--------------------....VY.....H---LKK----S.SIAAVTGP
Q88MW8_PSEPK/83-158-------------WAVD--GVR.V-A-G--------------------....MH.....R---LSN----S.ALAPTIRA
Q8PF71_XANAC/63-139-------------YPEA--GID.P-P-R--------------------....MQ.....A---VAD----A.AFAELAQG
Q7N107_PHOLL/69-145-------------FPIT--HVR.L-A-G--------------------....TE.....N---FPH----WLPFRLVAQQ
Q605Q3_METCA/48-123-------------FDVW--EYR.V-E-G--------------------....NS.....V---LDQ----R.VVEKTVYG
Q664C6_YERPS/89-165-------------VAIN--NVE.L-I-N--------------------....LD.....A---FPN----AAHLKEKAEE
Q71BF5_HAEIF/73-150-------------FPLT--QVQIL-D-R--------------------...NNQ.....E---VVT----D.ELAHILKN
Q9JY36_NEIMB/87-166-------------FAIN--EVV.L-E-G--------------------EHHARF.....Q---FAL----K.RALRETGF
Q8YM25_NOSS1/96-171-------------FRVD--RIE.V-V-G--------------------....SQ.....V---FPP----E.KFTPITDP
Q7N1B0_PHOLL/77-152-------------HTIQ--QIE.F-V-G--------------------....AE.....S---LSK----S.VKQNVIHP
Q89H68_BRAJA/98-173-------------FVLR--GLN.V-S-G--------------------....AR.....A---VSR----D.RIAAVYQP
Q93QU8_ECOLX/82-162-------------ITLK--HIM.L-T-G--------------------....DKPGGMAR---VSE----G.KIRKILDG
Q9HVN7_PSEAE/59-134-------------VLVK--RFQ.L-S-G--------------------....NR.....Q---FDD----R.RLLALLHD
Q8XQZ3_RALSO/84-163-------------FRID--RIT.L-T-G--------------------DAAERF.....Q---WAL----P.AADPSDDP
Q880E0_PSESM/77-152-------------FTIS--RIE.L-K-G--------------------....AD.....S---LSP----A.ERDALIKP
Q8XYH9_RALSO/79-151-------------FPIQ--GIV.L-E-D--------------------....NV......---..F----N.WLPYLLQP
O32607_EDWTA/81-154-------------LPID--GVY.L-T-G--------------------....IT.....L---LSL----R.DLRAL.DP
Q8DLP0_THEEB/81-156-------------IPVQ--KII.V-E-G--------------------....ST.....L---FGP----A.EFDPILKP
Q8XQX3_RALSO/69-144-------------LTPS--KFQ.I-E-G--------------------....VK.....A---LPF----P.EIAAHFAP
Q8X9M8_ECO57/65-141-------------FQIK--QTE.L-K-G--------------------....AD.....A---LPH----WLPLQKIANG
Q7MRX6_WOLSU/59-134-------------FITR--SIH.D-E-G--------------------....IT.....L---LQE----E.KKQSLYRQ
Q8PLI4_XANAC/79-156-------------FSIT--RVR.L-S-G--------------------..AGDD.....A---ARF----A.WLWTSLRR
Q9RGR3_BORBO/89-164-------------VTVH--AVDLD-F-G--------------------VEGRLF......---...----..DPTPLVQD
P94771_ERWCH/76-151-------------FTLR--DIR.F-N-H--------------------....ST.....L---LRP----S.DQATLVAG
Q9I792_PSEAE/71-146-------------FEIR--RIE.L-E-G--------------------....AG.....H---LGE----S.ARRQLLAP
Q8XPV1_RALSO/81-156-------------FDIH--RIE.L-T-G--------------------....NT.....V---LDA----D.TVERVTQP
Q7VLT7_HAEDU/59-128-------------LPYK--GIK.F-Q-G--------------------....IT.....L---IDP----L.PYL....P
Q7NWR3_CHRVO/87-160-------------LPVS--GLK.L-A-G--------------------....IR.....L---LSR----E.EVTAL.GP
Q6RK56_ERWCR/75-150-------------FTIN--EIH.Y-R-N--------------------....SS.....L---LSE----K.DKNTLNKD
Q6FDM4_ACIAD/101-180-------------FEIK--DIH.L-Q-G--------------------EKAEHF.....L---FAL----N.EITQGTHN
Q8VMR1_PHOLU/79-152-------------LPLT--GVY.L-K-G--------------------....IS.....L---LSV----R.DLSTL.SA
Q5GD94_XENNE/79-152-------------LAIT--GVY.L-Q-G--------------------....IT.....L---LSI----R.DLNTL.SA
Q9AHG0_9FUSO/86-161-------------FLLK--KLE.I-P-K--------------------....SD.....I---LTE----E.EIVRIWEP
Q63JI8_BURPS/74-148-------------FPIT--QIE.V-R-G--------------------.....G.....A---RHS----R.EIDRIVER
HLYB_PROMI/77-150-------------LPIK--GVY.I-Q-G--------------------....IT.....L---LTE----K.DLNSL.SP
Q9AAJ4_CAUCR/8-83-------------IILK--HVN.F-P-G--------------------....AT.....V---VPP----H.DLQPAWQN
Q63TR3_BURPS/65-140-------------LTPS--SFQ.V-E-G--------------------....VK.....S---IPF----E.EISQRFTP
Q89Q77_BRAJA/73-148-------------FRLR--KVE.F-D-A--------------------....SK.....F---ITP----A.ELDEIAKK
Q8XAN8_ECO57/70-144-------------FIIN--RIE.L-E-D--------------------....NF......---LGG----Q.LISEVQKA
Q9HVG7_PSEAE/71-146-------------FKLR--EIR.I-E-G--------------------....NT.....R---YDK----A.VLESYYQH
Q6DA64_ERWCT/107-183-------------FPIK--KVE.L-Q-G--------------------....TE.....D---FPG----WLPLQRLADQ
Q8RGK0_FUSNN/41-115-------------LNVT--SID.L-E-G--------------------....NT.....I---FED----F.QIDALLRK
Q8G9X8_ECOLX/104-179-------------FTVS--RIV.V-S-G--------------------....AT.....R---LTS----A.ETDRLVAP
Q9PAG8_XYLFA/106-185-------------FPIQ--KIF.L-E-G--------------------DKAARF.....Q---WAL----T.AANPPHDP
Q74E11_GEOSL/79-154-------------VFIS--HIV.T-D-P--------------------....SE.....I---LTE----D.DLRQVVAP
Q8YWF4_NOSS1/18-93-------------FLVK--KIE.V-L-G--------------------....AT.....V---LKN----..EIAKLIEP
Q7N910_PHOLL/78-154-------------FPIT--RVV.L-E-G--------------------....TE.....H---FPH----WLPLKRLAQQ
IBPB_HAES2/99-172-------------ITKI--TID.F-G-G--------------------....EE.....I---FL.----..DFDEVTKH
Q88QC1_PSEPK/91-166-------------LVLQ--KVR.F-E-G--------------------....GT.....V---FPL----G.DLREHYQP
Q7NY08_CHRVO/92-167-------------LLVQ--DIV.L-E-G--------------------....NT.....V---FDN----K.TLLELVAD
Q669F9_YERPS/77-153-------------FVID--RVT.L-S-G--------------------....TE.....P---LPR----WLPLQRIANQ
Q8D0E8_YERPE/68-141-------------LPIT--GVF.L-Q-G--------------------....NT.....L---LSS----Q.DLNQI.DH
Q9I5N4_PSEAE/47-122-------------VDIN--EYV.V-R-G--------------------....NT.....V---LDN----R.AIEAAVYP

PF08478

FTSQ_VIBF1/50-120-------------LPLS--HMI-I-Q-G------------------QLKHITAD-----D---IRE----AIDS------
Q5FG13_EHRRG/81-147-------------FTVD--KIL-I-D-G------------------.NEYVSSD-----E---IRK----..LV------
FTSQ_SHEON/52-121-------------LPIE--AVA-I-K-G------------------ERTYTTDK-----D---IQI----ALQD------
DIVIB_BACSU/54-123-------------SKVS--TIS-V-T-G------------------.NENVSKK-----E---IID----LSDI------
FTSQ_STRCU/57-126-------------LRLE--RVS-V-S-G------------------.TRMLTPA-----D---VRE----AASV------
FTSQ_RHIME/89-157-------------FAIE--DVR-V-S-G------------------.NAQTSEI-----D---ILQ----QLGL------
Q5P6Z9_AROAE/37-106-------------FPLR--EVV-V-L-T------------------PPAQVTTA-----Q---LEY----VART------
O83403_TREPA/55-123-------------TSFA--KVE-F-S-G------------------.NVTISPE-----Y---LMK----AAGL------
DIVIB_CLOTE/54-122-------------FNVK--IVE-V-K-D------------------.NKSIKKE-----S---IIK----SSQI------
FTSQ_ECOLI/55-126-------------LPLS--KLV-L-T-G------------------ERHYTRND-----D---IRQ----SILA------
FTSQ_STRGR/5-74-------------LRVE--KVG-T-S-G------------------.VEVLTRE-----E---VEA----VAAV------
Q8D2Z8_WIGBR/41-111-------------FPIS--HII-I-K-G------------------NMNFTPQE-----D---IRQ----IFLN------
Q8RMK7_AZOBR/99-167-------------FAIA--DVL-V-E-G------------------.RTETDPA-----S---ILR----VLGV------
Q83N06_TROWT/56-124-------------MSLR--SIR-V-A-G------------------.NMQVKTD-----D---IVA----..AL------
Q8E185_STRA5/122-193-------------SKQK--TIT-V-S-G------------------.NQHTPDD-----I---LIE----KTNI------
Q5SJC7_THET8/24-91-------------VPVE--EVR-V-E-G------------------.LRHLSRE-----A---VLQ----TLRL------
Q9F1M8_SHEVI/67-136-------------LPIE--AVA-V-K-G------------------ERIHTSDK-----E---IRT----ALQD------
Q5R0N0_IDILO/43-112-------------VPLA--ELS-V-Q-G------------------ELHYTASE-----E---VRQ----AL.T------
Q6F706_ACIAD/59-128-------------AKIA--DLS-I-V-G------------------TRSVVEQN-----Q---LQQ----HIQP------
Q728V1_DESVH/71-139-------------FAIR--DVE-I-S-G------------------.NLMLSKD-----E---ILA----TAGL------
O07671_ENTHR/66-137-------------SRLQ--GIT-V-S-G------------------.NQMITSQ-----T---AIA----DSHL------
FTSQ_HAEIN/54-124-------------KPIS--AFA-L-V-G------------------QNTFTTAD-----D---IKE----SLLK------
DIVIB_STRR6/153-223-------------ATMK--DIR-V-E-G------------------.TVQTTAD-----D---IRQ----ASGI------
Q9CPA8_PASMU/55-125-------------KPIS--AFI-L-T-G------------------TPTFTTYD-----D---IRD----VVLK------
Q7MNU9_VIBVY/53-123-------------LPLS--KII-L-Q-G------------------DLQYVTAD-----D---VQH----AFGS------
O07324_STAAU/195-263-------------SKIA--HVN-I-N-G------------------.NNHVSTS-----K---INK----VLGV------
Q73IQ7_WOLPM/61-128-------------FSID--EVV-V-S-G------------------.NKFTNKK-----D---ILS----..LT------
Q7NQ02_CHRVO/37-106-------------FPVK--KIR-I-Q-G------------------DMNRVTAE-----Q---LKF----IAEH------
Q5YYX7_NOCFA/42-110-------------LSVR--TVD-V-E-G------------------.LRAVPED-----E---VMA----QLQV------
Q8DVE1_STRMU/126-197-------------SRQK--EIT-V-S-G------------------.NKNAIES-----Q---LIE----ELGI------
Q82AD6_STRAW/56-125-------------LRVE--RVS-V-S-G------------------.TRVLTEG-----Q---VRE----AADV------
Q8YQH2_NOSS1/56-126-------------KTPE--QVL-M-K-S------------------DNQLLSQE-----A---IKS----LLVL------
Q98KB7_RHILO/92-160-------------FAVD--QVK-V-V-G------------------.NRQTSEI-----D---ILD----RLEL------
Q5XB06_STRP6/125-196-------------SKKK--EFS-V-R-G------------------.NHQTNLD-----E---LIK----ASKV------
FTSQ_COXBU/46-115-------------LPFR--QIK-I-T-V------------------SSDHIKMA-----E---LKD----IVVH------
Q5HQ08_STAEQ/219-287-------------SKIS--NVN-I-K-G------------------.NNNVSTS-----K---IKK----ELNV------
Q57352_BORBG/33-101-------------FLIR--YIS-I-N-N------------------.DISLSKE-----D---IIK----ISGI------
Q8DMI0_THEEB/61-130-------------RGPE--QVL-I-R-G------------------.NQLLKTE-----A---LQA----QLPL------
Q72N66_LEPIC/45-113-------------RELN--KLI-I-T-G------------------.HEKLKTE-----E---IVR----MLEI------
O07110_ENTFL/126-197-------------SRLS--EVT-V-S-G------------------.NKSVESQ-----A---IIQ----QSKL------
FTSQ_BARBA/87-155-------------FLVT--HVD-M-S-G------------------.NKRMMEQ-----D---ILK----VLGL------
Q87WY8_PSESM/73-142-------------RPIA--RIN-V-Q-G------------------DLSYISQQ-----A---VQQ----RIAP------
Q5FUJ1_GLUOX/84-152-------------LPIR--HIV-I-N-G------------------.RGMTSEA-----S---IQE----ALGT------
DIVIB_GEOKA/50-118-------------GAVG--HVE-V-S-G------------------.NRHLTAE-----R---IIS----LSGI------
Q87AG2_XYLFT/34-103-------------WPLA--KLR-V-S-G------------------DFKRVSAE-----E---LRA----VVLP------
Q7V8M1_PROMM/59-128-------------NNAK--QIH-V-Q-G------------------.SRNIQTN-----T---VIK----AGAL------
DIVIB_LACLA/153-224-------------SKIS--TFS-V-S-G------------------.NANESSE-----Q---VAL----ASGI------
Q65RZ0_MANSM/55-125-------------KPIS--SFA-L-V-G------------------TPQYTTNA-----D---VRD----MILK------
Q6AE66_LEIXX/96-164-------------LALK--NIE-V-T-G------------------.TERLDPQ-----A---IRQ----KLGD------
P73457_SYNY3/54-123-------------RSDR--QVE-F-L-G------------------.NKLVSRE-----T---LYE----DLDL------
Q73NF1_TREDE/62-130-------------SSIA--AVN-I-S-G------------------.CSDLSSI-----E---VKK----LAGI------
Q6AJ56_DESPS/51-120-------------FRVE--EVK-F-S-G------------------.QHRMSSA-----D---LYR----QTGI------
Q9RWN7_DEIRA/101-171-------------VPVR--QVV-V-S-G------------------.NTHLAAD-----E---VRR----LAGL------
Q604W1_METCA/56-127-------------RRVQ--TVR-V-K-G------------------AFRYIDPA-----S---VED----TVRE------
Q62GT0_BURMA/37-106-------------FALR--EIR-I-D-G------------------DTEHINAP-----T---VRA----GVVG------
Q6NGD0_CORDI/29-97-------------MTVQ--KIE-I-D-G------------------.AVRSSAE-----E---VET----ASGI------
Q5PBK1_ANAMM/65-133-------------FSTR--EVV-I-R-G------------------.NSVVSTA-----E---ILN----..MI------
FTSQ_RICTY/72-140-------------FRLE--NVI-I-E-G------------------.QQNVDEL-----T---ILK----VLNA------
Q7VMY3_HAEDU/61-131-------------TPIR--SFA-L-T-H------------------KTRFTHNA-----D---IRE----KLSI------
Q8CXI4_OCEIH/50-118-------------SHIR--TIE-V-N-G------------------.NTFLNEE-----K---IIK----YSEL------
Q5WFH0_BACSK/51-119-------------SGVK--TIH-I-D-G------------------.NQLVAEE-----T---ILK----ASGL------
Q7U5Q7_SYNPX/51-120-------------KGSD--QVV-V-R-G------------------.DTTFNST-----I---VSE----VAQF------
Q5WTJ0_LEGPL/39-108-------------FPIT--TIK-V-A-A------------------TYEHITHK-----E---LEN----VLAK------
Q636B8_BACCZ/53-121-------------SNIK--KIS-V-F-G------------------.NHYMTDE-----Q---VMK----ESGV------
FTSQ_BLOFL/45-115-------------GPLS--YII-V-T-G------------------NRFFTTND-----D---INY----IILK------
FTSQ_VIBCH/52-122-------------LPLS--KLV-L-Q-G------------------DLHYVSAL-----D---VQR----VLAR------
Q6N416_RHOPA/110-178-------------FRIK--QVA-I-A-G------------------.RKQLTQD-----E---ILA----IGGI------
FTSQ_NEIG1/37-106-------------LPVK--QVS-L-K-G------------------.NLVYSDK-----K---ALG----SLAK------
Q6FZ75_BARQU/88-156-------------FVVT--DID-M-S-G------------------.NKRVVQQ-----E---ILR----ILGL------
Q67Q43_SYMTH/58-125-------------FRLE--RVQ-I-G-G------------------.NERLSQA-----E---VMA----IAGV------
FTSQ_GEOSL/67-135-------------LPLK--EIE-V-S-K------------------.LQRLKRD-----D---VIA----QAGV------
Q5M0D3_STRT1/104-175-------------SKQK--ILT-V-S-G------------------.TKNALPE-----D---VKV----ASGI------
Q9CCE5_MYCLE/151-219-------------MSVR--NIV-V-T-G------------------.IETVTRE-----E---VLD----AAGV------
Q5GS65_WOLTR/61-128-------------FSID--EVV-V-N-G------------------.NKFTNEK-----D---ILN----..LV------
FTSQ_CORGL/30-98-------------LKVG--NIE-V-T-G------------------.ATRTDPD-----Q---VLE----VSGI------
Q8R9G8_THETN/29-97-------------FKIK--SIK-V-V-G------------------.NQILSYN-----D---IKE----ISKI------
Q8XJA3_CLOPE/42-109-------------FNIK--KVN-V-N-N------------------.NNVITKE-----S---VIG----ENDI------
Q57C82_BRUAB/68-136-------------FAIE--DIK-V-V-G------------------.NNETSDI-----D---ILG----QLNL------
Q93JX7_PROMR/60-129-------------INSN--QIH-I-K-G------------------.AANTPNR-----E---IVK----AMGI------
Q7NNV9_GLOVI/69-138-------------RSAG--AVR-I-V-G------------------.YERLQLD-----Q---LQR----VLKL------
Q6A9Q0_PROAC/48-116-------------LCVN--TIE-V-H-G------------------.TRLVTAS-----Q---VEQ----VAKI------
Q5FKV1_LACAC/77-148-------------ANIS--TVK-V-V-G------------------.TTDLPVK-----E---IVK----ISKI------
Q8FNU2_COREF/30-98-------------FKVE--SIE-I-N-G------------------.AVRTDTE-----V---ARE----VSGI------
DIVIB_CLOAB/41-109-------------FNIK--YIN-V-E-G------------------.NKIIKSD-----N---IIE----NSKL------
Q6LMF8_PHOPR/51-121-------------LPLS--QLV-I-Q-G------------------DLDYLTTD-----D---VRQ----AIWH------
Q9RNN0_ZYMMB/40-108-------------FSVR--HVE-I-V-G------------------.LHHMDRQ-----A---IYD----IAST------
Q9K9T2_BACHD/50-118-------------SHIR--SIK-V-E-G------------------.NQFVDDE-----T---IIE----ASKL------
FTSQ_MYCTU/124-192-------------MSAR--EIV-I-I-G------------------.IGAVSRE-----E---VLD----AARV------
FTSQ_CAUCR/94-162-------------FRLK--TVH-I-R-G------------------.ASATAQA-----D---ILK----ASGL------
Q6G1J3_BARQU/39-106-------------SVVR--SIE-V-R-G------------------.NKFVSAQ-----A---IRD----NIGI------
Q71XX9_LISMF/51-119-------------SKLD--KIA-V-S-G------------------.NKQLTEN-----E---VRK----ESGL------
Q45306_BACLI/54-123-------------SKVS--TVE-I-K-G------------------.NKNVSKD-----Q---IIS----LSSI------

PF06898

YQFD_BACSU/2-387KNKWLSFFSGKVQLELTGRGIERLLNECTRQGIPVFHVKKKK.EAVSLYIQLQDVHAFRR---VRSKFKCKARFINRKGF
Q9KD59_BACHD/4-388KAMWKQLVRGYVRVQIDGVYGERFLNRCIQKNVAIWSIKRMGAERIVCFMDMQDAKKIRP---LVKQTECKVTFVERLGY
Q8XIU3_CLOPE/2-375..NLEFLKKGQVKVEIKTFDINKLLNVLWRNGINVENVRKIDVVTLTLNVDYSDYGKLKT---YVKRLNGKVKIISSKGM
Q8EPX5_OCEIH/2-398KRNYGKRIRGYVTVRVSGEKPELFFQKCANEGILVWDAKKISSKDCVAKLKLQDIKKLKQ---LRRRTLYKISFEERKGL
Q8RB55_THETN/8-388SIKLWNFLRGYVIIKVEGLAIEKFLNLVMVNEVYIWDVERKNYTTLTAKVSTKAFKEVLQ---YAKKTGCSVFIVSKNGL
Q892R7_CLOTE/6-378KINLEKFRKSNITLEIQSLIPEKIINLAWQSGIEIKNIERKNITTLKLTINLKDYKKLEK---IAKKTQCKFKIVERTGI
Q97JI9_CLOAB/2-374KLKFESFKNTYVVVEVRTANIEKFINLLWRNKIEVMSMIRVNANLIRFKVALKNYRKTIK---LVKAVKGKIKVIERHGT
Q9S6M8_BACME/2-386KNGWTNFVIGTVRIRIVGKGIERFLNNCVRQQIMISNVHKVDGQLATRTILLKDVKKIRI---LIRNADCKIYFIRRRGF

PF07244

Q5NND8_ZYMMO/246-316.....L....RA--G.............QRYN--SEILDS....AIQDLY.......ATQL.....FSDV.......VI.
Q5NND8_ZYMMO/317-394.....L....AP--R.............QIFT--RDAVRA....DVSRII...ELYRRQGR.F...AATV.......EP.
Q5NND8_ZYMMO/397-485.....T....KQ--ARFWR....FMSSGASYD--PDKLAY....DQQKLR...QFYLVNGY.A...DFRV......VSA.
Q5NND8_ZYMMO/488-566.....I....KK--G.............QWYN--AKLVED....TIDTLT...EAAGLMGY.....TPDV.......NP.
Q5NND8_ZYMMO/569-643.....L....AE--G.............DVFN--LLRVKR....SRDRVQ.......SLGY.F...QDRL.......EI.
BAMA_HELPY/70-137.....I....RV--G.............DIVD--SKKIDT....AVLALF.......NQGY.....FKDV.......YA.
BAMA_HELPY/138-216.....I....KK--G.............DTFD--EQKLEH....AKTALK...TALEGQGY.Y...GSVV.......EV.
BAMA_HELPY/219-309.....N....KQ--RDFMGW..MWGLNDGKLR--LDQLEY....DSMRIQ...DVYMRRGY.L...DAHI......SSP.
BAMA_HELPY/312-391.....V....KR--K.............DVFN--IEHLRA....DAQILK...TEIADKGY.A...FAVV.......KP.
BAMA_HELPY/394-466.....L....GP--K.............DKYN--LTKLRN....SENSLR.......RLGF.....FSKV.......KI.
O30912_NEIME/23-90.....V....KV--G.............DTYN--DTHGSA....IIKSLY.......ATGF.....FDDV.......RV.
O30912_NEIME/91-171S..FGL....AQ--S.............QYFN--QATLNQ....AVAGLK...EEYLGRGK.L...NIQI.......TP.
O30912_NEIME/174-262.....L....TE--GGIWT....WLTRSNQFN--EQKFAQ....DMEKVT...DFYQNNGY.F...DFRILD..TDIQT.
O30912_NEIME/265-344.....M....KP--G.............KWYE--RQQMTA....VLGEIQ...NRMGSAGY.A...YSEI.......SV.
O30912_NEIME/347-421.....Q....ME--S.............APYD--TSKLQR....SKERVE.......LLGY.....FDNVQF..DAVPL.
O32625_HAEIF/22-89.....V....RA--G.............QRVT--DNDVAN....IVRSLF.......VSGR.....FDDV.......KA.
O32625_HAEIF/90-170A..NGF....KV--G.............DILI--REKLNE....FAKSVK...EHYASVGR.Y...NATV.......EP.
O32625_HAEIF/173-259.....L....QP--DSWW......KLWGNKFE--GAQFEK....DLQAIR...DYYLNNGY.AKAQITKT.......DV.
O32625_HAEIF/262-341....AL....HL--N.............DTFR--RSDIAD....VENAIK...AKLGERGY.G...NTTV.......NS.
O32625_HAEIF/344-418.....Q....QE--G.............TWYN--SQLVEL....GKIRLD.......RTGF.....FETV.......ENR
O51735_BORBU/30-102.....P....YI--G.............VSYS--NEIFDK....LQIDLY...SLDY.........FSGL.......IK.
O51735_BORBU/103-180.....I....KT--N.............EPLN--LASVNK....GIGKLE...EMYKDMGY.L...EVSA.......NF.
O51735_BORBU/183-274.....L....FS--D.............GKYL--KSNVDK....DKRQLE...SFYKNNGY.I...DVKIIN..STVDI.
O51735_BORBU/277-353.....F....SE--G.............DIFN--DSKFEQ....DFVKIK...ESYFREGY.I.....FT.......EI.
O51735_BORBU/356-429.....L....QE--G.............DVFS--LDKFKM....GMANLQ.......QLGY.....FSNV.......IP.
O66463_AQUAE/72-149.....I....EE--G.............IPLI--EDNPKT....YEEILE...KYYKEIGF.L...NADT.......KV.
O66463_AQUAE/152-225.....L....VI--G.............SIFD--IDKVED....AEENLE...NFYRKKGF.....FESF..........
O67326_AQUAE/18-90.....V....RK--G.............SEFS--LERIRK....DIRKLY.......RTGL.....FTKV.......EA.
O67326_AQUAE/203-287.....L....KE--PNIFL.....FRLHPAFS--EETLKE....DVKKIE...EFYKNEGF.L...EVEV.......SY.
O67326_AQUAE/290-371.....E....RK--G.............RYFR--REVIEK....IKNRIR...EKYAEIGF.L...NTSV.......EE.
O67326_AQUAE/374-446.....V....QE--N.............ELAL--KKGIER....SKTRIM.......NLGY.....YEDV.......QI.
O68454_TREPL/31-105.....Q....YK--G.............QKWT--YELYLE....ILQKVY.......DLEY.....FSEV.......SP.
O68454_TREPL/106-182.....L....KK--G.............DIYN--EVKMKV....DQESLR...RHYLDQGY.A...AVKI.......SC.
O68454_TREPL/185-273.....T....QE--ARF........LTSGVFK--ENALEA....DKAAVH...SYYAERGY.I...DARVEG..VAKTV.
O68454_TREPL/276-354.....L....KR--G.............AIMN--MVAFEQ....GFQALA...DAYFENGY.T...SNYL.......NK.
O68454_TREPL/357-430.....L....KP--G.............DVFS--KSKFTD....SLRNLF.......NLRY.FSSLVPDV.......RP.
O84244_CHLTR/104-182.....L....YK--N.............DLFD--RELFFK....NFDALR...TLYLKRGY.Y...DSQL.......SY.
O84244_CHLTR/185-272.....T....KQ--YSTTTS...WFTGAGVYH--PDMVEQ....DLFAIT...NYFQNKGY.A..............DA.
O84244_CHLTR/275-353.....V....GP--N.............SLYC--PDKIWT....GAQKIR...SAYARYGY.V...NTNV.......DV.
O84244_CHLTR/356-435.....L....FP--G.............DTFD--RLKLEG....TETRLR.......NTGY.....FKSVSV..YTVRS.
BAMA_SHIFL/24-91.....V....RT--G.............DTVN--DEDISN....TIRALF.......ATGN.....FEDV.......RVL
BAMA_SHIFL/92-172A..SGV....RV--G.............ESLD--RTTIAD....IEKGLE...DFYYSVGK.Y...SASV.......KA.
BAMA_SHIFL/175-263.....L....RD--EVPWW....NVVGDRKYQ--KQKLAG....DLETLR...SYYLDRGY.A...RFNI......DST.
BAMA_SHIFL/266-344.....I....EP--G.............ELYN--GTKVTK....MEDDIK...KLLGRYGY.A...YPRV.......QS.
BAMA_SHIFL/347-421.....Q....ME--G.............AWLG--SDLVDQ....GKERLN.......RLGF.FETVDTDT.......QR.
YTFM_ECOLI/189-263.....F....KE--G.............DEYE--SKDLAE....LNRRLS.......ATGW.....FNSV.......VV.
BAMA_BUCAI/24-91.....F....RI--G.............STIS--QYDVKN....SIKSLF.......KTGK.....FEDI.......KV.
BAMA_BUCAI/92-172.....I....ET--G.............KSFN--NFFTNV....LTKTIK...DFYLDIGR.C...KPDI.......KI.
BAMA_BUCAI/175-263.....L....QD--YHSWW....NLLSKSTYS--PKELNN....DLEHLK...NFYLSNGY.Y...YFNV......NTK.
BAMA_BUCAI/266-344.....I....NP--N.............EFYN--RDKIDI....IVNKIT...RFLSEYGY.V...NTKV.......IV.
BAMA_BUCAI/347-421.....Q....ME--G.............KYFN--TKLVEL....GKKLLE.......KTKY.....FSDV.......KI.
P73472_SYNY3/260-331.....T....QP--G.............RTTT--RTQLQE....DVNAIY.......ATGY.....FSNV.......RV.
P73472_SYNY3/425-496.....L....KP--G.............DVFN--RNRAQT....DLQRVY.......SLGL.....FEDV.......RLS
Q44629_BRUAO/39-106.....I....RP--G.............KAFT--SADIDA....AVQRLF.......AMGL.....FSDV.......RI.
Q44629_BRUAO/107-184.....L....KP--R.............APFD--MATMEA....DKEAIK...AAYSHIGR.T...DATV.......NA.
Q44629_BRUAO/361-434.....L....NE--G.............DAFN--QVMVQR....AKRRLE.......ALDF.FQTVNIST.......AP.
Q51930_PASMD/21-88.....V....RV--G.............QRAT--DNDIAN....VVRKLF.......LSGQ.....YDDV.......KA.
Q51930_PASMD/89-169A..NGF....KV--G.............DVLN--RAKLEE....FRKGIV...EHYNSVGR.Y...NAKV.......DA.
Q51930_PASMD/172-247.....L....QT--DSWW......KLFGNKFD--QTQFNK....DLETLR...SYYLDRGYAQ...FQIL.......DT.
Q51930_PASMD/341-414.....Q....QE--G.............AWLS--SELVEL....GKLRLD.......RTGY.FESVETKT.......EA.
Q57CY5_BRUAB/278-357.....T....RT--G.............KPYS--AKEIED....SVLSVT...ESVAGSGY.A...FAKV.......EP.
Q57FW8_BRUAB/233-307.....L....KP--G.............QEYD--PDDIEN....AKKRLGR.MEVFRAMTF.....EEAD.......KI.
Q5DZL2_VIBF1/357-428.....F....EQ--G.............TLLS--SDYIED....KIHALYA.TNRFETITY................LV.
Q5E2U2_VIBF1/342-414.....L....EE--G.............RSYS--ADELEE....HIRDLYV.IDRFERVDY.Y...YQEN.......EE.
Q5E3E7_VIBF1/24-91.....V....RV--G.............DTMS--QQDVAQ....VIQALF.......ASGN.....FEDV.......KV.
Q5E3E7_VIBF1/92-172A..SSI....RV--G.............EALD--RTTLSN....IEKGLE...DFYYSVGK.Y...NATV.......HA.
Q5E3E7_VIBF1/175-263.....L....NV--DVAWW....NFLADEKYQ--KQVLAG....DIEALR...SYYLDRGY.L...KFQV......DST.
Q5E3E7_VIBF1/266-344.....F....EN--G.............EVYN--GSAVTS....LEENIK...RILGEAGY.A...YPQV.......RT.
Q5E3E7_VIBF1/347-421.....Q....ME--G.............AWLN--SKSIET....GKNRLN.......RLGF.....FETV.......DV.
Q5E819_VIBF1/104-185.....L....NL--G.............QVIN--HGRYES....LKSTLQ...NLALRKGY.F...DGDFTT..NRLEI.
Q5F5H0_NEIG1/248-322.....F....QP--G.............TPYD--LDLLLD....FQQALE.......QNGHYS...GASV.......QA.
Q5FGI9_EHRRG/23-91.....V....NL--E.............DNIK--ESTINQ....IIKNLY.......STQL.....FSEV.......EV.
Q5FGI9_EHRRG/92-170.....L....KK--L.............GVFT--KSKLQR....DISDLV...SLYQTKGK.L...GVTI.......SH.
Q5FGI9_EHRRG/173-260.....S....TE--YYPYK....IFNSSTKFA--PERLML....DQAALY...NFYTSKGF.I...DFKV......KSA.
Q5FGI9_EHRRG/346-418.....I....SE--G.............DIYN--ASIINR....SYKNIL.......GLGF.....FDSV.......NV.
Q5FPE9_GLUOX/347-432.....L....KE--G.............ELYR--PSRIEA....ARQDLA.......STGVFA...SVQVRNAPPIITL.
Q5FPY9_GLUOX/49-116.....A....QP--G.............DTFN--QDDLDR....SLKTLY.......ATGL.....FKDV.......TL.
Q5FPY9_GLUOX/117-194.....L....RP--R.............AVFS--SQTTAA....DRQKIL...NQYAGKAR.F...GATV.......TP.
Q5FPY9_GLUOX/197-285.....S....KE--TIWYR....FFSSSDEYN--PERVKY....DAELLR...RFYLHNGF.V...DFHM......VDA.
Q5FPY9_GLUOX/370-443.....M....AE--G.............DPYT--PFDRKY....SKLGLQ.......DLGY.....FSSV.......SV.
Q5GTM8_WOLTR/28-96.....L....EP--D.............SYVN--DDDIDS....IIKSLY.......KTKL.....FASV.......HA.
Q5GTM8_WOLTR/97-175.....S....KP--L.............TIFT--ETKLQS....DLVNLV...TLYRHNGK.I...GVKV.......EY.
Q5GTM8_WOLTR/274-352.....K....ED--N.............KVFD--RVKVSN....AVEKIN...KYLNEIGY.I...FAKV.......NP.
Q5GTM8_WOLTR/355-427.....V....AE--G.............DAYN--TSEVQK....SRRRLI.......GSDF.....FETV.......KI.
Q5GUR4_XANOR/127-208.....P....RE--G.............QVFS--HPQYEA....SKVRIT...RRLAERGY.F...DADL.......TQ.
Q5H1E9_XANOR/59-126.....V....NR--G.............DTVD--DAKVAD....AIRALY.......RTGF.....FEDV.......QL.
Q5H1E9_XANOR/127-207D..IGL....TE--G.............GTFD--RLSLDR....VTQELT...RQYNNRGK.Y...NVEI.......TP.
Q5H1E9_XANOR/210-298.....S....KE--HNWAS....WYRRDDQYS--KEKMSG....DLEKLN...SWYLDRGY.V...DFSI......DST.
Q5H1E9_XANOR/301-379.....P....KA--G.............DIFS--RALLEH....TSDAIT...NTLSNVGY.A...FAKV.......NP.
Q5H1E9_XANOR/382-456.....Q....FE--N.............TWYS--QAAIDR....SKIRLQ.......RLGY.....FESV.......EV.
Q5HX37_CAMJR/18-85.....L....KI--G.............EEIN--PAKINT....AILNLY.......KQNY.....FENI.......AV.
Q5HX37_CAMJR/86-164.....I....KR--G.............TLLD--EGSIKE....AIERIK...AYYEAKSY.F...DTIV.......EY.
Q5HX37_CAMJR/167-257.....N....KE--KEFMGW..MWGRNDGKLK--VFELSN....DSSRIA...DEYMKKGY.L...DVQV......SSP.
Q5HX37_CAMJR/260-340.....S....SA--G.............KTIN--IEDIRK....DVKTIE...TQSADLGY.A...FVEV.......YP.
Q5HX37_CAMJR/343-415.....I....TE--G.............NLYN--RTDLSE....SKNALK.......RTSY.....FDDV.......NI.
Q5LSU6_SILPO/48-115.....I....ER--G.............KTIS--AGALND....AYQRLL.......DSGV.....FETV.......EL.
Q5LSU6_SILPO/116-193.....S....QS--R.............RVFT--PEQAER....DAATIA...EIYSTQGR.V...AATV.......VP.
Q5LSU6_SILPO/196-284.....T....KQ--AGFLR....TFIRSDTFI--ADRIEF....DKQVLR...DFYLSRGH.V...DFRV......NSA.
Q5LSU6_SILPO/369-442.....T....VE--G.............DPFN--PREIRE....SAERIR.......ALGFFG...DANV.......ET.
Q5N4G5_SYNP6/1-77.....T....QA--G.............ATST--RTQLQN....DVNAIF.......GTGL.....FSNV.......QV.
Q5N4G5_SYNP6/78-153.....D....DY--G.............KILN--LQTLQA....RIRTLN...TWYRENGYVL...AQVV.......DA.
Q5N4G5_SYNP6/165-242.....F....KE--G.............DVFN--RPQAEA....GLRRIF.......GLGL.....FSDV.......RL.
Q5NEP7_FRATT/28-95.....Y....KK--G.............SYIT--PEDTNQ....IINNLY.......GTGF.....FNSV.......DL.
Q5NEP7_FRATT/96-176D..AGI....YV--G.............NVYN--PNTMFL....LKQSLL...NQYSMMGL.Y...GAKI.......EE.
Q5NEP7_FRATT/179-270.....F....EV--PSIWNLW.GFLAPFDSYS--PDGMNQ....SVQGLT...NYYLDRGY.L...DFKV......TSK.
Q5NEP7_FRATT/273-351.....I....KQ--G.............EVFS--KSKLVQ....TVEGIK...TLLGSKGY.A...FATV.......NP.
Q5NEP7_FRATT/354-428.....Y....YE--Q.............SQYN--KEAIDK....SQRRLE.......QLPYVG...AADM.......EL.
Q5NNB2_ZYMMO/333-411.....F....KE--G.............QRYD--SQMVDD....LRQAL.......AATSL.F...SHVS......VEP.
Q5NZG7_AROAE/25-92.....V....RV--G.............ETFT--EAQAAE....AIRGLF.......ATGF.....FKDV.......RI.
Q5NZG7_AROAE/93-173..........EV--GLA.........ESRIFD--RSLLER....AEQELK...RQYLSRGK.....YAAV........I.
Q5NZG7_AROAE/176-264.....T....TP--GWLTW.....YTKNDQYS--RQKLAA....DLENLR...SYYLNRGY.L...DFNIDS..TQVSI.
Q5NZG7_AROAE/267-345.....I....KP--G.............EIFS--REKLTE....TTKAVA...DRLGNEGY.A...FANV.......NA.
Q5NZG7_AROAE/348-422..........ME--G.............AWYD--AEEINR....SRTRID.......RLGH.....FEEV.......TV.
Q5P9S8_ANAMM/28-95.....V....PL--T.............GDVT--QPEIDE....AIKNLY.......ATSL.....FSRV.......SV.
Q5P9S8_ANAMM/96-174.....M....KK--M.............SIFT--EAKLKR....DLSTLH...ALYQSRGM.L...GAKV.......SY.
Q5P9S8_ANAMM/177-268.....L....KE--GFGL......FGGSTKFF--AERLVA....DQSILR...EFYTSRGF.L...DFRVKS..VVSEV.
Q5P9S8_ANAMM/355-427.....I....HE--G.............DVYS--TGAVRQ....SRKRLA.......DMDF.....FETV.......DV.
Q5R0Z1_IDILO/25-92.....V....RV--G.............DEVS--ELQIRS....AIRSLY.......SSTH.....FDYI.......DAR
Q5R0Z1_IDILO/93-173.....I....VT--G.............EPLD--RTTISG....IEKGLE...DFYHSVGK.Y...NASV.......EV.
Q5R0Z1_IDILO/176-264.....L....RD--SLPWW....NFIGEKRYQ--KQQLSG....DLETLE...SFYRDRGY.L...RFRV......ESV.
Q5R0Z1_IDILO/267-345.....I....EK--G.............TLYN--AAQVTY....IEDMIS...RFYGRYGY.A...YPEV.......RA.
Q5R0Z1_IDILO/348-422.....Q....LE--G.............AWLS--DSNIEQ....GKVRLE.......RLGY.....FETVET..STERV.
Q5SKT2_THET8/83-163.....I....GK--G.............ATYN--PVRAQE....AAEALA...RAYRQAGFPF...TPKV.......AV.
Q5SKT2_THET8/164-238.....A....LK--G..............SFD--FAKYQE....ALRAIA...KRYEEAGY.R...FSGP.......DP.
Q5SKT2_THET8/375-450..........KP--G.............SLLN--VQELRK....AIARLM.......ATGLLAEPPRVSL.......AP.
Q5UCE9_LEPIR/114-187.....F....KQ--G.............DLFN--SILVNR....SRERIF.......NLGY.FKEVNFNM.......RP.
Q5WVP5_LEGPL/184-255.....F....DP--G.............QPYA--TDQVLK....LNDYLS.......NSGY.....FSSV.......LV.
Q5WZ37_LEGPL/30-97.....V....QV--G.............EEIS--SSSTAQ....IIRALY.......ETGF.....FQSV.......SL.
Q5WZ37_LEGPL/98-178E..MGL....VK--G.............RVFQ--RSSLER....LEKELK...QAYTARGK.Y...NSRI.......ET.
Q5WZ37_LEGPL/181-269.....L....ST--SNLFT....YFTKKDQYS--KAGMDA....SLEALR...SFYLDRGY.L...KFNV......VSS.
Q5WZ37_LEGPL/272-350.....V....KK--G.............DIFS--RKKVTE....SISAIG...LALGDVGY.G...FPAI.......NA.
Q5WZ37_LEGPL/353-427.....Q....DE--G.............GLLS--LHNIKE....SERQLR.......MLGY.....LKNI.......DV.
Q604T9_METCA/56-123.....V....RE--G.............DTLD--EKRSAE....VIRALF.......KTGF.....FKDV.......RL.
Q604T9_METCA/124-204G..IGL....AE--G.............KVFD--RQILDK....VEQELR...RQYYSRGK.Y...SLKI.......DS.
Q604T9_METCA/207-295.....S....TS--NLLSF.....YTKDDQYS--KQKLSA....DLERLR...SYYLDRGY.V...NFEIES..TQVSI.
Q604T9_METCA/298-376.....I....GP--E.............DIFS--RKLATE....TQKGIS...DRLGEEGY.I...FANV.......NM.
Q604T9_METCA/379-453.....Q....ME--A.............AWAS--TAKIER....SKTRLE.......RLGY.....FQDV.......NV.
Q62CQ1_BURMA/318-390.....V....KP--G.............DVYD--PQAVSA....DLLSLT.......TSGN.....FENV.......TQ.
Q62JD2_BURMA/31-98.....I....KQ--G.............DTFT--DGKASE....AIRALY.......ATGF.....FNDV.......RI.
Q62JD2_BURMA/99-179A..VGL....SQ--G.............RYYD--KALVDK....AEQELK...RQYLTRGF.Y...AAEV.......ST.
Q62JD2_BURMA/182-270.....S....TP--NWFSW.....YTKNDLYS--KEKLTG....DLENVR...SYYLNRGY.L...EFNIES..TQVSI.
Q62JD2_BURMA/273-351.....I....KP--G.............DRFS--AEKLQQ....TTKAIV...DKLGQYGY.A...FATV.......NA.
Q62JD2_BURMA/354-428.....Q....LE--S.............SWFD--SSRLAL....SKDRVN.......RLGY.....FTDV.......DV.
Q62LE4_BURMA/222-296.....L....AA--G.............EIYD--AKRITE....LQRQLQ.......NTPY.....YASV.......AI.
Q64Z23_BACFR/5-84.....M....IK--G.............SQIT--PNLVDR....AKVLSK...RYFDDKGF.K...NAEI.......TI.
Q64Z23_BACFR/87-175.....MKKTNEK--GKLLN.....LFRTKKFV--NEKYEE....DKQLII...DKYNELGY.....RDAR.......IV.
Q64Z23_BACFR/178-259.....M....KK--G.............DVYN--QKLLNERLSTDEDAIG...NLYYNNGY.L...FYTL.......DP.
Q64Z23_BACFR/262-337.....T....RP--G.............ELFS--REDLMR....SMREIQ.......QMGH.FDPENIKP.......DI.
Q65R79_MANSM/21-87.....V....RV--G.............QRAT--DGDIAN....VVKTLF.......ARGY......DNV.......KA.
Q65R79_MANSM/88-168A..NGF....KA--G.............EVLN--REKLEA....FRQGIQ...EHYESTGR.Y...NAKV.......ET.
Q65R79_MANSM/260-339....TI....HV--G.............EMYR--RGELQS....VEEQIK...AKLGERGY.A...NATV.......NV.
Q65R79_MANSM/342-416.....Q....QE--G.............SWLS--SQLVEL....GKVRLD.......RTGF.....YESV.......EH.
BAMA_YERPS/266-344.....I....EP--G.............ELFN--GSKVTR....MEDDIK...KMLGRYGY.A...YPRV.......VT.
BAMA_YERPS/347-421.....Q....ME--G.............AWLG--NDQVEA....GKERLN.......RLGY.....FETV.......DV.
Q66F88_YERPS/190-264.....F....HE--G.............EFYT--SDELAE....LNRRLA.......ATNW.....FNSV.......VV.
Q68XK8_RICTY/26-94.....F....NV--G.............ETYN--NSKEDE....AIKRLY.......ATSL.....FKNI.......NM.
Q68XK8_RICTY/95-172.....T....MS--G.............ESLS--QAKIEL....DVKKIL...EIYKRSGR.F...STKV.......IP.
Q68XK8_RICTY/175-263.....T....KE--SRWFR....FLENNDTYD--PDRVEY....DKELLR...EFYQSVGF.A...DFRV......ISA.
Q68XK8_RICTY/266-344.....I....KQ--G.............KIFN--MKKVDD....IAEKIG...EYFTANGY.S...AVNV.......YP.
Q68XK8_RICTY/347-420.....I....EE--G.............DVIN--RSYIEK....GERNLR.......NLDY.....FEKV.......SI.
Q6ARL5_DESPS/20-91.....S....KA--G.............DIYD--PATLRQ....DLKAIY.......AMGY.....FNDV.......QV.
Q6ARL5_DESPS/92-170.....I....KE--H.............RIIN--PAQISA....AKEAII...SLYESKGF.Y...NCTV.......KS.
Q6ARL5_DESPS/173-259.....T....KE--KSWLT....WLTAAGLLD--MEKIKQ....DGNRLL...AYYNNHGF.L...DAKV......GEP.
Q6ARL5_DESPS/262-340.....V....RN--E.............PYLN--RGLMRD....DIMNIT...DAYSELGY.A...FASV.......KP.
Q6ARL5_DESPS/343-416.....I....VE--G.............GLFD--SAALRK....SNKALQ.......RLGY.....FKEV.......NI.
Q6ATX4_ORYSJ/67-146.....E......--..............LLRA--APTVQD....LLRNASIASARLRQLDV.FDSVNITL.......DA.
Q6D152_ERWCT/230-304.....F....HE--G.............DVYT--SEDLGE....LNRRLS.......ASGW.....FNSV.......VV.
Q6FCG7_ACIAD/28-95.....I....NS--G.............DRVD--DPTIAD....AIRTLY.......ATGL.....FDDI.......KT.
Q6FCG7_ACIAD/96-176K..MGV....VE--G.............DVLK--SSALQT....IETELE...QQYAQQGR.Y...DADI.......KV.
Q6FCG7_ACIAD/179-267..........ES--GWSSI.....VTRNDRYA--REKMAA....SLESLR...ALYLNKGY.I...NFNINN..SQLNI.
Q6FCG7_ACIAD/270-348.....Y....KD--G.............DTYS--QEKVNA....VKQLLL...RKYGNAGY.Y...FAEV.......NV.
Q6FCG7_ACIAD/351-425.....Q....ME--G.............ALAS--NEKIDL....SKIRLE.......RTGF.....FKTV.......DI.
Q6G1J3_BARQU/107-184.....L....KP--N.............ESFN--SAKLSA....DVNVIC...EAYKTVGR.N...NVAV.......TV.
Q6G1J3_BARQU/187-275.....T....KP--SGILS....LLLRGDVYS--EERLAA....DEEALR...RFYYNHGY.A...DFRV......ISS.
Q6G1J3_BARQU/278-357.....T....RP--G.............DVYN--AENIEQ....SVAIIN...NKAADSGY.A...FAKV.......EP.
Q6G1J3_BARQU/360-433.....L....NE--G.............DAYN--QTLVQR....AKRRLE.......SLGF.FKAVNISM.......VP.
Q6LHU2_PHOPR/343-412.....L....QP--N.............QEYS--AEEIEQ....AIDRLY.......AKGI.....FEKI.......TY.
Q6LKQ8_PHOPR/351-422.....L....PV--D.............RVIS--TEELEQ....AVERLH.......AQDN.....FSRI.......TY.
Q6LMH9_PHOPR/358-429.....L....HS--G.............EKMS--SEQLAE....SVRNLY.......ALDR.....FERI.......DY.
Q6LN32_PHOPR/24-91.....V....RV--G.............DNVD--DRDVAE....IIQALF.......ASGN.....FEDI.......KVF
Q6LN32_PHOPR/175-263.....L....KA--DIPWW....NFLADEKYQ--KQVLAG....DLEILR...SQYLNNGY.L...KYKL......DST.
Q6LN32_PHOPR/266-344.....I....KE--G.............DIYN--GAQVTA....LEDAVK...RTLGESGY.A...YPQV.......TT.
Q6MAC6_PARUW/256-330.....W....NQ--G.............ELYD--PKKLEK....TQEALE.......LSGL.....FSSI.......NI.
Q6MAE9_PARUW/137-215..........GI--GC...........FVTFE--RQAFNQ....AFHKLK...AYYIRKGF.F...EAQL.......NY.
Q6MAE9_PARUW/218-306.....K....KY--NIFLS....WFSEEGTYN--EDAIQQ....DRLIIT...NYLQNQGY.A...DASV.......EI.
Q6MAE9_PARUW/309-387.....I....RQ--G.............EFFS--IESIRE....TIETLT...DAYGRLGY.V...DAII.......DF.
Q6MAE9_PARUW/390-467.....M....IP--G.............EIFN--TIKLKA....TEQRLI.......NIGY.....FKHV.......NV.
Q6MKB1_BDEBA/93-170.....V....KA--D.............DVFD--QQTLIE....GGEKLR...QAYRDIGF.Y...NAVI.......DI.
Q6MKB1_BDEBA/419-500.....L....RP--G.............P.LK--LGQIEE....AVARLK...NHYREQGY.....IEML.......LLN
Q6MKB1_BDEBA/503-577.....F....DK--G.............DLLT--PSNLEE....SVARLQ.......RTGF.....FGSV.......EI.
Q6MMX9_BDEBA/48-119.....T....KV--G.............ESYS--AQHIRE....DVQALF.......NMGF.....FNDI.......QV.
Q6MMX9_BDEBA/120-198.....I....KP--Y.............QLLN--MAKVKE....AVEKIQ...KLYEDKGF.F...LAKI.......DS.
Q6MMX9_BDEBA/201-289.....L....TQ--EGGFFS...GISGSGQYK--QEMFER....DVQILR...FLYWNQGY.V...QAKV......DRP.
Q6MMX9_BDEBA/292-370.....I....DD--N.............GVFA--YDVLQK....DISELT...AKYGDLGY.A...YANV.......IP.
Q6MMX9_BDEBA/373-447.....V....HE--G.............ELYN--ETRRRQ....SLENIQ.......RLGF.FEEVNFKT.......SI.
Q6N5Q8_RHOPA/39-106.....P....GP--G.............GRLD--QGSIDD....GLKALI.......ETGL.....FQDV.......RI.
Q6N5Q8_RHOPA/107-184.....S....KP--R.............GTLS--RPMVQG....DALRIA...EIYRRSGR.Y...DVRV.......DP.
Q6N5Q8_RHOPA/187-275.....T....RE--SNLLS....FLGNGDVYD--PDRVEA....DRDLIR...RFYLKHGF.A...DVQV......VAA.
Q6N5Q8_RHOPA/278-357.....V....NV--G.............SLYN--AEALEK....SVEEMQ...IELSRRGY.A...FATV.......RP.
Q6N5Q8_RHOPA/360-433.....I....SE--G.............DAYN--RALVDR....AERRLK.......NLDF.....FKTV.......KI.
Q6Q8T1_9GAMM/23-90.....I....SV--G.............DRID--SRKSYD....IVKSLF.......STEQ.....FDDI.......QI.
Q6Q8T1_9GAMM/91-171G..VGI....KE--G.............EVYK--RSTLER....VKSELV...RSYASNGR.Y...GADV.......EI.
Q6Q8T1_9GAMM/174-262.....L....SE--GSFFS....FLSNDNQYS--REKLKG....DIETLE...SFYRDRGY.L...KFSIES..SQISL.
Q6Q8T1_9GAMM/265-343.....R....LK--D.............TTYS--QAQITS....IEEFFT...NVLGNRGY.A...FAEV.......VG.
Q6Q8T1_9GAMM/346-420.....Q....FE--G.............AWTS--DNSIEA....GKVRLE.......RLGY.....FKEV.......NV.
BAMA_DESVH/59-130.....T....RK--G.............DPID--PAAINK....EIKRIW.......DLGY.....FSDV.......QA.
BAMA_DESVH/131-209.....S....KT--G.............SVLN--DKLLAQ....DLQKVT...ELYRKEGF.Y...LAHV.......TH.
BAMA_DESVH/212-298.....ILALSER--GMFSW.....FTGTGVLK--DELLER....DSAAIT...AYCLNHGY.....VDAL.......VS.
BAMA_DESVH/301-383.....LDDHKKD--N.............QYFA--LDVMQT....DDKLLS...DYYADYGY.A...FAEI.......NS.
BAMA_DESVH/386-459.....I....AD--G.............DMFE--GAKLRR....SNERLN.......RTRY.....FSQV.......DT.
Q72RW5_LEPIC/53-124.....I....KV--G.............KILT--KRILDR....DLKNLF.......NSGF.....FYFV.......DI.
Q72RW5_LEPIC/125-204.....L....KD--N.............EVIT--PQKITK....SRDLIL...QKYRDEGF.F...LAYV.......KV.
Q72RW5_LEPIC/207-299MKEEGV....FE--G.............GNFK--ESSFEK....DKDTIV...AYLKSKGY.L...DAELIR..EGTNW.
Q73G77_WOLPM/28-96.....L....KS--G.............DYIN--DDDIDS....IIKDLY.......KTKL.....FASV.......NA.
Q73G77_WOLPM/274-352.....E....EN--D.............KIFN--RVKINN....TVEKIN...KYLNEKGY.I...FAKV.......NP.
Q73JH4_TREDE/30-104.....S....YK--K.............KPFS--DELYWE....ILQKIY.......ALDY.....FTDI.......VP.
Q73JH4_TREDE/105-183.....V....KK--G.............DIFN--EVNIKN....AERALK...DFYIEKGF.T...KAEI.......SS.
Q73JH4_TREDE/186-274.....S....KE--AWL........LQKGFFR--EDALQA....DKNAIK...LLYGEHGY.I...DAHVET..IKKDI.
Q73JH4_TREDE/277-355.....L....KK--G.............DVFN--LRKFET....GFGDVA...NLYFENGY.T...GNYI.......DK.
Q73JH4_TREDE/358-431.....L....KE--G.............DVFS--KTKLIN....SFRNLA.......NLRY.F...SAVL.......PD.
Q74AT3_GEOSL/27-98.....L....KT--G.............DLLY--AEKVDA....DVRAVY.......KLGQ.....FIDV.......RA.
Q74AT3_GEOSL/99-176.....L....KA--N.............TIFS--QKELTL....AGKRVK...KLYGDEGY.Y...LAEV.......TT.
Q74AT3_GEOSL/179-267.....T....KE--KWFLS....WLTGAGTYK--DEVVKN....DANLIA...DLYFNNGY.V...NVKV......GEP.
Q74AT3_GEOSL/270-348.....L....KS--G.............DVFS--RANLRT....DVMTLT...DLYADKGF.A...FVNV.......TP.
Q74AT3_GEOSL/351-424.....V....AE--G.............ETYS--STGLKQ....SKQRLM.......NLGF.F...EEAA.......IS.
Q7CWM5_AGRT5/240-314.....L....NG--G.............EPYS--PEKLRK....AADRLR.......QLGV.....FSSL.......TI.
Q7MAB6_WOLSU/20-87.....I....KV--G.............DALD--VQKVDR....SIIEFH.......KQGY.....FEDI.......WV.
Q7MAB6_WOLSU/88-166.....I....KK--G.............DVYD--ESKVER....ARKSIM...AALEKKGF.Y...DTVV.......EA.
Q7MAB6_WOLSU/169-259.....N....KE--REFMGW..MWGFNDGKLK--VGELEH....DSFRMK...DYYMKKGF.L...DAEV......SPP.
Q7MAB6_WOLSU/262-341.....L....TE--G.............KRFN--IEKLRK....DMESMK...EVVGDLGY.A...FVRI.......TP.
Q7MAB6_WOLSU/344-416.....L....AP--G.............EMYE--ATKVKN....SKNALK.......RMGY.....FENV.......EI.
Q7MHW3_VIBVY/361-432.....L....ET--G.............RVLK--TGEIEA....AIENLYA.LDRFELISY.H..............YE.
Q7MIG8_VIBVY/24-91.....V....RV--G.............DTVE--QKDVSA....IIKALY.......ASGN.....FEDV.......KVL
Q7MIG8_VIBVY/266-344.....F....EA--G.............ETYN--GSAVTT....LEENIK...RVLGEAGY.A...YPKV.......ST.
Q7MPD6_VIBVY/100-183.....L....KQ--G.............AILN--HGDYDT....LKSSIR...NLALQKGY.F...KGDFIE..TRLEV.
Q7MXJ3_PORGI/45-119.....L....AV--GD...........EVLIP--GDAMSA....AVNRIM.......RQGY.....FSNV.......RI.
Q7MXJ3_PORGI/120-199.....L....RE--G.............IQMT--RNNEDK....VRQIVQ...KYFSEKGY.R...DASI.......RI.
Q7MXJ3_PORGI/302-383.....I....KS--G.............DVYN--QRRLAKRLNEDEDAVG...NLYYNNGY.I...FAWV.......DP.
Q7MXJ3_PORGI/386-461.....T....KP--G.............QLFS--REDIIN....SIRLIN.......QLGH.FDAEKSIP.......RP.
Q7MYW2_PHOLL/190-266.....F....SE--G.............DFYT--SEQLAE....LNRRLA.......ETGW.F...NSAVVS..PDFNS.
BAMA_PHOLL/266-344.....I....EP--G.............SLYN--GTQVTK....MENDIK...NLLGRYGY.A...YPRV.......MT.
Q7NJG9_GLOVI/85-160.....T....RP--G.............QTTT--RTQLQQ....DINAVF.......ATGY.....FADV.......KA.
Q7NVY6_CHRVO/25-92.....V....KV--G.............DTFT--DAKAKE....AIKALF.......GTGF.....FNDV.......RV.
Q7NVY6_CHRVO/93-173..........DN--GFA.........ESLIFD--QALLDG....AVQELK...RQYYSRGK.Y...SVEI.......TP.
Q7NVY6_CHRVO/176-264.....L....TT--GGWLS....WITKDDQYS--KQKLTG....DLEKLK...AFYQNQGY.M...EFGIDS..SQVSI.
Q7NVY6_CHRVO/267-345.....V....KR--G.............DTFN--NEKVTE....SVKALS...DRLGNEGY.A...FANV.......NV.
Q7NVY6_CHRVO/348-422.....Q....LE--G.............APYN--AANVKR....SKERLE.......LLGY.FEDVNVET.......PA.
Q7P0N3_CHRVO/181-255.....F....NP--G.............SPYS--QDKVLA....YQSALE.......QDPH.....FSSVI.....VSA.
Q7P3C7_FUSNV/76-147.....L....KA--G.............EYFS--RSRVED....AQRRLL.......ATGK.....FSEV.......RP.
Q7P3C7_FUSNV/148-222.....T....KP--G.............SVQN--YNNLRE....DRDKIL...GSYQAEGY.T...LVNI.......TD.
Q7PAV1_RICSI/266-344.....I....KQ--G.............KVFN--MKKVND....IAEKIG...EYFTANGY.P...AVNV.......YP.
Q7U8Q8_SYNPX/59-135.....V....RP--G.............SRVT--REELQR....DLNAIQ.......ATGW.....FSDV.......RI.
Q7U8Q8_SYNPX/217-301.....V....QP--G.............DTFN--RNKLEK....DIKRLY.......GTQL.....FSDV.......KVT
Q7UK20_RHOBA/97-179.....T....RK--G.............RFYS--EETVLS....DVSRLN.......DMGS.....FDHV.......TF.
Q7UK20_RHOBA/180-256.....I....TE--G.............DPLS--EFAIET....GKRRLL...DYYHEEGF.N...QAAI.......EA.
Q7UK20_RHOBA/259-346.....S....RG--PMMGI....MSYINNVAD--MKKIDA....DVNVLA...SYYHNLGF.L...TATV.......GR.
Q7UK20_RHOBA/349-427.....L....KA--N.............DTFS--GTKMRK....DIGEIV...YGYGELGF.I...YAEV.......NP.
Q7V0C8_PROMP/84-160.....I....KP--G.............SVIN--NKKLKN....DLNSIY.......ASGW.....FSGV.......KI.
Q7V0C8_PROMP/253-325.....T....IP--G.............SIFN--RTILEA....DIKRLY.......ATSL.....FDDV.......KVS
Q7V5X2_PROMM/98-174.....V....RP--G.............SRVT--RDELKR....DLDAIY.......ATGW.....FSDV.......RI.
Q7VAN9_PROMA/161-237.....I....RP--G.............SRVS--RLQLKR....DLNSIY.......ATGW.....FSGL.......EI.
Q7VAN9_PROMA/238-314.....T....DF--G.............KTLN--LNVLKL....RMNKLK...DWYSKRGF.....SLAR.......IS.
Q7VHH5_HELHP/19-86.....I....KV--G.............ESLN--IAKVDK....AIVSLY.......SQGY.....FEDI.......YA.
Q7VHH5_HELHP/87-166.....I....KK--G.............DSYD--ETKLNR....AKLVIR...TILEYQGY.Y...GTVV.......EA.
Q7VHH5_HELHP/169-259.....N....RA--KQFMGW..LWGRNDGKLK--LADLEY....DSPRIQ...DAYMRKGF.L...DASV......SQA.
Q7VHH5_HELHP/262-341.....V....KK--G.............TYFN--IEEVRA....DVESIR...QKIADLGY.A...FARV.......NP.
Q7VHH5_HELHP/344-416.....L....AP--G.............DTYS--LSDLKE....SENALK.......RLGY.....FGKV.......KI.
Q7VQ47_CHLPN/108-186.....I....YR--N.............DLFE--REKFLK....GLDDLR...TYYLKRGY.F...ASSV.......DY.
Q7VQ47_CHLPN/189-276.....T....KQ--HSTTTS...WFTGSGLYH--PDIVEQ....DSLAIT...NYLHNNGY.A..............DA.
Q7VQ47_CHLPN/279-357.....V....GP--N.............DLYC--PDKIWD....GAHKIK...QTYAKYGY.I...NTNV.......DV.
Q7VRD8_BLOFL/32-100.....L....KV--G.............TTIS--NKNVSD....SIRFLF.......STGY.....FSNV.......SV.
Q7VRD8_BLOFL/101-181S..KNI....KI--G.............STLN--DYFIFE....ANNDIQ...DIYHNFGK.F...NVSV.......KI.
Q7VRD8_BLOFL/184-272.....I....YK--QIKWN....NIFHRNVYK--KQKFFY....DLESLR...VFYLSNGY.A...KFCI......DET.
Q7VRD8_BLOFL/356-430.....Q....LE--Q.............SLLN--YHYVLQ....DQERLS.......RLNY.FKLVNTRI.......EN.
Q7VYC2_BORPE/34-101.....V....KV--G.............EKFT--DEEATE....AVRRLY.......GTGF.....FSDV.......QI.
Q7VYC2_BORPE/102-182Q..VGF....GE--G.............RIFD--QSMLER....AEYELK...EQYLAKGK.Y...GVEV.......TA.
Q7VYC2_BORPE/185-273.....T....TP--GWLTW.....YTNTDKYS--REKLEG....DIERLR...SFYLDQGY.L...EFTVEP..PQVTI.
Q7VYC2_BORPE/276-354.....I....KP--G.............EVFS--AAKANN....SAKAIT...NYLGDLGY.A...FANV.......NP.
Q7VYC2_BORPE/357-431..........QE--A.............AWYD--AGDIKV....SRDRVD.......RLGY.....FNEV.......NV.
Q823D8_CHLCV/106-184.....V....YE--N.............DVFD--REKFLK....NFDELR...VYYLKRGY.F...DSNL.......SY.
Q823D8_CHLCV/187-274.....S....KT--TSWF.......TGSGLYH--PDIVEQ....DSFAIT...NYLHNLGY.A...DATV.......TP.
Q823D8_CHLCV/277-355.....A....GP--N.............DIYC--PENIWS....GAQKIK...NTYAKYGY.I...NTNV.......DV.
Q82U03_NITEU/23-90.....V....KV--G.............DVLD--SKKASA....AIKALY.......ATGF.....FSDV.......KL.
Q82U03_NITEU/91-171..........QA--GLS.........ESRIFS--RSLLEK....AEQELK...RQYISRGK.Y...AVKI.......TT.
Q82U03_NITEU/174-262.....K....TP--GFMTW.....FTKDDQYS--KQKLSA....DLETLR...SYYLDRGY.L...EFNIES..TQVSI.
Q82U03_NITEU/265-343.....L....EP--G.............GIFV--REKLTE....SIKLIS...DRLGNDGY.A...FANV.......NA.
Q82U03_NITEU/346-420.....Q....ME--G.............GWHS--TEQINR....SRQRVD...RLDFFTGV.....NIET.......PP.
Q82VX0_NITEU/116-201.....L....TP--G.............KVFR--SARWED....AKSALL...SSIANRDF.A...TARIVE..SQAKV.
Q82VX0_NITEU/204-278.....F....RP--G.............DPYR--REQLLA....FQAALQ.......NSQL.FNAAAVTV.......KP.
Q83DT2_COXBU/31-98.....I....HE--G.............QEYT--AQRGQR....ILQSLY.......RTGF.....FETV.......RL.
Q83DT2_COXBU/99-179K..LNI....SE--G.............QPYD--PTKLHE....IEVGLE...QQYGAMGY.H...AATV.......ST.
Q83DT2_COXBU/182-270.....T....TP--GLFTW.....ISHRDRYS--QVKLEE....DLQQLS...EFYLNHGY.L...RFRVVS..HDVQW.
Q83DT2_COXBU/273-351.....L....KR--G.............DIFS--RQVIIN....TNKAIG...DFLGDRGY.A...FARV.......NV.
Q83DT2_COXBU/354-428.....Q....YE--G.............SLYS--LSKIEE....SKRRLE.......LLGY.....LSDV.......KY.
Q87EI1_XYLFT/272-350.....P....KT--G.............DIFS--RVLLEY....SSAAII...NTLSNIGY.A...FSKV.......NP.
Q87LW2_VIBPA/354-425.....L....ET--G.............RKIE--TAEIEK....AVENLY.......ALDR.....FELI.......TY.
Q87ME5_VIBPA/266-344.....F....ED--N.............ETYN--GSLVTS....MEEGIK...RVLGESGY.A...YPQV.......NT.
Q87SW5_VIBPA/101-182.....L....KV--G.............RILN--QGEYDS....LKSGIR...NLALQRGY.F...NGDFKL..NKLEV.
Q881Y2_PSESM/187-261.....F....KE--N.............TPYD--SQMIAE....LTQAMQ.......ASGYFE...GVRV.......DA.
Q886N5_PSESM/23-90.....L....NV--G.............EQAD--DGRLVD....ATRSLF.......KTGF.....FQDI.......QL.
Q886N5_PSESM/91-171Q..SGL....AE--G.............EIFQ--RATLEG....VRNELQ...RQYVAQGR.Y...SAEV.......DA.
Q886N5_PSESM/174-262.....L....KT--SNWLS....FFKNDDKYA--REKLSG....DLERLR...SYYLDRGY.I...NMDI......AST.
Q886N5_PSESM/265-343.....V....QP--G.............QVFS--RKVMTT....TSELIT...RRLGNEGY.T...FANV.......NG.
Q886N5_PSESM/346-420.....Q....ME--G.............GWAS--TYLIDQ....SKTRLD.......RLGF.....FKEV.......NV.
Q88EF1_PSEPK/356-425.....Q....PI--D.............APLE--LDRLQT....DMGTLY.......GLDY.....FDRV.......QY.
Q88IV7_PSEPK/195-269.....F....KP--G.............TPYD--SELVAE....LNNDLQ.......SSGY.F..EGVRV.......DA.
Q89KQ1_BRAJA/278-357.....V....NV--G.............SLYN--VESVEK....SVEEMQ...IEASRRGY.A...FAVV.......RP.
Q89NX1_BRAJA/79-147.....S....GP--D.............GRLD--QAAIDD....GLKALI.......GTRL.....FQDV.......KI.
Q89NX1_BRAJA/148-225.....S....KP--R.............GAFS--RAIVQS....DTLRIA...EIYRRSGR.Y...DVHV.......TP.
Q89NX1_BRAJA/319-398.....V....NA--G.............SLYN--VELVEK....SVEDMQ...IEASRRGF.A...FAVV.......RP.
Q8A1E1_BACTN/46-120.....L....SV--GQ...........TITVP--GDEITG....AIKRY.......WKHGL.F...S..........NV.
Q8A1E1_BACTN/121-200.....M....VK--G.............MQIT--PNTVDR....AKTLIK...RYFDDKGF.K...NAEV.......II.
Q8A1E1_BACTN/203-291.....MKKTNEK--GKLLN.....LFRTKKFV--PENFEA....DKQLII...DKYNELGY.....RDAM.......IV.
Q8A1E1_BACTN/378-447.....I....RP--G.............QLFS--KDDLMR....SLREIQ.......QMGH.....FDPE.......KL.
Q8D271_WIGBR/189-264.....I....SN--NY..........YNKLYN--IELISD....LNNKLI.......STNW.....FNSV.......TV.
Q8D2H0_WIGBR/27-94.....I....KI--G.............KILT--KQDVSE....SIRILF.......DSKN.....FNKI.......KI.
Q8D2H0_WIGBR/95-175S..KNI....KI--G.............NPLY--PSASQE....IKISLK...NIYDYIGK.Y...NSEI.......NV.
Q8D2H0_WIGBR/178-266.....L....CE--YNSSL....SFFQKCIYQ--KHKLIK....TKNILK...NFYFNQGY.V...DFKI......NFT.
Q8D2H0_WIGBR/348-422.....Q....LE--R.............STLE--ISNIYK....DISNLN.......KLNY.IEVIDINI.......KN.
Q8DI03_THEEB/90-161.....T....RP--G.............STTT--RTQLQQ....DTNAIF.......ATGF.....FADV.......NA.
Q8DI03_THEEB/242-318.....T....QP--G.............VVLN--QKTVQA....DLRRLF.......ELGL.....FEDV.......QVA
Q8EF72_SHEON/112-195.....I....KP--G.............DTLN--HGMYSD....VKSQLV...TLALARGY.F...DGEFTE..SQIKI.
Q8EF72_SHEON/198-271.....F....KE--D.............ASYS--TRRVSA....LNRQLL.......DTGY.....FSNI.......KV.
Q8EGG7_SHEON/29-96.....V....KV--G.............DTVD--QLKLQQ....AIKSLY.......ASTN.....FENI.......SV.
Q8EGG7_SHEON/97-177.....V....KV--G.............ESLD--RTMLTG....IEKGLQ...DFYYGVGK.Y...GAKV.......EA.
Q8EGG7_SHEON/180-268.....L....KD--YVAWW....DLFGERRYQ--KQKLQA....DLETIK...TYYHNKGY.I...RFEV......TST.
Q8EGG7_SHEON/271-349.....I....KA--G.............DMYN--GGDVTF....AEEMYS...KYLGRFGY.A...YPEV.......KT.
Q8EGG7_SHEON/352-426.....Q....ME--G.............AWLN--SAQVEQ....SKARLN.......RLGF.....FETV.......DT.
Q8EJN5_SHEON/337-408.....L....KP--G.............QNIT--KDELNE....AIKRIY...ALNK.........FERV.......DA.
Q8GBX8_PASMD/261-340....TI....QL--N.............GLFR--RANVLE....VEQRIK...SKLGERGY.A...TAQV.......NV.
Q8I576_PLAF7/116-193.....M....KQ--NK...........LLTIR--YKDINT....IINIIN...NYYASNNY.L...FSKV.......LT.
BAMA_BUCAP/24-91.....F....NI--G.............SNIS--ENDIKH....SIKSLF.......QTGK.F..............ET.
BAMA_BUCAP/92-172E..LGI....KE--G.............NFFN--PFLNTV....FVKNLK...EFYSNVGR.Y...NSDI.......KI.
BAMA_BUCAP/175-263.....L....KD--CKSWW....NFLEKRFYY--SQQLEE....DLKNLS...NFYLNQGY.Y...YFNI......HRK.
BAMA_BUCAP/266-344.....I....HN--N.............EFYN--KEKITL....IVKKIQ...RFLSEKGY.I...DPKI.......II.
BAMA_BUCAP/347-421.....Q....IE--G.............EWFN--LKLIEL....GIKSLE.......KLKF.....LSDI.......TV.
Q8KBW3_CHLTE/43-133.....T....ST--RNSFFGTGLFAGARRPFI--ADDFEK....DISLIR...KLYTFKGY.F...FADV.......EP.
Q8KC70_CHLTE/372-447.....P....IT--G.............KLYT--SEIATG....SLEKLI...RLYRDKGY................SL.
Q8KFQ6_CHLTE/57-131.....I....ND--R.............ITVP--GQEIPG....VLQYLW.......NLQY.....FSNI.......QI.
Q8KFQ6_CHLTE/132-209.....L....NP--G.............RRIS--NQELLN....AENRIE...KQYAAKGY.L...TAGV.......EY.
Q8KFQ6_CHLTE/212-301.....E....TS--QNSWWR...KIFGQPKLD--KDKFEE....DKNLLV...EFYRDNGY.R...DARI......VKD.
Q8KFQ6_CHLTE/304-389.....I....KK--G.............DLYN--AKKINERLNFSQDHSDV.SSLYLDRGY.L...SFRA.......QL.
Q8KFQ6_CHLTE/392-467.....T....IP--G.............DTFS--RKNVVR....SIRELS.......MLNY.F...DPETLT..PDIQP.
Q8LEH7_ARATH/74-152.....V....RQ--A.............TTLQ--ELLKAS....KVANFN.....LQALDI.FDSVKITL.......DS.
Q8PEY4_XANAC/199-273.....W....DE--G.............SYYH--EGKLDR....LRESLT.......KLDY.....FSTI.......DI.
Q8RHT4_FUSNN/4-75.....L....KE--G.............AKFS--TEALLA....DFNALK.......ETGY.....FEDV.......IL.
Q8RHT4_FUSNN/251-335.....I....QP--G.............KIFN--....VK....EYDATV...DNLMRLGI.F...K.NV.......KY.
A9CJ61_AGRT5/38-105.....I....AP--G.............KNFS--NSDIDE....SVKRLY.......ATGY.....FSNV.......SM.
A9CJ61_AGRT5/106-183.....T....QP--M.............GPFN--QAIVTA....DIARIK...EAYSAIGR.S...DVEI.......TT.
A9CJ61_AGRT5/186-274.....T....KK--SNMLS....FLTRKDVYN--EDKLRA....DEEALR...QFYYNRGY.A...DFRV......VSS.
A9CJ61_AGRT5/277-356.....T....RQ--G.............ASYS--AKEVQQ....SMEAIS...KRVAGEGY.P...FARV.......TP.
A9CJ61_AGRT5/359-432.....I....SE--G.............DAFN--QTIITA....AKRRLE.......ALGY.....FSKV.......NI.
Q8XZI3_RALSO/30-97.....V....KV--G.............ETFT--DDKGAE....SIRALY.......NTGF.....FKDV.......QI.
Q8XZI3_RALSO/98-178G..VGV....AE--A.............RYYD--KSLIDR....AEQELK...RQYVSRGY.Y...AADV.......QT.
Q8XZI3_RALSO/181-269.....S....TP--NWLSW.....YTKNDLYS--KQKLTA....DLEALR...SFYLDRGY.L...EFAIES..TQVSI.
Q8XZI3_RALSO/272-350.....L....KQ--G.............DVFS--SAKLSA....TTKAIT...DLLGTYGY.A...FATI.......NP.
Q8XZI3_RALSO/353-427.....Q....ME--S.............SWFD--GEKLQL....SQNRIN.......RTGY.....FTDT.......NI.
Q8YUR6_NOSS1/221-296.....T....QP--G.............RTTT--RSQLQE....DINAIF.......GTGF.....FSNV.......QA.
Q8YUR6_NOSS1/395-466.....L....KP--G.............QVFN--RNTVQK....DLQRVF.......GTGL.....FEDV.......NVS
Q92LN9_RHIME/217-291.....L....NH--G.............RPYS--PENIRK....AAERLR.......QLNV.F...SSVT.......IN.
Q92Q48_RHIME/39-106.....I....VP--G.............KSFS--NADIDA....SVKRLY.......ATGY.....FSDV.......SI.
Q92Q48_RHIME/107-184.....T....QP--L.............GPYS--EATVET....DIQAIR...DAYAAIGR......SDV.......TV.
Q92Q48_RHIME/187-275.....T....KE--SGIFS....FLTRKDVYN--PDKLRA....DEELLR...QFYYNRGY.A...DFQV......VSS.
Q92Q48_RHIME/278-357.....S....RE--G.............TVYK--AKDIQS....TMSEIS...KRVASEGY.P...FARV.......TP.
Q92Q48_RHIME/360-431.....V....GE--G.............DAFN--QEMVAR....AKRRLE.......ALGY.....FSSV.......NI.
Q93PM2_HAEDC/20-87.....V....KV--G.............QTAT--DGDVTN....IVKQLF.......SQNR.....FENV.......SA.
Q93PM2_HAEDC/88-168A..NLI....VA--G.............EVYD--KAKLEA....FKQALV...DHYHTMGR.Y...QADI.......QT.
Q93PM2_HAEDC/171-259.....I....KP--NAPWW....NIFESSKFQ--QQEYNK....DIEILR...DFYMDHGY.AKFTLKDT.......DV.
Q93PM2_HAEDC/262-341....HF....KA--G.............QLFR--KTELSI....IEEQIK...QILGDRGY.G...SAKV.......DL.
Q93PM2_HAEDC/344-418.....Q....QE--G.............AWLS--TSAVSL....AKSRLE.......RTGF.....YETVEM..SMPTV.
Q98K30_RHILO/218-292.....L....KR--G.............KQYS--PQEISD....ARDRLLA.LEVFNSVTF................KE.
Q98MC3_RHILO/39-106.....I....KP--G.............KAFS--SSDVDA....AVKALF.......GTGL.....FSDV.......QI.
Q98MC3_RHILO/107-184.....L....KP--R.............GTFS--QATLDS....DVEAVK...AAYRRIGR.D...DAGV.......TT.
Q98MC3_RHILO/187-275.....T....KR--SSWVS....FILRDDVYD--EDKLRA....DQELLR...RFYYNHGY.A...DFQV......VSA.
Q98MC3_RHILO/278-357.....T....HK--G.............DVYN--AKDVED....SIIALT...EKVAGSGY.A...FAQV.......TP.
Q98MC3_RHILO/360-433.....V....SE--G.............DAFN--QVLIQR....AKKRLE.......DLNY.FDKVEIST.......VP.
Q9A711_CAUCR/24-91.....I....QP--G.............DTVD--SQRLDL....ALKTLA.......RTDL.....FADV.......KI.
Q9A711_CAUCR/92-169.....I....RP--R.............GIFT--RAKVQA....DVQRII...ELYRRSGR.I...SATV.......TP.
Q9A711_CAUCR/172-260.....T....KE--SRWYK....ILTSNDNYD--PDRIEY....DREQLR...KHYRNRGY.F...DFRV......ISS.
Q9A711_CAUCR/263-342.....V....RT--G.............QLYE--DERIEQ....ATDALT...FAAGAAGF.A...FVDV.......RP.
Q9A711_CAUCR/345-418.....V....AE--G.............DAYN--RVLVDR....SKNNMR.......RLGF.....FKEV.......EI.
Q9HXY4_PSEAE/265-343.....V....QK--G.............QVFS--RKVMTT....TSDLIT...RRLGNEGY.T...FANV.......NG.
Q9HYQ6_PSEAE/333-404.....Q....PL--G.............TRLD--LGRLQD....DMSTLY.......GLDY.....FDQV.......QY.
Q9I0U1_PSEAE/190-268.....F....KA--G.............QPYD--SELIAE....LNQNLQ.......SSGY.....FEGV.......RV.
Q9KPW0_VIBCH/266-344.....F....EI--G.............ETYN--GSAVTR....LEESVK...KVLGESGY.A...YPQV.......RT.
Q9KUB9_VIBCH/347-418.....L....EP--A.............QKLS--TEEIEA....SIEDLYA.LDRFELVRY................QY.
Q9RXD5_DEIRA/97-179.....I....AP--G.............AVLN--TQRLEQ....AKEALA...QNYRQEGFPF...VPSI.......SA.
Q9RXD5_DEIRA/180-256.....L....QT--S.............KRFT--TQAFFA....ASDALQ...AAYEAAGY.F..............QA.
Q9RXD5_DEIRA/329-402.....T....KP--G.............DVYS--PQLAQD....DFMALR...NVYRQAGYEI...STRD.......AI.
Q9RXD5_DEIRA/407-477..........AA--G.............QTFN--SKDVQA....ALGRVS.......ALGY.VTINDVRV.......KS.
BAMA_PHOLU/175-263.....L....RD--DVPWW....NLTADQKYQ--KQKLTG....DLEALR...SFYLDRGY.A...RFNI......DST.
Q9SRL6_ARATH/77-155.....A....EV--D.............AVRE--ATTLQE....LLEASRVANSNLRALDI.FDSVNITL.......DS.
Q9WYS9_THEMA/19-89..........KV--G.............KLFG--EVSSDE....IQEYLK....KVFNLGY.....FSSL.......TP.
Q9WYS9_THEMA/90-164.....I....EK--G.............MPLN--VNLLKE....TFEAIR...NRYQEAGY.F...LVEI.......NG.
Q9WYS9_THEMA/270-342.....L....ST--D.............ETYT--NSQILL....AMNRLV...DFYERNNYPYVWVEARV..........

PF08479

Q8XQ41_RALSO/70-145----------LN--G-------------GTRT--LADLSR----GAARIT---RFYRAQGW-----PLAS-------AYL
Q7W7Z0_BORPA/73-148----------LA--G-------------KEIT--VAQLVQ----QVDRIT---ELYRSSGY-----PLSF-------ALV
Q8RI18_FUSNN/32-109----------YI--D-------------KDLG--STDITN----LITDLT---NRLIAKGY-----ITSV-------TTI
Q7NU30_CHRVO/77-152----------GL--A-------------GCVD--LARING----LTAALT---NEMVARGF-----VTSR-------VYL
Q7N2L1_PHOLL/77-152----------YL--S-------------RCLT--LPDINE----LVRKVS---NAYIERGY-----VTSR-------AGL
Q7N9T5_PHOLL/77-152----------YL--S-------------HCLS--LQDINT----LVRQTT---NAYIERGY-----VTSR-------AGL
HLYB_SERMA/79-152----------LP--E-------------QCIS--SNDINR----LTRELT---RLYVQKGY-----ITAR-------VQI
Q6G3U5_BARHE/90-166----------YV--G-------------RCIG--LSDIQF----LIKQLT---KIYLDQGY-----ITAR-------FYI
Q88MW8_PSEPK/83-158----------LT--P-------------ACMG--IADINR----LLKAIT---QRYVQAGY-----PTSR-------PYL
Q8PF71_XANAC/63-139----------QP--V-------------VALR--FDQLQA----VADAIT---RAYRQAGF-----IVST-------AYL
Q7N107_PHOLL/69-145----------GE--N-------------HCLG--DKGISR----LITQLQ---DQLINHGY-----VTSR-------VLV
Q605Q3_METCA/48-123----------FL--G-------------PGKS--IGDVES----ARAALE---KAYHDAGY-----SAAL-------VDI
Q664C6_YERPS/89-165----------AH--G-------------RCLG--EQGLSV----LVANLQ---QQLVVDGY-----ITSR-------VVF
Q71BF5_HAEIF/73-150----------YV--G-------------KEVS--LSDLSN----LANEIS---EFYRHNNY-----LVAK-------AIL
Q9JY36_NEIMB/87-166----------QA--G-------------KCLH--AGNINQ----IMSLAQ---NALIGRGY-----TTTR-------ILA
Q8YM25_NOSS1/96-171----------FV--G-------------REVS--FAELLQ----VRDAIT---KLYTDNGY-----VTTG-------AVI
Q7N1B0_PHOLL/77-152----------YL--S-------------HCLT--LQEINE----LVRKVS---NAYIKRGY-----VTSR-------ADL
Q89H68_BRAJA/98-173----------YL--G-------------KKVS--QADLAA----IAGAIS---DLYRADGF-----HLSR-------AVV
Q93QU8_ECOLX/82-162----------YT--G-------------RPLS--FGDLQE----LTSVLT---GTYRSHGA-----LLAR-------VII
Q9HVN7_PSEAE/59-134----------LP--G-------------QELN--LSQLHA----AAARIG---DFYQEKGY-----VLAR-------AFL
Q8XQZ3_RALSO/84-163----------AT--G-------------RCLG--TAGINL----VMKRVQ---NAIVARGY-----VTTR-------VLA
Q880E0_PSESM/77-152----------FQ--N-------------KCLG--VAQLND----LLKTIT---DHYLDKGL-----ITTR-------AYL
Q8XYH9_RALSO/79-151----------VN--G-------------QCVG--KQGLEA----IELQVN---NALIEHGY-----VTSR-------VLI
O32607_EDWTA/81-154----------LP--T-------------HCIR--SRDVNH----LAKQLT---ALYLEKGY-----ITAR-------VQF
Q8DLP0_THEEB/81-156----------LE--G-------------QQVT--LAELQR----ATDAIT---KLYLEGGY-----LTSR-------AVL
Q8XQX3_RALSO/69-144----------MA--G-------------HDVT--VAQLLQ----AASEVT---KLYADRGY-----PLSF-------AFV
Q8X9M8_ECO57/65-141----------AV--G-------------HCLG--AKGINL----LMSTLQ---NRLVDHGY-----VTTR-------VLA
Q7MRX6_WOLSU/59-134----------YV--G-------------KCNT--LTDLTN----LARQLT---GLYIDKGY-----VTSQ-------VYI
Q8PLI4_XANAC/79-156----------YQ--G-------------RCIG--HAGIDI----IRRRAL---DQLVARGL-----VTTR-------IGV
Q9RGR3_BORBO/89-164----------YL--N-------------RPLD--NEQLFL----LVKALS---AALYDRGY-----ATSI-------VTF
P94771_ERWCH/76-151----------YL--N-------------RCNN--LEQINQ----LVHDVS---NWYIQRGY-----ITSR-------AFL
Q9I792_PSEAE/71-146----------YQ--G-------------RCLG--VGQLNA----LLKAVT---DHYLDRGY-----VTTR-------AYL
Q8XPV1_RALSO/81-156----------FL--N-------------RALG--TNRINL----LLRRLT---EAFIAHGF-----VTTR-------AYL
Q7VLT7_HAEDU/59-128----------KK--N-------------ECLN--QSRLNQ----LSQDIT---QAYLNKGY-----IHNP-------FQF
Q7NWR3_CHRVO/87-160----------PR--G-------------TCLD--IAELNR----FSRALT---ALYLERGF-----IAAR-------VRP
Q6RK56_ERWCR/75-150----------YI--N-------------RCIN--VNNINQ----LIHDVS---NWYIEQGY-----ITSR-------AFI
Q6FDM4_ACIAD/101-180----------II--G-------------RCLG--VQGLNQ----ALDLVQ---NRIISAGY-----VTSR-------VLL
Q8VMR1_PHOLU/79-152----------LS--P-------------ACIS--SHDINR----LSHELT---HLYISKGY-----ITAR-------VQF
Q5GD94_XENNE/79-152----------LP--D-------------SCIT--SNNINE----LSAEIT---NLYIAKGY-----ITAR-------VQF
Q9AHG0_9FUSO/86-161----------YI--E-------------KEVT--VADLYT----IVQKIN---ELYQEKGY-----LVCR-------AVL
Q63JI8_BURPS/74-148----------YR--G-------------ATMG--QAEIFA----LLRDLM---NFYYGRGY-----ITTG-------VSL
HLYB_PROMI/77-150----------LP--D-------------QCIK--SADINR----LVKELT---QRYLQHGY-----ITAR-------IQF
Q9AAJ4_CAUCR/8-83----------FV--G-------------KPVA--LADLKT----IARNAE---AIYAGRGY-----PFVV-------VVP
Q63TR3_BURPS/65-140----------LV--G-------------KDIT--IGQLIE----TANGVT---KLYQERGY-----ALSF-------AFV
Q89Q77_BRAJA/73-148----------YV--G-------------KDVD--IASLLQ----LVADIN---AIYTARGI-----VTGI-------ATL
Q8XAN8_ECO57/70-144----------IA--G-------------RCVG--SAGVQK----IAAALQ---DYYINAGY-----ITTR-------ISI
Q9HVG7_PSEAE/71-146----------ML--G-------------EQVS--LAELVD----LANRLT---AKYRQDGF-----LLTQ-------VVV
Q6DA64_ERWCT/107-183----------AV--N-------------QCLG--GKGINL----LMSALQ---NRLVNHGY-----VTAR-------VLA
Q8RGK0_FUSNN/41-115----------YV--G-------------KD..--.KDIYA----LINELE---NKYIEKGY-----VTTK-------VGL
Q8G9X8_ECOLX/104-179----------WV--N-------------QCLN--ITGLTA----VTDAVT---DGYIRRGY-----ITSR-------AFL
Q9PAG8_XYLFA/106-185----------AI--G-------------RCLG--TAGINI----VISRVQ---NAIISRGY-----VTTR-------VLA
Q74E11_GEOSL/79-154----------LE--G-------------KEVS--IRELLA----MVDRIN---DLYRQKGY-----LTAR-------AVL
Q8YWF4_NOSS1/18-93----------FE--K-------------RQVT--FADLIQ----LRSDIT---ELYIQNGC-----ITSG-------AFL
Q7N910_PHOLL/78-154----------GE--N-------------QCLG--TQGINI----LMTRIQ---NRLINHGY-----VTSR-------VLA
IBPB_HAES2/99-172----------YL--N-------------QPLS--AKTVFA----LTKELT---QVLYNAGY-----VTSA-------IGL
Q88QC1_PSEPK/91-166----------LI--G-------------RETT--LGELQQ----YTQRLT---QRYRQKGY-----LLSY-------AYL
Q7NY08_CHRVO/92-167----------AK--G-------------KELN--LDQLKE----LATRIT---HYYQQHGY-----PISL-------AYI
Q669F9_YERPS/77-153----------AL--G-------------QCLG--GQGINQ----LMSQLQ---NRLVGHGY-----VTTR-------VLA
Q8D0E8_YERPE/68-141----------IL--G-------------ECIS--EDDINI----LAKEVT---RLYLSKGY-----LAAR-------VNF
Q9I5N4_PSEAE/47-122----------FL--G-------------PQRS--LGDIEG----ARDALQ---AAYQEKGY-----QSVY-------VEL

PF08478

FTSQ_VIBF1/50-120----------MD.SI-------------GTFM..TQDVNK----LQDALL------S.LPW-----IAQV-------SV-
Q5FG13_EHRRG/81-147----------D...A-------------RSIF..FVPLAD----LRNKIE------SSHPW-----IKSA-------SV-
FTSQ_SHEON/52-121----------LM.Q.-------------RSFF..SADITL----VQQALE------A.LPW-----VYRA-------SV-
DIVIB_BACSU/54-123----------NS.GD-------------TEFW..SLDKQK----TEKKIQ------Q.NKL-----VKKA-------EI-
FTSQ_STRCU/57-126----------PV..G-------------APLV..SVDTEA----VEARLR------RKLPR-----IDTV-------DV-
FTSQ_RHIME/89-157----------DG..T-------------TSLV..ALDIEE----ARRLIG------E.LPW-----VETV-------TV-
Q5P6Z9_AROAE/37-106----------AI..R-------------GNFF..SVDLEQ----VRGVFE------K.LPW-----VRRA-------EV-
O83403_TREPA/55-123----------TG..K-------------EKWM..SLDGFT----ISERLA------S.VPL-----LAQV-------EV-
DIVIB_CLOTE/54-122----------SN..E-------------NNIF..YLNLNN----VKNNIM------S.NPY-----ILDA-------QI-
FTSQ_ECOLI/55-126----------LG.EP-------------GTFM..TQDVNI----IQTQIE------QRLPW-----IKQV-------SV-
FTSQ_STRGR/5-74----------PV..G-------------APLV..SVDTDA----MERRLR------QKLPR-----IDTV-------DV-
Q8D2Z8_WIGBR/41-111----------LK.LS-------------KNFV..KKDIEF----IKIQIE------K.MSW-----IKNY-------II-
Q8RMK7_AZOBR/99-167----------QR..G-------------DPIL..AVTLSD----AKEKLE------S.LPX-----VASX-------SI-
Q83N06_TROWT/56-124----------RGEFN-------------KPLA..FVDPET----VRKKLA------K.FKL-----LKEV-------TV-
Q8E185_STRA5/122-193----------QKNDY-------------FFSL..IFKHKA----IEQRLA------AEDVW-----VKTA-------QM-
Q5SJC7_THET8/24-91----------AP..G-------------DPWL..WVWGNR----LRPLLE------..NPW-----VAEA-------HL-
Q9F1M8_SHEVI/67-136----------LM.Q.-------------RSFF..SADVNQ----VQEALE------A.LPW-----VYQA-------SV-
Q5R0N0_IDILO/43-112----------AE.PL-------------GSFF..TADVDD----LRRRVE------Q.LPW-----VQKV-------SI-
Q6F706_ACIAD/59-128----------II..K-------------DNYF..TSDLEQ----IRDKAL------E.ISW-----VDRV-------VV-
Q728V1_DESVH/71-139----------VE..G-------------ANSI..ALNIAD----VEDRLA------S.SPW-----IAEV-------SV-
O07671_ENTHR/66-137----------AI..D-------------GNVWSQYFHKNQ----YLDTLK------KEQPR-----VESA-------QL-
FTSQ_HAEIN/54-124----------MG.EL-------------KGFW..GQDVAP----IQEQIE------A.LPW-----VKGA-------IV-
DIVIB_STRR6/153-223----------QDSDY-------------TINL..LLDKAK----YEKQIK------S.NYW-----VESA-------QL-
Q9CPA8_PASMU/55-125----------MG.DL-------------KGFF..GQDIDA----VREQIE------T.MPW-----IKGA-------VV-
Q7MNU9_VIBVY/53-123----------IT.HI-------------GTFM..SQDVSV----LQESVE------A.LPW-----VAHA-------SI-
O07324_STAAU/195-263----------KN..D-------------SRMY..TFSKKN----AINDLE------E.NPL-----IKSV-------EI-
Q73IQ7_WOLPM/61-128----------DR..T-------------QPIL..YISLSK----LAGNIQ------SVSRW-----IKHV-------RV-
Q7NQ02_CHRVO/37-106----------EL..S-------------GTFF..TLDIDK----TRAAFG------K.LPW-----VRDA-------QV-
Q5YYX7_NOCFA/42-110----------PE..G-------------RSLL..RVDTDA----MARRV.------AALPK-----VASV-------RI-
Q8DVE1_STRMU/126-197----------KKSDY-------------LTTL..LFQANR----FERNLK------SKDKW-----VKEA-------KL-
Q82AD6_STRAW/56-125----------SL..G-------------SPLI..SVGIDE----IEARLR------QKLPR-----IDSV-------DV-
Q8YQH2_NOSS1/56-126----------SY..P-------------QSLW..RIQPAA----IADSLK------K.QPT-----IAQA-------TV-
Q98KB7_RHILO/92-160----------DG..W-------------TSLI..GFDAEA----ARERIS------G.LPW-----IEVA-------AV-
Q5XB06_STRP6/125-196----------KTSDY-------------WLTL..LTSPGQ----YERPIL------HTIPW-----VKSV-------HL-
FTSQ_COXBU/46-115----------HI..Q-------------GGFF..SFNASA----LQTALM------S.LPW-----VHDV-------SV-
Q5HQ08_STAEQ/219-287----------TS..R-------------SRMY..TFSKNK----AIRNLK------Q.NPL-----IKEV-------DI-
Q57352_BORBG/33-101----------KP..N-------------TYYH..NANVRI----YEENLK------K.DLR-----VKNV-------KV-
Q8DMI0_THEEB/61-130----------QY..P-------------ESLL..RLRPQE----IIHVLE------TTLP.-----LQRV-------TI-
Q72N66_LEPIC/45-113----------QP..G-------------TSFD..SLDLDL----LEKKLS------R.LPR-----INSV-------RI-
O07110_ENTFL/126-197----------ET..G-------------SGLWEQYSNRNY----FSANIQ------KKFPI-----IKKA-------NI-
FTSQ_BARBA/87-155----------DE..Y-------------PSMI..SFDIDK----ARFILE------Q.QPW-----VRLA-------DV-
Q87WY8_PSESM/73-142----------YV..A-------------SSFF..KIDLAA----MRTELE------Q.MPW-----IAHA-------EV-
Q5FUJ1_GLUOX/84-152----------SV..G-------------RPIF..GFSVEA----ARQRLD------E.LPF-----IDHA-------TV-
DIVIB_GEOKA/50-118----------TK..R-------------TSFW..KVNEQN----VEKKLT------R.HPE-----IKEA-------TV-
Q87AG2_XYLFT/34-103----------YV..R-------------SGFF..AVRLPQ----VQDAVE------R.LPW-----VERA-------HV-
Q7V8M1_PROMM/59-128----------HF..P-------------QPLL..GFNPKE----LEQTLL------RKLPL-----NSVV-------VQ-
DIVIB_LACLA/153-224----------QTSDS-------------IFNI..LNNKEK----IEATIE------QKFPR-----ISAV-------TI-
Q65RZ0_MANSM/55-125----------MG.EL-------------KGFF..GQDVDV----IREQIE------S.MPW-----IKGA-------VV-
Q6AE66_LEIXX/96-164----------QL..G-------------RPLP..LLDQAA----ISSDLA------A.FPL-----IRSY-------SV-
P73457_SYNY3/54-123----------EY..P-------------QAVW..QLSTQA----LGDELA------K.NPA-----LLRV-------EV-
Q73NF1_TREDE/62-130----------ES..N-------------TKWL..SIDSSE----ISKKLV------S.YPG-----IASV-------TV-
Q6AJ56_DESPS/51-120----------LR.YQ-------------NSLF..SVDADV----VAARLE------D.LIW-----VEKA-------SV-
Q9RWN7_DEIRA/101-171----------PA.GE-------------SPFG..WLYYGR----WKAKGL------LTSPW-----IASA-------EV-
Q604W1_METCA/56-127----------KLVTG-------------NTYF..GVPLAE----IRQAVT------T.IPW-----VAEA-------SV-
Q62GT0_BURMA/37-106----------RL..K-------------GNFF..TVDLDL----ARVAFE------Q.MPW-----VRHA-------SV-
Q6NGD0_CORDI/29-97----------AK..G-------------TNIV..RVAAHD----AAGSVT------Q.LPW-----VRSA-------TV-
Q5PBK1_ANAMM/65-133----------NK..D-------------SSII..LLSLRT----LRSRIK------SHSPW-----VKEV-------AV-
FTSQ_RICTY/72-140----------NK..R-------------SSIF..ALKLDE----ISNNLK------K.SKW-----IKEV-------YV-
Q7VMY3_HAEDU/61-131----------EP.AL-------------KGYF..GQDIQL----IKQKLL------E.MPW-----VKDT-------IV-
Q8CXI4_OCEIH/50-118----------TT..D-------------TNIW..TINTNS----VEQAIA------K.DPV-----IKNI-------QV-
Q5WFH0_BACSK/51-119----------EE..G-------------MNIW..HLSEGE----REKAIT------S.LKE-----IESA-------KI-
Q7U5Q7_SYNPX/51-120----------NF..P-------------QLLW..EINPSE----LEQTLR------ENLP.-----IQSV-------QV-
Q5WTJ0_LEGPL/39-108----------YL..D-------------ASFF..LLSVNG----LQSELN------S.MSW-----IDTA-------YV-
Q636B8_BACCZ/53-121----------TY..D-------------TSYF..RVTAHK----AEENLT------K.RKE-----IKAV-------NV-
FTSQ_BLOFL/45-115----------SG.VL-------------GTFI..TQDVNI----IQKQIK------Q.MPW-----IQKV-------SV-
FTSQ_VIBCH/52-122----------LD.HI-------------GTFM..SQDINV----LQESVQ------S.IPW-----VSHA-------SI-
Q6N416_RHOPA/110-178----------TG..R-------------SSLL..FLDAAA----VRDKLK------A.NPW-----IADA-------TV-
FTSQ_NEIG1/37-106----------EY.IH-------------GNIL..RTDING----AQEAYR------R.YPW-----IASV-------MV-
Q6FZ75_BARQU/88-156----------DA..A-------------PSIF..TFDVDK----ARSLLE------Q.QAW-----IQLA-------NV-
Q67Q43_SYMTH/58-125----------MP..G-------------DLKW..EVTAER----VRQRLL------A.DPW-----VESA-------GV-
FTSQ_GEOSL/67-135----------RP..G-------------DSML..GLRLRD----IGSQLA------K.NPW-----IDKV-------QV-
Q5M0D3_STRT1/104-175----------LDTDY-------------ITHV..FFNQEE----IASTVE------KTNVW-----VKKA-------TV-
Q9CCE5_MYCLE/151-219----------QL..G-------------TPLL..QINTNQ----VADQV.------AAIRR-----VASA-------RA-
Q5GS65_WOLTR/61-128----------NK..T-------------QPII..YISPSK----LADSIQ------SVSKW-----IKHV-------RI-
FTSQ_CORGL/30-98----------VE..G-------------ENLF..RVDATA----AGQNIV------E.LPW-----VKSV-------TV-
Q8R9G8_THETN/29-97----------QA..G-------------TNIF..KVNPKQ----VEKNLL------E.NPY-----IKEC-------KV-
Q8XJA3_CLOPE/42-109----------LN..Q-------------.NIF..LLNTSA----LKKKIL------S.NPY-----VKSV-------KI-
Q57C82_BRUAB/68-136----------DG..E-------------TSLV..GLSAEE----ARQSID------K.LPW-----VESA-------EV-
Q93JX7_PROMR/60-129----------NL..P-------------TSLL..EINPKQ----LENNLQ------KNLPI-----KAVA-------IS-
Q7NNV9_GLOVI/69-138----------DY..P-------------QPIL..SVRPEQ----LQQRLL------EALP.-----LEAV-------RV-
Q6A9Q0_PROAC/48-116----------PK..G-------------QPLA..RVNTDD----VAARVT------R.MDI-----VQQA-------EV-
Q5FKV1_LACAC/77-148----------KA..S-------------DKVFDYLFQQKD----LSQKLS------RKYPE-----IQSA-------QV-
Q8FNU2_COREF/30-98----------TA..G-------------DNLL..RIDATG----AAHAIA------E.MPW-----VSSV-------TL-
DIVIB_CLOAB/41-109----------KK..G-------------NNIF..YLNLNK----YKDNIM------Q.DPY-----IKNV-------SI-
Q6LMF8_PHOPR/51-121----------LD.HL-------------SSFM..TQDVDD----IQAALE------A.LPW-----VAQA-------SV-
Q9RNN0_ZYMMB/40-108----------QQ..N-------------LAMP..LVDLNA----IRDRLL------R.FGW-----IEDA-------RV-
Q9K9T2_BACHD/50-118----------SN..E-------------TSIW..SISDEQ----LKANVE------S.LEE-----VEAI-------EW-
FTSQ_MYCTU/124-192----------RP..A-------------TPLL..QIDTQQ----VADRV.------ATIRR-----VASA-------RV-
FTSQ_CAUCR/94-162----------YL..D-------------QPTL..GMDLAD----VRDRVQ------G.VGW-----VKDA-------KV-
Q6G1J3_BARQU/39-106----------KV..G-------------KSFS..SGDIDF----AVKRLF------G.LGL-----FYDV-------KI-
Q71XX9_LISMF/51-119----------EI..G-------------EFVI..GISNGK----TEDTLK------K.NTL-----IKDA-------TV-
Q45306_BACLI/54-123----------HK.GQ-------------TEFW..SLSKQK----AAEKIE------Q.NKL-----IKKA-------EI-

PF06898

YQFD_BACSU/2-387PFLLLKSKLNIGFTIGFAIFFILLFLLSNMVW--KIDVTGAKPETEHQMR---QHLNEIGVKKGRLQFLMMSPEKIQKS-
Q9KD59_BACHD/4-388PAFVKKAMNRVGFVGGIGLAIVLMFILSNIVW--SIEIKGASPKVEHELR---QLVEELGVKRGAFQFTLPSVEDLQRE-
Q8XIU3_CLOPE/2-375IFFLSRAKKSISIFVGVLIFLVGLYIYSGFIW--RIDIETKKNIAPFEIR---TMLNDFDIKPGVKKSSVN.VYGLERK-
Q8EPX5_OCEIH/2-398PFGFARFLKKRFLVIGILVGVLFFLFLSNLLW--SVNITGVPKEIEEKIK---VQLDSYGIHSGVWLFSVDSPKDIQRN-
Q8RB55_THETN/8-388PFVIFRLRKRKGIVLGFLLSVLLVYLFSTFIW--EIDVKTVNGLKEEEVA---KKLSEMGLKSGVSKFKID.INKLEKE-
Q892R7_CLOTE/6-378GFLILKLRRRRALILGCILFAIIIYYLSTYIW--RIDIITEKNLSPYEIR---MELLNYGVKEGVKKKNID.IYKLEEE-
Q97JI9_CLOAB/2-374GFLFFRIRNRLSILVGIAAFIACVFYLSTFIW--QIDIVTEKNIAPYDVR---QDLREIGVQPGMKKSSLD.VYKIEEK-
Q9S6M8_BACME/2-386PFLTKRVIKNSGFRLGFLSFFIILGFVSNMVW--KVEISGAEPQTEHQMT---KQLAKIGVKRGEFQFLLESPEKIQRY-

PF07244

Q5NND8_ZYMMO/246-316.EDN--..PEHP.............G..S---------------------------------------------------
Q5NND8_ZYMMO/317-394.KMV--..RLEQ....NR.......V..D---------------------------------------------------
Q5NND8_ZYMMO/397-485.IAE--...LTPD..RRD.......F..I---------------------------------------------------
Q5NND8_ZYMMO/488-566.DFT--...PDK....DNL.....TM..G---------------------------------------------------
Q5NND8_ZYMMO/569-643.TQR--P.GSTP....DR.......L..I---------------------------------------------------
BAMA_HELPY/70-137.TFE--..........GG..........I---------------------------------------------------
BAMA_HELPY/138-216.RTE--...KVSE..G.A.......L..L---------------------------------------------------
BAMA_HELPY/219-309.FLK--...TDFS..THD.......A..K---------------------------------------------------
BAMA_HELPY/312-391.DLD--...KDEK..NGL.......V..K---------------------------------------------------
BAMA_HELPY/394-466.EEK--..RVNS.............SLMD---------------------------------------------------
O30912_NEIME/23-90.ETA--..........DG..........Q---------------------------------------------------
O30912_NEIME/91-171.KVT--...KLA....RN......RV..D---------------------------------------------------
O30912_NEIME/174-262.NED--..KTKQ................T---------------------------------------------------
O30912_NEIME/265-344.QPL--...PNAE..TKT.......V..D---------------------------------------------------
O30912_NEIME/347-421.AGT--...PDK.............V..D---------------------------------------------------
O32625_HAEIF/22-89.HQE--..........GD..........V---------------------------------------------------
O32625_HAEIF/90-170.IVN--...TLP....NN......RA..E---------------------------------------------------
O32625_HAEIF/173-259.QLN--DEKTKV................N---------------------------------------------------
O32625_HAEIF/262-341.VPD--...FDDA..NKT.......L..A---------------------------------------------------
O32625_HAEIF/344-418IDPI--NGSNDE.............V..D---------------------------------------------------
O51735_BORBU/30-102.PIF--...KIDG..EDL.......F...---------------------------------------------------
O51735_BORBU/103-180.EIK--...EEG.....N......LV..D---------------------------------------------------
O51735_BORBU/183-274.KDS--...LKDS..KRLE....KEV..F---------------------------------------------------
O51735_BORBU/277-353.IPS--..QKIR....GE......FV..D---------------------------------------------------
O51735_BORBU/356-429.DIV--..PGNT....EG......LM..K---------------------------------------------------
O66463_AQUAE/72-149.NIS--...LDD....KG......NA..I---------------------------------------------------
O66463_AQUAE/152-225.VYL--KGIKKE................K---------------------------------------------------
O67326_AQUAE/18-90.YEE--D.QNKN....GK..........P---------------------------------------------------
O67326_AQUAE/203-287.EVK--...EEG....PA.......R..K---------------------------------------------------
O67326_AQUAE/290-371.RVN--...VNPE..KKE.......V..S---------------------------------------------------
O67326_AQUAE/374-446.EPV--..PRRD.............AWWD---------------------------------------------------
O68454_TREPL/31-105.KAV--...PTDPEYQYV..........M---------------------------------------------------
O68454_TREPL/106-182.EAK--...TEA....GG.......V..V---------------------------------------------------
O68454_TREPL/185-273.DKK--...TDAS..RNL.......V..T---------------------------------------------------
O68454_TREPL/276-354.EEH--..RDTA....EK......TL..S---------------------------------------------------
O68454_TREPL/357-430.GSE--...QDL.............V..D---------------------------------------------------
O84244_CHLTR/104-182.SHN--H.NEKE....GF.......I..D---------------------------------------------------
O84244_CHLTR/185-272.KVS--...KEVS..TDAK....GNI..T---------------------------------------------------
O84244_CHLTR/275-353.SFS--...AHP....TL.......PVYD---------------------------------------------------
O84244_CHLTR/356-435.QLD--..PLDS....ND.......LYRD---------------------------------------------------
BAMA_SHIFL/24-91RDGD--......................T---------------------------------------------------
BAMA_SHIFL/92-172.VVT--...PLP....RN......RV..D---------------------------------------------------
BAMA_SHIFL/175-263.QVS--...LTPD..KKG.......I..Y---------------------------------------------------
BAMA_SHIFL/266-344.MPE--...INDA..DKT.......V..K---------------------------------------------------
BAMA_SHIFL/347-421.VPG--..SPDQ.............V..D---------------------------------------------------
YTFM_ECOLI/189-263.APQ--...FDKARETKV.......L..P---------------------------------------------------
BAMA_BUCAI/24-91.SFL--..........GK..........T---------------------------------------------------
BAMA_BUCAI/92-172.LKI--FSKNNS.............V..S---------------------------------------------------
BAMA_BUCAI/175-263.KVD--...FLQD..KKQ.......V..D---------------------------------------------------
BAMA_BUCAI/266-344.DPQ--...IDHK..KKT.......I..A---------------------------------------------------
BAMA_BUCAI/347-421.IQK--...LNSY.DSNQ.......I..D---------------------------------------------------
P73472_SYNY3/260-331.APS--...DTP.............LGVR---------------------------------------------------
P73472_SYNY3/425-496FNPG--...SDP.............TEVI---------------------------------------------------
Q44629_BRUAO/39-106.HQS--..........GS..........T---------------------------------------------------
Q44629_BRUAO/107-184.RTV--D.LGQG....RV..........N---------------------------------------------------
Q44629_BRUAO/361-434.GSD--...PDQ.............V..I---------------------------------------------------
Q51930_PASMD/21-88.SRE--..........GN..........T---------------------------------------------------
Q51930_PASMD/89-169.IVN--...TLP....NN......SA..E---------------------------------------------------
Q51930_PASMD/172-247....--......................D---------------------------------------------------
Q51930_PASMD/341-414.IPG--...SDQ.............V..D---------------------------------------------------
Q57CY5_BRUAB/278-357.RGD--...RNFE..NHT.......I..S---------------------------------------------------
Q57FW8_BRUAB/233-307.EPD--..........GS.......L..P---------------------------------------------------
Q5DZL2_VIBF1/357-428.EED--..NNEN................V---------------------------------------------------
Q5E2U2_VIBF1/342-414.GTH--......................D---------------------------------------------------
Q5E3E7_VIBF1/24-91.FRD--....GN................A---------------------------------------------------
Q5E3E7_VIBF1/92-172.VVT--...PLP....RN......RA..D---------------------------------------------------
Q5E3E7_VIBF1/175-263.QVS--...ISPD..KKG.......V..Y---------------------------------------------------
Q5E3E7_VIBF1/266-344.MPE--...FDDE..NQT.......V..S---------------------------------------------------
Q5E3E7_VIBF1/347-421.QTV--...RVPG.SDDE.......V..D---------------------------------------------------
Q5E819_VIBF1/104-185.APG--...RHQ.............A..I---------------------------------------------------
Q5F5H0_NEIG1/248-322.DFD--..RLQG....DR.......V..P---------------------------------------------------
Q5FGI9_EHRRG/23-91.YVN--...KDN................Y---------------------------------------------------
Q5FGI9_EHRRG/92-170.EIQ--...ELE...NNK.......V..D---------------------------------------------------
Q5FGI9_EHRRG/173-260.VPE--...ITS...DKN.......V..N---------------------------------------------------
Q5FGI9_EHRRG/346-418.QNH--..KVSD....SL.......V..D---------------------------------------------------
Q5FPE9_GLUOX/347-432.PPS--R.TLMPGILQAM..........P---------------------------------------------------
Q5FPY9_GLUOX/49-116.HRD--..........GN..........T---------------------------------------------------
Q5FPY9_GLUOX/117-194.QIV--..KLSH....NR.......V..D---------------------------------------------------
Q5FPY9_GLUOX/197-285.TGE--...LAPD..HKS.......F..Y---------------------------------------------------
Q5FPY9_GLUOX/370-443.DQT--Q.GSAP....DR.......V..N---------------------------------------------------
Q5GTM8_WOLTR/28-96.YID--...NEK................K---------------------------------------------------
Q5GTM8_WOLTR/97-175.ELD--...KLD...GNR.......V..N---------------------------------------------------
Q5GTM8_WOLTR/274-352.EYT--...QHGN..V.........V..D---------------------------------------------------
Q5GTM8_WOLTR/355-427.NSY--..AIND....NA.......V..N---------------------------------------------------
Q5GUR4_XANOR/127-208.RRV--...AITRAEHAA..........D---------------------------------------------------
Q5H1E9_XANOR/59-126.DRQ--..........GN..........I---------------------------------------------------
Q5H1E9_XANOR/127-207.TVS--...PLD....RN......RV..D---------------------------------------------------
Q5H1E9_XANOR/210-298.QVS--...ISPD..KRD.......M..F---------------------------------------------------
Q5H1E9_XANOR/301-379.IPT--...PNRE..DRT.......V..A---------------------------------------------------
Q5H1E9_XANOR/382-456.ETP--...AVPG.SNDQ.......V..D---------------------------------------------------
Q5HX37_CAMJR/18-85.ENN--..........NG..........I---------------------------------------------------
Q5HX37_CAMJR/86-164.KKK--...TLEN..TDG.......L..E---------------------------------------------------
Q5HX37_CAMJR/167-257.YLK--...TYTD..TYQ.......A..N---------------------------------------------------
Q5HX37_CAMJR/260-340.DIQ--...KNDQ..TQE.......A..T---------------------------------------------------
Q5HX37_CAMJR/343-415.KEE--..KVDN....TH.......I..D---------------------------------------------------
Q5LSU6_SILPO/48-115.IPR--..........GN..........T---------------------------------------------------
Q5LSU6_SILPO/116-193.RII--..RRSD....NR.......V..D---------------------------------------------------
Q5LSU6_SILPO/196-284.NVE--...FTRE..RDA.......F..F---------------------------------------------------
Q5LSU6_SILPO/369-442.REG--...STP....AQ.......V..I---------------------------------------------------
Q5N4G5_SYNP6/1-77.LPE--...DTP....LG.......V..Q---------------------------------------------------
Q5N4G5_SYNP6/78-153.SRI--..SPNG................E---------------------------------------------------
Q5N4G5_SYNP6/165-242.NLE--...PDPRDPTKV..........V---------------------------------------------------
Q5NEP7_FRATT/28-95.YRK--..........GS..........N---------------------------------------------------
Q5NEP7_FRATT/96-176.NIR--...KLP....NN......RI..D---------------------------------------------------
Q5NEP7_FRATT/179-270.QAS--...MSKD..REH.......S..Y---------------------------------------------------
Q5NEP7_FRATT/273-351.IPT--...VDKD..NHI.......V..S---------------------------------------------------
Q5NEP7_FRATT/354-428.VPV--..AGSD....DL.......V..D---------------------------------------------------
Q5NNB2_ZYMMO/333-411.IAT--...GRKR..EDG......SE..I---------------------------------------------------
Q5NZG7_AROAE/25-92.EVE--..........GD..........V---------------------------------------------------
Q5NZG7_AROAE/93-173.ETT--...VTPLERNRV..........G---------------------------------------------------
Q5NZG7_AROAE/176-264.TPD--...KKD.............I..Y---------------------------------------------------
Q5NZG7_AROAE/267-345.SPE--...VDKE..KRE.......V..A---------------------------------------------------
Q5NZG7_AROAE/348-422.ETP--...AVT.....GTT...DQV..D---------------------------------------------------
Q5P9S8_ANAMM/28-95.RAE--..........GN..........E---------------------------------------------------
Q5P9S8_ANAMM/96-174.AVR--...RAP...HNA.......V..D---------------------------------------------------
Q5P9S8_ANAMM/177-268.SRD--...LTR.............M..T---------------------------------------------------
Q5P9S8_ANAMM/355-427.ETQ--..KISD....SL.......V..D---------------------------------------------------
Q5R0Z1_IDILO/25-92RSED--......................T---------------------------------------------------
Q5R0Z1_IDILO/93-173.QVV--...DLP....RN......RV..E---------------------------------------------------
Q5R0Z1_IDILO/176-264.QVS--...MTPD..REG.......I..Y---------------------------------------------------
Q5R0Z1_IDILO/267-345.IPE--...HDDE..DKT.......V..K---------------------------------------------------
Q5R0Z1_IDILO/348-422.EGR--...DDQ.............V..D---------------------------------------------------
Q5SKT2_THET8/83-163.EAK--...EDK....EG.......I..A---------------------------------------------------
Q5SKT2_THET8/164-238.EAS--T.LEEG................V---------------------------------------------------
Q5SKT2_THET8/375-450.GEK--...PDE.............A..V---------------------------------------------------
Q5UCE9_LEPIR/114-187.GSD--..QTKM................N---------------------------------------------------
Q5WVP5_LEGPL/184-255.KPQ--...ITDA.QT.........V..P---------------------------------------------------
Q5WZ37_LEGPL/30-97.ERQ--..........GN..........V---------------------------------------------------
Q5WZ37_LEGPL/98-178.KVT--...PLT....EN......RV..A---------------------------------------------------
Q5WZ37_LEGPL/181-269.QVL--...LSPD..KKD.......V..Y---------------------------------------------------
Q5WZ37_LEGPL/272-350.EPR--...LDEN..NKT.......V..F---------------------------------------------------
Q5WZ37_LEGPL/353-427.KTT--...PVPG.TNNQ.......V..D---------------------------------------------------
Q604T9_METCA/56-123.DED--..........DG..........K---------------------------------------------------
Q604T9_METCA/124-204.QVT--...ELP....RN......RV..A---------------------------------------------------
Q604T9_METCA/207-295.TPN--...KKE.............I..Y---------------------------------------------------
Q604T9_METCA/298-376.VPD--...INQE..KKT.......V..N---------------------------------------------------
Q604T9_METCA/379-453.ETP--...AVPGTTDQI..........D---------------------------------------------------
Q62CQ1_BURMA/318-390.QII--N.EGDE.............H..R---------------------------------------------------
Q62JD2_BURMA/31-98.ATQ--..........GG..........V---------------------------------------------------
Q62JD2_BURMA/99-179.TVT--PVDANR.............V..S---------------------------------------------------
Q62JD2_BURMA/182-270.SPD--...KKD.............M..Y---------------------------------------------------
Q62JD2_BURMA/273-351.QPE--...IDQA..THK.......V..G---------------------------------------------------
Q62JD2_BURMA/354-428.TTV--...PVEG.TNDQ.......V..D---------------------------------------------------
Q62LE4_BURMA/222-296.DVA--...DDVAHPLDS..........P---------------------------------------------------
Q64Z23_BACFR/5-84.TQR--...DDPA.NENQ.......V..L---------------------------------------------------
Q64Z23_BACFR/87-175.KDS--VSKFDD....KT.......V..D---------------------------------------------------
Q64Z23_BACFR/178-259.VEV--..NIDN....DS.......I..D---------------------------------------------------
Q64Z23_BACFR/262-337.QPD--...PVN....GT.......V..D---------------------------------------------------
Q65R79_MANSM/21-87.ARD--..........GN..........T---------------------------------------------------
Q65R79_MANSM/88-168.IVN--...NLP....NN......TA..E---------------------------------------------------
Q65R79_MANSM/260-339.HPD--...FDEE..NKT.......I..A---------------------------------------------------
Q65R79_MANSM/342-416.RTE--...EVPGSDDEL..........D---------------------------------------------------
BAMA_YERPS/266-344.QPE--...INDD..DKT.......V..K---------------------------------------------------
BAMA_YERPS/347-421.ETQ--...RVPGAADLV..........D---------------------------------------------------
Q66F88_YERPS/190-264.SPD--...FQDAKESKI.......L..P---------------------------------------------------
Q68XK8_RICTY/26-94.YIT--...NDG................N---------------------------------------------------
Q68XK8_RICTY/95-172.KIK--NLENNR.............V..K---------------------------------------------------
Q68XK8_RICTY/175-263.SVE--...LNDT..KEY.......F..T---------------------------------------------------
Q68XK8_RICTY/266-344.EIK--...KND...NHT.......A..D---------------------------------------------------
Q68XK8_RICTY/347-420.SLA--KTKAKD....KY..........D---------------------------------------------------
Q6ARL5_DESPS/20-91.DVK--E.TAKG.............K..T---------------------------------------------------
Q6ARL5_DESPS/92-170.EIS--..YPAE....SG......GA..V---------------------------------------------------
Q6ARL5_DESPS/173-259.QVR--...QEG....DL.......V..Y---------------------------------------------------
Q6ARL5_DESPS/262-340.RTR--...KSAV..GNR.......I..D---------------------------------------------------
Q6ARL5_DESPS/343-416.TPE--..PTSDP.SR.........M..N---------------------------------------------------
Q6ATX4_ORYSJ/67-146.GPP--...ELP....GT.......T..N---------------------------------------------------
Q6D152_ERWCT/230-304.SPN--...FEQSKSTKV.......L..P---------------------------------------------------
Q6FCG7_ACIAD/28-95.YKQ--..........ND..........V---------------------------------------------------
Q6FCG7_ACIAD/96-176.ETV--...AQP....NN......RV..E---------------------------------------------------
Q6FCG7_ACIAD/179-267.SED--..KKHI................F---------------------------------------------------
Q6FCG7_ACIAD/270-348.VPQ--...INNE..TGL.......V..D---------------------------------------------------
Q6FCG7_ACIAD/351-425.KPV--...RVPN.STDE.......V..D---------------------------------------------------
Q6G1J3_BARQU/107-184.QTI--N.LGKG....RV..........N---------------------------------------------------
Q6G1J3_BARQU/187-275.KAV--...FDEA..RNA.......Y..K---------------------------------------------------
Q6G1J3_BARQU/278-357.RGN--...RDLA..NHT.......I..S---------------------------------------------------
Q6G1J3_BARQU/360-433.TDQ--...SDQ.............I..I---------------------------------------------------
Q6LHU2_PHOPR/343-412.ELE--..KNGK................Q---------------------------------------------------
Q6LKQ8_PHOPR/351-422.VID--..QKDD....EN..........I---------------------------------------------------
Q6LMH9_PHOPR/358-429.SIE--KGDDKN................I---------------------------------------------------
Q6LN32_PHOPR/24-91RDGD--......................A---------------------------------------------------
Q6LN32_PHOPR/175-263.QVS--...ISPD..KKG.......V..Y---------------------------------------------------
Q6LN32_PHOPR/266-344.IPD--...FDDD..KNE.......V..S---------------------------------------------------
Q6MAC6_PARUW/256-330.SPA--Q.EPVQ....GN......LL..P---------------------------------------------------
Q6MAE9_PARUW/137-215.HVE--..LNSET.NE.........V..N---------------------------------------------------
Q6MAE9_PARUW/218-306.NVM--...EASK..TDR.......I..I---------------------------------------------------
Q6MAE9_PARUW/309-387.EPE--...LDER..DYK.......Y..H---------------------------------------------------
Q6MAE9_PARUW/390-467.YIV--..........KGTESTLGNNYRD---------------------------------------------------
Q6MKB1_BDEBA/93-170.EMP--...PE.S..PES.......V..S---------------------------------------------------
Q6MKB1_BDEBA/419-500ERAD--LVTYDE....TN.......TKAT---------------------------------------------------
Q6MKB1_BDEBA/503-577.RTL--...EEKTNVANR..........T---------------------------------------------------
Q6MMX9_BDEBA/48-119.DRK--A.TGKD.............V..T---------------------------------------------------
Q6MMX9_BDEBA/120-198.EVQ--EVTKDE....TV..........R---------------------------------------------------
Q6MMX9_BDEBA/201-289.QVT--...VTPD..KKN.......I..Y---------------------------------------------------
Q6MMX9_BDEBA/292-370.RTR--...FNDK..ERR.......V..D---------------------------------------------------
Q6MMX9_BDEBA/373-447.DPE--..RTEV.............M..N---------------------------------------------------
Q6N5Q8_RHOPA/39-106.NQA--..........GG..........R---------------------------------------------------
Q6N5Q8_RHOPA/107-184.QII--..EQPN....NR.......V..D---------------------------------------------------
Q6N5Q8_RHOPA/187-275.LTE--...YDPE..RKG.......F..L---------------------------------------------------
Q6N5Q8_RHOPA/278-357.RGD--...RNFD..EHT.......V..S---------------------------------------------------
Q6N5Q8_RHOPA/360-433.TTE--..PGSS....SD......RV..I---------------------------------------------------
Q6Q8T1_9GAMM/23-90.GKD--..........GN..........T---------------------------------------------------
Q6Q8T1_9GAMM/91-171.DEI--...VKP....RN......RI..E---------------------------------------------------
Q6Q8T1_9GAMM/174-262.SRD--...KKS.............I..F---------------------------------------------------
Q6Q8T1_9GAMM/265-343.NPE--...INEA..TNE.......V..K---------------------------------------------------
Q6Q8T1_9GAMM/346-420.ETI--...PVPG.TEDQ.......I..D---------------------------------------------------
BAMA_DESVH/59-130.SVE--Q.GGDG.............T..V---------------------------------------------------
BAMA_DESVH/131-209.RVE--..ARQG....AA......SA..T---------------------------------------------------
BAMA_DESVH/212-298.APK--V.DYEE....DG.......I..I---------------------------------------------------
BAMA_DESVH/301-383.RTQ--...KSAE..EHV.......I..D---------------------------------------------------
BAMA_DESVH/386-459.ELV--..PTQKE.DE.........V..D---------------------------------------------------
Q72RW5_LEPIC/53-124.QAE--D.FQDG.............V..R---------------------------------------------------
Q72RW5_LEPIC/125-204.ELG--..KPDP....KT.......NLVR---------------------------------------------------
Q72RW5_LEPIC/207-299.EIH--..WENPE..KKDR....RVI..I---------------------------------------------------
Q73G77_WOLPM/28-96.YID--...DKK................N---------------------------------------------------
Q73G77_WOLPM/274-352.EYA--...QRDN..V.........V..D---------------------------------------------------
Q73JH4_TREDE/30-104.KAI--...PADEKYQYV..........L---------------------------------------------------
Q73JH4_TREDE/105-183.KTS--...EDKE..KNS.......V..N---------------------------------------------------
Q73JH4_TREDE/186-274.DTE--...SDPQ..KDQ.......I..T---------------------------------------------------
Q73JH4_TREDE/277-355.KEN--..RNTS....TK......EV..S---------------------------------------------------
Q73JH4_TREDE/358-431.VLQ--..GSEP....DL.......V..D---------------------------------------------------
Q74AT3_GEOSL/27-98.ETE--...QGD....GG.......V..V---------------------------------------------------
Q74AT3_GEOSL/99-176.RSE--K.RSDT....DV..........R---------------------------------------------------
Q74AT3_GEOSL/179-267.QVA--..LNED....KS......GL..I---------------------------------------------------
Q74AT3_GEOSL/270-348.LTK--...VNPE..TKT.......V..D---------------------------------------------------
Q74AT3_GEOSL/351-424.TVK--..GSAE....NK.......L..D---------------------------------------------------
Q7CWM5_AGRT5/240-314.KEA--..GTLA....RDG.....TI..P---------------------------------------------------
Q7MAB6_WOLSU/20-87.TEE--..........SG..........V---------------------------------------------------
Q7MAB6_WOLSU/88-166.TTE--...KLS...DQA.......I..K---------------------------------------------------
Q7MAB6_WOLSU/169-259.SLL--...ADFT..TYD.......A..N---------------------------------------------------
Q7MAB6_WOLSU/262-341.DLD--...KDEE..NAK.......V..R---------------------------------------------------
Q7MAB6_WOLSU/344-416.EER--..RVSE....DS.......V..D---------------------------------------------------
Q7MHW3_VIBVY/361-432.EVD--...GIN................Q---------------------------------------------------
Q7MIG8_VIBVY/24-91RDGD--......................V---------------------------------------------------
Q7MIG8_VIBVY/266-344.IPE--...FDDE..NKQ.......V..S---------------------------------------------------
Q7MPD6_VIBVY/100-183.AAD--...LNQ.............A..F---------------------------------------------------
Q7MXJ3_PORGI/45-119.IAD--K.YVGN....KV..........Y---------------------------------------------------
Q7MXJ3_PORGI/120-199.TQE--...PDLS.KDGF.......V..N---------------------------------------------------
Q7MXJ3_PORGI/302-383.VET--..NVVG....DS.......V..S---------------------------------------------------
Q7MXJ3_PORGI/386-461.IPN--...PET....GT.......V..D---------------------------------------------------
Q7MYW2_PHOLL/190-266.ARK--...NGD....GM.......L..P---------------------------------------------------
BAMA_PHOLL/266-344.QPE--...INDQ..GKT.......V..K---------------------------------------------------
Q7NJG9_GLOVI/85-160.TPE--...DTP....LG.......V..R---------------------------------------------------
Q7NVY6_CHRVO/25-92.ESR--..........GD..........T---------------------------------------------------
Q7NVY6_CHRVO/93-173.TVT--..KLER....NR.......V..A---------------------------------------------------
Q7NVY6_CHRVO/176-264.GAD--..KKDM................Y---------------------------------------------------
Q7NVY6_CHRVO/267-345.LPD--...IDRE..KQT.......A..A---------------------------------------------------
Q7NVY6_CHRVO/348-422.VAD--..APDQ.............V..D---------------------------------------------------
Q7P0N3_CHRVO/181-255.DFD--..HIVD....NR.......V..P---------------------------------------------------
Q7P3C7_FUSNV/76-147.DAQ--VANGKM................A---------------------------------------------------
Q7P3C7_FUSNV/148-222.MST--..DENG................T---------------------------------------------------
Q7PAV1_RICSI/266-344.DIM--...KNA....NH......TA..D---------------------------------------------------
Q7U8Q8_SYNPX/59-135.NPV--...NGP....LG.......V..Q---------------------------------------------------
Q7U8Q8_SYNPX/217-301LKPV--PEQPGD.............V..V---------------------------------------------------
Q7UK20_RHOBA/97-179.ETE--...ERVTRANGSSNAPQKSV..L---------------------------------------------------
Q7UK20_RHOBA/180-256.GIG--...LPSD..T.........N..A---------------------------------------------------
Q7UK20_RHOBA/259-346.RIE--...YDET..GKW.......L..T---------------------------------------------------
Q7UK20_RHOBA/349-427.KTI--...MRDE..NGI.......V..D---------------------------------------------------
Q7V0C8_PROMP/84-160.KSQ--...DGP....LG.......V..R---------------------------------------------------
Q7V0C8_PROMP/253-325LGPD--IKNPGK.............V..L---------------------------------------------------
Q7V5X2_PROMM/98-174.EPS--...DGP....LG.......V..Q---------------------------------------------------
Q7VAN9_PROMA/161-237.QPI--...DTP....LG.......V..Q---------------------------------------------------
Q7VAN9_PROMA/238-314.GPN--..RITP....KG..........K---------------------------------------------------
Q7VHH5_HELHP/19-86.DFN--..........GG..........I---------------------------------------------------
Q7VHH5_HELHP/87-166.DIT--...QVGE..DKA.......Y..A---------------------------------------------------
Q7VHH5_HELHP/169-259.FLD--...ANFN..DYS.......A..N---------------------------------------------------
Q7VHH5_HELHP/262-341.DLD--...KDPQ..NAE.......V..K---------------------------------------------------
Q7VHH5_HELHP/344-416.DER--RVSEDS.............M..D---------------------------------------------------
Q7VQ47_CHLPN/108-186.SLE--H.NQEK....GH.......I..D---------------------------------------------------
Q7VQ47_CHLPN/189-276.IVN--...SHYD..LDDK....GNI..L---------------------------------------------------
Q7VQ47_CHLPN/279-357.LFI--...PHA....TR.......PIYD---------------------------------------------------
Q7VRD8_BLOFL/32-100.FND--...ENG................I---------------------------------------------------
Q7VRD8_BLOFL/101-181.NTI--...VLP....KN......RV..I---------------------------------------------------
Q7VRD8_BLOFL/184-272.DIK--...MTPD..KRN.......V..Y---------------------------------------------------
Q7VRD8_BLOFL/356-430.VPN--..KSNQ.............V..D---------------------------------------------------
Q7VYC2_BORPE/34-101.QTD--..........NN..........V---------------------------------------------------
Q7VYC2_BORPE/102-182.TVT--...PLP....RN......RV..G---------------------------------------------------
Q7VYC2_BORPE/185-273.SPD--...RKD.............I..Y---------------------------------------------------
Q7VYC2_BORPE/276-354.NPQ--...LDRA..KHE.......A..D---------------------------------------------------
Q7VYC2_BORPE/357-431.KTD--...PVP.....GSP...DQV..D---------------------------------------------------
Q823D8_CHLCV/106-184.DLD--H.NEHL....GY.......I..D---------------------------------------------------
Q823D8_CHLCV/187-274.RRE--IDECGN.............I..I---------------------------------------------------
Q823D8_CHLCV/277-355.TFS--...PHA....SR.......SVYD---------------------------------------------------
Q82U03_NITEU/23-90.KSE--..........GG..........L---------------------------------------------------
Q82U03_NITEU/91-171.TTT--...PLE....RN......RI..G---------------------------------------------------
Q82U03_NITEU/174-262.TPD--...MKD.............I..Y---------------------------------------------------
Q82U03_NITEU/265-343.SPE--...LDKE..TRK.......T..A---------------------------------------------------
Q82U03_NITEU/346-420.VAD--..VPDQ.............V..D---------------------------------------------------
Q82VX0_NITEU/116-201.DPD--..TAQA................T---------------------------------------------------
Q82VX0_NITEU/204-278.DPM--..QHEA.............V..P---------------------------------------------------
Q83DT2_COXBU/31-98.ARR--..........GD..........A---------------------------------------------------
Q83DT2_COXBU/99-179.RVV--...KET....KN......RV..A---------------------------------------------------
Q83DT2_COXBU/182-270.SPD--..KKHV................Y---------------------------------------------------
Q83DT2_COXBU/273-351.IPT--...IDDQ..QHL.......V..H---------------------------------------------------
Q83DT2_COXBU/354-428.TPQ--...IVPN.SPDQ.......V..D---------------------------------------------------
Q87EI1_XYLFT/272-350.IPT--...ANRA..DRT.......V..A---------------------------------------------------
Q87LW2_VIBPA/354-425.HFE--EVDGSN................L---------------------------------------------------
Q87ME5_VIBPA/266-344.IPE--...FDDE..NKQ.......V..S---------------------------------------------------
Q87SW5_VIBPA/101-182.IPE--...LNE.............A..N---------------------------------------------------
Q881Y2_PSESM/187-261.APT--..AAEN....QV.......I..P---------------------------------------------------
Q886N5_PSESM/23-90.GRD--..........GN..........V---------------------------------------------------
Q886N5_PSESM/91-171.EVV--...PQP....RN......RV..G---------------------------------------------------
Q886N5_PSESM/174-262.QVS--...ITPD..KKN.......V..Y---------------------------------------------------
Q886N5_PSESM/265-343.VPT--...PNNE..DHT.......V..D---------------------------------------------------
Q886N5_PSESM/346-420.ETP--...PVPG.TDDQ.......V..D---------------------------------------------------
Q88EF1_PSEPK/356-425.RVV--H.KGND.............H..T---------------------------------------------------
Q88IV7_PSEPK/195-269.APT--..AAVG....EE.......V..P---------------------------------------------------
Q89KQ1_BRAJA/278-357.GGD--...RNFE..AHT.......V..S---------------------------------------------------
Q89NX1_BRAJA/79-147.RRA--..........GA..........Q---------------------------------------------------
Q89NX1_BRAJA/148-225.EIV--EQPNNR.............V..D---------------------------------------------------
Q89NX1_BRAJA/319-398.TGD--...RNFE..AQT.......V..S---------------------------------------------------
Q8A1E1_BACTN/46-120.QIT--...AEKI.EGNK.......I..W---------------------------------------------------
Q8A1E1_BACTN/121-200.AQK--...DDPS.NENQ.......V..I---------------------------------------------------
Q8A1E1_BACTN/203-291.KDS--VAQYDE....KT.......V..D---------------------------------------------------
Q8A1E1_BACTN/378-447.QPD--..IQPD................P---------------------------------------------------
Q8D271_WIGBR/189-264.SPD--..IYNNSKYKNV.......V..P---------------------------------------------------
Q8D2H0_WIGBR/27-94.SYE--..........EN..........N---------------------------------------------------
Q8D2H0_WIGBR/95-175.NSI--...NLK....NN......KV..D---------------------------------------------------
Q8D2H0_WIGBR/178-266.KVN--...IIKE..KKF.......V..Y---------------------------------------------------
Q8D2H0_WIGBR/348-422.APN--..MENY.............L..D---------------------------------------------------
Q8DI03_THEEB/90-161.VPR--...DTP....LG.......V..R---------------------------------------------------
Q8DI03_THEEB/242-318LEPG--...QDP....RK.......V..N---------------------------------------------------
Q8EF72_SHEON/112-195.NRD--...LNT.............A..Q---------------------------------------------------
Q8EF72_SHEON/198-271.IPQ--L.DLAK....DN......QL..P---------------------------------------------------
Q8EGG7_SHEON/29-96.SHE--..........DG..........V---------------------------------------------------
Q8EGG7_SHEON/97-177.QVI--...NLP....RN......RV..E---------------------------------------------------
Q8EGG7_SHEON/180-268.QVA--...MTPD..RKG.......L..Y---------------------------------------------------
Q8EGG7_SHEON/271-349.YPE--...IDDK..TKE.......V..T---------------------------------------------------
Q8EGG7_SHEON/352-426.ETI--...QVPG.TDDL.......V..D---------------------------------------------------
Q8EJN5_SHEON/337-408.EFV--...EGED..GRV...........---------------------------------------------------
Q8GBX8_PASMD/261-340.HPT--...FDEQ..DKT.......I..S---------------------------------------------------
Q8I576_PLAF7/116-193.HEV--V.KKGK....DK..........T---------------------------------------------------
BAMA_BUCAP/24-91.IKI--...VHS....GK..........T---------------------------------------------------
BAMA_BUCAP/92-172.FKK--...ISS....NN......KI..D---------------------------------------------------
BAMA_BUCAP/175-263.KVR--...FLKD..KNK.......V..N---------------------------------------------------
BAMA_BUCAP/266-344.YPQ--...INFK..EKK.......I..I---------------------------------------------------
BAMA_BUCAP/347-421.QKE--ILFNKE....NG.......V..D---------------------------------------------------
Q8KBW3_CHLTE/43-133.TVK--...RSK...NGD.......V..S---------------------------------------------------
Q8KC70_CHLTE/372-447.VGI--...ERAS..VSG.......E..T---------------------------------------------------
Q8KFQ6_CHLTE/57-131.EQT--D.LGSG....NI..........K---------------------------------------------------
Q8KFQ6_CHLTE/132-209.RLQ--N.IGEN....KV..........K---------------------------------------------------
Q8KFQ6_CHLTE/212-301.TIT--...YTDD..KKG.......L..I---------------------------------------------------
Q8KFQ6_CHLTE/304-389.EEQ--..VVQP....NQ.......V..D---------------------------------------------------
Q8KFQ6_CHLTE/392-467.NAK--...NDT.............V..D---------------------------------------------------
Q8LEH7_ARATH/74-152.GPP--...ELP....GT.......T..N---------------------------------------------------
Q8PEY4_XANAC/199-273.QPK--...PEEADDQGC.......V..P---------------------------------------------------
Q8RHT4_FUSNN/4-75.QPV--...SYD....GG.......V..R---------------------------------------------------
Q8RHT4_FUSNN/251-335.EAR--...SIP....GDP....EGI..D---------------------------------------------------
A9CJ61_AGRT5/38-105.RVS--..........GS..........T---------------------------------------------------
A9CJ61_AGRT5/106-183.QTV--..SVGQ....GR.......V..N---------------------------------------------------
A9CJ61_AGRT5/186-274.DAV--...LDES..KNE.......Y..T---------------------------------------------------
A9CJ61_AGRT5/277-356.RGD--...RDMS..GNT.......I..G---------------------------------------------------
A9CJ61_AGRT5/359-432.STA--..GGSAP.DR.........V..V---------------------------------------------------
Q8XZI3_RALSO/30-97.RAE--..........GN..........V---------------------------------------------------
Q8XZI3_RALSO/98-178.TVT--PVDANR.............V..S---------------------------------------------------
Q8XZI3_RALSO/181-269.TPD--...KKD.............I..Y---------------------------------------------------
Q8XZI3_RALSO/272-350.QPQ--...INQK..DRT.......V..A---------------------------------------------------
Q8XZI3_RALSO/353-427.TTE--...DVPGMSDQV..........D---------------------------------------------------
Q8YUR6_NOSS1/221-296.SPE--...DTP....LG.......V..R---------------------------------------------------
Q8YUR6_NOSS1/395-466LDPG--...TDP.............TKVN---------------------------------------------------
Q92LN9_RHIME/217-291.EAD--..GLAP....DG......TI..P---------------------------------------------------
Q92Q48_RHIME/39-106.TVS--..........GG..........S---------------------------------------------------
Q92Q48_RHIME/107-184.TTQ--...VVPIAEGRV..........N---------------------------------------------------
Q92Q48_RHIME/187-275.EAA--...LNEA..TNE.......Y..T---------------------------------------------------
Q92Q48_RHIME/278-357.RGN--...RDLA..NHT.......I..A---------------------------------------------------
Q92Q48_RHIME/360-431.STQ--PGSAAD................R---------------------------------------------------
Q93PM2_HAEDC/20-87.ARE--..........GQ..........T---------------------------------------------------
Q93PM2_HAEDC/88-168.ITT--...PNN....NG......SI..N---------------------------------------------------
Q93PM2_HAEDC/171-259.KFN--...ENK....TE.......V..D---------------------------------------------------
Q93PM2_HAEDC/262-341.YPK--...FNEE..DHT.......V..Q---------------------------------------------------
Q93PM2_HAEDC/344-418.KNT--...DDQ.............V..D---------------------------------------------------
Q98K30_RHILO/218-292.ADK--..LDAD....GN.......I..P---------------------------------------------------
Q98MC3_RHILO/39-106.NQV--..........GS..........T---------------------------------------------------
Q98MC3_RHILO/107-184.QVM--E.LGDN....RV..........N---------------------------------------------------
Q98MC3_RHILO/187-275.VGE--...LDNA..TNK.......Y..T---------------------------------------------------
Q98MC3_RHILO/278-357.RGD--...RNFE..NHT.......I..S---------------------------------------------------
Q98MC3_RHILO/360-433.GSQ--...PDQ.............V..V---------------------------------------------------
Q9A711_CAUCR/24-91.EML--..........GG..........D---------------------------------------------------
Q9A711_CAUCR/92-169.KVV--ELPQKR.............V..D---------------------------------------------------
Q9A711_CAUCR/172-260.VAE--...LAPD..KNG.......F..A---------------------------------------------------
Q9A711_CAUCR/263-342.RYV--...PNRE..TKT.......V..D---------------------------------------------------
Q9A711_CAUCR/345-418.EDA--...PGSA.PDRT..........S---------------------------------------------------
Q9HXY4_PSEAE/265-343.VPE--...AHDD..DKT.......V..S---------------------------------------------------
Q9HYQ6_PSEAE/333-404.RVV--K.EKKL.............N..T---------------------------------------------------
Q9I0U1_PSEAE/190-268.DAA--...PTQ....AQADGARQAI..P---------------------------------------------------
Q9KPW0_VIBCH/266-344.IPE--...FDDE..KQQ.......V..S---------------------------------------------------
Q9KUB9_VIBCH/347-418.EQR--..DDQQ................Q---------------------------------------------------
Q9RXD5_DEIRA/97-179.DTK--T.NKDG....TA..........T---------------------------------------------------
Q9RXD5_DEIRA/180-256.GID--...PRS...VTLE.....NG..V---------------------------------------------------
Q9RXD5_DEIRA/329-402.TFQ--..........NG..........V---------------------------------------------------
Q9RXD5_DEIRA/407-477.DPQ--N.PENV................T---------------------------------------------------
BAMA_PHOLU/175-263.QVS--...LTPD..KKG.......I..Y---------------------------------------------------
Q9SRL6_ARATH/77-155.GPP--...ELP....GT.......T..N---------------------------------------------------
Q9WYS9_THEMA/19-89.SLE--...PAD.............VGYR---------------------------------------------------
Q9WYS9_THEMA/90-164.SFE--..........NG..........T---------------------------------------------------
Q9WYS9_THEMA/270-342.EDD--......................R---------------------------------------------------

PF08479

Q8XQ41_RALSO/70-145.PAQ..SI.RDG----------------Q-.-------------------------------------------------
Q7W7Z0_BORPA/73-148.QNQ..DF.ANG----------------L-.-------------------------------------------------
Q8RI18_FUSNN/32-109SEDN..DL.STK----------------T-.-------------------------------------------------
Q7NU30_CHRVO/77-152.PEQ..NL.RGG----------------Q-.-------------------------------------------------
Q7N2L1_PHOLL/77-152.RAQ..DL.STG----------------T-.-------------------------------------------------
Q7N9T5_PHOLL/77-152.NAQ..DL.SSG----------------I-.-------------------------------------------------
HLYB_SERMA/79-152VRPN.....SQG----------------E-.-------------------------------------------------
Q6G3U5_BARHE/90-166.PDQ..DIKSSK----------------A-.-------------------------------------------------
Q88MW8_PSEPK/83-158RQPP.....AEG----------------M-P-------------------------------------------------
Q8PF71_XANAC/63-139.PAQ..TPGPDQ----------------L-.-------------------------------------------------
Q7N107_PHOLL/69-145.PRQ..DL.RTQ----------------T-.-------------------------------------------------
Q605Q3_METCA/48-123.PEQ..DV.NEG----------------V-.-------------------------------------------------
Q664C6_YERPS/89-165.VGD..SE.RDG----------------T-.-------------------------------------------------
Q71BF5_HAEIF/73-150.PPQ..EI.EQG----------------T-.-------------------------------------------------
Q9JY36_NEIMB/87-166.APQ..DL.NSG----------------K-.-------------------------------------------------
Q8YM25_NOSS1/96-171.TPQ..TV.EAG----------------V-.-------------------------------------------------
Q7N1B0_PHOLL/77-152.KAQ..DL.SSG----------------T-.-------------------------------------------------
Q89H68_BRAJA/98-173.PPQ..DI.ANG----------------V-.-------------------------------------------------
Q93QU8_ECOLX/82-162.PPQ..TI.RDG----------------L-.-------------------------------------------------
Q9HVN7_PSEAE/59-134.PAQ..EI.QDG----------------T-.-------------------------------------------------
Q8XQZ3_RALSO/84-163.APQ..DL.KQG----------------T-.-------------------------------------------------
Q880E0_PSESM/77-152.PQQ..DL.STG----------------D-.-------------------------------------------------
Q8XYH9_RALSO/79-151.PQQ..NL.AEG----------------A-.-------------------------------------------------
O32607_EDWTA/81-154LRPN.....ARG----------------E-.-------------------------------------------------
Q8DLP0_THEEB/81-156.NEQ..VV.RDG----------------V-.-------------------------------------------------
Q8XQX3_RALSO/69-144.PAQ..TF.EGG----------------V-.-------------------------------------------------
Q8X9M8_ECO57/65-141.PSQ..DL.KSG----------------I-.-------------------------------------------------
Q7MRX6_WOLSU/59-134.KPQ..NI.SDG----------------E-.-------------------------------------------------
Q8PLI4_XANAC/79-156.PEQ..DL.SRG----------------E-.-------------------------------------------------
Q9RGR3_BORBO/89-164VPPG...V.VDG----------------V-.-------------------------------------------------
P94771_ERWCH/76-151.SEQ..DL.SGG----------------V-.-------------------------------------------------
Q9I792_PSEAE/71-146.PQQ..DL.ASG----------------T-.-------------------------------------------------
Q8XPV1_RALSO/81-156.APQ..NL.KVG----------------V-.-------------------------------------------------
Q7VLT7_HAEDU/59-128.EDK.....LSG----------------F-.-------------------------------------------------
Q7NWR3_CHRVO/87-160EGPD.....ADG----------------A-.-------------------------------------------------
Q6RK56_ERWCR/75-150.SEQ..DL.SSG----------------I-.-------------------------------------------------
Q6FDM4_ACIAD/101-180.PAQ..NI.ASG----------------Q-.-------------------------------------------------
Q8VMR1_PHOLU/79-152IAPN.....TDG----------------E-.-------------------------------------------------
Q5GD94_XENNE/79-152IPPN.....SNG----------------E-.-------------------------------------------------
Q9AHG0_9FUSO/86-161.PAQ..KI.QNG----------------L-.-------------------------------------------------
Q63JI8_BURPS/74-148.AEQ..NL.SSG----------------K-.-------------------------------------------------
HLYB_PROMI/77-150LRPN.....QHG----------------E-.-------------------------------------------------
Q9AAJ4_CAUCR/8-83.PAQ..TV.VDG----------------V-.-------------------------------------------------
Q63TR3_BURPS/65-140.PAQ..TF.EGG----------------V-.-------------------------------------------------
Q89Q77_BRAJA/73-148.PDQ..DA.KGG----------------V-.-------------------------------------------------
Q8XAN8_ECO57/70-144.PSQ..DI.SKG----------------K-.-------------------------------------------------
Q9HVG7_PSEAE/71-146.PEQ..SI.EGG----------------K-.-------------------------------------------------
Q6DA64_ERWCT/107-183.PAQ..DL.KSG----------------T-.-------------------------------------------------
Q8RGK0_FUSNN/41-115.NTEKSDF.ENG----------------N-.-------------------------------------------------
Q8G9X8_ECOLX/104-179.TEQ..DL.SGG----------------V-.-------------------------------------------------
Q9PAG8_XYLFA/106-185.APQ..DL.KSG----------------E-.-------------------------------------------------
Q74E11_GEOSL/79-154.PPQ..KV.ERG----------------T-.-------------------------------------------------
Q8YWF4_NOSS1/18-93PNNQ..NL.TDG----------------V-.-------------------------------------------------
Q7N910_PHOLL/78-154.PSQ..NL.NSK----------------T-.-------------------------------------------------
IBPB_HAES2/99-172.KSS..KI.KNG----------------E-.-------------------------------------------------
Q88QC1_PSEPK/91-166.PPQ..DV.ADG----------------R-.-------------------------------------------------
Q7NY08_CHRVO/92-167.PAQ..TP.SDG----------------T-.-------------------------------------------------
Q669F9_YERPS/77-153.PQQ..DL.NSG----------------T-.-------------------------------------------------
Q8D0E8_YERPE/68-141IPLN.....NAG----------------E-.-------------------------------------------------
Q9I5N4_PSEAE/47-122.PEQ..QV.SGG----------------V-.-------------------------------------------------

PF08478

FTSQ_VIBF1/50-120-RKQ-----.WP----------------E.T-------------------------------------------------
Q5FG13_EHRRG/81-147-KRL-----.LP----------------N.T-------------------------------------------------
FTSQ_SHEON/52-121-RRE-----.WP----------------A.K-------------------------------------------------
DIVIB_BACSU/54-123-SKS-----.LP----------------N.K-------------------------------------------------
FTSQ_STRCU/57-126-VRS-----.WP----------------H.G-------------------------------------------------
FTSQ_RHIME/89-157-RKV-----.YP----------------G.T-------------------------------------------------
Q5P6Z9_AROAE/37-106-RRR-----.WP----------------D.V-------------------------------------------------
O83403_TREPA/55-123-LKK-----.FP----------------D.T-------------------------------------------------
DIVIB_CLOTE/54-122-KRK-----.LP----------------N.K-------------------------------------------------
FTSQ_ECOLI/55-126-RKQ-----.WP----------------D.E-------------------------------------------------
FTSQ_STRGR/5-74-VRS-----.WP----------------D.G-------------------------------------------------
Q8D2Z8_WIGBR/41-111-EKK-----.WP----------------N.C-------------------------------------------------
Q8RMK7_AZOBR/99-167-ERH-----.LP----------------D.I-------------------------------------------------
Q83N06_TROWT/56-124-EAK-----.PP----------------G.A-------------------------------------------------
Q8E185_STRA5/122-193-TYQ-----.FP----------------N.K-------------------------------------------------
Q5SJC7_THET8/24-91-EKP-----.AL----------------G.Q-------------------------------------------------
Q9F1M8_SHEVI/67-136-RRE-----.WP----------------A.K-------------------------------------------------
Q5R0N0_IDILO/43-112-RKV-----.WP----------------D.K-------------------------------------------------
Q6F706_ACIAD/59-128-SRA-----.WP----------------N.S-------------------------------------------------
Q728V1_DESVH/71-139-KR.-----LLP----------------D.R-------------------------------------------------
O07671_ENTHR/66-137-HFK-----.SI----------------N.T-------------------------------------------------
FTSQ_HAEIN/54-124-RKM-----.WP----------------N.R-------------------------------------------------
DIVIB_STRR6/153-223-VYQ-----.FP----------------T.K-------------------------------------------------
Q9CPA8_PASMU/55-125-RKI-----.WP----------------D.K-------------------------------------------------
Q7MNU9_VIBVY/53-123-RKQ-----.WP----------------D.T-------------------------------------------------
O07324_STAAU/195-263-HKQ-----.LP----------------N.T-------------------------------------------------
Q73IQ7_WOLPM/61-128-HRI-----.LP----------------N.T-------------------------------------------------
Q7NQ02_CHRVO/37-106-RRR-----.WP----------------D.A-------------------------------------------------
Q5YYX7_NOCFA/42-110-KRV-----.YP----------------Q.T-------------------------------------------------
Q8DVE1_STRMU/126-197-VYH-----.FP----------------N.H-------------------------------------------------
Q82AD6_STRAW/56-125-VRS-----.WP----------------H.G-------------------------------------------------
Q8YQH2_NOSS1/56-126-NRR-----LFP----------------P.G-------------------------------------------------
Q98KB7_RHILO/92-160-RKV-----.YP----------------H.T-------------------------------------------------
Q5XB06_STRP6/125-196-SYQ-----.FP----------------N.H-------------------------------------------------
FTSQ_COXBU/46-115-RRI-----.WP----------------N.E-------------------------------------------------
Q5HQ08_STAEQ/219-287-HKQ-----.LP----------------N.T-------------------------------------------------
Q57352_BORBG/33-101-DLK-----.FP----------------N.K-------------------------------------------------
Q8DMI0_THEEB/61-130-ARQ-----LFP----------------P.T-------------------------------------------------
Q72N66_LEPIC/45-113-TKK-----.SE----------------D.Q-------------------------------------------------
O07110_ENTFL/126-197-KLN-----.GI----------------N.S-------------------------------------------------
FTSQ_BARBA/87-155-QKI-----.YP----------------D.R-------------------------------------------------
Q87WY8_PSESM/73-142-RRV-----.WP----------------D.Q-------------------------------------------------
Q5FUJ1_GLUOX/84-152-ERH-----.MP----------------D.T-------------------------------------------------
DIVIB_GEOKA/50-118-EKQ-----.LP----------------N.T-------------------------------------------------
Q87AG2_XYLFT/34-103-SKR-----.WP----------------D.V-------------------------------------------------
Q7V8M1_PROMM/59-128-RRL-----.LP----------------P.G-------------------------------------------------
DIVIB_LACLA/153-224-NYH-----.FP----------------N.R-------------------------------------------------
Q65RZ0_MANSM/55-125-RKI-----.WP----------------D.R-------------------------------------------------
Q6AE66_LEIXX/96-164-ESH-----.PP----------------D.T-------------------------------------------------
P73457_SYNY3/54-123-TRQ-----LFP----------------A.Q-------------------------------------------------
Q73NF1_TREDE/62-130-EKK-----.FP----------------D.K-------------------------------------------------
Q6AJ56_DESPS/51-120-SFD-----.WP----------------S.T-------------------------------------------------
Q9RWN7_DEIRA/101-171-TRQ-----.FP----------------D.T-------------------------------------------------
Q604W1_METCA/56-127-ERR-----.WP----------------D.R-------------------------------------------------
Q62GT0_BURMA/37-106-RRV-----.WP----------------N.A-------------------------------------------------
Q6NGD0_CORDI/29-97-TRS-----.FP----------------N.T-------------------------------------------------
Q5PBK1_ANAMM/65-133-HRE-----.LA----------------NGI-------------------------------------------------
FTSQ_RICTY/72-140-SRR-----.LP----------------N.T-------------------------------------------------
Q7VMY3_HAEDU/61-131-HKL-----.YP----------------D.R-------------------------------------------------
Q8CXI4_OCEIH/50-118-DRK-----.FP----------------S.T-------------------------------------------------
Q5WFH0_BACSK/51-119-ERE-----.LP----------------V.S-------------------------------------------------
Q7U5Q7_SYNPX/51-120-SRH-----MLP----------------T.R-------------------------------------------------
Q5WTJ0_LEGPL/39-108-ERV-----.WP----------------D.T-------------------------------------------------
Q636B8_BACCZ/53-121-KKR-----.FP----------------N.K-------------------------------------------------
FTSQ_BLOFL/45-115-RKQ-----.WP----------------N.T-------------------------------------------------
FTSQ_VIBCH/52-122-RKQ-----.WP----------------D.T-------------------------------------------------
Q6N416_RHOPA/110-178-LKF-----.YP----------------G.E-------------------------------------------------
FTSQ_NEIG1/37-106-RRR-----.FP----------------D.T-------------------------------------------------
Q6FZ75_BARQU/88-156-QKI-----.YP----------------N.L-------------------------------------------------
Q67Q43_SYMTH/58-125-T..-----.WR----------------GNA-------------------------------------------------
FTSQ_GEOSL/67-135-RRY-----.FP----------------H.T-------------------------------------------------
Q5M0D3_STRT1/104-175-TYS-----.FP----------------N.Q-------------------------------------------------
Q9CCE5_MYCLE/151-219-QRQ-----.YP----------------S.A-------------------------------------------------
Q5GS65_WOLTR/61-128-HRI-----.LP----------------N.T-------------------------------------------------
FTSQ_CORGL/30-98-NRA-----.LP----------------S.T-------------------------------------------------
Q8R9G8_THETN/29-97-KIL-----.YP----------------N.R-------------------------------------------------
Q8XJA3_CLOPE/42-109-SRK-----.LP----------------D.Q-------------------------------------------------
Q57C82_BRUAB/68-136-RKV-----.YP----------------G.T-------------------------------------------------
Q93JX7_PROMR/60-129-RRI-----.AP----------------L.G-------------------------------------------------
Q7NNV9_GLOVI/69-138-ERQ-----LLP----------------P.S-------------------------------------------------
Q6A9Q0_PROAC/48-116-YRK-----.WP----------------H.T-------------------------------------------------
Q5FKV1_LACAC/77-148-HLG-----.HV----------------N.Q-------------------------------------------------
Q8FNU2_COREF/30-98-NRR-----.LP----------------S.T-------------------------------------------------
DIVIB_CLOAB/41-109-RQK-----.LP----------------N.T-------------------------------------------------
Q6LMF8_PHOPR/51-121-RKQ-----.WP----------------D.T-------------------------------------------------
Q9RNN0_ZYMMB/40-108-SRR-----.WP----------------D.T-------------------------------------------------
Q9K9T2_BACHD/50-118-HRV-----.LP----------------N.T-------------------------------------------------
FTSQ_MYCTU/124-192-QRQ-----.YP----------------S.A-------------------------------------------------
FTSQ_CAUCR/94-162-VRM-----.LP----------------D.T-------------------------------------------------
Q6G1J3_BARQU/39-106-NQV-----.GD----------------..K-------------------------------------------------
Q71XX9_LISMF/51-119-SKE-----.GI----------------N.D-------------------------------------------------
Q45306_BACLI/54-123-SKQ-----.LP----------------N.K-------------------------------------------------

PF06898

YQFD_BACSU/2-387-LTNGIDNITWVGVDLKGTTIHMKVVEKNEP...EKEKYVSPRNIVAKKKATITRMFVQKGQPMAAIHDHVEKGQLLVSG
Q9KD59_BACHD/4-388-VTEQLSGATWIGVRQNGTTYQFEVVEQQLP...EEAERISPRHLVAKKKAIVHSVFVEHGQPKVKVNDYVEKGDMLVSG
Q8XIU3_CLOPE/2-375-LENGHGDIMWVNARIEGGTLKIKVEEKVSPKIKEENENKEFKNIVASMDGEIKRIYTTSGTAVVKEGDVVKKGDILIIP
Q8EPX5_OCEIH/2-398-LLDDVPELLWAGVELRGTTLYLEGVEKLIV...EELDPGEPGNIVAAKEGVITRMYVSKGEPVKQINDYVKPGDLLVSG
Q8RB55_THETN/8-388-FLLNNEEVAWIGINVRGTKAFVKVVGKTKP..QKVLSKEEPCNIIAKRDGIIYKMTVLEGEAVKKVGDTVKTGDILISG
Q892R7_CLOTE/6-378-IMKNNDSIMWIRIRTEGSLLKITASERQSP..PKVILMDDPCNLVAKKDGEVVRVYTTAGTALVKEEDIVKKGDILVKG
Q97JI9_CLOAB/2-374-LMQKNNNIMWARVRVYGSKLKVKIVERQEI..PDVKPNNEARDVLAKKSGQILRVYTTSGTAIVKAGDVVKKGQVLIKG
Q9S6M8_BACME/2-386-LTDNMNNITWVGVEVRGTSYHFQVVEKNEP...KPQQKTPYQHLIAKKKAIITNLFVEKGQPLVKVNDFVNEGEVLVSG

PF07244

Q5NND8_ZYMMO/246-316--------------------------------------------------------------------------------
Q5NND8_ZYMMO/317-394--------------------------------------------------------------------------------
Q5NND8_ZYMMO/397-485--------------------------------------------------------------------------------
Q5NND8_ZYMMO/488-566--------------------------------------------------------------------------------
Q5NND8_ZYMMO/569-643--------------------------------------------------------------------------------
BAMA_HELPY/70-137--------------------------------------------------------------------------------
BAMA_HELPY/138-216--------------------------------------------------------------------------------
BAMA_HELPY/219-309--------------------------------------------------------------------------------
BAMA_HELPY/312-391--------------------------------------------------------------------------------
BAMA_HELPY/394-466--------------------------------------------------------------------------------
O30912_NEIME/23-90--------------------------------------------------------------------------------
O30912_NEIME/91-171--------------------------------------------------------------------------------
O30912_NEIME/174-262--------------------------------------------------------------------------------
O30912_NEIME/265-344--------------------------------------------------------------------------------
O30912_NEIME/347-421--------------------------------------------------------------------------------
O32625_HAEIF/22-89--------------------------------------------------------------------------------
O32625_HAEIF/90-170--------------------------------------------------------------------------------
O32625_HAEIF/173-259--------------------------------------------------------------------------------
O32625_HAEIF/262-341--------------------------------------------------------------------------------
O32625_HAEIF/344-418--------------------------------------------------------------------------------
O51735_BORBU/30-102--------------------------------------------------------------------------------
O51735_BORBU/103-180--------------------------------------------------------------------------------
O51735_BORBU/183-274--------------------------------------------------------------------------------
O51735_BORBU/277-353--------------------------------------------------------------------------------
O51735_BORBU/356-429--------------------------------------------------------------------------------
O66463_AQUAE/72-149--------------------------------------------------------------------------------
O66463_AQUAE/152-225--------------------------------------------------------------------------------
O67326_AQUAE/18-90--------------------------------------------------------------------------------
O67326_AQUAE/203-287--------------------------------------------------------------------------------
O67326_AQUAE/290-371--------------------------------------------------------------------------------
O67326_AQUAE/374-446--------------------------------------------------------------------------------
O68454_TREPL/31-105--------------------------------------------------------------------------------
O68454_TREPL/106-182--------------------------------------------------------------------------------
O68454_TREPL/185-273--------------------------------------------------------------------------------
O68454_TREPL/276-354--------------------------------------------------------------------------------
O68454_TREPL/357-430--------------------------------------------------------------------------------
O84244_CHLTR/104-182--------------------------------------------------------------------------------
O84244_CHLTR/185-272--------------------------------------------------------------------------------
O84244_CHLTR/275-353--------------------------------------------------------------------------------
O84244_CHLTR/356-435--------------------------------------------------------------------------------
BAMA_SHIFL/24-91--------------------------------------------------------------------------------
BAMA_SHIFL/92-172--------------------------------------------------------------------------------
BAMA_SHIFL/175-263--------------------------------------------------------------------------------
BAMA_SHIFL/266-344--------------------------------------------------------------------------------
BAMA_SHIFL/347-421--------------------------------------------------------------------------------
YTFM_ECOLI/189-263--------------------------------------------------------------------------------
BAMA_BUCAI/24-91--------------------------------------------------------------------------------
BAMA_BUCAI/92-172--------------------------------------------------------------------------------
BAMA_BUCAI/175-263--------------------------------------------------------------------------------
BAMA_BUCAI/266-344--------------------------------------------------------------------------------
BAMA_BUCAI/347-421--------------------------------------------------------------------------------
P73472_SYNY3/260-331--------------------------------------------------------------------------------
P73472_SYNY3/425-496--------------------------------------------------------------------------------
Q44629_BRUAO/39-106--------------------------------------------------------------------------------
Q44629_BRUAO/107-184--------------------------------------------------------------------------------
Q44629_BRUAO/361-434--------------------------------------------------------------------------------
Q51930_PASMD/21-88--------------------------------------------------------------------------------
Q51930_PASMD/89-169--------------------------------------------------------------------------------
Q51930_PASMD/172-247--------------------------------------------------------------------------------
Q51930_PASMD/341-414--------------------------------------------------------------------------------
Q57CY5_BRUAB/278-357--------------------------------------------------------------------------------
Q57FW8_BRUAB/233-307--------------------------------------------------------------------------------
Q5DZL2_VIBF1/357-428--------------------------------------------------------------------------------
Q5E2U2_VIBF1/342-414--------------------------------------------------------------------------------
Q5E3E7_VIBF1/24-91--------------------------------------------------------------------------------
Q5E3E7_VIBF1/92-172--------------------------------------------------------------------------------
Q5E3E7_VIBF1/175-263--------------------------------------------------------------------------------
Q5E3E7_VIBF1/266-344--------------------------------------------------------------------------------
Q5E3E7_VIBF1/347-421--------------------------------------------------------------------------------
Q5E819_VIBF1/104-185--------------------------------------------------------------------------------
Q5F5H0_NEIG1/248-322--------------------------------------------------------------------------------
Q5FGI9_EHRRG/23-91--------------------------------------------------------------------------------
Q5FGI9_EHRRG/92-170--------------------------------------------------------------------------------
Q5FGI9_EHRRG/173-260--------------------------------------------------------------------------------
Q5FGI9_EHRRG/346-418--------------------------------------------------------------------------------
Q5FPE9_GLUOX/347-432--------------------------------------------------------------------------------
Q5FPY9_GLUOX/49-116--------------------------------------------------------------------------------
Q5FPY9_GLUOX/117-194--------------------------------------------------------------------------------
Q5FPY9_GLUOX/197-285--------------------------------------------------------------------------------
Q5FPY9_GLUOX/370-443--------------------------------------------------------------------------------
Q5GTM8_WOLTR/28-96--------------------------------------------------------------------------------
Q5GTM8_WOLTR/97-175--------------------------------------------------------------------------------
Q5GTM8_WOLTR/274-352--------------------------------------------------------------------------------
Q5GTM8_WOLTR/355-427--------------------------------------------------------------------------------
Q5GUR4_XANOR/127-208--------------------------------------------------------------------------------
Q5H1E9_XANOR/59-126--------------------------------------------------------------------------------
Q5H1E9_XANOR/127-207--------------------------------------------------------------------------------
Q5H1E9_XANOR/210-298--------------------------------------------------------------------------------
Q5H1E9_XANOR/301-379--------------------------------------------------------------------------------
Q5H1E9_XANOR/382-456--------------------------------------------------------------------------------
Q5HX37_CAMJR/18-85--------------------------------------------------------------------------------
Q5HX37_CAMJR/86-164--------------------------------------------------------------------------------
Q5HX37_CAMJR/167-257--------------------------------------------------------------------------------
Q5HX37_CAMJR/260-340--------------------------------------------------------------------------------
Q5HX37_CAMJR/343-415--------------------------------------------------------------------------------
Q5LSU6_SILPO/48-115--------------------------------------------------------------------------------
Q5LSU6_SILPO/116-193--------------------------------------------------------------------------------
Q5LSU6_SILPO/196-284--------------------------------------------------------------------------------
Q5LSU6_SILPO/369-442--------------------------------------------------------------------------------
Q5N4G5_SYNP6/1-77--------------------------------------------------------------------------------
Q5N4G5_SYNP6/78-153--------------------------------------------------------------------------------
Q5N4G5_SYNP6/165-242--------------------------------------------------------------------------------
Q5NEP7_FRATT/28-95--------------------------------------------------------------------------------
Q5NEP7_FRATT/96-176--------------------------------------------------------------------------------
Q5NEP7_FRATT/179-270--------------------------------------------------------------------------------
Q5NEP7_FRATT/273-351--------------------------------------------------------------------------------
Q5NEP7_FRATT/354-428--------------------------------------------------------------------------------
Q5NNB2_ZYMMO/333-411--------------------------------------------------------------------------------
Q5NZG7_AROAE/25-92--------------------------------------------------------------------------------
Q5NZG7_AROAE/93-173--------------------------------------------------------------------------------
Q5NZG7_AROAE/176-264--------------------------------------------------------------------------------
Q5NZG7_AROAE/267-345--------------------------------------------------------------------------------
Q5NZG7_AROAE/348-422--------------------------------------------------------------------------------
Q5P9S8_ANAMM/28-95--------------------------------------------------------------------------------
Q5P9S8_ANAMM/96-174--------------------------------------------------------------------------------
Q5P9S8_ANAMM/177-268--------------------------------------------------------------------------------
Q5P9S8_ANAMM/355-427--------------------------------------------------------------------------------
Q5R0Z1_IDILO/25-92--------------------------------------------------------------------------------
Q5R0Z1_IDILO/93-173--------------------------------------------------------------------------------
Q5R0Z1_IDILO/176-264--------------------------------------------------------------------------------
Q5R0Z1_IDILO/267-345--------------------------------------------------------------------------------
Q5R0Z1_IDILO/348-422--------------------------------------------------------------------------------
Q5SKT2_THET8/83-163--------------------------------------------------------------------------------
Q5SKT2_THET8/164-238--------------------------------------------------------------------------------
Q5SKT2_THET8/375-450--------------------------------------------------------------------------------
Q5UCE9_LEPIR/114-187--------------------------------------------------------------------------------
Q5WVP5_LEGPL/184-255--------------------------------------------------------------------------------
Q5WZ37_LEGPL/30-97--------------------------------------------------------------------------------
Q5WZ37_LEGPL/98-178--------------------------------------------------------------------------------
Q5WZ37_LEGPL/181-269--------------------------------------------------------------------------------
Q5WZ37_LEGPL/272-350--------------------------------------------------------------------------------
Q5WZ37_LEGPL/353-427--------------------------------------------------------------------------------
Q604T9_METCA/56-123--------------------------------------------------------------------------------
Q604T9_METCA/124-204--------------------------------------------------------------------------------
Q604T9_METCA/207-295--------------------------------------------------------------------------------
Q604T9_METCA/298-376--------------------------------------------------------------------------------
Q604T9_METCA/379-453--------------------------------------------------------------------------------
Q62CQ1_BURMA/318-390--------------------------------------------------------------------------------
Q62JD2_BURMA/31-98--------------------------------------------------------------------------------
Q62JD2_BURMA/99-179--------------------------------------------------------------------------------
Q62JD2_BURMA/182-270--------------------------------------------------------------------------------
Q62JD2_BURMA/273-351--------------------------------------------------------------------------------
Q62JD2_BURMA/354-428--------------------------------------------------------------------------------
Q62LE4_BURMA/222-296--------------------------------------------------------------------------------
Q64Z23_BACFR/5-84--------------------------------------------------------------------------------
Q64Z23_BACFR/87-175--------------------------------------------------------------------------------
Q64Z23_BACFR/178-259--------------------------------------------------------------------------------
Q64Z23_BACFR/262-337--------------------------------------------------------------------------------
Q65R79_MANSM/21-87--------------------------------------------------------------------------------
Q65R79_MANSM/88-168--------------------------------------------------------------------------------
Q65R79_MANSM/260-339--------------------------------------------------------------------------------
Q65R79_MANSM/342-416--------------------------------------------------------------------------------
BAMA_YERPS/266-344--------------------------------------------------------------------------------
BAMA_YERPS/347-421--------------------------------------------------------------------------------
Q66F88_YERPS/190-264--------------------------------------------------------------------------------
Q68XK8_RICTY/26-94--------------------------------------------------------------------------------
Q68XK8_RICTY/95-172--------------------------------------------------------------------------------
Q68XK8_RICTY/175-263--------------------------------------------------------------------------------
Q68XK8_RICTY/266-344--------------------------------------------------------------------------------
Q68XK8_RICTY/347-420--------------------------------------------------------------------------------
Q6ARL5_DESPS/20-91--------------------------------------------------------------------------------
Q6ARL5_DESPS/92-170--------------------------------------------------------------------------------
Q6ARL5_DESPS/173-259--------------------------------------------------------------------------------
Q6ARL5_DESPS/262-340--------------------------------------------------------------------------------
Q6ARL5_DESPS/343-416--------------------------------------------------------------------------------
Q6ATX4_ORYSJ/67-146--------------------------------------------------------------------------------
Q6D152_ERWCT/230-304--------------------------------------------------------------------------------
Q6FCG7_ACIAD/28-95--------------------------------------------------------------------------------
Q6FCG7_ACIAD/96-176--------------------------------------------------------------------------------
Q6FCG7_ACIAD/179-267--------------------------------------------------------------------------------
Q6FCG7_ACIAD/270-348--------------------------------------------------------------------------------
Q6FCG7_ACIAD/351-425--------------------------------------------------------------------------------
Q6G1J3_BARQU/107-184--------------------------------------------------------------------------------
Q6G1J3_BARQU/187-275--------------------------------------------------------------------------------
Q6G1J3_BARQU/278-357--------------------------------------------------------------------------------
Q6G1J3_BARQU/360-433--------------------------------------------------------------------------------
Q6LHU2_PHOPR/343-412--------------------------------------------------------------------------------
Q6LKQ8_PHOPR/351-422--------------------------------------------------------------------------------
Q6LMH9_PHOPR/358-429--------------------------------------------------------------------------------
Q6LN32_PHOPR/24-91--------------------------------------------------------------------------------
Q6LN32_PHOPR/175-263--------------------------------------------------------------------------------
Q6LN32_PHOPR/266-344--------------------------------------------------------------------------------
Q6MAC6_PARUW/256-330--------------------------------------------------------------------------------
Q6MAE9_PARUW/137-215--------------------------------------------------------------------------------
Q6MAE9_PARUW/218-306--------------------------------------------------------------------------------
Q6MAE9_PARUW/309-387--------------------------------------------------------------------------------
Q6MAE9_PARUW/390-467--------------------------------------------------------------------------------
Q6MKB1_BDEBA/93-170--------------------------------------------------------------------------------
Q6MKB1_BDEBA/419-500--------------------------------------------------------------------------------
Q6MKB1_BDEBA/503-577--------------------------------------------------------------------------------
Q6MMX9_BDEBA/48-119--------------------------------------------------------------------------------
Q6MMX9_BDEBA/120-198--------------------------------------------------------------------------------
Q6MMX9_BDEBA/201-289--------------------------------------------------------------------------------
Q6MMX9_BDEBA/292-370--------------------------------------------------------------------------------
Q6MMX9_BDEBA/373-447--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/39-106--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/107-184--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/187-275--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/278-357--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/360-433--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/23-90--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/91-171--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/174-262--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/265-343--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/346-420--------------------------------------------------------------------------------
BAMA_DESVH/59-130--------------------------------------------------------------------------------
BAMA_DESVH/131-209--------------------------------------------------------------------------------
BAMA_DESVH/212-298--------------------------------------------------------------------------------
BAMA_DESVH/301-383--------------------------------------------------------------------------------
BAMA_DESVH/386-459--------------------------------------------------------------------------------
Q72RW5_LEPIC/53-124--------------------------------------------------------------------------------
Q72RW5_LEPIC/125-204--------------------------------------------------------------------------------
Q72RW5_LEPIC/207-299--------------------------------------------------------------------------------
Q73G77_WOLPM/28-96--------------------------------------------------------------------------------
Q73G77_WOLPM/274-352--------------------------------------------------------------------------------
Q73JH4_TREDE/30-104--------------------------------------------------------------------------------
Q73JH4_TREDE/105-183--------------------------------------------------------------------------------
Q73JH4_TREDE/186-274--------------------------------------------------------------------------------
Q73JH4_TREDE/277-355--------------------------------------------------------------------------------
Q73JH4_TREDE/358-431--------------------------------------------------------------------------------
Q74AT3_GEOSL/27-98--------------------------------------------------------------------------------
Q74AT3_GEOSL/99-176--------------------------------------------------------------------------------
Q74AT3_GEOSL/179-267--------------------------------------------------------------------------------
Q74AT3_GEOSL/270-348--------------------------------------------------------------------------------
Q74AT3_GEOSL/351-424--------------------------------------------------------------------------------
Q7CWM5_AGRT5/240-314--------------------------------------------------------------------------------
Q7MAB6_WOLSU/20-87--------------------------------------------------------------------------------
Q7MAB6_WOLSU/88-166--------------------------------------------------------------------------------
Q7MAB6_WOLSU/169-259--------------------------------------------------------------------------------
Q7MAB6_WOLSU/262-341--------------------------------------------------------------------------------
Q7MAB6_WOLSU/344-416--------------------------------------------------------------------------------
Q7MHW3_VIBVY/361-432--------------------------------------------------------------------------------
Q7MIG8_VIBVY/24-91--------------------------------------------------------------------------------
Q7MIG8_VIBVY/266-344--------------------------------------------------------------------------------
Q7MPD6_VIBVY/100-183--------------------------------------------------------------------------------
Q7MXJ3_PORGI/45-119--------------------------------------------------------------------------------
Q7MXJ3_PORGI/120-199--------------------------------------------------------------------------------
Q7MXJ3_PORGI/302-383--------------------------------------------------------------------------------
Q7MXJ3_PORGI/386-461--------------------------------------------------------------------------------
Q7MYW2_PHOLL/190-266--------------------------------------------------------------------------------
BAMA_PHOLL/266-344--------------------------------------------------------------------------------
Q7NJG9_GLOVI/85-160--------------------------------------------------------------------------------
Q7NVY6_CHRVO/25-92--------------------------------------------------------------------------------
Q7NVY6_CHRVO/93-173--------------------------------------------------------------------------------
Q7NVY6_CHRVO/176-264--------------------------------------------------------------------------------
Q7NVY6_CHRVO/267-345--------------------------------------------------------------------------------
Q7NVY6_CHRVO/348-422--------------------------------------------------------------------------------
Q7P0N3_CHRVO/181-255--------------------------------------------------------------------------------
Q7P3C7_FUSNV/76-147--------------------------------------------------------------------------------
Q7P3C7_FUSNV/148-222--------------------------------------------------------------------------------
Q7PAV1_RICSI/266-344--------------------------------------------------------------------------------
Q7U8Q8_SYNPX/59-135--------------------------------------------------------------------------------
Q7U8Q8_SYNPX/217-301--------------------------------------------------------------------------------
Q7UK20_RHOBA/97-179--------------------------------------------------------------------------------
Q7UK20_RHOBA/180-256--------------------------------------------------------------------------------
Q7UK20_RHOBA/259-346--------------------------------------------------------------------------------
Q7UK20_RHOBA/349-427--------------------------------------------------------------------------------
Q7V0C8_PROMP/84-160--------------------------------------------------------------------------------
Q7V0C8_PROMP/253-325--------------------------------------------------------------------------------
Q7V5X2_PROMM/98-174--------------------------------------------------------------------------------
Q7VAN9_PROMA/161-237--------------------------------------------------------------------------------
Q7VAN9_PROMA/238-314--------------------------------------------------------------------------------
Q7VHH5_HELHP/19-86--------------------------------------------------------------------------------
Q7VHH5_HELHP/87-166--------------------------------------------------------------------------------
Q7VHH5_HELHP/169-259--------------------------------------------------------------------------------
Q7VHH5_HELHP/262-341--------------------------------------------------------------------------------
Q7VHH5_HELHP/344-416--------------------------------------------------------------------------------
Q7VQ47_CHLPN/108-186--------------------------------------------------------------------------------
Q7VQ47_CHLPN/189-276--------------------------------------------------------------------------------
Q7VQ47_CHLPN/279-357--------------------------------------------------------------------------------
Q7VRD8_BLOFL/32-100--------------------------------------------------------------------------------
Q7VRD8_BLOFL/101-181--------------------------------------------------------------------------------
Q7VRD8_BLOFL/184-272--------------------------------------------------------------------------------
Q7VRD8_BLOFL/356-430--------------------------------------------------------------------------------
Q7VYC2_BORPE/34-101--------------------------------------------------------------------------------
Q7VYC2_BORPE/102-182--------------------------------------------------------------------------------
Q7VYC2_BORPE/185-273--------------------------------------------------------------------------------
Q7VYC2_BORPE/276-354--------------------------------------------------------------------------------
Q7VYC2_BORPE/357-431--------------------------------------------------------------------------------
Q823D8_CHLCV/106-184--------------------------------------------------------------------------------
Q823D8_CHLCV/187-274--------------------------------------------------------------------------------
Q823D8_CHLCV/277-355--------------------------------------------------------------------------------
Q82U03_NITEU/23-90--------------------------------------------------------------------------------
Q82U03_NITEU/91-171--------------------------------------------------------------------------------
Q82U03_NITEU/174-262--------------------------------------------------------------------------------
Q82U03_NITEU/265-343--------------------------------------------------------------------------------
Q82U03_NITEU/346-420--------------------------------------------------------------------------------
Q82VX0_NITEU/116-201--------------------------------------------------------------------------------
Q82VX0_NITEU/204-278--------------------------------------------------------------------------------
Q83DT2_COXBU/31-98--------------------------------------------------------------------------------
Q83DT2_COXBU/99-179--------------------------------------------------------------------------------
Q83DT2_COXBU/182-270--------------------------------------------------------------------------------
Q83DT2_COXBU/273-351--------------------------------------------------------------------------------
Q83DT2_COXBU/354-428--------------------------------------------------------------------------------
Q87EI1_XYLFT/272-350--------------------------------------------------------------------------------
Q87LW2_VIBPA/354-425--------------------------------------------------------------------------------
Q87ME5_VIBPA/266-344--------------------------------------------------------------------------------
Q87SW5_VIBPA/101-182--------------------------------------------------------------------------------
Q881Y2_PSESM/187-261--------------------------------------------------------------------------------
Q886N5_PSESM/23-90--------------------------------------------------------------------------------
Q886N5_PSESM/91-171--------------------------------------------------------------------------------
Q886N5_PSESM/174-262--------------------------------------------------------------------------------
Q886N5_PSESM/265-343--------------------------------------------------------------------------------
Q886N5_PSESM/346-420--------------------------------------------------------------------------------
Q88EF1_PSEPK/356-425--------------------------------------------------------------------------------
Q88IV7_PSEPK/195-269--------------------------------------------------------------------------------
Q89KQ1_BRAJA/278-357--------------------------------------------------------------------------------
Q89NX1_BRAJA/79-147--------------------------------------------------------------------------------
Q89NX1_BRAJA/148-225--------------------------------------------------------------------------------
Q89NX1_BRAJA/319-398--------------------------------------------------------------------------------
Q8A1E1_BACTN/46-120--------------------------------------------------------------------------------
Q8A1E1_BACTN/121-200--------------------------------------------------------------------------------
Q8A1E1_BACTN/203-291--------------------------------------------------------------------------------
Q8A1E1_BACTN/378-447--------------------------------------------------------------------------------
Q8D271_WIGBR/189-264--------------------------------------------------------------------------------
Q8D2H0_WIGBR/27-94--------------------------------------------------------------------------------
Q8D2H0_WIGBR/95-175--------------------------------------------------------------------------------
Q8D2H0_WIGBR/178-266--------------------------------------------------------------------------------
Q8D2H0_WIGBR/348-422--------------------------------------------------------------------------------
Q8DI03_THEEB/90-161--------------------------------------------------------------------------------
Q8DI03_THEEB/242-318--------------------------------------------------------------------------------
Q8EF72_SHEON/112-195--------------------------------------------------------------------------------
Q8EF72_SHEON/198-271--------------------------------------------------------------------------------
Q8EGG7_SHEON/29-96--------------------------------------------------------------------------------
Q8EGG7_SHEON/97-177--------------------------------------------------------------------------------
Q8EGG7_SHEON/180-268--------------------------------------------------------------------------------
Q8EGG7_SHEON/271-349--------------------------------------------------------------------------------
Q8EGG7_SHEON/352-426--------------------------------------------------------------------------------
Q8EJN5_SHEON/337-408--------------------------------------------------------------------------------
Q8GBX8_PASMD/261-340--------------------------------------------------------------------------------
Q8I576_PLAF7/116-193--------------------------------------------------------------------------------
BAMA_BUCAP/24-91--------------------------------------------------------------------------------
BAMA_BUCAP/92-172--------------------------------------------------------------------------------
BAMA_BUCAP/175-263--------------------------------------------------------------------------------
BAMA_BUCAP/266-344--------------------------------------------------------------------------------
BAMA_BUCAP/347-421--------------------------------------------------------------------------------
Q8KBW3_CHLTE/43-133--------------------------------------------------------------------------------
Q8KC70_CHLTE/372-447--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/57-131--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/132-209--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/212-301--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/304-389--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/392-467--------------------------------------------------------------------------------
Q8LEH7_ARATH/74-152--------------------------------------------------------------------------------
Q8PEY4_XANAC/199-273--------------------------------------------------------------------------------
Q8RHT4_FUSNN/4-75--------------------------------------------------------------------------------
Q8RHT4_FUSNN/251-335--------------------------------------------------------------------------------
A9CJ61_AGRT5/38-105--------------------------------------------------------------------------------
A9CJ61_AGRT5/106-183--------------------------------------------------------------------------------
A9CJ61_AGRT5/186-274--------------------------------------------------------------------------------
A9CJ61_AGRT5/277-356--------------------------------------------------------------------------------
A9CJ61_AGRT5/359-432--------------------------------------------------------------------------------
Q8XZI3_RALSO/30-97--------------------------------------------------------------------------------
Q8XZI3_RALSO/98-178--------------------------------------------------------------------------------
Q8XZI3_RALSO/181-269--------------------------------------------------------------------------------
Q8XZI3_RALSO/272-350--------------------------------------------------------------------------------
Q8XZI3_RALSO/353-427--------------------------------------------------------------------------------
Q8YUR6_NOSS1/221-296--------------------------------------------------------------------------------
Q8YUR6_NOSS1/395-466--------------------------------------------------------------------------------
Q92LN9_RHIME/217-291--------------------------------------------------------------------------------
Q92Q48_RHIME/39-106--------------------------------------------------------------------------------
Q92Q48_RHIME/107-184--------------------------------------------------------------------------------
Q92Q48_RHIME/187-275--------------------------------------------------------------------------------
Q92Q48_RHIME/278-357--------------------------------------------------------------------------------
Q92Q48_RHIME/360-431--------------------------------------------------------------------------------
Q93PM2_HAEDC/20-87--------------------------------------------------------------------------------
Q93PM2_HAEDC/88-168--------------------------------------------------------------------------------
Q93PM2_HAEDC/171-259--------------------------------------------------------------------------------
Q93PM2_HAEDC/262-341--------------------------------------------------------------------------------
Q93PM2_HAEDC/344-418--------------------------------------------------------------------------------
Q98K30_RHILO/218-292--------------------------------------------------------------------------------
Q98MC3_RHILO/39-106--------------------------------------------------------------------------------
Q98MC3_RHILO/107-184--------------------------------------------------------------------------------
Q98MC3_RHILO/187-275--------------------------------------------------------------------------------
Q98MC3_RHILO/278-357--------------------------------------------------------------------------------
Q98MC3_RHILO/360-433--------------------------------------------------------------------------------
Q9A711_CAUCR/24-91--------------------------------------------------------------------------------
Q9A711_CAUCR/92-169--------------------------------------------------------------------------------
Q9A711_CAUCR/172-260--------------------------------------------------------------------------------
Q9A711_CAUCR/263-342--------------------------------------------------------------------------------
Q9A711_CAUCR/345-418--------------------------------------------------------------------------------
Q9HXY4_PSEAE/265-343--------------------------------------------------------------------------------
Q9HYQ6_PSEAE/333-404--------------------------------------------------------------------------------
Q9I0U1_PSEAE/190-268--------------------------------------------------------------------------------
Q9KPW0_VIBCH/266-344--------------------------------------------------------------------------------
Q9KUB9_VIBCH/347-418--------------------------------------------------------------------------------
Q9RXD5_DEIRA/97-179--------------------------------------------------------------------------------
Q9RXD5_DEIRA/180-256--------------------------------------------------------------------------------
Q9RXD5_DEIRA/329-402--------------------------------------------------------------------------------
Q9RXD5_DEIRA/407-477--------------------------------------------------------------------------------
BAMA_PHOLU/175-263--------------------------------------------------------------------------------
Q9SRL6_ARATH/77-155--------------------------------------------------------------------------------
Q9WYS9_THEMA/19-89--------------------------------------------------------------------------------
Q9WYS9_THEMA/90-164--------------------------------------------------------------------------------
Q9WYS9_THEMA/270-342--------------------------------------------------------------------------------

PF08479

Q8XQ41_RALSO/70-145--------------------------------------------------------------------------------
Q7W7Z0_BORPA/73-148--------------------------------------------------------------------------------
Q8RI18_FUSNN/32-109--------------------------------------------------------------------------------
Q7NU30_CHRVO/77-152--------------------------------------------------------------------------------
Q7N2L1_PHOLL/77-152--------------------------------------------------------------------------------
Q7N9T5_PHOLL/77-152--------------------------------------------------------------------------------
HLYB_SERMA/79-152--------------------------------------------------------------------------------
Q6G3U5_BARHE/90-166--------------------------------------------------------------------------------
Q88MW8_PSEPK/83-158--------------------------------------------------------------------------------
Q8PF71_XANAC/63-139--------------------------------------------------------------------------------
Q7N107_PHOLL/69-145--------------------------------------------------------------------------------
Q605Q3_METCA/48-123--------------------------------------------------------------------------------
Q664C6_YERPS/89-165--------------------------------------------------------------------------------
Q71BF5_HAEIF/73-150--------------------------------------------------------------------------------
Q9JY36_NEIMB/87-166--------------------------------------------------------------------------------
Q8YM25_NOSS1/96-171--------------------------------------------------------------------------------
Q7N1B0_PHOLL/77-152--------------------------------------------------------------------------------
Q89H68_BRAJA/98-173--------------------------------------------------------------------------------
Q93QU8_ECOLX/82-162--------------------------------------------------------------------------------
Q9HVN7_PSEAE/59-134--------------------------------------------------------------------------------
Q8XQZ3_RALSO/84-163--------------------------------------------------------------------------------
Q880E0_PSESM/77-152--------------------------------------------------------------------------------
Q8XYH9_RALSO/79-151--------------------------------------------------------------------------------
O32607_EDWTA/81-154--------------------------------------------------------------------------------
Q8DLP0_THEEB/81-156--------------------------------------------------------------------------------
Q8XQX3_RALSO/69-144--------------------------------------------------------------------------------
Q8X9M8_ECO57/65-141--------------------------------------------------------------------------------
Q7MRX6_WOLSU/59-134--------------------------------------------------------------------------------
Q8PLI4_XANAC/79-156--------------------------------------------------------------------------------
Q9RGR3_BORBO/89-164--------------------------------------------------------------------------------
P94771_ERWCH/76-151--------------------------------------------------------------------------------
Q9I792_PSEAE/71-146--------------------------------------------------------------------------------
Q8XPV1_RALSO/81-156--------------------------------------------------------------------------------
Q7VLT7_HAEDU/59-128--------------------------------------------------------------------------------
Q7NWR3_CHRVO/87-160--------------------------------------------------------------------------------
Q6RK56_ERWCR/75-150--------------------------------------------------------------------------------
Q6FDM4_ACIAD/101-180--------------------------------------------------------------------------------
Q8VMR1_PHOLU/79-152--------------------------------------------------------------------------------
Q5GD94_XENNE/79-152--------------------------------------------------------------------------------
Q9AHG0_9FUSO/86-161--------------------------------------------------------------------------------
Q63JI8_BURPS/74-148--------------------------------------------------------------------------------
HLYB_PROMI/77-150--------------------------------------------------------------------------------
Q9AAJ4_CAUCR/8-83--------------------------------------------------------------------------------
Q63TR3_BURPS/65-140--------------------------------------------------------------------------------
Q89Q77_BRAJA/73-148--------------------------------------------------------------------------------
Q8XAN8_ECO57/70-144--------------------------------------------------------------------------------
Q9HVG7_PSEAE/71-146--------------------------------------------------------------------------------
Q6DA64_ERWCT/107-183--------------------------------------------------------------------------------
Q8RGK0_FUSNN/41-115--------------------------------------------------------------------------------
Q8G9X8_ECOLX/104-179--------------------------------------------------------------------------------
Q9PAG8_XYLFA/106-185--------------------------------------------------------------------------------
Q74E11_GEOSL/79-154--------------------------------------------------------------------------------
Q8YWF4_NOSS1/18-93--------------------------------------------------------------------------------
Q7N910_PHOLL/78-154--------------------------------------------------------------------------------
IBPB_HAES2/99-172--------------------------------------------------------------------------------
Q88QC1_PSEPK/91-166--------------------------------------------------------------------------------
Q7NY08_CHRVO/92-167--------------------------------------------------------------------------------
Q669F9_YERPS/77-153--------------------------------------------------------------------------------
Q8D0E8_YERPE/68-141--------------------------------------------------------------------------------
Q9I5N4_PSEAE/47-122--------------------------------------------------------------------------------

PF08478

FTSQ_VIBF1/50-120--------------------------------------------------------------------------------
Q5FG13_EHRRG/81-147--------------------------------------------------------------------------------
FTSQ_SHEON/52-121--------------------------------------------------------------------------------
DIVIB_BACSU/54-123--------------------------------------------------------------------------------
FTSQ_STRCU/57-126--------------------------------------------------------------------------------
FTSQ_RHIME/89-157--------------------------------------------------------------------------------
Q5P6Z9_AROAE/37-106--------------------------------------------------------------------------------
O83403_TREPA/55-123--------------------------------------------------------------------------------
DIVIB_CLOTE/54-122--------------------------------------------------------------------------------
FTSQ_ECOLI/55-126--------------------------------------------------------------------------------
FTSQ_STRGR/5-74--------------------------------------------------------------------------------
Q8D2Z8_WIGBR/41-111--------------------------------------------------------------------------------
Q8RMK7_AZOBR/99-167--------------------------------------------------------------------------------
Q83N06_TROWT/56-124--------------------------------------------------------------------------------
Q8E185_STRA5/122-193--------------------------------------------------------------------------------
Q5SJC7_THET8/24-91--------------------------------------------------------------------------------
Q9F1M8_SHEVI/67-136--------------------------------------------------------------------------------
Q5R0N0_IDILO/43-112--------------------------------------------------------------------------------
Q6F706_ACIAD/59-128--------------------------------------------------------------------------------
Q728V1_DESVH/71-139--------------------------------------------------------------------------------
O07671_ENTHR/66-137--------------------------------------------------------------------------------
FTSQ_HAEIN/54-124--------------------------------------------------------------------------------
DIVIB_STRR6/153-223--------------------------------------------------------------------------------
Q9CPA8_PASMU/55-125--------------------------------------------------------------------------------
Q7MNU9_VIBVY/53-123--------------------------------------------------------------------------------
O07324_STAAU/195-263--------------------------------------------------------------------------------
Q73IQ7_WOLPM/61-128--------------------------------------------------------------------------------
Q7NQ02_CHRVO/37-106--------------------------------------------------------------------------------
Q5YYX7_NOCFA/42-110--------------------------------------------------------------------------------
Q8DVE1_STRMU/126-197--------------------------------------------------------------------------------
Q82AD6_STRAW/56-125--------------------------------------------------------------------------------
Q8YQH2_NOSS1/56-126--------------------------------------------------------------------------------
Q98KB7_RHILO/92-160--------------------------------------------------------------------------------
Q5XB06_STRP6/125-196--------------------------------------------------------------------------------
FTSQ_COXBU/46-115--------------------------------------------------------------------------------
Q5HQ08_STAEQ/219-287--------------------------------------------------------------------------------
Q57352_BORBG/33-101--------------------------------------------------------------------------------
Q8DMI0_THEEB/61-130--------------------------------------------------------------------------------
Q72N66_LEPIC/45-113--------------------------------------------------------------------------------
O07110_ENTFL/126-197--------------------------------------------------------------------------------
FTSQ_BARBA/87-155--------------------------------------------------------------------------------
Q87WY8_PSESM/73-142--------------------------------------------------------------------------------
Q5FUJ1_GLUOX/84-152--------------------------------------------------------------------------------
DIVIB_GEOKA/50-118--------------------------------------------------------------------------------
Q87AG2_XYLFT/34-103--------------------------------------------------------------------------------
Q7V8M1_PROMM/59-128--------------------------------------------------------------------------------
DIVIB_LACLA/153-224--------------------------------------------------------------------------------
Q65RZ0_MANSM/55-125--------------------------------------------------------------------------------
Q6AE66_LEIXX/96-164--------------------------------------------------------------------------------
P73457_SYNY3/54-123--------------------------------------------------------------------------------
Q73NF1_TREDE/62-130--------------------------------------------------------------------------------
Q6AJ56_DESPS/51-120--------------------------------------------------------------------------------
Q9RWN7_DEIRA/101-171--------------------------------------------------------------------------------
Q604W1_METCA/56-127--------------------------------------------------------------------------------
Q62GT0_BURMA/37-106--------------------------------------------------------------------------------
Q6NGD0_CORDI/29-97--------------------------------------------------------------------------------
Q5PBK1_ANAMM/65-133--------------------------------------------------------------------------------
FTSQ_RICTY/72-140--------------------------------------------------------------------------------
Q7VMY3_HAEDU/61-131--------------------------------------------------------------------------------
Q8CXI4_OCEIH/50-118--------------------------------------------------------------------------------
Q5WFH0_BACSK/51-119--------------------------------------------------------------------------------
Q7U5Q7_SYNPX/51-120--------------------------------------------------------------------------------
Q5WTJ0_LEGPL/39-108--------------------------------------------------------------------------------
Q636B8_BACCZ/53-121--------------------------------------------------------------------------------
FTSQ_BLOFL/45-115--------------------------------------------------------------------------------
FTSQ_VIBCH/52-122--------------------------------------------------------------------------------
Q6N416_RHOPA/110-178--------------------------------------------------------------------------------
FTSQ_NEIG1/37-106--------------------------------------------------------------------------------
Q6FZ75_BARQU/88-156--------------------------------------------------------------------------------
Q67Q43_SYMTH/58-125--------------------------------------------------------------------------------
FTSQ_GEOSL/67-135--------------------------------------------------------------------------------
Q5M0D3_STRT1/104-175--------------------------------------------------------------------------------
Q9CCE5_MYCLE/151-219--------------------------------------------------------------------------------
Q5GS65_WOLTR/61-128--------------------------------------------------------------------------------
FTSQ_CORGL/30-98--------------------------------------------------------------------------------
Q8R9G8_THETN/29-97--------------------------------------------------------------------------------
Q8XJA3_CLOPE/42-109--------------------------------------------------------------------------------
Q57C82_BRUAB/68-136--------------------------------------------------------------------------------
Q93JX7_PROMR/60-129--------------------------------------------------------------------------------
Q7NNV9_GLOVI/69-138--------------------------------------------------------------------------------
Q6A9Q0_PROAC/48-116--------------------------------------------------------------------------------
Q5FKV1_LACAC/77-148--------------------------------------------------------------------------------
Q8FNU2_COREF/30-98--------------------------------------------------------------------------------
DIVIB_CLOAB/41-109--------------------------------------------------------------------------------
Q6LMF8_PHOPR/51-121--------------------------------------------------------------------------------
Q9RNN0_ZYMMB/40-108--------------------------------------------------------------------------------
Q9K9T2_BACHD/50-118--------------------------------------------------------------------------------
FTSQ_MYCTU/124-192--------------------------------------------------------------------------------
FTSQ_CAUCR/94-162--------------------------------------------------------------------------------
Q6G1J3_BARQU/39-106--------------------------------------------------------------------------------
Q71XX9_LISMF/51-119--------------------------------------------------------------------------------
Q45306_BACLI/54-123--------------------------------------------------------------------------------

PF06898

YQFD_BACSU/2-387LIGSEDHQQE............VASKAEIYGETWYRSEVTVPLETLFNVYTGKVRTKHKLSFGSLAIPIWGMTFKKEELK
Q9KD59_BACHD/4-388FIGKEGKEQI............VPAVGVVLGEIWYTSDVTIPLESQFSTLTGESVTTHQLSAFGVNLPI..WGFKKHEFK
Q8XIU3_CLOPE/2-375QQGIEGGEYE............VDAEGEVTANTFYEKTIELQVQGKKEERTGEVDSDIYLEIMGKKIYL...KKPTKEFD
Q8EPX5_OCEIH/2-398DLSYEENQDEDESDSEKRKTPPITAEAEIFANTWYEVTLTVPLSYNYEQLTGKSKNKYYMKMGQLQLPI..WGFRDPEFE
Q8RB55_THETN/8-388IIEKPGLDTM...........FVHADGEVLARTWYEISVEEELKRTRWVKTGEKIVATKIIIGSNTITF...TSRKIEFE
Q892R7_CLOTE/6-378QQGKEGEEYA............VHAKGDVIARTFYEEIKEVKPYKIERTKTGNKINNVFINFRGKKLFL...KKTVNKFE
Q97JI9_CLOAB/2-374EAGQDDKVYK............VHADGSIIAKTFNENIAKVMLTTHIRKRTGKKVQNYYVRIGNKKFYL...KKSENKFN
Q9S6M8_BACME/2-386IIGNEKNKKV............VAAKGKVYGETWYKSEVEVPLKTDFQVLTGNGYTKHYLDFQAFKMPL..WAFNKEKYT

PF07244

Q5NND8_ZYMMO/246-316--------------------------------------------------------------------------------
Q5NND8_ZYMMO/317-394--------------------------------------------------------------------------------
Q5NND8_ZYMMO/397-485--------------------------------------------------------------------------------
Q5NND8_ZYMMO/488-566--------------------------------------------------------------------------------
Q5NND8_ZYMMO/569-643--------------------------------------------------------------------------------
BAMA_HELPY/70-137--------------------------------------------------------------------------------
BAMA_HELPY/138-216--------------------------------------------------------------------------------
BAMA_HELPY/219-309--------------------------------------------------------------------------------
BAMA_HELPY/312-391--------------------------------------------------------------------------------
BAMA_HELPY/394-466--------------------------------------------------------------------------------
O30912_NEIME/23-90--------------------------------------------------------------------------------
O30912_NEIME/91-171--------------------------------------------------------------------------------
O30912_NEIME/174-262--------------------------------------------------------------------------------
O30912_NEIME/265-344--------------------------------------------------------------------------------
O30912_NEIME/347-421--------------------------------------------------------------------------------
O32625_HAEIF/22-89--------------------------------------------------------------------------------
O32625_HAEIF/90-170--------------------------------------------------------------------------------
O32625_HAEIF/173-259--------------------------------------------------------------------------------
O32625_HAEIF/262-341--------------------------------------------------------------------------------
O32625_HAEIF/344-418--------------------------------------------------------------------------------
O51735_BORBU/30-102--------------------------------------------------------------------------------
O51735_BORBU/103-180--------------------------------------------------------------------------------
O51735_BORBU/183-274--------------------------------------------------------------------------------
O51735_BORBU/277-353--------------------------------------------------------------------------------
O51735_BORBU/356-429--------------------------------------------------------------------------------
O66463_AQUAE/72-149--------------------------------------------------------------------------------
O66463_AQUAE/152-225--------------------------------------------------------------------------------
O67326_AQUAE/18-90--------------------------------------------------------------------------------
O67326_AQUAE/203-287--------------------------------------------------------------------------------
O67326_AQUAE/290-371--------------------------------------------------------------------------------
O67326_AQUAE/374-446--------------------------------------------------------------------------------
O68454_TREPL/31-105--------------------------------------------------------------------------------
O68454_TREPL/106-182--------------------------------------------------------------------------------
O68454_TREPL/185-273--------------------------------------------------------------------------------
O68454_TREPL/276-354--------------------------------------------------------------------------------
O68454_TREPL/357-430--------------------------------------------------------------------------------
O84244_CHLTR/104-182--------------------------------------------------------------------------------
O84244_CHLTR/185-272--------------------------------------------------------------------------------
O84244_CHLTR/275-353--------------------------------------------------------------------------------
O84244_CHLTR/356-435--------------------------------------------------------------------------------
BAMA_SHIFL/24-91--------------------------------------------------------------------------------
BAMA_SHIFL/92-172--------------------------------------------------------------------------------
BAMA_SHIFL/175-263--------------------------------------------------------------------------------
BAMA_SHIFL/266-344--------------------------------------------------------------------------------
BAMA_SHIFL/347-421--------------------------------------------------------------------------------
YTFM_ECOLI/189-263--------------------------------------------------------------------------------
BAMA_BUCAI/24-91--------------------------------------------------------------------------------
BAMA_BUCAI/92-172--------------------------------------------------------------------------------
BAMA_BUCAI/175-263--------------------------------------------------------------------------------
BAMA_BUCAI/266-344--------------------------------------------------------------------------------
BAMA_BUCAI/347-421--------------------------------------------------------------------------------
P73472_SYNY3/260-331--------------------------------------------------------------------------------
P73472_SYNY3/425-496--------------------------------------------------------------------------------
Q44629_BRUAO/39-106--------------------------------------------------------------------------------
Q44629_BRUAO/107-184--------------------------------------------------------------------------------
Q44629_BRUAO/361-434--------------------------------------------------------------------------------
Q51930_PASMD/21-88--------------------------------------------------------------------------------
Q51930_PASMD/89-169--------------------------------------------------------------------------------
Q51930_PASMD/172-247--------------------------------------------------------------------------------
Q51930_PASMD/341-414--------------------------------------------------------------------------------
Q57CY5_BRUAB/278-357--------------------------------------------------------------------------------
Q57FW8_BRUAB/233-307--------------------------------------------------------------------------------
Q5DZL2_VIBF1/357-428--------------------------------------------------------------------------------
Q5E2U2_VIBF1/342-414--------------------------------------------------------------------------------
Q5E3E7_VIBF1/24-91--------------------------------------------------------------------------------
Q5E3E7_VIBF1/92-172--------------------------------------------------------------------------------
Q5E3E7_VIBF1/175-263--------------------------------------------------------------------------------
Q5E3E7_VIBF1/266-344--------------------------------------------------------------------------------
Q5E3E7_VIBF1/347-421--------------------------------------------------------------------------------
Q5E819_VIBF1/104-185--------------------------------------------------------------------------------
Q5F5H0_NEIG1/248-322--------------------------------------------------------------------------------
Q5FGI9_EHRRG/23-91--------------------------------------------------------------------------------
Q5FGI9_EHRRG/92-170--------------------------------------------------------------------------------
Q5FGI9_EHRRG/173-260--------------------------------------------------------------------------------
Q5FGI9_EHRRG/346-418--------------------------------------------------------------------------------
Q5FPE9_GLUOX/347-432--------------------------------------------------------------------------------
Q5FPY9_GLUOX/49-116--------------------------------------------------------------------------------
Q5FPY9_GLUOX/117-194--------------------------------------------------------------------------------
Q5FPY9_GLUOX/197-285--------------------------------------------------------------------------------
Q5FPY9_GLUOX/370-443--------------------------------------------------------------------------------
Q5GTM8_WOLTR/28-96--------------------------------------------------------------------------------
Q5GTM8_WOLTR/97-175--------------------------------------------------------------------------------
Q5GTM8_WOLTR/274-352--------------------------------------------------------------------------------
Q5GTM8_WOLTR/355-427--------------------------------------------------------------------------------
Q5GUR4_XANOR/127-208--------------------------------------------------------------------------------
Q5H1E9_XANOR/59-126--------------------------------------------------------------------------------
Q5H1E9_XANOR/127-207--------------------------------------------------------------------------------
Q5H1E9_XANOR/210-298--------------------------------------------------------------------------------
Q5H1E9_XANOR/301-379--------------------------------------------------------------------------------
Q5H1E9_XANOR/382-456--------------------------------------------------------------------------------
Q5HX37_CAMJR/18-85--------------------------------------------------------------------------------
Q5HX37_CAMJR/86-164--------------------------------------------------------------------------------
Q5HX37_CAMJR/167-257--------------------------------------------------------------------------------
Q5HX37_CAMJR/260-340--------------------------------------------------------------------------------
Q5HX37_CAMJR/343-415--------------------------------------------------------------------------------
Q5LSU6_SILPO/48-115--------------------------------------------------------------------------------
Q5LSU6_SILPO/116-193--------------------------------------------------------------------------------
Q5LSU6_SILPO/196-284--------------------------------------------------------------------------------
Q5LSU6_SILPO/369-442--------------------------------------------------------------------------------
Q5N4G5_SYNP6/1-77--------------------------------------------------------------------------------
Q5N4G5_SYNP6/78-153--------------------------------------------------------------------------------
Q5N4G5_SYNP6/165-242--------------------------------------------------------------------------------
Q5NEP7_FRATT/28-95--------------------------------------------------------------------------------
Q5NEP7_FRATT/96-176--------------------------------------------------------------------------------
Q5NEP7_FRATT/179-270--------------------------------------------------------------------------------
Q5NEP7_FRATT/273-351--------------------------------------------------------------------------------
Q5NEP7_FRATT/354-428--------------------------------------------------------------------------------
Q5NNB2_ZYMMO/333-411--------------------------------------------------------------------------------
Q5NZG7_AROAE/25-92--------------------------------------------------------------------------------
Q5NZG7_AROAE/93-173--------------------------------------------------------------------------------
Q5NZG7_AROAE/176-264--------------------------------------------------------------------------------
Q5NZG7_AROAE/267-345--------------------------------------------------------------------------------
Q5NZG7_AROAE/348-422--------------------------------------------------------------------------------
Q5P9S8_ANAMM/28-95--------------------------------------------------------------------------------
Q5P9S8_ANAMM/96-174--------------------------------------------------------------------------------
Q5P9S8_ANAMM/177-268--------------------------------------------------------------------------------
Q5P9S8_ANAMM/355-427--------------------------------------------------------------------------------
Q5R0Z1_IDILO/25-92--------------------------------------------------------------------------------
Q5R0Z1_IDILO/93-173--------------------------------------------------------------------------------
Q5R0Z1_IDILO/176-264--------------------------------------------------------------------------------
Q5R0Z1_IDILO/267-345--------------------------------------------------------------------------------
Q5R0Z1_IDILO/348-422--------------------------------------------------------------------------------
Q5SKT2_THET8/83-163--------------------------------------------------------------------------------
Q5SKT2_THET8/164-238--------------------------------------------------------------------------------
Q5SKT2_THET8/375-450--------------------------------------------------------------------------------
Q5UCE9_LEPIR/114-187--------------------------------------------------------------------------------
Q5WVP5_LEGPL/184-255--------------------------------------------------------------------------------
Q5WZ37_LEGPL/30-97--------------------------------------------------------------------------------
Q5WZ37_LEGPL/98-178--------------------------------------------------------------------------------
Q5WZ37_LEGPL/181-269--------------------------------------------------------------------------------
Q5WZ37_LEGPL/272-350--------------------------------------------------------------------------------
Q5WZ37_LEGPL/353-427--------------------------------------------------------------------------------
Q604T9_METCA/56-123--------------------------------------------------------------------------------
Q604T9_METCA/124-204--------------------------------------------------------------------------------
Q604T9_METCA/207-295--------------------------------------------------------------------------------
Q604T9_METCA/298-376--------------------------------------------------------------------------------
Q604T9_METCA/379-453--------------------------------------------------------------------------------
Q62CQ1_BURMA/318-390--------------------------------------------------------------------------------
Q62JD2_BURMA/31-98--------------------------------------------------------------------------------
Q62JD2_BURMA/99-179--------------------------------------------------------------------------------
Q62JD2_BURMA/182-270--------------------------------------------------------------------------------
Q62JD2_BURMA/273-351--------------------------------------------------------------------------------
Q62JD2_BURMA/354-428--------------------------------------------------------------------------------
Q62LE4_BURMA/222-296--------------------------------------------------------------------------------
Q64Z23_BACFR/5-84--------------------------------------------------------------------------------
Q64Z23_BACFR/87-175--------------------------------------------------------------------------------
Q64Z23_BACFR/178-259--------------------------------------------------------------------------------
Q64Z23_BACFR/262-337--------------------------------------------------------------------------------
Q65R79_MANSM/21-87--------------------------------------------------------------------------------
Q65R79_MANSM/88-168--------------------------------------------------------------------------------
Q65R79_MANSM/260-339--------------------------------------------------------------------------------
Q65R79_MANSM/342-416--------------------------------------------------------------------------------
BAMA_YERPS/266-344--------------------------------------------------------------------------------
BAMA_YERPS/347-421--------------------------------------------------------------------------------
Q66F88_YERPS/190-264--------------------------------------------------------------------------------
Q68XK8_RICTY/26-94--------------------------------------------------------------------------------
Q68XK8_RICTY/95-172--------------------------------------------------------------------------------
Q68XK8_RICTY/175-263--------------------------------------------------------------------------------
Q68XK8_RICTY/266-344--------------------------------------------------------------------------------
Q68XK8_RICTY/347-420--------------------------------------------------------------------------------
Q6ARL5_DESPS/20-91--------------------------------------------------------------------------------
Q6ARL5_DESPS/92-170--------------------------------------------------------------------------------
Q6ARL5_DESPS/173-259--------------------------------------------------------------------------------
Q6ARL5_DESPS/262-340--------------------------------------------------------------------------------
Q6ARL5_DESPS/343-416--------------------------------------------------------------------------------
Q6ATX4_ORYSJ/67-146--------------------------------------------------------------------------------
Q6D152_ERWCT/230-304--------------------------------------------------------------------------------
Q6FCG7_ACIAD/28-95--------------------------------------------------------------------------------
Q6FCG7_ACIAD/96-176--------------------------------------------------------------------------------
Q6FCG7_ACIAD/179-267--------------------------------------------------------------------------------
Q6FCG7_ACIAD/270-348--------------------------------------------------------------------------------
Q6FCG7_ACIAD/351-425--------------------------------------------------------------------------------
Q6G1J3_BARQU/107-184--------------------------------------------------------------------------------
Q6G1J3_BARQU/187-275--------------------------------------------------------------------------------
Q6G1J3_BARQU/278-357--------------------------------------------------------------------------------
Q6G1J3_BARQU/360-433--------------------------------------------------------------------------------
Q6LHU2_PHOPR/343-412--------------------------------------------------------------------------------
Q6LKQ8_PHOPR/351-422--------------------------------------------------------------------------------
Q6LMH9_PHOPR/358-429--------------------------------------------------------------------------------
Q6LN32_PHOPR/24-91--------------------------------------------------------------------------------
Q6LN32_PHOPR/175-263--------------------------------------------------------------------------------
Q6LN32_PHOPR/266-344--------------------------------------------------------------------------------
Q6MAC6_PARUW/256-330--------------------------------------------------------------------------------
Q6MAE9_PARUW/137-215--------------------------------------------------------------------------------
Q6MAE9_PARUW/218-306--------------------------------------------------------------------------------
Q6MAE9_PARUW/309-387--------------------------------------------------------------------------------
Q6MAE9_PARUW/390-467--------------------------------------------------------------------------------
Q6MKB1_BDEBA/93-170--------------------------------------------------------------------------------
Q6MKB1_BDEBA/419-500--------------------------------------------------------------------------------
Q6MKB1_BDEBA/503-577--------------------------------------------------------------------------------
Q6MMX9_BDEBA/48-119--------------------------------------------------------------------------------
Q6MMX9_BDEBA/120-198--------------------------------------------------------------------------------
Q6MMX9_BDEBA/201-289--------------------------------------------------------------------------------
Q6MMX9_BDEBA/292-370--------------------------------------------------------------------------------
Q6MMX9_BDEBA/373-447--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/39-106--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/107-184--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/187-275--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/278-357--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/360-433--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/23-90--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/91-171--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/174-262--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/265-343--------------------------------------------------------------------------------
Q6Q8T1_9GAMM/346-420--------------------------------------------------------------------------------
BAMA_DESVH/59-130--------------------------------------------------------------------------------
BAMA_DESVH/131-209--------------------------------------------------------------------------------
BAMA_DESVH/212-298--------------------------------------------------------------------------------
BAMA_DESVH/301-383--------------------------------------------------------------------------------
BAMA_DESVH/386-459--------------------------------------------------------------------------------
Q72RW5_LEPIC/53-124--------------------------------------------------------------------------------
Q72RW5_LEPIC/125-204--------------------------------------------------------------------------------
Q72RW5_LEPIC/207-299--------------------------------------------------------------------------------
Q73G77_WOLPM/28-96--------------------------------------------------------------------------------
Q73G77_WOLPM/274-352--------------------------------------------------------------------------------
Q73JH4_TREDE/30-104--------------------------------------------------------------------------------
Q73JH4_TREDE/105-183--------------------------------------------------------------------------------
Q73JH4_TREDE/186-274--------------------------------------------------------------------------------
Q73JH4_TREDE/277-355--------------------------------------------------------------------------------
Q73JH4_TREDE/358-431--------------------------------------------------------------------------------
Q74AT3_GEOSL/27-98--------------------------------------------------------------------------------
Q74AT3_GEOSL/99-176--------------------------------------------------------------------------------
Q74AT3_GEOSL/179-267--------------------------------------------------------------------------------
Q74AT3_GEOSL/270-348--------------------------------------------------------------------------------
Q74AT3_GEOSL/351-424--------------------------------------------------------------------------------
Q7CWM5_AGRT5/240-314--------------------------------------------------------------------------------
Q7MAB6_WOLSU/20-87--------------------------------------------------------------------------------
Q7MAB6_WOLSU/88-166--------------------------------------------------------------------------------
Q7MAB6_WOLSU/169-259--------------------------------------------------------------------------------
Q7MAB6_WOLSU/262-341--------------------------------------------------------------------------------
Q7MAB6_WOLSU/344-416--------------------------------------------------------------------------------
Q7MHW3_VIBVY/361-432--------------------------------------------------------------------------------
Q7MIG8_VIBVY/24-91--------------------------------------------------------------------------------
Q7MIG8_VIBVY/266-344--------------------------------------------------------------------------------
Q7MPD6_VIBVY/100-183--------------------------------------------------------------------------------
Q7MXJ3_PORGI/45-119--------------------------------------------------------------------------------
Q7MXJ3_PORGI/120-199--------------------------------------------------------------------------------
Q7MXJ3_PORGI/302-383--------------------------------------------------------------------------------
Q7MXJ3_PORGI/386-461--------------------------------------------------------------------------------
Q7MYW2_PHOLL/190-266--------------------------------------------------------------------------------
BAMA_PHOLL/266-344--------------------------------------------------------------------------------
Q7NJG9_GLOVI/85-160--------------------------------------------------------------------------------
Q7NVY6_CHRVO/25-92--------------------------------------------------------------------------------
Q7NVY6_CHRVO/93-173--------------------------------------------------------------------------------
Q7NVY6_CHRVO/176-264--------------------------------------------------------------------------------
Q7NVY6_CHRVO/267-345--------------------------------------------------------------------------------
Q7NVY6_CHRVO/348-422--------------------------------------------------------------------------------
Q7P0N3_CHRVO/181-255--------------------------------------------------------------------------------
Q7P3C7_FUSNV/76-147--------------------------------------------------------------------------------
Q7P3C7_FUSNV/148-222--------------------------------------------------------------------------------
Q7PAV1_RICSI/266-344--------------------------------------------------------------------------------
Q7U8Q8_SYNPX/59-135--------------------------------------------------------------------------------
Q7U8Q8_SYNPX/217-301--------------------------------------------------------------------------------
Q7UK20_RHOBA/97-179--------------------------------------------------------------------------------
Q7UK20_RHOBA/180-256--------------------------------------------------------------------------------
Q7UK20_RHOBA/259-346--------------------------------------------------------------------------------
Q7UK20_RHOBA/349-427--------------------------------------------------------------------------------
Q7V0C8_PROMP/84-160--------------------------------------------------------------------------------
Q7V0C8_PROMP/253-325--------------------------------------------------------------------------------
Q7V5X2_PROMM/98-174--------------------------------------------------------------------------------
Q7VAN9_PROMA/161-237--------------------------------------------------------------------------------
Q7VAN9_PROMA/238-314--------------------------------------------------------------------------------
Q7VHH5_HELHP/19-86--------------------------------------------------------------------------------
Q7VHH5_HELHP/87-166--------------------------------------------------------------------------------
Q7VHH5_HELHP/169-259--------------------------------------------------------------------------------
Q7VHH5_HELHP/262-341--------------------------------------------------------------------------------
Q7VHH5_HELHP/344-416--------------------------------------------------------------------------------
Q7VQ47_CHLPN/108-186--------------------------------------------------------------------------------
Q7VQ47_CHLPN/189-276--------------------------------------------------------------------------------
Q7VQ47_CHLPN/279-357--------------------------------------------------------------------------------
Q7VRD8_BLOFL/32-100--------------------------------------------------------------------------------
Q7VRD8_BLOFL/101-181--------------------------------------------------------------------------------
Q7VRD8_BLOFL/184-272--------------------------------------------------------------------------------
Q7VRD8_BLOFL/356-430--------------------------------------------------------------------------------
Q7VYC2_BORPE/34-101--------------------------------------------------------------------------------
Q7VYC2_BORPE/102-182--------------------------------------------------------------------------------
Q7VYC2_BORPE/185-273--------------------------------------------------------------------------------
Q7VYC2_BORPE/276-354--------------------------------------------------------------------------------
Q7VYC2_BORPE/357-431--------------------------------------------------------------------------------
Q823D8_CHLCV/106-184--------------------------------------------------------------------------------
Q823D8_CHLCV/187-274--------------------------------------------------------------------------------
Q823D8_CHLCV/277-355--------------------------------------------------------------------------------
Q82U03_NITEU/23-90--------------------------------------------------------------------------------
Q82U03_NITEU/91-171--------------------------------------------------------------------------------
Q82U03_NITEU/174-262--------------------------------------------------------------------------------
Q82U03_NITEU/265-343--------------------------------------------------------------------------------
Q82U03_NITEU/346-420--------------------------------------------------------------------------------
Q82VX0_NITEU/116-201--------------------------------------------------------------------------------
Q82VX0_NITEU/204-278--------------------------------------------------------------------------------
Q83DT2_COXBU/31-98--------------------------------------------------------------------------------
Q83DT2_COXBU/99-179--------------------------------------------------------------------------------
Q83DT2_COXBU/182-270--------------------------------------------------------------------------------
Q83DT2_COXBU/273-351--------------------------------------------------------------------------------
Q83DT2_COXBU/354-428--------------------------------------------------------------------------------
Q87EI1_XYLFT/272-350--------------------------------------------------------------------------------
Q87LW2_VIBPA/354-425--------------------------------------------------------------------------------
Q87ME5_VIBPA/266-344--------------------------------------------------------------------------------
Q87SW5_VIBPA/101-182--------------------------------------------------------------------------------
Q881Y2_PSESM/187-261--------------------------------------------------------------------------------
Q886N5_PSESM/23-90--------------------------------------------------------------------------------
Q886N5_PSESM/91-171--------------------------------------------------------------------------------
Q886N5_PSESM/174-262--------------------------------------------------------------------------------
Q886N5_PSESM/265-343--------------------------------------------------------------------------------
Q886N5_PSESM/346-420--------------------------------------------------------------------------------
Q88EF1_PSEPK/356-425--------------------------------------------------------------------------------
Q88IV7_PSEPK/195-269--------------------------------------------------------------------------------
Q89KQ1_BRAJA/278-357--------------------------------------------------------------------------------
Q89NX1_BRAJA/79-147--------------------------------------------------------------------------------
Q89NX1_BRAJA/148-225--------------------------------------------------------------------------------
Q89NX1_BRAJA/319-398--------------------------------------------------------------------------------
Q8A1E1_BACTN/46-120--------------------------------------------------------------------------------
Q8A1E1_BACTN/121-200--------------------------------------------------------------------------------
Q8A1E1_BACTN/203-291--------------------------------------------------------------------------------
Q8A1E1_BACTN/378-447--------------------------------------------------------------------------------
Q8D271_WIGBR/189-264--------------------------------------------------------------------------------
Q8D2H0_WIGBR/27-94--------------------------------------------------------------------------------
Q8D2H0_WIGBR/95-175--------------------------------------------------------------------------------
Q8D2H0_WIGBR/178-266--------------------------------------------------------------------------------
Q8D2H0_WIGBR/348-422--------------------------------------------------------------------------------
Q8DI03_THEEB/90-161--------------------------------------------------------------------------------
Q8DI03_THEEB/242-318--------------------------------------------------------------------------------
Q8EF72_SHEON/112-195--------------------------------------------------------------------------------
Q8EF72_SHEON/198-271--------------------------------------------------------------------------------
Q8EGG7_SHEON/29-96--------------------------------------------------------------------------------
Q8EGG7_SHEON/97-177--------------------------------------------------------------------------------
Q8EGG7_SHEON/180-268--------------------------------------------------------------------------------
Q8EGG7_SHEON/271-349--------------------------------------------------------------------------------
Q8EGG7_SHEON/352-426--------------------------------------------------------------------------------
Q8EJN5_SHEON/337-408--------------------------------------------------------------------------------
Q8GBX8_PASMD/261-340--------------------------------------------------------------------------------
Q8I576_PLAF7/116-193--------------------------------------------------------------------------------
BAMA_BUCAP/24-91--------------------------------------------------------------------------------
BAMA_BUCAP/92-172--------------------------------------------------------------------------------
BAMA_BUCAP/175-263--------------------------------------------------------------------------------
BAMA_BUCAP/266-344--------------------------------------------------------------------------------
BAMA_BUCAP/347-421--------------------------------------------------------------------------------
Q8KBW3_CHLTE/43-133--------------------------------------------------------------------------------
Q8KC70_CHLTE/372-447--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/57-131--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/132-209--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/212-301--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/304-389--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/392-467--------------------------------------------------------------------------------
Q8LEH7_ARATH/74-152--------------------------------------------------------------------------------
Q8PEY4_XANAC/199-273--------------------------------------------------------------------------------
Q8RHT4_FUSNN/4-75--------------------------------------------------------------------------------
Q8RHT4_FUSNN/251-335--------------------------------------------------------------------------------
A9CJ61_AGRT5/38-105--------------------------------------------------------------------------------
A9CJ61_AGRT5/106-183--------------------------------------------------------------------------------
A9CJ61_AGRT5/186-274--------------------------------------------------------------------------------
A9CJ61_AGRT5/277-356--------------------------------------------------------------------------------
A9CJ61_AGRT5/359-432--------------------------------------------------------------------------------
Q8XZI3_RALSO/30-97--------------------------------------------------------------------------------
Q8XZI3_RALSO/98-178--------------------------------------------------------------------------------
Q8XZI3_RALSO/181-269--------------------------------------------------------------------------------
Q8XZI3_RALSO/272-350--------------------------------------------------------------------------------
Q8XZI3_RALSO/353-427--------------------------------------------------------------------------------
Q8YUR6_NOSS1/221-296--------------------------------------------------------------------------------
Q8YUR6_NOSS1/395-466--------------------------------------------------------------------------------
Q92LN9_RHIME/217-291--------------------------------------------------------------------------------
Q92Q48_RHIME/39-106--------------------------------------------------------------------------------
Q92Q48_RHIME/107-184--------------------------------------------------------------------------------
Q92Q48_RHIME/187-275--------------------------------------------------------------------------------
Q92Q48_RHIME/278-357--------------------------------------------------------------------------------
Q92Q48_RHIME/360-431--------------------------------------------------------------------------------
Q93PM2_HAEDC/20-87--------------------------------------------------------------------------------
Q93PM2_HAEDC/88-168--------------------------------------------------------------------------------
Q93PM2_HAEDC/171-259--------------------------------------------------------------------------------
Q93PM2_HAEDC/262-341--------------------------------------------------------------------------------
Q93PM2_HAEDC/344-418--------------------------------------------------------------------------------
Q98K30_RHILO/218-292--------------------------------------------------------------------------------
Q98MC3_RHILO/39-106--------------------------------------------------------------------------------
Q98MC3_RHILO/107-184--------------------------------------------------------------------------------
Q98MC3_RHILO/187-275--------------------------------------------------------------------------------
Q98MC3_RHILO/278-357--------------------------------------------------------------------------------
Q98MC3_RHILO/360-433--------------------------------------------------------------------------------
Q9A711_CAUCR/24-91--------------------------------------------------------------------------------
Q9A711_CAUCR/92-169--------------------------------------------------------------------------------
Q9A711_CAUCR/172-260--------------------------------------------------------------------------------
Q9A711_CAUCR/263-342--------------------------------------------------------------------------------
Q9A711_CAUCR/345-418--------------------------------------------------------------------------------
Q9HXY4_PSEAE/265-343--------------------------------------------------------------------------------
Q9HYQ6_PSEAE/333-404--------------------------------------------------------------------------------
Q9I0U1_PSEAE/190-268--------------------------------------------------------------------------------
Q9KPW0_VIBCH/266-344--------------------------------------------------------------------------------
Q9KUB9_VIBCH/347-418--------------------------------------------------------------------------------
Q9RXD5_DEIRA/97-179--------------------------------------------------------------------------------
Q9RXD5_DEIRA/180-256--------------------------------------------------------------------------------
Q9RXD5_DEIRA/329-402--------------------------------------------------------------------------------
Q9RXD5_DEIRA/407-477--------------------------------------------------------------------------------
BAMA_PHOLU/175-263--------------------------------------------------------------------------------
Q9SRL6_ARATH/77-155--------------------------------------------------------------------------------
Q9WYS9_THEMA/19-89--------------------------------------------------------------------------------
Q9WYS9_THEMA/90-164--------------------------------------------------------------------------------
Q9WYS9_THEMA/270-342--------------------------------------------------------------------------------

PF08479

Q8XQ41_RALSO/70-145--------------------------------------------------------------------------------
Q7W7Z0_BORPA/73-148--------------------------------------------------------------------------------
Q8RI18_FUSNN/32-109--------------------------------------------------------------------------------
Q7NU30_CHRVO/77-152--------------------------------------------------------------------------------
Q7N2L1_PHOLL/77-152--------------------------------------------------------------------------------
Q7N9T5_PHOLL/77-152--------------------------------------------------------------------------------
HLYB_SERMA/79-152--------------------------------------------------------------------------------
Q6G3U5_BARHE/90-166--------------------------------------------------------------------------------
Q88MW8_PSEPK/83-158--------------------------------------------------------------------------------
Q8PF71_XANAC/63-139--------------------------------------------------------------------------------
Q7N107_PHOLL/69-145--------------------------------------------------------------------------------
Q605Q3_METCA/48-123--------------------------------------------------------------------------------
Q664C6_YERPS/89-165--------------------------------------------------------------------------------
Q71BF5_HAEIF/73-150--------------------------------------------------------------------------------
Q9JY36_NEIMB/87-166--------------------------------------------------------------------------------
Q8YM25_NOSS1/96-171--------------------------------------------------------------------------------
Q7N1B0_PHOLL/77-152--------------------------------------------------------------------------------
Q89H68_BRAJA/98-173--------------------------------------------------------------------------------
Q93QU8_ECOLX/82-162--------------------------------------------------------------------------------
Q9HVN7_PSEAE/59-134--------------------------------------------------------------------------------
Q8XQZ3_RALSO/84-163--------------------------------------------------------------------------------
Q880E0_PSESM/77-152--------------------------------------------------------------------------------
Q8XYH9_RALSO/79-151--------------------------------------------------------------------------------
O32607_EDWTA/81-154--------------------------------------------------------------------------------
Q8DLP0_THEEB/81-156--------------------------------------------------------------------------------
Q8XQX3_RALSO/69-144--------------------------------------------------------------------------------
Q8X9M8_ECO57/65-141--------------------------------------------------------------------------------
Q7MRX6_WOLSU/59-134--------------------------------------------------------------------------------
Q8PLI4_XANAC/79-156--------------------------------------------------------------------------------
Q9RGR3_BORBO/89-164--------------------------------------------------------------------------------
P94771_ERWCH/76-151--------------------------------------------------------------------------------
Q9I792_PSEAE/71-146--------------------------------------------------------------------------------
Q8XPV1_RALSO/81-156--------------------------------------------------------------------------------
Q7VLT7_HAEDU/59-128--------------------------------------------------------------------------------
Q7NWR3_CHRVO/87-160--------------------------------------------------------------------------------
Q6RK56_ERWCR/75-150--------------------------------------------------------------------------------
Q6FDM4_ACIAD/101-180--------------------------------------------------------------------------------
Q8VMR1_PHOLU/79-152--------------------------------------------------------------------------------
Q5GD94_XENNE/79-152--------------------------------------------------------------------------------
Q9AHG0_9FUSO/86-161--------------------------------------------------------------------------------
Q63JI8_BURPS/74-148--------------------------------------------------------------------------------
HLYB_PROMI/77-150--------------------------------------------------------------------------------
Q9AAJ4_CAUCR/8-83--------------------------------------------------------------------------------
Q63TR3_BURPS/65-140--------------------------------------------------------------------------------
Q89Q77_BRAJA/73-148--------------------------------------------------------------------------------
Q8XAN8_ECO57/70-144--------------------------------------------------------------------------------
Q9HVG7_PSEAE/71-146--------------------------------------------------------------------------------
Q6DA64_ERWCT/107-183--------------------------------------------------------------------------------
Q8RGK0_FUSNN/41-115--------------------------------------------------------------------------------
Q8G9X8_ECOLX/104-179--------------------------------------------------------------------------------
Q9PAG8_XYLFA/106-185--------------------------------------------------------------------------------
Q74E11_GEOSL/79-154--------------------------------------------------------------------------------
Q8YWF4_NOSS1/18-93--------------------------------------------------------------------------------
Q7N910_PHOLL/78-154--------------------------------------------------------------------------------
IBPB_HAES2/99-172--------------------------------------------------------------------------------
Q88QC1_PSEPK/91-166--------------------------------------------------------------------------------
Q7NY08_CHRVO/92-167--------------------------------------------------------------------------------
Q669F9_YERPS/77-153--------------------------------------------------------------------------------
Q8D0E8_YERPE/68-141--------------------------------------------------------------------------------
Q9I5N4_PSEAE/47-122--------------------------------------------------------------------------------

PF08478

FTSQ_VIBF1/50-120--------------------------------------------------------------------------------
Q5FG13_EHRRG/81-147--------------------------------------------------------------------------------
FTSQ_SHEON/52-121--------------------------------------------------------------------------------
DIVIB_BACSU/54-123--------------------------------------------------------------------------------
FTSQ_STRCU/57-126--------------------------------------------------------------------------------
FTSQ_RHIME/89-157--------------------------------------------------------------------------------
Q5P6Z9_AROAE/37-106--------------------------------------------------------------------------------
O83403_TREPA/55-123--------------------------------------------------------------------------------
DIVIB_CLOTE/54-122--------------------------------------------------------------------------------
FTSQ_ECOLI/55-126--------------------------------------------------------------------------------
FTSQ_STRGR/5-74--------------------------------------------------------------------------------
Q8D2Z8_WIGBR/41-111--------------------------------------------------------------------------------
Q8RMK7_AZOBR/99-167--------------------------------------------------------------------------------
Q83N06_TROWT/56-124--------------------------------------------------------------------------------
Q8E185_STRA5/122-193--------------------------------------------------------------------------------
Q5SJC7_THET8/24-91--------------------------------------------------------------------------------
Q9F1M8_SHEVI/67-136--------------------------------------------------------------------------------
Q5R0N0_IDILO/43-112--------------------------------------------------------------------------------
Q6F706_ACIAD/59-128--------------------------------------------------------------------------------
Q728V1_DESVH/71-139--------------------------------------------------------------------------------
O07671_ENTHR/66-137--------------------------------------------------------------------------------
FTSQ_HAEIN/54-124--------------------------------------------------------------------------------
DIVIB_STRR6/153-223--------------------------------------------------------------------------------
Q9CPA8_PASMU/55-125--------------------------------------------------------------------------------
Q7MNU9_VIBVY/53-123--------------------------------------------------------------------------------
O07324_STAAU/195-263--------------------------------------------------------------------------------
Q73IQ7_WOLPM/61-128--------------------------------------------------------------------------------
Q7NQ02_CHRVO/37-106--------------------------------------------------------------------------------
Q5YYX7_NOCFA/42-110--------------------------------------------------------------------------------
Q8DVE1_STRMU/126-197--------------------------------------------------------------------------------
Q82AD6_STRAW/56-125--------------------------------------------------------------------------------
Q8YQH2_NOSS1/56-126--------------------------------------------------------------------------------
Q98KB7_RHILO/92-160--------------------------------------------------------------------------------
Q5XB06_STRP6/125-196--------------------------------------------------------------------------------
FTSQ_COXBU/46-115--------------------------------------------------------------------------------
Q5HQ08_STAEQ/219-287--------------------------------------------------------------------------------
Q57352_BORBG/33-101--------------------------------------------------------------------------------
Q8DMI0_THEEB/61-130--------------------------------------------------------------------------------
Q72N66_LEPIC/45-113--------------------------------------------------------------------------------
O07110_ENTFL/126-197--------------------------------------------------------------------------------
FTSQ_BARBA/87-155--------------------------------------------------------------------------------
Q87WY8_PSESM/73-142--------------------------------------------------------------------------------
Q5FUJ1_GLUOX/84-152--------------------------------------------------------------------------------
DIVIB_GEOKA/50-118--------------------------------------------------------------------------------
Q87AG2_XYLFT/34-103--------------------------------------------------------------------------------
Q7V8M1_PROMM/59-128--------------------------------------------------------------------------------
DIVIB_LACLA/153-224--------------------------------------------------------------------------------
Q65RZ0_MANSM/55-125--------------------------------------------------------------------------------
Q6AE66_LEIXX/96-164--------------------------------------------------------------------------------
P73457_SYNY3/54-123--------------------------------------------------------------------------------
Q73NF1_TREDE/62-130--------------------------------------------------------------------------------
Q6AJ56_DESPS/51-120--------------------------------------------------------------------------------
Q9RWN7_DEIRA/101-171--------------------------------------------------------------------------------
Q604W1_METCA/56-127--------------------------------------------------------------------------------
Q62GT0_BURMA/37-106--------------------------------------------------------------------------------
Q6NGD0_CORDI/29-97--------------------------------------------------------------------------------
Q5PBK1_ANAMM/65-133--------------------------------------------------------------------------------
FTSQ_RICTY/72-140--------------------------------------------------------------------------------
Q7VMY3_HAEDU/61-131--------------------------------------------------------------------------------
Q8CXI4_OCEIH/50-118--------------------------------------------------------------------------------
Q5WFH0_BACSK/51-119--------------------------------------------------------------------------------
Q7U5Q7_SYNPX/51-120--------------------------------------------------------------------------------
Q5WTJ0_LEGPL/39-108--------------------------------------------------------------------------------
Q636B8_BACCZ/53-121--------------------------------------------------------------------------------
FTSQ_BLOFL/45-115--------------------------------------------------------------------------------
FTSQ_VIBCH/52-122--------------------------------------------------------------------------------
Q6N416_RHOPA/110-178--------------------------------------------------------------------------------
FTSQ_NEIG1/37-106--------------------------------------------------------------------------------
Q6FZ75_BARQU/88-156--------------------------------------------------------------------------------
Q67Q43_SYMTH/58-125--------------------------------------------------------------------------------
FTSQ_GEOSL/67-135--------------------------------------------------------------------------------
Q5M0D3_STRT1/104-175--------------------------------------------------------------------------------
Q9CCE5_MYCLE/151-219--------------------------------------------------------------------------------
Q5GS65_WOLTR/61-128--------------------------------------------------------------------------------
FTSQ_CORGL/30-98--------------------------------------------------------------------------------
Q8R9G8_THETN/29-97--------------------------------------------------------------------------------
Q8XJA3_CLOPE/42-109--------------------------------------------------------------------------------
Q57C82_BRUAB/68-136--------------------------------------------------------------------------------
Q93JX7_PROMR/60-129--------------------------------------------------------------------------------
Q7NNV9_GLOVI/69-138--------------------------------------------------------------------------------
Q6A9Q0_PROAC/48-116--------------------------------------------------------------------------------
Q5FKV1_LACAC/77-148--------------------------------------------------------------------------------
Q8FNU2_COREF/30-98--------------------------------------------------------------------------------
DIVIB_CLOAB/41-109--------------------------------------------------------------------------------
Q6LMF8_PHOPR/51-121--------------------------------------------------------------------------------
Q9RNN0_ZYMMB/40-108--------------------------------------------------------------------------------
Q9K9T2_BACHD/50-118--------------------------------------------------------------------------------
FTSQ_MYCTU/124-192--------------------------------------------------------------------------------
FTSQ_CAUCR/94-162--------------------------------------------------------------------------------
Q6G1J3_BARQU/39-106--------------------------------------------------------------------------------
Q71XX9_LISMF/51-119--------------------------------------------------------------------------------
Q45306_BACLI/54-123--------------------------------------------------------------------------------

PF06898

YQFD_BACSU/2-387HPKTEQEKHSLHFLGFKLPVSYVKEQTRESEEALRKYTKEEAVQEGIKLGKQDVEDKIGENGEVKSEKVLHQTVENGKVK
Q9KD59_BACHD/4-388EFETFQEQKELYFWKWTLPIQYTRTKVYEANRFEQKLTKGEAVERGKKLAKQELYEKIDKDATIEGEKVLHERVENGKVK
Q8XIU3_CLOPE/2-375KYDKIESTGKF..........INRNLYYEKIDKDIVDDKETIINKAVELMKNSINKEISKQSKIVDNIITTEDLGEGKIR
Q8EPX5_OCEIH/2-398QTQVELNEKPIQFLKWQLPISIIESEINEKQLYEGERTKEEAIDAGKKQAVKQLETELGPDAEILSEKVLHERIEHGKVK
Q8RB55_THETN/8-388KFKKEEKN....LIPYEAPFKIVKEVYYEVKPEVETVPIKEAKEKGRKKALEELEKVISPGGKVVNKKEKYEVIDGRILR
Q892R7_CLOTE/6-378QYDKIEDNKGP..........IVIETYYEVKQNKVDLNKDSLVNTVAKELEKKITLNFDKNVIVKDKIIDKKDYEE.YIE
Q97JI9_CLOAB/2-374KYDKIVDDKCF..........GGRETYYEVDDKVVKKDKDAIVKETANKMYDKMKENYDMNIKVLDKIVDS.NVEGNICT
Q9S6M8_BACME/2-386SKVTEKVEHPLYFFKWKLPLSYEKVAVREEQNSQRVYSKQEAVEKALEIGRKKLLSTLGEDAKIKGEKVLHQEQDNGKVR

PF07244

Q5NND8_ZYMMO/246-316--LTLQIHEN--
Q5NND8_ZYMMO/317-394--IVFEITEG--
Q5NND8_ZYMMO/397-485--ITYVVEEG--
Q5NND8_ZYMMO/488-566--IEFRIAEA--
Q5NND8_ZYMMO/569-643--LDTNLQEK--
BAMA_HELPY/70-137--LEFHFDEK--
BAMA_HELPY/138-216--IVFDVNRG--
BAMA_HELPY/219-309--LHYKVKEG--
BAMA_HELPY/312-391--VIYRIEVG--
BAMA_HELPY/394-466--LLVSVEEG--
O30912_NEIME/23-90--LLLTVIER--
O30912_NEIME/91-171--IDITIDEG--
O30912_NEIME/174-262--IKITVHEG--
O30912_NEIME/265-344--FVLHIEPG--
O30912_NEIME/347-421--LNMSLTER--
O32625_HAEIF/22-89--LVVSVVAK--
O32625_HAEIF/90-170--ILIQINED--
O32625_HAEIF/173-259--VTIDVNEG--
O32625_HAEIF/262-341--ITFVVDAG--
O32625_HAEIF/344-418--VVYKVKER--
O51735_BORBU/30-102--ITFIVKEK--
O51735_BORBU/103-180--IIFNIVAG--
O51735_BORBU/183-274--LKYFLSEG--
O51735_BORBU/277-353--LLIKILEK--
O51735_BORBU/356-429--INLNIEER--
O66463_AQUAE/72-149--FYINIREG--
O66463_AQUAE/152-225--LKRKFREA--
O67326_AQUAE/18-90--EVILVVED--
O67326_AQUAE/203-287--VIVKVKEG--
O67326_AQUAE/290-371--VLLKIIEG--
O67326_AQUAE/374-446--LLVKIRER--
O68454_TREPL/31-105--LQFTVKER--
O68454_TREPL/106-182--VQFTIQEG--
O68454_TREPL/185-273--LTYTVVEG--
O68454_TREPL/276-354--FKITVVER--
O68454_TREPL/357-430--IILNVEEQ--
O84244_CHLTR/104-182--ISIEIKEG--
O84244_CHLTR/185-272--LLIVVDKG--
O84244_CHLTR/275-353--VTYRVSEG--
O84244_CHLTR/356-435--VFIEVKET--
BAMA_SHIFL/24-91--LLVQVKER--
BAMA_SHIFL/92-172--LKLVFQEG--
BAMA_SHIFL/175-263--VTVNITEG--
BAMA_SHIFL/266-344--LRVNVDAG--
BAMA_SHIFL/347-421--VVYKVKER--
YTFM_ECOLI/189-263--LTGVVSPR--
BAMA_BUCAI/24-91--IVFNIRER--
BAMA_BUCAI/92-172--IKILINEG--
BAMA_BUCAI/175-263--ITIGVSEG--
BAMA_BUCAI/266-344--LNFNIDMK--
BAMA_BUCAI/347-421--ITYQVKEQ--
P73472_SYNY3/260-331--VTFEVQAN--
P73472_SYNY3/425-496--VNVDVVEG--
Q44629_BRUAO/39-106--LIVQVKER--
Q44629_BRUAO/107-184--VVYEINEG--
Q44629_BRUAO/361-434--LVVDVVEK--
Q51930_PASMD/21-88--LVVTVMPK--
Q51930_PASMD/89-169--IKIQINED--
Q51930_PASMD/172-247--VKLSDDKK--
Q51930_PASMD/341-414--VIYKVKER--
Q57CY5_BRUAB/278-357--VVYSVDQG--
Q57FW8_BRUAB/233-307--ITLNVQER--
Q5DZL2_VIBF1/357-428--LKVTAKEK--
Q5E2U2_VIBF1/342-414--LIVEVKEK--
Q5E3E7_VIBF1/24-91--LLIKVTER--
Q5E3E7_VIBF1/92-172--LKFVFTE