Sequence alignment for CL0191

PF07244

Q5F5H0_NEIG1/221-295--------------------------------------------------------------------------------
TP326_TREPA/186-273--------------------------------------------------------------------------------
Q98MC3_RHILO/107-184--------------------------------------------------------------------------------
Q6ARL5_DESPS/92-170--------------------------------------------------------------------------------
Q5NEP7_FRATT/354-428--------------------------------------------------------------------------------
Q5FPE9_GLUOX/347-432--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/212-301--------------------------------------------------------------------------------
Q73JH4_TREDE/105-183--------------------------------------------------------------------------------
O84244_CHLTR/185-272--------------------------------------------------------------------------------
Q9I0U1_PSEAE/190-268--------------------------------------------------------------------------------
Q8EGG7_SHEON/97-177--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/304-389--------------------------------------------------------------------------------
Q9KUB9_VIBCH/347-418--------------------------------------------------------------------------------
Q73JH4_TREDE/186-274--------------------------------------------------------------------------------
Q98MC3_RHILO/360-433--------------------------------------------------------------------------------
Q6MAE9_PARUW/218-306--------------------------------------------------------------------------------
Q8XZI3_RALSO/98-178--------------------------------------------------------------------------------
Q8EGG7_SHEON/352-426--------------------------------------------------------------------------------
Q604T9_METCA/124-204--------------------------------------------------------------------------------
Q8D271_WIGBR/189-264--------------------------------------------------------------------------------
Q82VX0_NITEU/116-201--------------------------------------------------------------------------------
Q87LW2_VIBPA/354-425--------------------------------------------------------------------------------
Q6MAE9_PARUW/390-467--------------------------------------------------------------------------------
Q6LKQ8_PHOPR/351-422--------------------------------------------------------------------------------
O84244_CHLTR/275-353--------------------------------------------------------------------------------
Q5NZG7_AROAE/348-422--------------------------------------------------------------------------------
O67326_AQUAE/374-446--------------------------------------------------------------------------------
Q5NNB2_ZYMMO/333-411--------------------------------------------------------------------------------
Q7VHH5_HELHP/344-416--------------------------------------------------------------------------------
Q98MC3_RHILO/187-275--------------------------------------------------------------------------------
Q6FCG7_ACIAD/270-348--------------------------------------------------------------------------------
Q6MMX9_BDEBA/120-198--------------------------------------------------------------------------------
Q8XZI3_RALSO/353-427--------------------------------------------------------------------------------
Q7MIG8_VIBVY/266-344--------------------------------------------------------------------------------
BAMA_HELPY/312-391--------------------------------------------------------------------------------
Q8RHT4_FUSNN/251-335--------------------------------------------------------------------------------
Q6D152_PECAS/230-304--------------------------------------------------------------------------------
Q5E2U2_VIBF1/342-414--------------------------------------------------------------------------------
Q89NX1_BRADU/319-398--------------------------------------------------------------------------------
Q92Q48_RHIME/107-184--------------------------------------------------------------------------------
Q5R0Z1_IDILO/176-264--------------------------------------------------------------------------------
Q5E3E7_VIBF1/92-172--------------------------------------------------------------------------------
Q8D2H0_WIGBR/95-175--------------------------------------------------------------------------------
Q5FPY9_GLUOX/117-194--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/132-209--------------------------------------------------------------------------------
Q83DT2_COXBU/99-179--------------------------------------------------------------------------------
Q6FCG7_ACIAD/179-267--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/187-275--------------------------------------------------------------------------------
Q6ATX4_ORYSJ/67-146--------------------------------------------------------------------------------
Q7MHW3_VIBVY/361-432--------------------------------------------------------------------------------
Q7MAB6_WOLSU/88-166--------------------------------------------------------------------------------
BAMA_DESVH/301-383--------------------------------------------------------------------------------
Q5NEP7_FRATT/96-176--------------------------------------------------------------------------------
O67326_AQUAE/290-371--------------------------------------------------------------------------------
BAMA_DESVH/131-209--------------------------------------------------------------------------------
Q7UK20_RHOBA/180-256--------------------------------------------------------------------------------
Q7MXJ3_PORGI/386-461--------------------------------------------------------------------------------
Q98K30_RHILO/218-292--------------------------------------------------------------------------------
Q82U03_NITEU/346-420--------------------------------------------------------------------------------
Q5R0Z1_IDILO/93-173--------------------------------------------------------------------------------
Q7MXJ3_PORGI/302-383--------------------------------------------------------------------------------
Q88IV7_PSEPK/195-269--------------------------------------------------------------------------------
Q74AT3_GEOSL/270-348--------------------------------------------------------------------------------
Q5NND8_ZYMMO/397-485--------------------------------------------------------------------------------
Q5FPY9_GLUOX/370-443--------------------------------------------------------------------------------
Q6MAC6_PARUW/256-330--------------------------------------------------------------------------------
Q82U03_NITEU/265-343--------------------------------------------------------------------------------
Q8EGG7_SHEON/271-349--------------------------------------------------------------------------------
BAMA_BUCAI/175-263--------------------------------------------------------------------------------
Q6MKB1_BDEBA/93-170--------------------------------------------------------------------------------
Q65R79_MANSM/88-168--------------------------------------------------------------------------------
Q5LSU6_RUEPO/196-284--------------------------------------------------------------------------------
Q74AT3_GEOSL/179-267--------------------------------------------------------------------------------
Q9A711_CAUCR/345-418--------------------------------------------------------------------------------
Q7VYC2_BORPE/276-354--------------------------------------------------------------------------------
BAMA_HELPY/138-216--------------------------------------------------------------------------------
Q7MPD6_VIBVY/100-183--------------------------------------------------------------------------------
Q7MXJ3_PORGI/45-119--------------------------------------------------------------------------------
Q5NZG7_AROAE/267-345--------------------------------------------------------------------------------
Q9RXD5_DEIRA/97-179--------------------------------------------------------------------------------
Q8DI03_THEEB/90-161--------------------------------------------------------------------------------
Q604T9_METCA/298-376--------------------------------------------------------------------------------
Q886N5_PSESM/91-171--------------------------------------------------------------------------------
Q8EGG7_SHEON/180-268--------------------------------------------------------------------------------
Q74AT3_GEOSL/99-176--------------------------------------------------------------------------------
Q89KQ1_BRADU/278-357--------------------------------------------------------------------------------
Q87SW5_VIBPA/101-182--------------------------------------------------------------------------------
A9CJ61_AGRFC/186-274--------------------------------------------------------------------------------
Q8XZI3_RALSO/272-350--------------------------------------------------------------------------------
Q6MMX9_BDEBA/201-289--------------------------------------------------------------------------------
Q7CWM5_AGRFC/240-314--------------------------------------------------------------------------------
Q6MMX9_BDEBA/48-119--------------------------------------------------------------------------------
BAMA_HELPY/394-466--------------------------------------------------------------------------------
Q5R0Z1_IDILO/267-345--------------------------------------------------------------------------------
Q8A1E1_BACTN/46-120--------------------------------------------------------------------------------
Q5E819_VIBF1/104-185--------------------------------------------------------------------------------
Q5LSU6_RUEPO/369-442--------------------------------------------------------------------------------
Q5R0Z1_IDILO/348-422--------------------------------------------------------------------------------
TAMA_ECOLI/189-263--------------------------------------------------------------------------------
Q7NVY6_CHRVO/267-345--------------------------------------------------------------------------------
Q6MAE9_PARUW/309-387--------------------------------------------------------------------------------
Q92LN9_RHIME/217-291--------------------------------------------------------------------------------
O51735_BORBU/103-180--------------------------------------------------------------------------------
Q7UK20_RHOBA/97-179--------------------------------------------------------------------------------
A9CJ61_AGRFC/359-432--------------------------------------------------------------------------------
Q82U03_NITEU/174-262--------------------------------------------------------------------------------
Q9SRL6_ARATH/77-155--------------------------------------------------------------------------------
Q7VRD8_BLOFL/101-181--------------------------------------------------------------------------------
Q6MMX9_BDEBA/292-370--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/392-467--------------------------------------------------------------------------------
Q6LN32_PHOPR/175-263--------------------------------------------------------------------------------
Q604T9_METCA/207-295--------------------------------------------------------------------------------
Q8KC70_CHLTE/372-447--------------------------------------------------------------------------------
Q6ARL5_DESPS/20-91--------------------------------------------------------------------------------
Q7VRD8_BLOFL/184-272--------------------------------------------------------------------------------
Q5FPY9_GLUOX/197-285--------------------------------------------------------------------------------
O66463_AQUAE/72-149--------------------------------------------------------------------------------
Q73JH4_TREDE/358-431--------------------------------------------------------------------------------
Q7UK20_RHOBA/349-427--------------------------------------------------------------------------------
BAMA_BUCAI/266-344--------------------------------------------------------------------------------
Q7P0N3_CHRVO/181-255--------------------------------------------------------------------------------
Q7NVY6_CHRVO/348-422--------------------------------------------------------------------------------
Q6MKB1_BDEBA/419-500--------------------------------------------------------------------------------
Q8DI03_THEEB/242-318--------------------------------------------------------------------------------
Q7VAN9_PROMA/238-314--------------------------------------------------------------------------------
Q7MAB6_WOLSU/344-416--------------------------------------------------------------------------------
O66463_AQUAE/152-225--------------------------------------------------------------------------------
Q7MYW2_PHOLL/190-266--------------------------------------------------------------------------------
Q6MKB1_BDEBA/503-577--------------------------------------------------------------------------------
Q7MXJ3_PORGI/120-199--------------------------------------------------------------------------------
Q5NND8_ZYMMO/317-394--------------------------------------------------------------------------------
Q8EF72_SHEON/112-195--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/107-184--------------------------------------------------------------------------------
Q5NEP7_FRATT/273-351--------------------------------------------------------------------------------
Q7U8Q8_SYNPX/217-301--------------------------------------------------------------------------------
Q886N5_PSESM/346-420--------------------------------------------------------------------------------
Q6ARL5_DESPS/262-340--------------------------------------------------------------------------------
BAMA_DESVH/212-298--------------------------------------------------------------------------------
O84244_CHLTR/104-182--------------------------------------------------------------------------------
Q5SKT2_THET8/83-163--------------------------------------------------------------------------------
Q92Q48_RHIME/278-357--------------------------------------------------------------------------------
Q83DT2_COXBU/182-270--------------------------------------------------------------------------------
O84244_CHLTR/356-435--------------------------------------------------------------------------------
Q98MC3_RHILO/278-357--------------------------------------------------------------------------------
Q7VYC2_BORPE/185-273--------------------------------------------------------------------------------
Q7NVY6_CHRVO/93-173--------------------------------------------------------------------------------
Q7VHH5_HELHP/87-166--------------------------------------------------------------------------------
Q89NX1_BRADU/148-225--------------------------------------------------------------------------------
A9CJ61_AGRFC/277-356--------------------------------------------------------------------------------
Q7NVY6_CHRVO/176-264--------------------------------------------------------------------------------
Q6FCG7_ACIAD/351-425--------------------------------------------------------------------------------
Q6ARL5_DESPS/173-259--------------------------------------------------------------------------------
Q8A1E1_BACTN/203-291--------------------------------------------------------------------------------
Q8XZI3_RALSO/181-269--------------------------------------------------------------------------------
Q8D2H0_WIGBR/178-266--------------------------------------------------------------------------------
O67326_AQUAE/203-287--------------------------------------------------------------------------------
Q7VHH5_HELHP/262-341--------------------------------------------------------------------------------
Q9A711_CAUCR/263-342--------------------------------------------------------------------------------
Q9WYS9_THEMA/270-342--------------------------------------------------------------------------------
Q5E3E7_VIBF1/347-421--------------------------------------------------------------------------------
Q8I576_PLAF7/116-193--------------------------------------------------------------------------------
Q87ME5_VIBPA/266-344--------------------------------------------------------------------------------
BAMA_BUCAI/92-172--------------------------------------------------------------------------------
Q83DT2_COXBU/354-428--------------------------------------------------------------------------------
Q9A711_CAUCR/172-260--------------------------------------------------------------------------------
Q7MAB6_WOLSU/169-259--------------------------------------------------------------------------------
BAMA_HELPY/219-309--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/278-357--------------------------------------------------------------------------------
Q83DT2_COXBU/273-351--------------------------------------------------------------------------------
Q6N5Q8_RHOPA/360-433--------------------------------------------------------------------------------
Q5E3E7_VIBF1/266-344--------------------------------------------------------------------------------
Q6FCG7_ACIAD/96-176--------------------------------------------------------------------------------
Q82VX0_NITEU/204-278--------------------------------------------------------------------------------
Q5E3E7_VIBF1/175-263--------------------------------------------------------------------------------
Q5LSU6_RUEPO/116-193--------------------------------------------------------------------------------
Q8KFQ6_CHLTE/57-131--------------------------------------------------------------------------------
Q8A1E1_BACTN/121-200--------------------------------------------------------------------------------
Q5SKT2_THET8/164-238--------------------------------------------------------------------------------
Q9RXD5_DEIRA/180-256--------------------------------------------------------------------------------
Q7UK20_RHOBA/259-346--------------------------------------------------------------------------------
O67326_AQUAE/18-90--------------------------------------------------------------------------------
O51735_BORBU/277-353--------------------------------------------------------------------------------
Q8EF72_SHEON/198-271--------------------------------------------------------------------------------
Q73JH4_TREDE/277-355--------------------------------------------------------------------------------
Q9RXD5_DEIRA/329-402--------------------------------------------------------------------------------
Q82U03_NITEU/91-171--------------------------------------------------------------------------------
Q886N5_PSESM/174-262--------------------------------------------------------------------------------
BAMA_BUCAI/347-421--------------------------------------------------------------------------------
Q5NZG7_AROAE/93-173--------------------------------------------------------------------------------
Q65R79_MANSM/260-339--------------------------------------------------------------------------------
Q886N5_PSESM/265-343--------------------------------------------------------------------------------
Q7V0C8_PROMP/253-325--------------------------------------------------------------------------------
Q8EJN5_SHEON/337-408--------------------------------------------------------------------------------
Q74AT3_GEOSL/351-424--------------------------------------------------------------------------------
Q8D2H0_WIGBR/348-422--------------------------------------------------------------------------------
Q5NEP7_FRATT/179-270--------------------------------------------------------------------------------
Q8KBW3_CHLTE/43-133--------------------------------------------------------------------------------
BAMA_DESVH/386-459--------------------------------------------------------------------------------
Q6LN32_PHOPR/266-344--------------------------------------------------------------------------------
Q7VYC2_BORPE/102-182--------------------------------------------------------------------------------
Q6ARL5_DESPS/343-416--------------------------------------------------------------------------------
Q604T9_METCA/379-453--------------------------------------------------------------------------------
Q6LMH9_PHOPR/358-429--------------------------------------------------------------------------------
Q92Q48_RHIME/187-275--------------------------------------------------------------------------------
Q9HXY4_PSEAE/265-343--------------------------------------------------------------------------------
Q5NND8_ZYMMO/488-566--------------------------------------------------------------------------------
Q6MAE9_PARUW/137-215--------------------------------------------------------------------------------
P73472_SYNY3/425-496--------------------------------------------------------------------------------
Q5NZG7_AROAE/176-264--------------------------------------------------------------------------------
Q65R79_MANSM/342-416--------------------------------------------------------------------------------
BAMA_DESVH/59-130--------------------------------------------------------------------------------
Q881Y2_PSESM/187-261--------------------------------------------------------------------------------
Q74AT3_GEOSL/27-98--------------------------------------------------------------------------------
Q5NND8_ZYMMO/569-643--------------------------------------------------------------------------------
O51735_BORBU/183-274--------------------------------------------------------------------------------
Q7VYC2_BORPE/357-431--------------------------------------------------------------------------------
Q6MMX9_BDEBA/373-447--------------------------------------------------------------------------------
BAMA_PHOLL/266-344--------------------------------------------------------------------------------
Q9A711_CAUCR/92-169--------------------------------------------------------------------------------
Q9KPW0_VIBCH/266-344--------------------------------------------------------------------------------
Q7VHH5_HELHP/169-259--------------------------------------------------------------------------------
Q8YUR6_NOSS1/395-466--------------------------------------------------------------------------------
A9CJ61_AGRFC/106-183--------------------------------------------------------------------------------
Q7VRD8_BLOFL/356-430--------------------------------------------------------------------------------
Q7MAB6_WOLSU/262-341--------------------------------------------------------------------------------
B9KGV5_ANAMF/358-430--------------------------------------------------------------------------------
G1UBA5_HAEDU/89-168--------------------------------------------------------------------------------
BAMA_ECOLI/176-263--------------------------------------------------------------------------------
BAMA_HAEIN/175-259--------------------------------------------------------------------------------
Q2YPP8_BRUA2/234-307--------------------------------------------------------------------------------
Q2YRQ2_BRUA2/108-184--------------------------------------------------------------------------------
Q2YRQ2_BRUA2/278-357--------------------------------------------------------------------------------
Q31PR1_SYNE7/195-269--------------------------------------------------------------------------------
Q5ZY66_LEGPH/369-442--------------------------------------------------------------------------------
Q63T20_BURPS/183-270--------------------------------------------------------------------------------
Q63W94_BURPS/223-295--------------------------------------------------------------------------------
Q8F3T2_LEPIN/54-124--------------------------------------------------------------------------------
Q8PAW1_XANCP/129-208--------------------------------------------------------------------------------
Q8RHT4_FUSNN/101-171--------------------------------------------------------------------------------
BAMA_YERPE/267-344--------------------------------------------------------------------------------
Q9CJL1_PASMU/262-340--------------------------------------------------------------------------------
Q9CJL1_PASMU/89-168--------------------------------------------------------------------------------
Q9FFG3_ARATH/74-151--------------------------------------------------------------------------------
BAMA_NEIMB/267-343--------------------------------------------------------------------------------
Q9PEI2_XYLFA/272-347--------------------------------------------------------------------------------
Q9ZE03_RICPR/176-263--------------------------------------------------------------------------------

PF08479

Q8XQ41_RALSO/70-145--------------------------------------------------------------------------------
Q8RI18_FUSNN/32-109--------------------------------------------------------------------------------
Q7NU30_CHRVO/77-152--------------------------------------------------------------------------------
Q7N2L1_PHOLL/77-152--------------------------------------------------------------------------------
Q7N9T5_PHOLL/77-152--------------------------------------------------------------------------------
Q88MW8_PSEPK/83-158--------------------------------------------------------------------------------
Q7N107_PHOLL/69-145--------------------------------------------------------------------------------
Q605Q3_METCA/48-123--------------------------------------------------------------------------------
Q9JY36_NEIMB/87-166--------------------------------------------------------------------------------
Q8YM25_NOSS1/96-171--------------------------------------------------------------------------------
Q7N1B0_PHOLL/77-152--------------------------------------------------------------------------------
Q89H68_BRADU/98-173--------------------------------------------------------------------------------
Q9HVN7_PSEAE/59-134--------------------------------------------------------------------------------
Q8XQZ3_RALSO/84-163--------------------------------------------------------------------------------
Q880E0_PSESM/77-152--------------------------------------------------------------------------------
Q8XYH9_RALSO/79-151--------------------------------------------------------------------------------
Q8DLP0_THEEB/81-156--------------------------------------------------------------------------------
Q8XQX3_RALSO/69-144--------------------------------------------------------------------------------
Q7MRX6_WOLSU/59-134--------------------------------------------------------------------------------
Q9I792_PSEAE/71-146--------------------------------------------------------------------------------
Q8XPV1_RALSO/81-156--------------------------------------------------------------------------------
Q7VLT7_HAEDU/59-128--------------------------------------------------------------------------------
Q7NWR3_CHRVO/87-160--------------------------------------------------------------------------------
Q6FDM4_ACIAD/101-180--------------------------------------------------------------------------------
Q63JI8_BURPS/74-148--------------------------------------------------------------------------------
Q9AAJ4_CAUCR/8-83--------------------------------------------------------------------------------
Q63TR3_BURPS/65-140--------------------------------------------------------------------------------
Q89Q77_BRADU/73-148--------------------------------------------------------------------------------
Q9HVG7_PSEAE/71-146--------------------------------------------------------------------------------
Q6DA64_PECAS/107-183--------------------------------------------------------------------------------
Q8RGK0_FUSNN/41-115--------------------------------------------------------------------------------
Q9PAG8_XYLFA/106-185--------------------------------------------------------------------------------
Q74E11_GEOSL/79-154--------------------------------------------------------------------------------
Q8YWF4_NOSS1/18-93--------------------------------------------------------------------------------
Q7N910_PHOLL/78-154--------------------------------------------------------------------------------
IBPB_HISS2/99-172--------------------------------------------------------------------------------
Q88QC1_PSEPK/91-166--------------------------------------------------------------------------------
Q7NY08_CHRVO/92-167--------------------------------------------------------------------------------
Q9I5N4_PSEAE/47-122--------------------------------------------------------------------------------
B4F0Z8_PROMH/77-150--------------------------------------------------------------------------------
C5BBG6_EDWI9/81-153--------------------------------------------------------------------------------
D3VFR1_XENNA/80-152--------------------------------------------------------------------------------
FHAC_BORPE/92-164--------------------------------------------------------------------------------
HXUB1_HAEIN/73-150--------------------------------------------------------------------------------
Q0WFB2_YERPE/81-154--------------------------------------------------------------------------------
Q6D5C4_PECAS/75-150--------------------------------------------------------------------------------
Q74QU0_YERPE/90-165--------------------------------------------------------------------------------
Q7CJ53_YERPE/77-153--------------------------------------------------------------------------------
Q7N9K7_PHOLL/79-152--------------------------------------------------------------------------------
Q7VX34_BORPE/76-148--------------------------------------------------------------------------------

PF08478

FTSQ_VIBF1/50-120--------------------------------------------------------------------------------
FTSQ_SHEON/52-121--------------------------------------------------------------------------------
DIVIB_BACSU/54-123--------------------------------------------------------------------------------
FTSQ_RHIME/89-157--------------------------------------------------------------------------------
Q5P6Z9_AROAE/37-106--------------------------------------------------------------------------------
O83403_TREPA/55-123--------------------------------------------------------------------------------
DIVIB_CLOTE/54-122--------------------------------------------------------------------------------
FTSQ_ECOLI/55-126--------------------------------------------------------------------------------
Q8D2Z8_WIGBR/41-111--------------------------------------------------------------------------------
Q83N06_TROWT/56-124--------------------------------------------------------------------------------
Q8E185_STRA5/122-193--------------------------------------------------------------------------------
Q5SJC7_THET8/24-91--------------------------------------------------------------------------------
Q5R0N0_IDILO/43-112--------------------------------------------------------------------------------
Q6F706_ACIAD/59-128--------------------------------------------------------------------------------
Q728V1_DESVH/71-139--------------------------------------------------------------------------------
FTSQ_HAEIN/54-124--------------------------------------------------------------------------------
DIVIB_STRR6/153-223--------------------------------------------------------------------------------
Q9CPA8_PASMU/55-125--------------------------------------------------------------------------------
Q7MNU9_VIBVY/53-123--------------------------------------------------------------------------------
Q7NQ02_CHRVO/37-106--------------------------------------------------------------------------------
Q5YYX7_NOCFA/42-110--------------------------------------------------------------------------------
Q8DVE1_STRMU/126-197--------------------------------------------------------------------------------
Q82AD6_STRAW/56-125--------------------------------------------------------------------------------
Q8YQH2_NOSS1/56-126--------------------------------------------------------------------------------
Q98KB7_RHILO/92-160--------------------------------------------------------------------------------
FTSQ_COXBU/46-115--------------------------------------------------------------------------------
Q5HQ08_STAEQ/219-287--------------------------------------------------------------------------------
Q8DMI0_THEEB/61-130--------------------------------------------------------------------------------
Q87WY8_PSESM/73-142--------------------------------------------------------------------------------
Q5FUJ1_GLUOX/84-152--------------------------------------------------------------------------------
DIVIB_GEOKA/50-118--------------------------------------------------------------------------------
Q7V8M1_PROMM/59-128--------------------------------------------------------------------------------
DIVIB_LACLA/153-224--------------------------------------------------------------------------------
Q65RZ0_MANSM/55-125--------------------------------------------------------------------------------
Q6AE66_LEIXX/96-164--------------------------------------------------------------------------------
P73457_SYNY3/54-123--------------------------------------------------------------------------------
Q73NF1_TREDE/62-130--------------------------------------------------------------------------------
Q6AJ56_DESPS/51-120--------------------------------------------------------------------------------
Q9RWN7_DEIRA/101-171--------------------------------------------------------------------------------
Q604W1_METCA/56-127--------------------------------------------------------------------------------
Q6NGD0_CORDI/29-97--------------------------------------------------------------------------------
Q7VMY3_HAEDU/61-131--------------------------------------------------------------------------------
Q8CXI4_OCEIH/50-118--------------------------------------------------------------------------------
Q5WFH0_BACSK/51-119--------------------------------------------------------------------------------
Q7U5Q7_SYNPX/51-120--------------------------------------------------------------------------------
FTSQ_BLOFL/45-115--------------------------------------------------------------------------------
FTSQ_VIBCH/52-122--------------------------------------------------------------------------------
Q6N416_RHOPA/110-178--------------------------------------------------------------------------------
FTSQ_NEIG1/37-106--------------------------------------------------------------------------------
Q67Q43_SYMTH/58-125--------------------------------------------------------------------------------
FTSQ_GEOSL/67-135--------------------------------------------------------------------------------
Q9CCE5_MYCLE/151-219--------------------------------------------------------------------------------
FTSQ_CORGL/30-98--------------------------------------------------------------------------------
Q8R9G8_CALS4/29-97--------------------------------------------------------------------------------
Q8XJA3_CLOPE/42-109--------------------------------------------------------------------------------
Q7NNV9_GLOVI/69-138--------------------------------------------------------------------------------
Q6A9Q0_PROAC/48-116--------------------------------------------------------------------------------
Q5FKV1_LACAC/77-148--------------------------------------------------------------------------------
Q8FNU2_COREF/30-98--------------------------------------------------------------------------------
DIVIB_CLOAB/41-109--------------------------------------------------------------------------------
Q6LMF8_PHOPR/51-121--------------------------------------------------------------------------------
Q9K9T2_BACHD/50-118--------------------------------------------------------------------------------
FTSQ_CAUCR/94-162--------------------------------------------------------------------------------
B1W0J1_STRGG/62-130--------------------------------------------------------------------------------
B9KHS4_ANAMF/69-137--------------------------------------------------------------------------------
FTSQ_ZYMMO/97-165--------------------------------------------------------------------------------
D4ZDU0_SHEVD/36-105--------------------------------------------------------------------------------
G3XCS0_PROMA/62-129--------------------------------------------------------------------------------
G8AFN1_AZOBR/99-167--------------------------------------------------------------------------------
H7C7L9_BORBU/34-101--------------------------------------------------------------------------------
I6T797_ENTHA/66-137--------------------------------------------------------------------------------
FTSQ_MYCTU/125-192--------------------------------------------------------------------------------
DIVIB_STAA8/195-262--------------------------------------------------------------------------------
Q2YLY9_BRUA2/68-136--------------------------------------------------------------------------------
Q5M4Y0_STRT2/105-175--------------------------------------------------------------------------------
Q5ZSA8_LEGPH/39-107--------------------------------------------------------------------------------
FTSQ_BURPS/37-106--------------------------------------------------------------------------------
Q65JX8_BACLD/54-123--------------------------------------------------------------------------------
DIVIB_BACAN/53-121--------------------------------------------------------------------------------
DIVIB_ENTFA/126-197--------------------------------------------------------------------------------
Q8F8E7_LEPIN/47-113--------------------------------------------------------------------------------
DIVIB_LISMO/51-118--------------------------------------------------------------------------------
Q99YV5_STRP1/126-195--------------------------------------------------------------------------------
Q9PF78_XYLFA/35-103--------------------------------------------------------------------------------
FTSQ_RICPR/73-141--------------------------------------------------------------------------------
S5VEM4_STRC3/60-128--------------------------------------------------------------------------------

PF17243

Q5F5H0_NEIG1/53-127--------------------------------------------------------------------------------
B3PF57_CELJU/28-104--------------------------------------------------------------------------------
E1SF31_PANVC/25-101--------------------------------------------------------------------------------
Q7MYW2_PHOLL/25-100--------------------------------------------------------------------------------
G4E3B1_9GAMM/37-113--------------------------------------------------------------------------------
U2FWP7_9GAMM/36-116--------------------------------------------------------------------------------
E1VG33_9GAMM/24-96--------------------------------------------------------------------------------
A0A089WUQ1_9PSED/27-103--------------------------------------------------------------------------------
D5BUM0_NITHN/26-104--------------------------------------------------------------------------------
F0LSE4_VIBFN/2-73--------------------------------------------------------------------------------
J4UW94_9PAST/75-152--------------------------------------------------------------------------------
I1XJZ2_METNJ/35-114--------------------------------------------------------------------------------
E8RB68_DESPD/51-130--------------------------------------------------------------------------------
Q88IV7_PSEPK/30-106--------------------------------------------------------------------------------
C0B0J8_9GAMM/14-89--------------------------------------------------------------------------------
A0A078L5K0_9CHLA/31-107--------------------------------------------------------------------------------
W0DW72_MARPU/18-99--------------------------------------------------------------------------------
M4WYA6_PSEDE/23-95--------------------------------------------------------------------------------
A0A0N0VJQ7_9PSED/27-99--------------------------------------------------------------------------------
A3N0I9_ACTP2/53-130--------------------------------------------------------------------------------
I3DD68_HAEPH/46-123--------------------------------------------------------------------------------
B0UW15_HISS2/34-110--------------------------------------------------------------------------------
A8H5B9_SHEPA/25-98--------------------------------------------------------------------------------
W0TJZ2_9GAMM/59-138--------------------------------------------------------------------------------
V4IYU2_9DELT/43-121--------------------------------------------------------------------------------
A0A097AV25_9VIBR/23-94--------------------------------------------------------------------------------
G2FFV9_9GAMM/23-101--------------------------------------------------------------------------------
A0A0D8PQX7_9GAMM/25-98--------------------------------------------------------------------------------
H8KZN7_FRAAD/34-111--------------------------------------------------------------------------------
A0A077DGZ1_9BURK/23-96--------------------------------------------------------------------------------
Q8P3I6_XANCP/81-162--------------------------------------------------------------------------------
A0A097QYG2_HAFAL/25-100--------------------------------------------------------------------------------
A0A0B5FPQ4_9DELT/43-123--------------------------------------------------------------------------------
A4A831_9GAMM/27-99--------------------------------------------------------------------------------
Q881Y2_PSESM/26-98--------------------------------------------------------------------------------
F7YKQ1_VIBA7/24-95--------------------------------------------------------------------------------
D8MMC1_ERWBE/17-93--------------------------------------------------------------------------------
E3BGE0_9VIBR/25-94--------------------------------------------------------------------------------
B1KIB2_SHEWM/32-105--------------------------------------------------------------------------------
A0A0F6A239_9GAMM/26-101--------------------------------------------------------------------------------
A0A060BAA3_9GAMM/33-101--------------------------------------------------------------------------------
A0A089YTB8_9PSED/27-99--------------------------------------------------------------------------------
W0LAB6_9GAMM/25-100--------------------------------------------------------------------------------
A0A0F4QH72_9GAMM/40-104--------------------------------------------------------------------------------
Q15Z96_PSEA6/29-105--------------------------------------------------------------------------------
K8WZC7_9GAMM/39-114--------------------------------------------------------------------------------
A7TAA7_NEMVE/26-104--------------------------------------------------------------------------------
F9Q9H7_9PAST/9-84--------------------------------------------------------------------------------
J1EHC7_9BURK/78-159--------------------------------------------------------------------------------
K4KLG1_SIMAS/22-98--------------------------------------------------------------------------------
G7UU66_PSEUP/27-104--------------------------------------------------------------------------------
A4C5K4_9GAMM/25-96--------------------------------------------------------------------------------
H2ISU6_RAHAC/25-100--------------------------------------------------------------------------------
H8GM81_METAL/32-108--------------------------------------------------------------------------------
A0A0F4PJY1_9GAMM/31-102--------------------------------------------------------------------------------
G4E418_9GAMM/42-129--------------------------------------------------------------------------------
Q5ZUJ2_LEGPH/26-94--------------------------------------------------------------------------------
Q3JE50_NITOC/35-113--------------------------------------------------------------------------------
G3IU04_9GAMM/26-102--------------------------------------------------------------------------------
C4K4K7_HAMD5/18-88--------------------------------------------------------------------------------
C5BRL5_TERTT/13-89--------------------------------------------------------------------------------
A0A0N1EM58_9GAMM/26-95--------------------------------------------------------------------------------
A0A0F6A4Z6_9GAMM/28-97--------------------------------------------------------------------------------
R4VJ26_9GAMM/30-104--------------------------------------------------------------------------------
H8Z3L7_9GAMM/45-126--------------------------------------------------------------------------------
TAMA_HAEIN/27-102--------------------------------------------------------------------------------
A1WYH1_HALHL/24-97--------------------------------------------------------------------------------
Q0VRK8_ALCBS/36-113--------------------------------------------------------------------------------
Q5E819_VIBF1/25-98--------------------------------------------------------------------------------
Q7VL30_HAEDU/47-124--------------------------------------------------------------------------------
F9TAI0_9VIBR/25-96--------------------------------------------------------------------------------
G0A4A7_METMM/26-102--------------------------------------------------------------------------------
B8F3L0_HAEPS/24-100--------------------------------------------------------------------------------
I3BWR7_9GAMM/38-115--------------------------------------------------------------------------------
C5BF89_EDWI9/25-100--------------------------------------------------------------------------------
S6AFW0_PSERE/29-101--------------------------------------------------------------------------------
I1DU11_9GAMM/19-91--------------------------------------------------------------------------------
A1AU38_PELPD/53-132--------------------------------------------------------------------------------
A4VLJ6_PSEU5/59-131--------------------------------------------------------------------------------
D7N4I4_9NEIS/66-140--------------------------------------------------------------------------------
A1S617_SHEAM/29-102--------------------------------------------------------------------------------
C4LDD3_TOLAT/34-106--------------------------------------------------------------------------------
A0A0M2VJT9_9GAMM/23-96--------------------------------------------------------------------------------
D3UYW3_XENBS/25-100--------------------------------------------------------------------------------
A0A0F2P3L4_9GAMM/23-107--------------------------------------------------------------------------------
A0A0E3Y7U5_9ENTR/24-103--------------------------------------------------------------------------------
Q084L9_SHEFN/13-86--------------------------------------------------------------------------------
W0BDN3_9GAMM/32-98--------------------------------------------------------------------------------
F7NXK5_9GAMM/22-95--------------------------------------------------------------------------------
C1DLX0_AZOVD/8-80--------------------------------------------------------------------------------
E0WR26_9ENTR/91-165--------------------------------------------------------------------------------
Q65VW8_MANSM/38-113--------------------------------------------------------------------------------
N8TH50_ACIGI/255-325--------------------------------------------------------------------------------
Q7MPD6_VIBVY/25-96--------------------------------------------------------------------------------
K2J2F3_9GAMM/34-104--------------------------------------------------------------------------------
Q9PDZ7_XYLFA/52-133--------------------------------------------------------------------------------
W0VDJ6_9BURK/80-150--------------------------------------------------------------------------------
J3VTA7_9ENTR/27-102--------------------------------------------------------------------------------
Q3IIS7_PSEHT/43-112--------------------------------------------------------------------------------
W8UAH7_YEREN/25-100--------------------------------------------------------------------------------
A3QEZ0_SHELP/53-126--------------------------------------------------------------------------------
Q0ABA0_ALKEH/9-82--------------------------------------------------------------------------------
I3D8U3_9PAST/31-106--------------------------------------------------------------------------------
C9R2Q8_AGGAD/67-143--------------------------------------------------------------------------------
D3HRD5_LEGLN/26-95--------------------------------------------------------------------------------
A4XV24_PSEMY/27-99--------------------------------------------------------------------------------
A0A0F5ASB1_9GAMM/25-95--------------------------------------------------------------------------------
K1KFQ2_9BURK/25-95--------------------------------------------------------------------------------
F4GR00_PUSST/29-103--------------------------------------------------------------------------------
Q1LSN1_BAUCH/27-108--------------------------------------------------------------------------------
I4N4G8_9PSED/27-99--------------------------------------------------------------------------------
A0A0F7K051_9GAMM/40-116--------------------------------------------------------------------------------
A0A090ALX5_9GAMM/33-113--------------------------------------------------------------------------------
A0A0C5VP27_9GAMM/23-96--------------------------------------------------------------------------------
A0A0A7EIJ4_9GAMM/31-102--------------------------------------------------------------------------------
V4L9I2_9GAMM/39-120--------------------------------------------------------------------------------
W8KKG5_HALHR/15-91--------------------------------------------------------------------------------
A0A0F4RB08_9GAMM/35-107--------------------------------------------------------------------------------
A6D4A9_9VIBR/7-78--------------------------------------------------------------------------------
A0A0A7RZ09_9GAMM/25-96--------------------------------------------------------------------------------
F5SWL6_9GAMM/30-108--------------------------------------------------------------------------------
X2H7P2_9GAMM/12-82--------------------------------------------------------------------------------
M4NH26_9GAMM/26-103--------------------------------------------------------------------------------
Q9I0U1_PSEAE/29-101--------------------------------------------------------------------------------
Q12P36_SHEDO/30-103--------------------------------------------------------------------------------
B7S2R2_9GAMM/29-101--------------------------------------------------------------------------------
A0A078KVS5_9GAMM/33-99--------------------------------------------------------------------------------
E1VCV5_HALED/26-98--------------------------------------------------------------------------------
Q6LV64_PHOPR/26-99--------------------------------------------------------------------------------
A4BTF3_9GAMM/22-102--------------------------------------------------------------------------------
Q9KP31_VIBCH/35-106--------------------------------------------------------------------------------
M4R5B2_BIBTR/25-102--------------------------------------------------------------------------------
E6WX89_PSEUU/31-111--------------------------------------------------------------------------------
I3YHA7_THIV6/47-128--------------------------------------------------------------------------------
B8GL28_THISH/24-100--------------------------------------------------------------------------------
I4WC80_9GAMM/30-107--------------------------------------------------------------------------------
B0VM47_ACIBS/241-311--------------------------------------------------------------------------------
A0A0F7M6Y8_9GAMM/32-126--------------------------------------------------------------------------------
K0CID5_ALCDB/39-118--------------------------------------------------------------------------------
Q2LXE7_SYNAS/45-124--------------------------------------------------------------------------------
F4HFI8_GALAU/26-102--------------------------------------------------------------------------------
F9U5H8_9GAMM/65-146--------------------------------------------------------------------------------
W8X5B9_CASDE/43-115--------------------------------------------------------------------------------
M1NGG1_DESSD/41-119--------------------------------------------------------------------------------
E1SNG0_FERBD/142-214--------------------------------------------------------------------------------
K0C4U5_CYCSP/32-110--------------------------------------------------------------------------------
A0A0F2N8M6_9DELT/4-82--------------------------------------------------------------------------------
A1U274_MARHV/32-106--------------------------------------------------------------------------------
B2FP46_STRMK/43-124--------------------------------------------------------------------------------
Q481M1_COLP3/42-113--------------------------------------------------------------------------------
W0I1Y1_9GAMM/27-102--------------------------------------------------------------------------------
R5EJH3_9GAMM/81-157--------------------------------------------------------------------------------
F3KCM4_9GAMM/8-84--------------------------------------------------------------------------------
F5ZG84_ALTNA/45-117--------------------------------------------------------------------------------
I1YE94_METFJ/23-103--------------------------------------------------------------------------------
Q5QXU5_IDILO/24-102--------------------------------------------------------------------------------
G9ZFZ7_9GAMM/52-131--------------------------------------------------------------------------------
A0KIJ0_AERHH/45-117--------------------------------------------------------------------------------
E0SEC4_DICD3/41-116--------------------------------------------------------------------------------
A0A0A3W7U2_9GAMM/233-298--------------------------------------------------------------------------------
Q83EW0_COXBU/33-112--------------------------------------------------------------------------------
H3KF74_9BURK/135-211--------------------------------------------------------------------------------
A0A0F3KYT3_9GAMM/26-103--------------------------------------------------------------------------------
M4U484_9GAMM/45-118--------------------------------------------------------------------------------
A0A0F5EY31_AVIPA/36-112--------------------------------------------------------------------------------
D5WZA8_THIK1/95-170--------------------------------------------------------------------------------
U4K8U4_9VIBR/25-96--------------------------------------------------------------------------------
Q8EF72_SHEON/35-108--------------------------------------------------------------------------------
A6VL94_ACTSZ/58-133--------------------------------------------------------------------------------
B9LYY6_GEODF/30-109--------------------------------------------------------------------------------
A0A0B4XLV3_9GAMM/38-114--------------------------------------------------------------------------------
I3DI46_9PAST/12-87--------------------------------------------------------------------------------
L0GVE6_9GAMM/28-109--------------------------------------------------------------------------------
I4W4N9_9GAMM/26-103--------------------------------------------------------------------------------
C0N1X6_9GAMM/31-109--------------------------------------------------------------------------------
L0DRI3_THIND/19-95--------------------------------------------------------------------------------
K6YZU2_9ALTE/36-112--------------------------------------------------------------------------------
I8TC00_9GAMM/1-78--------------------------------------------------------------------------------
Q6ANA1_DESPS/46-124--------------------------------------------------------------------------------
H0J6T1_9PSED/10-82--------------------------------------------------------------------------------
B7RZ71_9GAMM/20-101--------------------------------------------------------------------------------
Q6F9T5_ACIAD/236-306--------------------------------------------------------------------------------
M9X0F4_MANHA/58-133--------------------------------------------------------------------------------
M1FHL3_9ALTE/33-110--------------------------------------------------------------------------------
D3SD66_THISK/46-123--------------------------------------------------------------------------------
N8ZR61_9GAMM/246-316--------------------------------------------------------------------------------
F9R7U5_VIBSN/25-96--------------------------------------------------------------------------------
A1SW22_PSYIN/24-98--------------------------------------------------------------------------------
N9GN96_ACIHA/239-309--------------------------------------------------------------------------------
C9P280_VIBME/24-95--------------------------------------------------------------------------------
B8KVC4_9GAMM/60-132--------------------------------------------------------------------------------
B5E9K3_GEOBB/44-124--------------------------------------------------------------------------------
W0H9Y5_PSECI/26-98--------------------------------------------------------------------------------
A5EYC6_DICNV/37-117--------------------------------------------------------------------------------
A0A023NUA5_9GAMM/24-101--------------------------------------------------------------------------------
A0A098G5T9_9GAMM/25-94--------------------------------------------------------------------------------
D0Z0D3_PHODD/26-99--------------------------------------------------------------------------------
F6AEQ8_PSEF1/15-87--------------------------------------------------------------------------------
F4R1T0_BREDI/26-101--------------------------------------------------------------------------------
A0A0A1AWH5_9GAMM/25-101--------------------------------------------------------------------------------
G2E3U5_9GAMM/45-126--------------------------------------------------------------------------------
H1G3I7_9GAMM/38-114--------------------------------------------------------------------------------
A0A0F5V817_9GAMM/26-99--------------------------------------------------------------------------------
Q39RU8_GEOMG/46-126--------------------------------------------------------------------------------
A0A0F4NYM5_PSEO7/35-102--------------------------------------------------------------------------------
Q3A843_PELCD/51-130--------------------------------------------------------------------------------
B7VKX1_VIBTL/24-95--------------------------------------------------------------------------------
A0A090K8A0_9GAMM/8-81--------------------------------------------------------------------------------
Q1QWE3_CHRSD/29-101--------------------------------------------------------------------------------
A0A0C5WYE8_9GAMM/26-97--------------------------------------------------------------------------------
A0A077LKB7_9PSED/12-84--------------------------------------------------------------------------------
J3TGA3_9ENTR/28-104--------------------------------------------------------------------------------
V2UTL7_9GAMM/227-297--------------------------------------------------------------------------------
W8RUQ6_PSEST/28-100--------------------------------------------------------------------------------
C6RNI3_ACIRA/259-329--------------------------------------------------------------------------------
A0A024HHG6_PSEKB/30-103--------------------------------------------------------------------------------
A0A098GEG6_TATMI/22-88--------------------------------------------------------------------------------
I2JK10_9GAMM/20-88--------------------------------------------------------------------------------
I4VVY4_9GAMM/24-101--------------------------------------------------------------------------------
D4ZL79_SHEVD/32-105--------------------------------------------------------------------------------
Q9CK26_PASMU/34-110--------------------------------------------------------------------------------
C8ND15_9GAMM/55-134--------------------------------------------------------------------------------
G4T286_META2/54-130--------------------------------------------------------------------------------
I3IFC5_9GAMM/27-103--------------------------------------------------------------------------------
I3CD79_9GAMM/43-124--------------------------------------------------------------------------------
E8UG99_TAYEM/32-105--------------------------------------------------------------------------------
D3RSV5_ALLVD/31-112--------------------------------------------------------------------------------
H2FUT9_OCESG/17-89--------------------------------------------------------------------------------

PF17287

FHAC_BORPE/165-222--------------------------------------------------------------------------------
A0A024HPR4_PSEKB/151-204--------------------------------------------------------------------------------
A0A068QSM5_9GAMM/152-206--------------------------------------------------------------------------------
A0A068QWP1_9GAMM/153-204--------------------------------------------------------------------------------
A0A077DEF9_9BURK/155-215--------------------------------------------------------------------------------
A0A077DEL8_9BURK/159-217--------------------------------------------------------------------------------
A0A077DG26_9BURK/166-226--------------------------------------------------------------------------------
A0A077FF06_9PSED/155-210--------------------------------------------------------------------------------
A0A077LIX7_9PSED/146-201--------------------------------------------------------------------------------
A0A089UNE9_9ENTR/153-207--------------------------------------------------------------------------------
A0A089W4Y4_9ENTR/147-199--------------------------------------------------------------------------------
A0A089WHP9_9PSED/110-165--------------------------------------------------------------------------------
A0A089Y7U6_9PSED/151-204--------------------------------------------------------------------------------
A0A097QNW4_9VIBR/155-207--------------------------------------------------------------------------------
A0A0A1AZE4_9GAMM/149-203--------------------------------------------------------------------------------
A0A0A1AZR9_9GAMM/137-191--------------------------------------------------------------------------------
A0A0A1B1E0_9GAMM/147-197--------------------------------------------------------------------------------
A0A0C4YLT9_9BURK/178-231--------------------------------------------------------------------------------
A0A0D5V6B3_9BURK/190-245--------------------------------------------------------------------------------
A0A0D5VBL5_9BURK/174-227--------------------------------------------------------------------------------
A0A0D5VJY2_9BURK/187-259--------------------------------------------------------------------------------
A0A0F3KZP8_9GAMM/162-215--------------------------------------------------------------------------------
A0A0G3WHT9_9BACT/148-209--------------------------------------------------------------------------------
A0A0K8J9J5_9FIRM/159-212--------------------------------------------------------------------------------
A0A0L0GTD6_9ENTR/141-193--------------------------------------------------------------------------------
A0A0N0GNX9_9NEIS/169-224--------------------------------------------------------------------------------
A0A0N0VK45_9PSED/154-209--------------------------------------------------------------------------------
A0A0N0XI56_9NEIS/174-242--------------------------------------------------------------------------------
A4ELV7_9RHOB/88-141--------------------------------------------------------------------------------
A4W4W2_ENT38/162-214--------------------------------------------------------------------------------
A6T6A6_KLEP7/149-202--------------------------------------------------------------------------------
A7I3H8_CAMHC/146-203--------------------------------------------------------------------------------
A7MPM4_CROS8/152-206--------------------------------------------------------------------------------
A8ETC5_ARCB4/143-192--------------------------------------------------------------------------------
A8GK57_SERP5/151-203--------------------------------------------------------------------------------
A8GL33_SERP5/148-202--------------------------------------------------------------------------------
A9BSR0_DELAS/158-217--------------------------------------------------------------------------------
A9I252_BORPD/159-211--------------------------------------------------------------------------------
IBPB_HISS2/173-229--------------------------------------------------------------------------------
B2FLM0_STRMK/159-213--------------------------------------------------------------------------------
B2FUC7_STRMK/181-235--------------------------------------------------------------------------------
B2JV22_PARP8/174-227--------------------------------------------------------------------------------
B2JXG1_PARP8/187-256--------------------------------------------------------------------------------
B2UCG2_RALPJ/151-205--------------------------------------------------------------------------------
B4EST2_PROMH/115-167--------------------------------------------------------------------------------
B4F0Z8_PROMH/151-202--------------------------------------------------------------------------------
B9JE38_AGRRK/160-215--------------------------------------------------------------------------------
B9NWW3_9RHOB/159-213--------------------------------------------------------------------------------
C0AU17_9GAMM/159-213--------------------------------------------------------------------------------
C0AWE4_9GAMM/75-126--------------------------------------------------------------------------------
C0B146_9GAMM/156-210--------------------------------------------------------------------------------
C0N7I3_9GAMM/155-211--------------------------------------------------------------------------------
C3KAG1_PSEFS/153-208--------------------------------------------------------------------------------
C4GNC2_9NEIS/182-241--------------------------------------------------------------------------------
C5AEA8_BURGB/199-252--------------------------------------------------------------------------------
C5B941_EDWI9/171-225--------------------------------------------------------------------------------
C5BAK3_EDWI9/164-218--------------------------------------------------------------------------------
C5BBG6_EDWI9/155-206--------------------------------------------------------------------------------
C6JLC2_FUSVA/140-194--------------------------------------------------------------------------------
C6JMM4_FUSVA/140-195--------------------------------------------------------------------------------
C7LTZ9_DESBD/162-218--------------------------------------------------------------------------------
C8NAG2_9GAMM/162-214--------------------------------------------------------------------------------
C8NB14_9GAMM/167-223--------------------------------------------------------------------------------
C9LS33_SELS3/149-202--------------------------------------------------------------------------------
D0GKG4_9FUSO/102-157--------------------------------------------------------------------------------
D0IXU8_COMT2/175-229--------------------------------------------------------------------------------
D1BMQ4_VEIPT/212-265--------------------------------------------------------------------------------
D1BNY4_VEIPT/156-209--------------------------------------------------------------------------------
D2RM30_ACIFV/149-203--------------------------------------------------------------------------------
D2TSU8_CITRI/142-196--------------------------------------------------------------------------------
D3V2Y6_XENBS/38-92--------------------------------------------------------------------------------
D3VA35_XENNA/161-213--------------------------------------------------------------------------------
D4GL27_PANAM/168-220--------------------------------------------------------------------------------
D4S825_9FIRM/155-208--------------------------------------------------------------------------------
D5V606_ARCNC/143-192--------------------------------------------------------------------------------
D8INY9_HERSS/172-225--------------------------------------------------------------------------------
D8J1G4_HERSS/166-220--------------------------------------------------------------------------------
D8MR72_ERWBE/151-205--------------------------------------------------------------------------------
D8MSB0_ERWBE/148-200--------------------------------------------------------------------------------
CDIB_DICD3/152-204--------------------------------------------------------------------------------
E1SHC2_PANVC/149-201--------------------------------------------------------------------------------
E1SI81_PANVC/161-215--------------------------------------------------------------------------------
E1SJQ8_PANVC/157-211--------------------------------------------------------------------------------
E2CR53_9RHOB/145-199--------------------------------------------------------------------------------
E3BH39_9VIBR/168-219--------------------------------------------------------------------------------
E5AMD0_PARRH/229-282--------------------------------------------------------------------------------
E5UJT7_NEIMU/157-208--------------------------------------------------------------------------------

PF06898

F6B8F3_DESCC/8-408SFLLGYVALVVRGDSLEKFVNMAASRGIFLWDITRLGQDKVKVRVRIPEVHSLRHIARATGSRFNITERRGLPFVFNRLK
D4JTF7_9FIRM/10-387..FAAYITIKGLGGFQEKFISELITNDIQIYEICQDKDG.FTAVIKPYSYLKTARIARKHGIRLNVTERQGFIFRLLPLR
R5L248_9CLOT/7-384NWFFGYVVFTFSGGFTDGFINRCYHEKINIKDISAENGV.LTARCSIGAYKRLHKIAFRSGGKVKLVKKRGLPFLLHPLK
R7QWQ5_9FIRM/7-391KFFRGFVCVRLSGYAPERFLNLCGNRDIVIWNLERDGDD.YEFYISVQAFRTLRPIAKKTRTKLVVKKRFGFPFWLHRYR
L0FBK0_DESDL/7-397AFLQGRVFFVARGKELARFMNESIRQGIVFYRTQRSERG.LRAQIRIQDFARLKGPARLTHTRVHIIAKYGWPFIAARWW
R6I0K6_9FIRM/6-384DLARGVTKIEASGAQPERILNYCAENGIEFWSASPCRDFSITFCVHASYADSLLARSGKNGLDVKLISETGGRKLKLGAK
L0EFM5_THECK/10-388HAVRGCVTVRIAGSGTERLLSDAAGDGIELLALRRTSPGEIECIVTVGDFFRLRPHLRRTGCRLRIVGKRGLPFQLARIG
U5MNL2_CLOSA/5-371RIKSGQITIEVSALMPEKILNVLWNNGIYTCKVVKINLTTIRFNIAFEDYNETEMLIKKQKLKMKVIGKSGMIVLLLNLK
R6SYS4_9FIRM/4-378....GYIDYVITGDSFTKFFRRIMSKKLPVSKMCEKNGK.LTLRMPAEHCKALERLCDELGLEYTATKRHGSFVLAKRFF
R7F0N3_9BACI/3-369....SRYRVRISGRNPEYFLRKLLSNQISF.KLLRMGRREFEILVCETDYQKLKKI..RTSYKVELVGYTGFLALYHLLL
R7P4H2_9CLOT/3-367....NKIWIKTKCNNYYKLISKIDNLNITVYDSRYSDY..IYLYVTYKDYLTLKKY..LVSYKFSIYKLTGINKLKDILK
Q0AWN4_SYNWW/7-394NQLAGIIKVNLRGERPERIINLALSRGIHIWDIKKTDDG.MHMKVKISGFEALENICEENNYSLEIVKKEGVPFLKGILT
I0JP38_HALH3/8-385DFFQGSMKIKVQGKMIEPFLQACVRRGCVISNIKRVNEHEVIMSIRLSEWKTFRQLRKKYRCKLSILGGRGLPFYYRKIT
R7H622_9FIRM/5-371..VHGKIDLEAKGGKLYGFINALRKHGVLCQNQRCCGDV.FYCRTETREKQLLEELAKQYHVTLQLHERKTLRFWLVRNR
B2A1M5_NATTJ/8-399YYIIGYLEVTVLGIAVEKFLNLALQENILIWDVKKYPRG.LKVKIGVKDFAKVRKVVKNSGCRVKIVRKRGLPFYVKKLK
A5N6N1_CLOK5/11-376HYRKGIVLIEIQSLIPEKFINLMWKNNIYIKNIKKKSITTMTMEINLKDYYNIKNIAQKTGTKIKIIKRRGILFLIIKLK
C8W3N7_DESAS/8-411SFLIGHVSLVVRGESLEKFINMAVSRGIYLWDITRLEGDRVRVKVRLSAINPLRHIARQTGSRFYFQERAGMPFLAARLK
R6MSI1_9FIRM/8-382.WSKGYVDFSASGKFPERFINLTTRNGINVWNLKPTEKG.LTATMQVYDYKNIRSIAYKSKLKMCVTGRHGLPFYAQRYR
B8CXJ2_HALOH/7-376NFIQGYLLIEITGNALERFINQIIEKEIILWDVKRENKSRYLAKIDIKNFNKLRPLVRKRMCRVRIMDKCGLPFLITRAK
W6RVC1_9CLOT/10-376LFYEARLTLKIEVIELEELINNLIKSDIDIDSITRVSISSAILSIQYKDFELFKEIFEKYDGTYKVIGKDKRSTTIYILK
D4LTE1_9FIRM/6-388GFRKGAVRIRVQGEQTERFLNLCKAREIKISKLIRTGEQSLEGNMLIADFFRLSPIRRKTGVKIHILEKHGLPFFFYRSK
K0B1J4_CLOA9/8-387NYLKGYVIIKVEGLTLEKFINLSISKNIFLWDIERIDYTTLEAKVSTAGFRELKDVVKAVDCRVSIEGKRGFPFFIYKFK
R5NSB5_9CLOT/8-384SFLAGYVEITAEGYYIERFMNECTRNGILLWGIERKQSTILEAKTSIQEFKTLCNLAKKNNCKIKIKRKEGIPFLIKKYR
R5HMY8_9FIRM/8-391..LFGTVTARITGAQPEDFLNLCARENLVLWRMVQRDLFTLEVQVTARQYARLCQLAQGAQCGVELEKRQGLPYFFLRFR
C0ZB79_BREBN/7-385EWVDGHVTITVRGKRFERMLNMAVRDGIRIWNIRRVGEEVTRCDILIRDYFRLRPLLKETGCRSHVEARDGLPFWLLRIR
R6XDX7_9CLOT/8-386NYILGYVNILVEGYFVEKFINICNKQKIFLWNLKRSKTTIIYANVSIKDFKKLKPIAQKTKCKIKIKSKKGLPFIFNKYK
A8MG63_ALKOO/8-387NYMRGYVNIRIEGLALERFINLCIAKGIYLWDIQRINHTALEGKVSIKGFKELRGIVKKAGCRVSIKRKNGYPFWIHKLK
J7J0E9_DESMD/7-385TFWYGRILFLARGEHLAHFVNQVSKEGIILYHTQKSERG.MRAQIKLADFRRLRRPARRTHTRVHIVAKYGWPFVAARWW
B8I730_CLOCE/8-390NYIIGYVIIIVEGYFLEKFINICTHRQIKLWNVKWNSSSKLTMKISINDFRKLRPVAKKSRCRVHISKKKGLPFLIYKYK
Q97JI9_CLOAB/7-373SFKNTYVVVEVRTANIEKFINLLWRNKIEVMSMIRVNANLIRFKVALKNYRKTIKLVKAVKGKIKVIERHGTGFLFFRIR
R5T3J2_9CLOT/7-380NKIDSIISIKITGKNVYNFINKIIKNKINIYNLDIINRKEAIVKIKYKDYLKLKKM..HTIYHFNIYSYHGKLKIRNYIK
R6C1Q2_9CLOT/6-386RYLKGYVLIKVWGFAPERFFNLCAGKNILLWNIRKEADA.YYMCISLSGFKSLRKIAKKTKTRVVIKKRFGLPFLMPGLL
K4LIU5_9FIRM/7-395RYLHGRVTIQAQGKNLAGFINEALKDRIEFYNGKKLTDS.FLAEINAADFRRLRKAAKKAGIKINIRNRYGFPFVALRWQ
R6UCV3_9CLOT/10-387..MTGIITVQIEGFFTERFINLCRINNIKIWEIRNIVKGVIRFKMNIADFKKLRSITKKTKCKVSIKEKKGLYFTLFKYR
R6N4A7_9CLOT/7-383RWMAGYVLFIGMGGYPEKFMNLAARANITLWQVKNSKGS.FQARVAKSQYRELRRPAKKAGMRLRVKKRKGFPFFMRRYR
I3VX08_THESW/8-382NFLYGYAIIRIEGLSIERFLNIVISKNIYVWDVERTNHTTIVAKISLKGFKLLLPYTKMTNCRVYIVEKRGLPFIVFYLK
B0TAE5_HELMI/7-400SFWIGFLGIRIEGSQLEKFINMAASRGIPLYDLRREPSGRISAKVRMDGFRSLRHVARKSGSRMRIESRYGLPFYASSLK
R5TPA1_9CLOT/8-390HRISGYLFVEMTGFSPERFFNMCSVHEIEIWGVSDTGRS.CRFYMTVKGFKKIKPIVRKSKVRLKVLGKFGLPFFLHRNR
R5QI90_9FIRM/5-375RYMRGYCRVKVREEKAAALLSLLMERKISFTPTKKAGDGLISFYTPYRFPEETEPLCED.......IHRRSFLSDLYRYR
R5KWN8_9CLOT/12-386....GIATVQIEGFFTERFINLCRINNIKIWNIKNIVKGVVRFNINIYDFKKIRKIAQKTKCKVFVKNKKGLYFKFFKYR
N0B454_9BACI/7-385EFYSGIVSVKITGKGIERFINKLIRSGISVWNVKRHGAETVILFMKLNDVKKLRLAARNSGCSISFQQRIGFPFLFKQLL
F8I923_SULAT/7-394RIIGGWVEVRLTGAQIEKVVSLLALNGFRIWRVRRQGES.ISCLIGLSVVEWLDEVTVEHGVSYEIVRQGGLPIRWSELK
D3E517_GEOS4/9-385..LRGYLKLAVRGEHVEAFINSLAEAGTPVWDVTPTGAHSAEFKLLLKDFKGLRPLLKRTGCRTRIKERFGYPFQARRLF
R6H3U2_9CLOT/8-388NYLIGYVRISIEGYYIERFINICRNHKITIWNLKRDKNVKLELNVGIHDVKEISKIVKQTKCKMKINKKKGLPFLFNKYR
R7F7B5_9CLOT/8-387GYLNGFVTIHVEGYFIERFINMCRLQKIYLWNIEKKNDIYLTVNIGIKDFKKIRKIAKKTKCKVGIDRKKGVPFFLHKYK
R7M7L8_9CLOT/8-385NYILGYVTIEIEGYFTERFINICNNQKIFLWNMKRKCSTIVQINIGISDFKKIKRIAKKTKCRVKIQGKKGIPFILYKYK
R6TJX8_9FIRM/7-385NRIQGQVRLRVEAPFPERVLNLCGARNLSFWDVAWDSDKAFTCRMSRRDSRTLRRAVQEMDCTVTVVGREGAPYFLLRFR
Q67S30_SYMTH/7-404RYLLGTLRIEVTGGDIERFLNGCLEEGILLWDLRRTPER.LHATMMLADFFQLRPVARAGRCRVRIRARHGLPFLTRRLR
R5F5D4_9CLOT/9-390..WEGYVRLRLHGYSPERFLNLCNARGLEVWGLICNRDGDYEFFMTVEGYRRVKPLVRKAQVRLHITGRFGLPFFIYRHR
R5Q8Y0_9CLOT/8-386KNLIGYVNIKIEGYFVEKFINKCINNKIFFWNIKREKSTIIYTNVGINEFKKIRKIAKETKCKIEILDKKGLPFILHRYK
R6M0R0_9CLOT/7-380RIFSSNIKIRVSGRNINNFIKRIIKNNIKIVKLTPRSHKEIDLIIDYNDLEEIEKY..KTIYDIKIVRYYGKLHIIKFLK
R5YC97_9FIRM/7-392RFVKGWLKIELYGKDVTRFLNLCSKHGIDFWDLACIDSEHVSCCISLGSIYNLRPFLRKTKVRMRIILRKGMPFLMFRYR
Q8RB55_CALS4/13-387NFLRGYVIIKVEGLAIEKFLNLVMVNEVYIWDVERKNYTTLTAKVSTKAFKEVLQYAKKTGCSVFIVSKNGLPFVIFRLR
F4LSY6_TEPAE/8-387NYLSGYVIIKIVGEYGERLLNQAAMKNLYLWDVKRINDNELTAKINVRNFFKLARLAKKSRSRIYVLQRVGLFFTISKLK
R6LHZ6_9FIRM/6-383FFLAGWCRIRITGASPQWILSALATRRVAFREFRKTDDFTAELRILKRDLPAAYAAAQRSMCDLELMQCGGFAATFAWVK
A4XKI6_CALS8/4-376....NQLILKVEGENLNKFLNMLVFNKVLL.DIREKGQNSLVIVVYLADFKKVVNIVKRTNSRIHILEKRGIYFLIREIT
R5T032_9CLOT/3-372...RSIYEVKIEGKDIRRFIQKLYRCNIYFEDIDIYDRV.AYVKLTSENYKKLLDV..KTIYQIKLIRLKGFAKFVDVIK
R5B397_9CLOT/7-382HYLSGYVIIDIKGKNLERFLNRVVQSGGDIWHVRRTGSESVRACVSVATFYALRPIVRQCGVRISIAAKRGAVVSLSRFR
R7DBV9_9FIRM/6-388GFRNGYVRVRIYGEQTERFLNLCRAHEIRISDLRRESELSLTGCLQIRDFFRLAPIHRKTKVKIHILEKHGLPFFFYRSK
R7FM48_9CLOT/8-386NYIIGYIRISIEGYYIERFINICGNEKITIWNLKRNKNVKLELNIGIKNLKKVAKIAKQTKCKMKIIKKKGLPFLFNRYR
B1I691_DESAP/9-398.YLFGYVTMVVNGRTLERFINLATRRGIYFWDIRRLDEDRILIKARLSGVKPLRHIARDTGSRFRIERRFGLPFFLGRAR
R7IV24_9CLOT/8-386KYILGYVRITVEGYYIERFINICTTSKILIWNLKREKGVRLYLNIGIKDFFEAVKIAKKLKCKVKITQKRGIPFLVHKYK
C9RAM9_AMMDK/7-391RYLRGYVLLKLEGKKIERFLNMALTRGIKFWDVRYLGKDRVLLRVRWGAVRALRHISRLTSTRLTIQEKMGLPFLIGRLK
R5XPL9_9CLOT/8-386NYILGYVNILVEGFFTERFINTCINKNIFLFNIKRDKSTIIYANVGIFDFKNVVKIAKQSKCRVKIQRKSGLPFLFNRYK
A6LRP5_CLOB8/4-370SLKSGQVTIEINALVPEKILNAFWNSQIYTCNIVKVSLTTVRVTIYYRDYKDAEILIKKYKGKVKIVRTSGIIVLLMKMR
Q892R7_CLOTE/11-377KFRKSNITLEIQSLIPEKIINLAWQSGIEIKNIERKNITTLKLTINLKDYKKLEKIAKKTQCKFKIVERTGIGFLILKLR
R7HMN6_9FIRM/7-380KIFSSSIKIKVTGRNINNFLKRLINNNINIEKVIPISHKEIDLIINYQDLDKVLKL..KTIYNIKIVRYYGKLRIIKRIK
E6U532_ETHHY/8-382QYMLGYVRFRAEGGSPERFLNLVARNGIMLWHIRSKDGV.LYAATLARHFPRLHPLALEAGVTLTREAQKGAPFQARRFS
D9R1A2_CLOSW/7-388HYFFGYLFIEMTGFSPERFLNMCSVHDIELWKVINSGHS.YQLFMSVQGFRKVKPLVRKTKVRLKILKKFGLPFFLHRNK
R7L9N0_9CLOT/9-386.YIFGYLEIKVEGYFIEKFINNCLKSNIFLWNIKRKRTTIMTCNIGVKDFKNIRKILKQTKCRIKIEKKKGLPFTFNKYR
A5D3V9_PELTS/9-406.YLLGHLVILVTGETPEKFVNMAASRGICLWDITRVKDGALLMKVRLSSVRALRHIARRTRCRFRICRRMGLPFYYSRLR
E3E8L2_PAEPS/9-385..LRGTVTLAVEGESVEAFINLLTDHHIPVWNVRPIGTRHAEMNLLLPHVFLLRPLLRRTGCKMHVLKRQGLPFTAVRLA
R7I713_9CLOT/7-390RWCRGYVLVELRGAAQERFFNLCRRHNIYLWNIYTVADQ.YFCCMDLSDFRVIKKIARKAKVRPWIVKRIGLPFCIYRMG
E6TW41_BACCJ/7-385HKISGYVRIKISGPYPELFINRCIDNGINIWDIHSVGKEVLVCSVLLDETPKLRRMARLSDCKIKFIQRKGFPFLWAKLW
X4ZFY3_9BACL/8-384.WLRGAVELHITGDRTEGFINAVTEAGIVIWNVKATGKG.VSLRLLLDDFYALRPLLKQTGCRMHITGRIGLPFVAARLW
R5CSR2_9FIRM/6-384DLARGTVRLEISGAEPERILNFCAQNGIEFWDTDPKADFAMQITIHAADYPLVQSQNGKNGIELRLVAAKGGKNITASMK
E6UAB1_RUMA7/4-383....GSIDYMIRDVDYARLLNRLTKEKMIYSDLHEENGC.LKITISFEHSFRFEKMCHLEGYKPCKTAIHGMLRFYKSLY
R5D9M1_9FIRM/7-386HFLQGQVLVRIECGCPERMLNLCGARGIPFWELTWESPVCLTLRAVGRDLPRLRQAAEDAGGSLHLCRSGGVPVFWRRLR
Q8EPX5_OCEIH/7-397KRIRGYVTVRVSGEKPELFFQKCANEGILVWDAKKISSKDCVAKLKLQDIKKLKQLRRRTLYKISFEERKGLPFGFARFL
R5IHX3_9FIRM/8-382..FLGVSRLSITGASPEWCMQRLAKARIAFHFCAKPDDFTAEVWILRRDEARAAQLVRMGGCDCAVIERGGFSTVFGGLR
Q24SU1_DESHY/7-393EFLQGRVLFVARGNQLPRFINEGIRQGIVFYKTQRSEKG.VRAQVKIQDFRRLKRPARLTHTRVRIVAKYGWPFVAARWW
Q9KD59_BACHD/9-387QLVRGYVRVQIDGVYGERFLNRCIQKNVAIWSIKRMGAERIVCFMDMQDAKKIRPLVKQTECKVTFVERLGYPAFVKKAM
R5XQE7_9CLOT/3-370NYIRGYYVLIVEGIDAEKYLNFICKSRISIYNVKRISNTKIEFCVNRGDLKKIKNTYRGSKFEIKIKQKTGIPFLAKRIY
Q3AEZ9_CARHZ/5-371..LFGEIHFKFQGSEVERFLNLAFSRQVDLREVKYTRDG.LTFKTSLKNFRQVKTIGKKVGGKTKVIAKEGAWFWWKKVL
F6CMU5_DESK7/8-406NFIIGYITITIRGEASEKFINMAAARGIFLWDIARPGEQTMRANVRLNAVRPLRHIARRTRCRFHITRRVGLPFLWMRLA
F2JQA7_CELLD/7-387HYLKGYVIVEVSGYMIEKFLNLALHHHIPMWDVVQKENK.VCFKTPIEAFKCMKPDLKKAHCRAKIVGKKGFPFIAHRYK
U5LCI4_9BACI/7-385AFYSGIITVKAAGSGIERLINSLTRNGIMVWQVKRHGEQAVTFKIKLTDVKRLRASVRKSGCRIEFLHRAGLPFLLKRSL
A8FFB9_BACP2/7-386AYFIGRVEVEIKGNGIERLINECTRQEITMFQVIRRKDS.VRLFIRLSDVHAFRKVQRHHEVTCSFHQKKGFPFLLLWSR
L7VHP9_CLOSH/8-388HYLKGYVIIIVSGLSVEKFINICTRRQILLWDIERLSPTEVIMKMSIRGFKNARSAARKSRCRVRIKAKKGLPYIIWRYK
R6D0A8_9CLOT/8-382RFIRGSVTFEVKGKFAERFFNLLGRNGIPVFSVSPTKDG.FYATTTVKKYFKIRPFVRKTHVRVHVVKRQGLPFLMKRYS
Q65H67_BACLD/7-386SFFSGKIQLKITGKGIERLLNECTRRNIPMFNVKKKKDA.VFLYIPLSDVHAFRKVIRGFDCKCRFIKRKGFPFLVQKSK
D9QV99_ACEAZ/7-405CLIRGYVIVQISGYGKEKLINFLMRSDFRVWNVKHKKDH.FEAKLKMKDFKQIRPYVRRADCKVRIKSKHGLPYWLRKLK
C8WY36_ALIAD/8-383WFLKGSATLWVTGPGARQLVARLQRQGVVVRDVRFTADG.VMLRVSVAALRHLMASRRAYGVRFRVVERHGAPFLGRRLV
Q2RKW7_MOOTA/8-408AYLTGYLVLTISGDDPEAFLNLALARGLTLLDVTRTGKGQILVKMPVSEYRLLRPLARESHCRVRIVDKRGLPFFSRRLR
YQFD_BACSU/7-386SFFSGKVQLELTGRGIERLLNECTRQGIPVFHVKKKKEA.VSLYIQLQDVHAFRRVRSKFKCKARFINRKGFPFLLLKSK
Q5KX07_GEOKA/7-385DTLAGSVRVKARGKGIERLINACVRQGIAVWNVKKHSADTATFFIKLSDVKRLRHVARQSECKLSFVGRTGLPFFWRQAW
R6XTI8_9CLOT/8-386NYILGYVNIKVEGFFIERFINICISKKILLWNMKREKSTILYANIGIQDYKKLKNIAKKTKTRISIQSKKGMPFLLHRYR
R6NIT4_9CLOT/8-386SYVLGYLKLSVEGYYIERFINICKNNKITIWNLKRNKEIELYLNVRISEFKKICEIAKKTKCKIKIKNKKGIPFLLHKYK
R6G2U3_9CLOT/4-369.IKKGKIKVEILVKDIEKILNILWLQNIPASKVKKVNITTLRLEIDYMDYERVCEIVRSVGGKVRVLEGKGPIFLLGNMK
R6QWU5_9CLOT/7-381RWFSGYAKFTAKGKFPERLLNMTMKNGVQLWGMRSDSSS.LAAYVAAREYKLLRPFAKRCELTLKCTKKGGLPFIISQYK
F4A357_MAHA5/8-386HYIFGYVIIRVEGMSLEKFINLCLQRGIHLWDVRRQSYSVLKARISIKGLKQLISISYITHCRIEVLSKRGLPFLFSRLK
R5ITB3_9CLOT/7-378NKLDKIIVVNIKSRNIDRLLKNIYNLNISIYNLVRINYKEINITIKENDLDKIRNL..SVLNEVSVIDYKGKMKAINKMK
R7IQG8_9FIRM/7-393SYLLGAVRIRIVGENKERFVNLCRNSDIYIWDIRNGTE..CTLCITKEDFFKLKPIIRKTFVRIKIMEKYGLPFLVYRYR
F6DMW5_DESRL/8-408SLLTGYVSLMVQGESLEKFVNMAAGRGIFLWDIVRLNNHAIQAKVRISEVRPLRHIAKTTGSRFKIVERRGLPFFSHRLR
R7L3Q3_9FIRM/6-381IRSRTYFEISSDSGDYNKFVNALRCSPVQFFGLEIRKNV.ISGYVRTKDMKRLCSLAEAYRLDVTQSREHGAAVVLKKYK
K0J274_AMPXN/9-396..FKGYVTIKVMGHYPERFFDLCARRNIPVWSIRKQSELECLADVYVDDIHKLRKIRRQTHYKLSFVRKKGMPFFIKRLK
I4DAP4_DESAJ/7-400AFWQGRVYFVARGEQLPRFLNYILQEGVVLYQTQRSERG.MRAQLKLNDFYRLKRAARLTHTRVHIIAKYGWPFVAARWW
D7CNW5_SYNLT/8-391NFLGGFLTVAVKGKYPEKLMNLALARGIFLWDVKRTPEG.ICFRIRNSAYQALQNLTEEHGFELEVINTEGFPFYRQVLQ
R5Y9N3_9FIRM/7-382NLLLGFVDFTFSGGFADGFINDCYNQKINVKNIVRRGDN.IEASCGAAAYKRLHSAAVKNGGRLKIVKKHGLPFLLRPFR
R4KCE0_9FIRM/7-406NYLDGYVTITLPEECLEKFVNMATTRGIYLWGITNAAGNQVALNARLRDVQPLRHVARMTRCRFHIINRSGLPFFIGKLR
R6YI22_9CLOT/2-369...NSYLIIKVEGKIIEKFILRCKKNNINLLKIERISNKEIIIKINSKDYENLNKI..KSIYTLTIINNEGYLKFKEELN
G8M1A5_CLOCD/7-388NYVKGYVIIFVEGYFLEKFVNICTRRQIFLWDIKKRKNSSMSMKVSIKGFKMLRPIAKKTGCRVKIIGRRGVPFVLYRYK
K4LKI1_THEPS/8-398AYLLGYLILVIKGEHPERLINLAYTRGVHLWDLCWIDAGTLTAKVYASSFRTLRHIAKKAGCRLRIRRKRGLPFLLFRLR
G4KWF7_OSCVS/7-385NRLRGQVHLRVESAFPERILNLCAQRKLELRDVRWKSATVFSCVLTRRDFRLLRLLTRKLDCTLHVEKQEGAPFLVGKLR
R6NSX8_9FIRM/7-390KFLYGYVIIKVYGKGAERFINICLRRNIDVWNIKPFDDG.IEMCIYIKDFFHIRQVRKKSNVKIKISQRRGIKHLMRLYR
R6RMK3_9CLOT/7-391LFFKGGVQAEITGLGRERFFNIAARRELFVTGIGTDRDGHVLFWTTGEDYKKMKPAARKAGVRLFLRKKYGLPFFLFRNR
A3DEC5_CLOTH/8-389NYIRGYVIIFVEGYFLEKFVNICTRRQILLWDIQRDRNSKMTLKVSIRGFKMLKPVAKKTGCRVKILEKRGLPFLLNRYR
R6GJ09_9CLOT/6-381RFLWGYVIFTASGAFPERFINLSAKAGVSLFNIKRQGAV.LYCSTMASEYKALRRISKKSGIKIKIKEKHGFPFFVRKYK
D9S2Q3_THEOJ/8-389NCLRGYVIIKIVGPYGERLINQAALHGLYLWDIKRIDEDVLLAKISVHGFFELRPLARKTRCRIYVLQRCGLFFSLYRLK
D4LCN8_RUMC1/4-373....ARVSIRVEGANLSGFMQGLRENGVICADQRCREGA.FSAALPAGHLKKARLLAQEHKVQLTVTERRGLRFSFYRIK
C5D4T1_GEOSW/7-385NLLVGSVRVKAQGKGVERLINACVRNDIAIWNVKKHGDHIATFFILLKDVRRLRVVARKSDCKLYFVGKAGFPFFLKKML
W0EAS0_9FIRM/7-398PFYHGRVIFAARGDQLARFVNEGIRDGVVFYKTQKSERG.LKAQVSIEDFKKLRHAARHTHTRIHILAKYGWPFIALRWW
F9VJJ5_ARTSS/9-374.FINGKIQLRIISKNSEQLLNTIWKREIKVTDVIRENLYSMCLMINSENFKEIKKICDETNSEVSVIKMGKLIKFIYNLK
A0Q1Q5_CLONN/8-374KYKKGTITLEIQTFRPERFINLLWKNGINVKNLRRKTITTLIFEVGLKDYNKIRDIAKRTDTKIKILGRSGVSFLLIKSK
F0SVD9_SYNGF/7-392RYGKGIVYIQISGDKFTDFINKARQDQIVFYNTRITNEK.IFAEVGINDFYRLRRSARNTGIKIRIRTRYGFPFVAARWL
D9SW54_CLOC7/9-375KARSGNLKLRVTVVNPQRLLNLLLNKNIPLKNVQYVDRYTIYITINSIDYEDFKEHAKRVNAKHIIVDGDSTFKILKRLK
G2TNK7_BACCO/7-385TFLQGSVAVKIEGKGIERFINQLTRAGLAVWNVRRQGTMAVTFELRLSDIHQLRKAVRGQDLHVRFLRGRGVPFLWKRTL
Q8XIU3_CLOPE/5-374FLKKGQVKVEIKTFDINKLLNVLWRNGINVENVRKIDVVTLTLNVDYSDYGKLKTYVKRLNGKVKIISSKGMIFFLSRAK
R5HCW7_9MOLU/9-376..FKNKLKIKVKGKNIERFIKRLVTNNIELLKIDYIKYNEVDIIIYKSDYNKILDL..KTIYEVTIVDIYGIIKLQKKLK
R7MJV7_9FIRM/5-378..INEYIKFSAKGKNLYKFINGIHTARIYCFNQYCKSEV.FYGEVYKKNLPLIEQLAQKHGISLEIFEYDTLVSKLKKYR
R5AEU1_9CLOT/3-374....ACVIIEITGKRAERLLDRMRADGIAVYAVRRAARETLELTMPAREFSRLHVLARGSGCRIRIAEKRGESFRIRRLL
R5JAK2_9FIRM/6-375...ISKISLNIKGKNINRFIKKLRTKRIEILSLKYKNPNEADIIIYKKDYETVLKI..KSIYDVTELDVFGLIKIKRKIK
R5JWC6_9CLOT/7-386.WLKGYLQVYVSGNRPERFLSLMKHKEILVWEVEPYENG.YLFFMEQSKFRELDAIRKKAGCKLEIRQKHGLPFWMFRYR
L0KBA1_HALHC/7-398DLLRGYLQLKITGNQFNKLVNLLMLQGVELWNIVRIEDT.FYANINFKDFNRIRSSVRKTDCKVTIYQRKGFPFWIDKLM
R5X7Q5_9FIRM/6-388CFLNGYVEVLICGGQTERFFNLCMARGIVVRNLRQNKDKSFTCIFSVSHFFLLGPIRRKTKVRIHILEKQGLPFWVEKGV
R7NE92_9MOLU/3-369....RYLLVRIKTTKKTNCLLKLNRLNVDIKEIQYESEY.LKFQMLEQDLKKVKKY..LVSYEIEIIDETGIYKLKKELK
D3FY22_BACPE/7-385QAWKGYVRVRVDGAYPERFLNRCIEERLSIWKIKRVGDERIVFYMDIEDAKKIRPLLRKTDCKVTFAERKGTPAVLRKVS
Q5WHE5_BACSK/7-385KSFIGSVTVEVAGQYPERLLNACLKNNIHVWNVRHGGNDNIQFDVALNDIAKIRVLFRHSGCKTTFTKRSGLPFFMKKVK
B2TM04_CLOBB/5-371KLKIGKIKIEVNSLIPEKILNILWQRGINVTKIVKLNITTVRFEIPFDSYKEVEDIVKKTKGKVRIVGKSGIIVLLLSIK
A6TSK6_ALKMQ/8-387NYFRGYVIIKVEGLSLEKFINLCIVREIYLWDIKRTNYTTVEMKVGIKAFKELRKIVRRTGCRVSIIEKSGYPFVAHQLK
G7MCG1_9CLOT/5-371SLKSGMITIEVNALMPEKMLNLLWNNEIYTCNIIKVNLTTIRFTIYFKDYKEAEMLIKKHKGKVKTVRASGIIVLLMKMK
Q182D1_PEPD6/3-370SFIRGYYVIVVEGVGLEQFLNHLIRNGISVYNVTRIKNTKMEFHIDRQDIKDFKNVYRGSKFDIKVKQKTGVPFIIKRVY
B7GKD9_ANOFW/7-385YRMSGNLRIRIVGKGLERLLNEFTRRGIYVWNVRREGEHSLTCYMLLRDIRHVRVAMRKSGCKLYVLERRGAPFWLKASW
R6CV47_9CLOT/2-371...NSYVNISIVGKNPKLFIKRYVLNQISFEDFKEVSHKHVTIKISYDDYLELLSK..NKTYEIYINRKYGIVKYTSYIK
D5XAQ9_THEPJ/8-405SYLMGYLTLLVEGEAVEKLVNMAVSRGIYLWDIRWLGPQKILLKARVSSFRSLRHIIKRTGGKMKIKNKKGLPFATAKVL
A5I631_CLOBH/5-371KYKNANITIEIQSMIPERFINLLWKNGVKVENVVKTNVTTFILDIDLKDYAVMENIARRTGTKVKIVKRKGISFLILFLK
R6CYS5_9FIRM/7-389NYLRGQAVAEVVCTAPERVVNLCAVHGIPFWDLTWLTETSFRVTTTLSGARRLAEVTADIGAQVTVCRKSGAPELWRRCR
R6BC91_9CLOT/8-386KYILGYINIKIEGYFVEKFINKCINENIFFWNVKREKSTIVYINTGIKDFKRLCRIARECKCKIQIKEKKGLPFILNRYR
R4KBT4_CLOPA/9-375EYKNGTITVQLQSKEIERIINVMWSHGIVIKNIKRNSINVITFDTSFNNYYKVKELATRTKSKIKIINRRGMIFLKMKLK
C6CTU6_PAESJ/7-385QWVRGVVTVHIRGGQPERLVNRALEGGLELSSIRWTSGGKLEFELSLGDFFRLRPFLKETGCRAHVVKREGMPFWLVRVE
R5AR68_9FIRM/7-385.ALCGYARLEVCGVHPERVLNACAAAGIACTASEPVDAYTLRITVRACCAETAAELARRCQCEVKTLYRRGLPQLLRRTA
M1LPE2_9CLOT/3-366...SKQITIEVSALKPERILNVLWNNSIYTSNIVKIDLLTIRFNINFNEYKEAESLIKKNNGKVRIVKVSDMIIIFMKLK
R5A1X4_9CLOT/2-368...NSPVKIKINTCS.NRFINYLIYNNIYYSSLIKTSDS....FILITNYENYKKIARR..FETVIIKYYGKMFFVNFIK
R6Z4S5_9CLOT/6-387HALTGMVRVRLTGCSPERFFNLCGQGDVEIWNISCADHE.YECCMTVQGFFACRPLAKKAGIRLKLLKKRGLPFFFYRNR
R5ACZ0_9CLOT/8-391.YLTGWVEFQISGSGP.RFLNAAAKTGVEFWGFRREGEH.TILRGTPSDYKRLRPLFRRCGVRSKIRQKRGFPFLRARIW
A4J7E2_DESRM/8-408SFLMGYVSLVVKGDFLEKFVNMAASRGIFLWDISRIGQDKVKVKVRITDVRPLRHIARATQSGFSIVERRGFPFLIHRLK

PF07244

Q5F5H0_NEIG1/221-295-------------------------------------IAFGD..FE-I-T.G...........TQ.------RY......
TP326_TREPA/186-273-------------------------------------.VVSR..IQ-F-K.G...........NK.------AF......
Q98MC3_RHILO/107-184-------------------------------------KVVNQ..VL-F-Q.G...........NK.------KL......
Q6ARL5_DESPS/92-170-------------------------------------PLVSS..VL-F-V.G...........LK.------EL......
Q5NEP7_FRATT/354-428-------------------------------------VYVNR..IN-F-F.G..........NN..------VT......
Q5FPE9_GLUOX/347-432-------------------------------------VVIGP..IS-M-T.G..........LA..------HT......
Q8KFQ6_CHLTE/212-301-------------------------------------VVIEK..IR-F-H.G...........NT.------AF......
Q73JH4_TREDE/105-183-------------------------------------PAVNN..IV-F-T.G...........NN.------NI......
O84244_CHLTR/185-272-------------------------------------GRIKK..LT-I-S.G...........IT.------RT......
Q9I0U1_PSEAE/190-268-------------------------------------YTFGK..VS-F-D.G..........DS..------II......
Q8EGG7_SHEON/97-177-------------------------------------PTISA..VT-F-E.G...........NK.------DI......
Q8KFQ6_CHLTE/304-389-------------------------------------YHIRN..IT-W-I.G..........NTK.------DF......
Q9KUB9_VIBCH/347-418-------------------------------------VQVDE..IV-L-Q.N..........NT..------HY......
Q73JH4_TREDE/186-274-------------------------------------SVITK..IL-F-E.G...........NS.------KF......
Q98MC3_RHILO/360-433-------------------------------------AYIER..IE-I-R.G..........ND..------RT......
Q6MAE9_PARUW/218-306-------------------------------------GKIQE..ID-F-V.N...........FS.------EK......
Q8XZI3_RALSO/98-178-------------------------------------PAISQ..LE-F-I.G...........IK.------EF......
Q8EGG7_SHEON/352-426-------------------------------------VYVRS..IN-F-T.G..........NT..------VT......
Q604T9_METCA/124-204-------------------------------------PSISS..VK-I-D.G...........NH.------DI......
Q8D271_WIGBR/189-264-------------------------------------YRFGK..IN-F-Y.G...........S..------KI......
Q82VX0_NITEU/116-201-------------------------------------AAVT...IE-F-Q.G...........AL.------AADEPAYR
Q87LW2_VIBPA/354-425-------------------------------------RVVDE..IV-I-V.N..........NT..------HY......
Q6MAE9_PARUW/390-467-------------------------------------FYVGL..VR-V-F.G...........NL.------ST......
Q6LKQ8_PHOPR/351-422-------------------------------------YYIDN..IV-L-N.N..........HT..------LL......
O84244_CHLTR/275-353-------------------------------------YTLGH..VH-I-E.G...........FT.------AL......
Q5NZG7_AROAE/348-422-------------------------------------VYVRR..IN-V-G.G..........NT..------KT......
O67326_AQUAE/374-446-------------------------------------VYVKK..IK-I-K.G..........NY..------ET......
Q5NNB2_ZYMMO/333-411-------------------------------------GSYGS..II-V-S.N...........NKH------IV......
Q7VHH5_HELHP/344-416-------------------------------------VKIND..VL-I-S.G..........NS..------RT......
Q98MC3_RHILO/187-275-------------------------------------TQIAA..IN-F-V.G...........NS.------AY......
Q6FCG7_ACIAD/270-348-------------------------------------FKFGQ..TK-F-L.G...........DA.------LY......
Q6MMX9_BDEBA/120-198-------------------------------------PSVVE..IT-Y-E.G...........NS.------EV......
Q8XZI3_RALSO/353-427-------------------------------------VYVRR..VN-V-V.G..........NS..------KT......
Q7MIG8_VIBVY/266-344-------------------------------------YSVKE..VN-F-R.G...........EL.------IG......
BAMA_HELPY/312-391-------------------------------------YRISDILIE-I-D.............NP.------VV......
Q8RHT4_FUSNN/251-335-------------------------------------IEVKK..MV-T-K.QKGNRRTPNDDVL..------KT......
Q6D152_PECAS/230-304-------------------------------------YRFGA..VN-F-Q.G...........A..------QI......
Q5E2U2_VIBF1/342-414-------------------------------------LYVNK..IT-I-K.N..........DS..------LY......
Q89NX1_BRADU/319-398-------------------------------------YRVGS..VD-F-R.S...........TVP------GF......
Q92Q48_RHIME/107-184-------------------------------------QLVNQ..VV-F-N.G...........NR.------KI......
Q5R0Z1_IDILO/176-264-------------------------------------AEIAQ..IN-I-V.G...........NK.------AF......
Q5E3E7_VIBF1/92-172-------------------------------------PTIAN..IS-F-S.G...........NK.------AI......
Q8D2H0_WIGBR/95-175-------------------------------------PIINN..IF-F-S.G...........NI.------SL......
Q5FPY9_GLUOX/117-194-------------------------------------PIVNR..IV-F-E.G...........NH.------AL......
Q8KFQ6_CHLTE/132-209-------------------------------------PVLQS..VE-F-Q.G...........NH.------KF......
Q83DT2_COXBU/99-179-------------------------------------PIISL..IR-I-S.G...........NK.------AI......
Q6FCG7_ACIAD/179-267-------------------------------------AKVVE..IN-L-I.G...........NT.------VF......
Q6N5Q8_RHOPA/187-275-------------------------------------TGVKS..IE-F-V.G...........NK.------AY......
Q6ATX4_ORYSJ/67-146-------------------------------------IRVHD..VI-I-K.G..........NA..------KT......
Q7MHW3_VIBVY/361-432-------------------------------------TRVDQ..IV-V-I.N..........NT..------HY......
Q7MAB6_WOLSU/88-166-------------------------------------STIAN..IE-I-N.G..........YGS.------GQ......
BAMA_DESVH/301-383-------------------------------------YKLGK..IG-F-D.G...........EL.------ID......
Q5NEP7_FRATT/96-176-------------------------------------PIIAG..FS-F-S.G...........NK.------KL......
O67326_AQUAE/290-371-------------------------------------YKLKE..IK-I-E.G...........NT.------LF......
BAMA_DESVH/131-209-------------------------------------PRIDN..IV-I-E.G...........SD.------KV......
Q7UK20_RHOBA/180-256-------------------------------------AMVSK..VI-Y-H.G...........NY.------RM......
Q7MXJ3_PORGI/386-461-------------------------------------ANINK..VI-I-K.G..........NT..------VV......
Q98K30_RHILO/218-292-------------------------------------AGYGA..TT-V-E.G...........TE.------KV......
Q82U03_NITEU/346-420-------------------------------------VYVRR..IN-I-S.G..........NE..------RT......
Q5R0Z1_IDILO/93-173-------------------------------------PTIAE..IT-F-E.G...........NS.------DI......
Q7MXJ3_PORGI/302-383-------------------------------------YYIKD..VN-F-V.G...........NS.------QY......
Q88IV7_PSEPK/195-269-------------------------------------YRLGA..VT-F-G.G..........DT..------PL......
Q74AT3_GEOSL/270-348-------------------------------------FRTGA..IG-Y-K.G...........DL.------LE......
Q5NND8_ZYMMO/397-485-------------------------------------SKVRQ..IN-I-I.G...........NK.------HF......
Q5FPY9_GLUOX/370-443-------------------------------------VYVER..ID-I-N.G..........NT..------IT......
Q6MAC6_PARUW/256-330-------------------------------------TYFGP..IK-I-N.G..........CD..------RV......
Q82U03_NITEU/265-343-------------------------------------YTVSD..IK-L-A.G...........EL.------LV......
Q8EGG7_SHEON/271-349-------------------------------------YKVKD..VN-L-T.G...........DL.------MG......
BAMA_BUCAI/175-263-------------------------------------IKINS..IK-I-L.G...........VQ.------AF......
Q6MKB1_BDEBA/93-170-------------------------------------RRISQ..VQ-W-E.G...........NK.------TI......
Q65R79_MANSM/88-168-------------------------------------PVIAD..VT-I-D.G...........NS.------SI......
Q5LSU6_RUEPO/196-284-------------------------------------IEIER..VS-F-V.G...........NR.------VF......
Q74AT3_GEOSL/179-267-------------------------------------VLIKS..IR-F-E.G...........NK.------AF......
Q9A711_CAUCR/345-418-------------------------------------VYVDR..ID-I-V.G..........NT..------RT......
Q7VYC2_BORPE/276-354-------------------------------------YKVRE..VK-L-A.G...........NL.------MG......
BAMA_HELPY/138-216-------------------------------------ARIAG..VE-I-K.G..........YGT.------EK......
Q7MPD6_VIBVY/100-183-------------------------------------VRVETFDVR-I-E.G...........E..------AS......
Q7MXJ3_PORGI/45-119-------------------------------------KTIAS..IE-I-E.G...........MR.------SF......
Q5NZG7_AROAE/267-345-------------------------------------YTVSA..VR-F-A.G...........DL.------IL......
Q9RXD5_DEIRA/97-179-------------------------------------PVIKD..VQ-A-T.G..............------LTFLPADA
Q8DI03_THEEB/90-161-------------------------------------VLIAE..VV-V-E.G...........AT.------PE......
Q604T9_METCA/298-376-------------------------------------FKVEQ..VR-L-T.G...........KT.------IV......
Q886N5_PSESM/91-171-------------------------------------PSVAS..IE-I-E.G...........NK.------AI......
Q8EGG7_SHEON/180-268-------------------------------------AEIRQ..IN-V-V.G...........NH.------EF......
Q74AT3_GEOSL/99-176-------------------------------------PIIRE..VR-I-E.G...........NK.------EL......
Q89KQ1_BRADU/278-357-------------------------------------YRVGA..LD-F-R.S...........SIP------NF......
Q87SW5_VIBPA/101-182-------------------------------------IKVMD..VV-I-S.G...........E..------AK......
A9CJ61_AGRFC/186-274-------------------------------------TKIGR..ID-F-I.G...........NN.------SY......
Q8XZI3_RALSO/272-350-------------------------------------YKVSD..IK-L-T.G...........EL.------LS......
Q6MMX9_BDEBA/201-289-------------------------------------VKVKK..IT-F-L.G...........NN.------HM......
Q7CWM5_AGRFC/240-314-------------------------------------APLGA..VT-V-T.G...........EK.------TV......
Q6MMX9_BDEBA/48-119-------------------------------------LIVKN..IE-V-A.G..........NR..------KI......
BAMA_HELPY/394-466-------------------------------------VYIND..VI-I-S.G..........NQ..------RT......
Q5R0Z1_IDILO/267-345-------------------------------------YKISE..TD-V-I.G...........DL.------KG......
Q8A1E1_BACTN/46-120-------------------------------------YEIAD..IK-V-E.G...........VK.------NY......
Q5E819_VIBF1/104-185-------------------------------------IYVSD..IV-I-S.G...........E..------AA......
Q5LSU6_RUEPO/369-442-------------------------------------IFVER..ID-I-E.G..........NT..------TT......
Q5R0Z1_IDILO/348-422-------------------------------------VYVRH..IN-F-E.G..........NG..------AT......
TAMA_ECOLI/189-263-------------------------------------YRFGH..VT-F-E.G...........S..------QI......
Q7NVY6_CHRVO/267-345-------------------------------------YTVSD..VR-L-A.G...........DL.------KV......
Q6MAE9_PARUW/309-387-------------------------------------YYFGR..LS-F-E.G...........NQ.------II......
Q92LN9_RHIME/217-291-------------------------------------APVGN..LT-V-S.G...........AR.------TV......
O51735_BORBU/103-180-------------------------------------SLVNS..VV-F-SDS...........SR.------VF......
Q7UK20_RHOBA/97-179-------------------------------------AVVAE..VR-L-V.G...........NQ.------VI......
A9CJ61_AGRFC/359-432-------------------------------------AYVER..IE-I-R.G..........NT..------RT......
Q82U03_NITEU/174-262-------------------------------------ARIKQ..IN-I-V.G...........NH.------VF......
Q9SRL6_ARATH/77-155-------------------------------------VRVHD..VI-I-G.G..........NE..------KT......
Q7VRD8_BLOFL/101-181-------------------------------------PIIHS..IE-F-S.G...........NK.------II......
Q6MMX9_BDEBA/292-370-------------------------------------YNVGD..VD-F-A.G...........DL.------LF......
Q8KFQ6_CHLTE/392-467-------------------------------------YTLNI..IN-I-K.G..........NT..------KT......
Q6LN32_PHOPR/175-263-------------------------------------AKIQQ..IN-F-I.G...........ND.------VF......
Q604T9_METCA/207-295-------------------------------------ARIKQ..IN-I-I.G...........NN.------AF......
Q8KC70_CHLTE/372-447-------------------------------------PRIEK..IE-V-TGG...........PAN------AI......
Q6ARL5_DESPS/20-91-------------------------------------HRIAA..IS-P-Q.G..........NA..------RV......
Q7VRD8_BLOFL/184-272-------------------------------------ANVKQ..IK-I-F.G...........NY.------IF......
Q5FPY9_GLUOX/197-285-------------------------------------TLIKK..IV-F-V.G...........NH.------AF......
O66463_AQUAE/72-149-------------------------------------PIIKE..IK-I-K.G...........NV.------FL......
Q73JH4_TREDE/358-431-------------------------------------SHVEN..II-I-K.G..........NT..------KT......
Q7UK20_RHOBA/349-427-------------------------------------FKVGD..VQ-I-V.G...........NE.------YV......
BAMA_BUCAI/266-344-------------------------------------YKISN..FF-V-N.G...........N..------LF......
Q7P0N3_CHRVO/181-255-------------------------------------IGFGK..IT-V-N.G...........VK.------RY......
Q7NVY6_CHRVO/348-422-------------------------------------TYVRR..VN-V-A.G..........NS..------KT......
Q6MKB1_BDEBA/419-500-------------------------------------TVVES..VT-F-T.G...........NQ.------AF......
Q8DI03_THEEB/242-318-------------------------------------VTYRF..LN-K-E.GEP.......TKQ..------RT......
Q7VAN9_PROMA/238-314-------------------------------------PIFTE..VE-I-IPS...........NS.------LL......
Q7MAB6_WOLSU/344-416-------------------------------------VKIND..VL-V-S.G..........NT..------RT......
O66463_AQUAE/152-225-------------------------------------YFLED..IQ-F-E.G...........VK.------KL......
Q7MYW2_PHOLL/190-266-------------------------------------YHFGQ..VR-Y-R.G...........S..------QI......
Q6MKB1_BDEBA/503-577-------------------------------------VRVAS..II-L-E.G..........NT..------FT......
Q7MXJ3_PORGI/120-199-------------------------------------PRISK..VT-F-S.G...........VK.------KS......
Q5NND8_ZYMMO/317-394-------------------------------------PIINR..IV-L-E.G...........NK.------RL......
Q8EF72_SHEON/112-195-------------------------------------VKIQWVDIN-F-S.G...........E..------ML......
Q6N5Q8_RHOPA/107-184-------------------------------------PVIGR..LA-F-E.G...........NK.------KI......
Q5NEP7_FRATT/273-351-------------------------------------YKVGS..VS-L-T.G...........KF.------IL......
Q7U8Q8_SYNPX/217-301-------------------------------------VEVEF..LN-S-E.GTSTDENGDPIRG..------KT......
Q886N5_PSESM/346-420-------------------------------------AYVNR..IN-Y-R.G..........NT..------KS......
Q6ARL5_DESPS/262-340-------------------------------------YRIGL..ID-F-S.G...........DL.------MI......
BAMA_DESVH/212-298-------------------------------------LYIKK..VK-I-E.G...........LK.------EL......
O84244_CHLTR/104-182-------------------------------------PVIRE..IN-I-S.G...........NE.------AI......
Q5SKT2_THET8/83-163-------------------------------------PPIAA..VR-V-E.............TE.------AF......
Q92Q48_RHIME/278-357-------------------------------------YDFGP..VN-I-E.S...........TVE------GI......
Q83DT2_COXBU/182-270-------------------------------------AKVGS..IQ-F-V.G...........NR.------AF......
O84244_CHLTR/356-435-------------------------------------YKIGL..IK-I-K.G..........NT..------HT......
Q98MC3_RHILO/278-357-------------------------------------YNFGD..IS-V-E.S...........TIP------EV......
Q7VYC2_BORPE/185-273-------------------------------------AKIRE..IR-V-V.G...........SK.------AF......
Q7NVY6_CHRVO/93-173-------------------------------------PVITQ..LN-I-N.G...........AK.------EF......
Q7VHH5_HELHP/87-166-------------------------------------PKVAS..VE-I-K.G..........YGS.------EQ......
Q89NX1_BRADU/148-225-------------------------------------AVIGR..VA-F-E.G...........NR.------KI......
A9CJ61_AGRFC/277-356-------------------------------------YDFGN..VA-V-E.S...........TVP------GV......
Q7NVY6_CHRVO/176-264-------------------------------------ARIRE..IR-I-V.G...........AN.------AF......
Q6FCG7_ACIAD/351-425-------------------------------------VKVRR..IN-I-V.G..........NT..------KT......
Q6ARL5_DESPS/173-259-------------------------------------VYVEE..IS-F-E.G...........NK.------NF......
Q8A1E1_BACTN/203-291-------------------------------------IKVHA..IH-I-T.G...........NS.------AI......
Q8XZI3_RALSO/181-269-------------------------------------AKIRQ..IN-I-V.G...........NK.------AF......
Q8D2H0_WIGBR/178-266-------------------------------------VLIKE..IN-F-I.G...........NN.------KF......
O67326_AQUAE/203-287-------------------------------------IYTSD..IE-I-E.G...........NK.------HF......
Q7VHH5_HELHP/262-341-------------------------------------YKVSE..IK-I-I.L...........HVP------VI......
Q9A711_CAUCR/263-342-------------------------------------YKFGK..IT-V-E.T...........ELK------KL......
Q9WYS9_THEMA/270-342-------------------------------------KKFKE..IL-F-H.G...........NT.------IF......
Q5E3E7_VIBF1/347-421-------------------------------------MYVRD..IR-F-V.G..........NT..------ST......
Q8I576_PLAF7/116-193-------------------------------------EMINN..VI-I-K.N...........ST.------VI......
Q87ME5_VIBPA/266-344-------------------------------------YTVKD..VK-F-R.G...........DL.------IG......
BAMA_BUCAI/92-172-------------------------------------PIISN..VI-V-S.G...........NH.------II......
Q83DT2_COXBU/354-428-------------------------------------VYVRR..IS-F-F.G..........NQ..------RT......
Q9A711_CAUCR/172-260-------------------------------------SGVLG..IN-F-L.G...........NA.------EY......
Q7MAB6_WOLSU/169-259-------------------------------------IIIRK..VN-Y-N.G...........AE.------KL......
BAMA_HELPY/219-309-------------------------------------IYIKQ..SI-Y-E.G...........SA.------KL......
Q6N5Q8_RHOPA/278-357-------------------------------------YRVGS..VT-F-E.S...........AIP------TL......
Q83DT2_COXBU/273-351-------------------------------------YHLSG..YT-I-T.G...........ET.------YG......
Q6N5Q8_RHOPA/360-433-------------------------------------VYIER..IN-V-V.G..........NT..------RT......
Q5E3E7_VIBF1/266-344-------------------------------------YTVSG..VK-F-Q.G...........EL.------IG......
Q6FCG7_ACIAD/96-176-------------------------------------PVISK..IE-F-K.G...........NK.------LI......
Q82VX0_NITEU/204-278-------------------------------------FRYGE..LQ-I-T.G...........LE.------RY......
Q5E3E7_VIBF1/175-263-------------------------------------AKIQQ..IN-F-I.G...........NE.------VF......
Q5LSU6_RUEPO/116-193-------------------------------------PTINR..IN-F-E.G...........NR.------RV......
Q8KFQ6_CHLTE/57-131-------------------------------------FTVRE..IT-F-S.G...........LQ.------TI......
Q8A1E1_BACTN/121-200-------------------------------------PRIAD..VR-Y-H.G...........VK.------KS......
Q5SKT2_THET8/164-238-------------------------------------PEVKA..VR-L-L.G...........VS.------LL......
Q9RXD5_DEIRA/180-256-------------------------------------APLSR..IE-V-T.G...........AT.------LL......
Q7UK20_RHOBA/259-346-------------------------------------ERIED..IQ-I-E.G...........AS.------IV......
O67326_AQUAE/18-90-------------------------------------AEIEK..II-I-K.G...........NK.------YI......
O51735_BORBU/277-353-------------------------------------FRFGK..LE-I-S.G...........NS.------VF......
Q8EF72_SHEON/198-271-------------------------------------YHFGQ..VS-F-E.G...........H..------TL......
Q73JH4_TREDE/277-355-------------------------------------FTYAG..VD-F-E.G...........NY.------IF......
Q9RXD5_DEIRA/329-402-------------------------------------GPVKS..IA-F-V.G...........NT.------KV......
Q82U03_NITEU/91-171-------------------------------------PAIAQ..IS-I-N.G...........AK.------EF......
Q886N5_PSESM/174-262-------------------------------------ASIQH..IN-V-V.G...........NT.------VF......
BAMA_BUCAI/347-421-------------------------------------YFVKR..IY-F-T.G...........NE.------IT......
Q5NZG7_AROAE/93-173-------------------------------------PAIAQ..ID-F-V.G...........VK.------EF......
Q65R79_MANSM/260-339-------------------------------------YTIKD..AR-I-V.G...........DV.------AG......
Q886N5_PSESM/265-343-------------------------------------YSVKS..VK-L-S.G...........DL.------KV......
Q7V0C8_PROMP/253-325-------------------------------------SVVDG..KP-R-K.G..............------KT......
Q8EJN5_SHEON/337-408-------------------------------------HVIED..IV-F-D.N..........QS..------KV......
Q74AT3_GEOSL/351-424-------------------------------------VFFDR..IN-V-S.G..........NT..------KT......
Q8D2H0_WIGBR/348-422-------------------------------------LYVNH..IN-F-S.G..........NE..------YT......
Q5NEP7_FRATT/179-270-------------------------------------AIIDS..IN-F-V.G...........NK.------SF......
Q8KBW3_CHLTE/43-133-------------------------------------PEVKS..IK-I-T.G...........NK.------AL......
BAMA_DESVH/386-459-------------------------------------VYINR..VL-V-E.G..........NQ..------KT......
Q6LN32_PHOPR/266-344-------------------------------------YQVKD..VT-F-R.G...........DL.------SK......
Q7VYC2_BORPE/102-182-------------------------------------PTIAS..IS-F-N.G...........MR.------EF......
Q6ARL5_DESPS/343-416-------------------------------------VYIDR..IT-I-N.G..........NV..------RT......
Q604T9_METCA/379-453-------------------------------------VYVRR..IN-F-Q.G..........NT..------KT......
Q6LMH9_PHOPR/358-429-------------------------------------LYIDE..VR-L-V.N..........NS..------QY......
Q92Q48_RHIME/187-275-------------------------------------TKITQ..IN-F-V.G...........NE.------VY......
Q9HXY4_PSEAE/265-343-------------------------------------YTIRD..VK-L-T.G...........DL.------KV......
Q5NND8_ZYMMO/488-566-------------------------------------YKFGD..IT-L-D.S...........QIR------DV......
Q6MAE9_PARUW/137-215-------------------------------------PTIRN..IH-W-C.G...........NH.------RV......
P73472_SYNY3/425-496-------------------------------------FDSED..EP-V-Q.G..............------RT......
Q5NZG7_AROAE/176-264-------------------------------------AKIRQ..IE-I-I.G...........NK.------AF......
Q65R79_MANSM/342-416-------------------------------------YSVRQ..IR-F-E.G..........NT..------VT......
BAMA_DESVH/59-130-------------------------------------NAIAD..VK-V-R.G..........TK..------VL......
Q881Y2_PSESM/187-261-------------------------------------YSLGK..VM-F-S.G..........NT..------PF......
Q74AT3_GEOSL/27-98-------------------------------------EKIID..VR-V-K.G..........NR..------RV......
Q5NND8_ZYMMO/569-643-------------------------------------QYIER..VD-I-S.G..........NT..------TT......
O51735_BORBU/183-274-------------------------------------YVVKG..ID-F-E.G...........NL.------SF......
Q7VYC2_BORPE/357-431-------------------------------------VYVRR..IQ-I-G.G..........NT..------RT......
Q6MMX9_BDEBA/373-447-------------------------------------VYFGK..IN-M-V.G..........NS..------KT......
BAMA_PHOLL/266-344-------------------------------------YKISG..ID-L-N.G...........NM.------AG......
Q9A711_CAUCR/92-169-------------------------------------PIINQ..VV-F-E.G...........NS.------SL......
Q9KPW0_VIBCH/266-344-------------------------------------YTVSK..VQ-F-R.G...........EL.------MG......
Q7VHH5_HELHP/169-259-------------------------------------IIIKK..AE-Y-D.G...........RE.------KL......
Q8YUR6_NOSS1/395-466-------------------------------------VNEQG..QP-I-R.G..............------RT......
A9CJ61_AGRFC/106-183-------------------------------------QLVNQ..VV-F-N.G...........NR.------KI......
Q7VRD8_BLOFL/356-430-------------------------------------FYVRE..VQ-F-E.G...........NN.------FT......
Q7MAB6_WOLSU/262-341-------------------------------------YEVSK..VE-I-VLE...........EP.------VV......
B9KGV5_ANAMF/358-430-------------------------------------VYIHR..IN-I-L.G...........NN.------RT......
G1UBA5_HAEDU/89-168-------------------------------------.LINN..LT-I-K.G...........NN.------AI......
BAMA_ECOLI/176-263-------------------------------------.EIQQ..IN-I-V.G...........NH.------AF......
BAMA_HAEIN/175-259-------------------------------------..LAS..LT-F-K.G...........NE.------SV......
Q2YPP8_BRUA2/234-307-------------------------------------.YYGP..VS-V-V.G...........TA.------RM......
Q2YRQ2_BRUA2/108-184-------------------------------------.VVNN..VL-F-Q.G...........NK.------KI......
Q2YRQ2_BRUA2/278-357-------------------------------------YTFGD..VS-V-E.S..........TVD.------GV......
Q31PR1_SYNE7/195-269-------------------------------------.VLSK..IE-L-D.G...........AR.------VL......
Q5ZY66_LEGPH/369-442-------------------------------------VYVRR..IN-F-H.G...........NT.------KT......
Q63T20_BURPS/183-270-------------------------------------.KIRQ..IN-F-I.G...........NK.------AF......
Q63W94_BURPS/223-295-------------------------------------.TIGA..LD-V-S.G...........VR.------RY......
Q8F3T2_LEPIN/54-124-------------------------------------.TIKE..VK-F-K.G...........NK.------NT......
Q8PAW1_XANCP/129-208-------------------------------------.AINK..LT-V-T.G...........NK.------DI......
Q8RHT4_FUSNN/101-171-------------------------------------.VLSS..VK-F-T.G...........NK.------RV......
BAMA_YERPE/267-344-------------------------------------.KLNS..VI-V-S.G...........NL.------AG......
Q9CJL1_PASMU/262-340-------------------------------------.TVKS..AR-I-L.G...........DV.------GG......
Q9CJL1_PASMU/89-168-------------------------------------PVISN..VV-I-D.G...........NK.------SI......
Q9FFG3_ARATH/74-151-------------------------------------VRVHD..VI-V-K.G...........NE.------KT......
BAMA_NEIMB/267-343-------------------------------------..WGK..VS-I-E.G..........DTN.------EV......
Q9PEI2_XYLFA/272-347-------------------------------------YKISS..IK-V-T.G...........NT.------VL......
Q9ZE03_RICPR/176-263-------------------------------------.VIKS..IY-F-S.G...........NE.------HY......

PF08479

Q8XQ41_RALSO/70-145-------------------------------------IPVRH--VR.V-T-G-------....AR-------LY------
Q8RI18_FUSNN/32-109-------------------------------------FHISQ--IN.L-E-D-------....NE-------RL------
Q7NU30_CHRVO/77-152-------------------------------------FTLSR--VS.L-E-G-------....AP-------AG------
Q7N2L1_PHOLL/77-152-------------------------------------HTIRY--IQ.F-E-G-------....VE-------SL------
Q7N9T5_PHOLL/77-152-------------------------------------HTIHR--IE.F-D-G-------....AK-------SL------
Q88MW8_PSEPK/83-158-------------------------------------WAVDG--VR.V-A-G-------....MH-------RL------
Q7N107_PHOLL/69-145-------------------------------------FPITH--VR.L-A-G-------....TE-------NF------
Q605Q3_METCA/48-123-------------------------------------FDVWE--YR.V-E-G-------....NS-------VL------
Q9JY36_NEIMB/87-166-------------------------------------FAINE--VV.L-E-G-------EHHARF-------QF------
Q8YM25_NOSS1/96-171-------------------------------------FRVDR--IE.V-V-G-------....SQ-------VF------
Q7N1B0_PHOLL/77-152-------------------------------------HTIQQ--IE.F-V-G-------....AE-------SL------
Q89H68_BRADU/98-173-------------------------------------FVLRG--LN.V-S-G-------....AR-------AV------
Q9HVN7_PSEAE/59-134-------------------------------------VLVKR--FQ.L-S-G-------....NR-------QF------
Q8XQZ3_RALSO/84-163-------------------------------------FRIDR--IT.L-T-G-------DAAERF-------QW------
Q880E0_PSESM/77-152-------------------------------------FTISR--IE.L-K-G-------....AD-------SL------
Q8XYH9_RALSO/79-151-------------------------------------FPIQG--IV.L-E-D-------....NV-------..------
Q8DLP0_THEEB/81-156-------------------------------------IPVQK--II.V-E-G-------....ST-------LF------
Q8XQX3_RALSO/69-144-------------------------------------LTPSK--FQ.I-E-G-------....VK-------AL------
Q7MRX6_WOLSU/59-134-------------------------------------FITRS--IH.D-E-G-------....IT-------LL------
Q9I792_PSEAE/71-146-------------------------------------FEIRR--IE.L-E-G-------....AG-------HL------
Q8XPV1_RALSO/81-156-------------------------------------FDIHR--IE.L-T-G-------....NT-------VL------
Q7VLT7_HAEDU/59-128-------------------------------------LPYKG--IK.F-Q-G-------....IT-------LI------
Q7NWR3_CHRVO/87-160-------------------------------------LPVSG--LK.L-A-G-------....IR-------LL------
Q6FDM4_ACIAD/101-180-------------------------------------FEIKD--IH.L-Q-G-------EKAEHF-------LF------
Q63JI8_BURPS/74-148-------------------------------------FPITQ--IE.V-R-G-------.....G-------AR------
Q9AAJ4_CAUCR/8-83-------------------------------------IILKH--VN.F-P-G-------....AT-------VV------
Q63TR3_BURPS/65-140-------------------------------------LTPSS--FQ.V-E-G-------....VK-------SI------
Q89Q77_BRADU/73-148-------------------------------------FRLRK--VE.F-D-A-------....SK-------FI------
Q9HVG7_PSEAE/71-146-------------------------------------FKLRE--IR.I-E-G-------....NT-------RY------
Q6DA64_PECAS/107-183-------------------------------------FPIKK--VE.L-Q-G-------....TE-------DF------
Q8RGK0_FUSNN/41-115-------------------------------------LNVTS--ID.L-E-G-------....NT-------IF------
Q9PAG8_XYLFA/106-185-------------------------------------FPIQK--IF.L-E-G-------DKAARF-------QW------
Q74E11_GEOSL/79-154-------------------------------------VFISH--IV.T-D-P-------....SE-------IL------
Q8YWF4_NOSS1/18-93-------------------------------------FLVKK--IE.V-L-G-------....AT-------VL------
Q7N910_PHOLL/78-154-------------------------------------FPITR--VV.L-E-G-------....TE-------HF------
IBPB_HISS2/99-172-------------------------------------ITKIT--ID.F-G-G-------....EE-------IF------
Q88QC1_PSEPK/91-166-------------------------------------LVLQK--VR.F-E-G-------....GT-------VF------
Q7NY08_CHRVO/92-167-------------------------------------LLVQD--IV.L-E-G-------....NT-------VF------
Q9I5N4_PSEAE/47-122-------------------------------------VDINE--YV.V-R-G-------....NT-------VL------
B4F0Z8_PROMH/77-150-------------------------------------LPIKG--VY.I-Q-G-------....IT-------LL------
C5BBG6_EDWI9/81-153-------------------------------------LPISG--VY.L-T-G-------....IT-------LL------
D3VFR1_XENNA/80-152-------------------------------------.AITG--VY.L-Q-G-------....IT-------LL------
FHAC_BORPE/92-164-------------------------------------...HA--VD.L-D-F-------....GV-------EG------
HXUB1_HAEIN/73-150-------------------------------------FPLKQ--VQIL-D-R-------...NNQ-------EV------
Q0WFB2_YERPE/81-154-------------------------------------LPITG--VF.L-Q-G-------....NT-------LL------
Q6D5C4_PECAS/75-150-------------------------------------FTINE--IH.Y-R-N-------....SS-------LL------
Q74QU0_YERPE/90-165-------------------------------------.AINN--VE.L-I-N-------....LD-------AF------
Q7CJ53_YERPE/77-153-------------------------------------FVIDR--VT.L-S-G-------....TE-------PL------
Q7N9K7_PHOLL/79-152-------------------------------------LPLTG--VY.L-K-G-------....IS-------LL------
Q7VX34_BORPE/76-148-------------------------------------...RN--FD.V-A-G-------....VH-------AL------

PF08478

FTSQ_VIBF1/50-120-------------------------------------LPLSH--MI-I-Q-G-----------QLK------HI------
FTSQ_SHEON/52-121-------------------------------------LPIEA--VA-I-K-G-----------ERT------YT------
DIVIB_BACSU/54-123-------------------------------------SKVST--IS-V-T-G-----------.NE------NV------
FTSQ_RHIME/89-157-------------------------------------FAIED--VR-V-S-G-----------.NA------QT------
Q5P6Z9_AROAE/37-106-------------------------------------FPLRE--VV-V-L-T-----------PPA------QV------
O83403_TREPA/55-123-------------------------------------TSFAK--VE-F-S-G-----------.NV------TI------
DIVIB_CLOTE/54-122-------------------------------------FNVKI--VE-V-K-D-----------.NK------SI------
FTSQ_ECOLI/55-126-------------------------------------LPLSK--LV-L-T-G-----------ERH------YT------
Q8D2Z8_WIGBR/41-111-------------------------------------FPISH--II-I-K-G-----------NMN------FT------
Q83N06_TROWT/56-124-------------------------------------MSLRS--IR-V-A-G-----------.NM------QV------
Q8E185_STRA5/122-193-------------------------------------SKQKT--IT-V-S-G-----------.NQ------HT------
Q5SJC7_THET8/24-91-------------------------------------VPVEE--VR-V-E-G-----------.LR------HL------
Q5R0N0_IDILO/43-112-------------------------------------VPLAE--LS-V-Q-G-----------ELH------YT------
Q6F706_ACIAD/59-128-------------------------------------AKIAD--LS-I-V-G-----------TRS------VV------
Q728V1_DESVH/71-139-------------------------------------FAIRD--VE-I-S-G-----------.NL------ML------
FTSQ_HAEIN/54-124-------------------------------------KPISA--FA-L-V-G-----------QNT------FT------
DIVIB_STRR6/153-223-------------------------------------ATMKD--IR-V-E-G-----------.TV------QT------
Q9CPA8_PASMU/55-125-------------------------------------KPISA--FI-L-T-G-----------TPT------FT------
Q7MNU9_VIBVY/53-123-------------------------------------LPLSK--II-L-Q-G-----------DLQ------YV------
Q7NQ02_CHRVO/37-106-------------------------------------FPVKK--IR-I-Q-G-----------DMN------RV------
Q5YYX7_NOCFA/42-110-------------------------------------LSVRT--VD-V-E-G-----------.LR------AV------
Q8DVE1_STRMU/126-197-------------------------------------SRQKE--IT-V-S-G-----------.NK------NA------
Q82AD6_STRAW/56-125-------------------------------------LRVER--VS-V-S-G-----------.TR------VL------
Q8YQH2_NOSS1/56-126-------------------------------------KTPEQ--VL-M-K-S-----------DNQ------LL------
Q98KB7_RHILO/92-160-------------------------------------FAVDQ--VK-V-V-G-----------.NR------QT------
FTSQ_COXBU/46-115-------------------------------------LPFRQ--IK-I-T-V-----------SSD------HI------
Q5HQ08_STAEQ/219-287-------------------------------------SKISN--VN-I-K-G-----------.NN------NV------
Q8DMI0_THEEB/61-130-------------------------------------RGPEQ--VL-I-R-G-----------.NQ------LL------
Q87WY8_PSESM/73-142-------------------------------------RPIAR--IN-V-Q-G-----------DLS------YI------
Q5FUJ1_GLUOX/84-152-------------------------------------LPIRH--IV-I-N-G-----------.RG------MT------
DIVIB_GEOKA/50-118-------------------------------------GAVGH--VE-V-S-G-----------.NR------HL------
Q7V8M1_PROMM/59-128-------------------------------------NNAKQ--IH-V-Q-G-----------.SR------NI------
DIVIB_LACLA/153-224-------------------------------------SKIST--FS-V-S-G-----------.NA------NE------
Q65RZ0_MANSM/55-125-------------------------------------KPISS--FA-L-V-G-----------TPQ------YT------
Q6AE66_LEIXX/96-164-------------------------------------LALKN--IE-V-T-G-----------.TE------RL------
P73457_SYNY3/54-123-------------------------------------RSDRQ--VE-F-L-G-----------.NK------LV------
Q73NF1_TREDE/62-130-------------------------------------SSIAA--VN-I-S-G-----------.CS------DL------
Q6AJ56_DESPS/51-120-------------------------------------FRVEE--VK-F-S-G-----------.QH------RM------
Q9RWN7_DEIRA/101-171-------------------------------------VPVRQ--VV-V-S-G-----------.NT------HL------
Q604W1_METCA/56-127-------------------------------------RRVQT--VR-V-K-G-----------AFR------YI------
Q6NGD0_CORDI/29-97-------------------------------------MTVQK--IE-I-D-G-----------.AV------RS------
Q7VMY3_HAEDU/61-131-------------------------------------TPIRS--FA-L-T-H-----------KTR------FT------
Q8CXI4_OCEIH/50-118-------------------------------------SHIRT--IE-V-N-G-----------.NT------FL------
Q5WFH0_BACSK/51-119-------------------------------------SGVKT--IH-I-D-G-----------.NQ------LV------
Q7U5Q7_SYNPX/51-120-------------------------------------KGSDQ--VV-V-R-G-----------.DT------TF------
FTSQ_BLOFL/45-115-------------------------------------GPLSY--II-V-T-G-----------NRF------FT------
FTSQ_VIBCH/52-122-------------------------------------LPLSK--LV-L-Q-G-----------DLH------YV------
Q6N416_RHOPA/110-178-------------------------------------FRIKQ--VA-I-A-G-----------.RK------QL------
FTSQ_NEIG1/37-106-------------------------------------LPVKQ--VS-L-K-G-----------.NL------VY------
Q67Q43_SYMTH/58-125-------------------------------------FRLER--VQ-I-G-G-----------.NE------RL------
FTSQ_GEOSL/67-135-------------------------------------LPLKE--IE-V-S-K-----------.LQ------RL------
Q9CCE5_MYCLE/151-219-------------------------------------MSVRN--IV-V-T-G-----------.IE------TV------
FTSQ_CORGL/30-98-------------------------------------LKVGN--IE-V-T-G-----------.AT------RT------
Q8R9G8_CALS4/29-97-------------------------------------FKIKS--IK-V-V-G-----------.NQ------IL------
Q8XJA3_CLOPE/42-109-------------------------------------FNIKK--VN-V-N-N-----------.NN------VI------
Q7NNV9_GLOVI/69-138-------------------------------------RSAGA--VR-I-V-G-----------.YE------RL------
Q6A9Q0_PROAC/48-116-------------------------------------LCVNT--IE-V-H-G-----------.TR------LV------
Q5FKV1_LACAC/77-148-------------------------------------ANIST--VK-V-V-G-----------.TT------DL------
Q8FNU2_COREF/30-98-------------------------------------FKVES--IE-I-N-G-----------.AV------RT------
DIVIB_CLOAB/41-109-------------------------------------FNIKY--IN-V-E-G-----------.NK------II------
Q6LMF8_PHOPR/51-121-------------------------------------LPLSQ--LV-I-Q-G-----------DLD------YL------
Q9K9T2_BACHD/50-118-------------------------------------SHIRS--IK-V-E-G-----------.NQ------FV------
FTSQ_CAUCR/94-162-------------------------------------FRLKT--VH-I-R-G-----------.AS------AT------
B1W0J1_STRGG/62-130-------------------------------------.RVEK--VG-T-S-G-----------.VE------VL------
B9KHS4_ANAMF/69-137-------------------------------------FSTRE--VV-I-R-G-----------.NS------VV------
FTSQ_ZYMMO/97-165-------------------------------------FSVRH--VE-I-V-G-----------.LH------HM------
D4ZDU0_SHEVD/36-105-------------------------------------LPIEA--VA-V-K-G-----------ERI------HT------
G3XCS0_PROMA/62-129-------------------------------------..SNQ--IH-I-K-G-----------.AA------NT------
G8AFN1_AZOBR/99-167-------------------------------------FAIAD--VL-V-E-G-----------.RT------ET------
H7C7L9_BORBU/34-101-------------------------------------.LIRY--IS-I-N-N-----------.DI------SL------
I6T797_ENTHA/66-137-------------------------------------SRLQG--IT-V-S-G-----------.NQ------MI------
FTSQ_MYCTU/125-192-------------------------------------.SARE--IV-I-I-G-----------.IG------AV------
DIVIB_STAA8/195-262-------------------------------------SKIAH--VN-I-N-G-----------.NN------HV------
Q2YLY9_BRUA2/68-136-------------------------------------FAIED--IK-V-V-G-----------.NN------ET------
Q5M4Y0_STRT2/105-175-------------------------------------.KQKI--LT-V-S-G-----------.TK------NA------
Q5ZSA8_LEGPH/39-107-------------------------------------FPITT--IK-V-A-A-----------TYE------HI------
FTSQ_BURPS/37-106-------------------------------------FALRE--IR-I-D-G-----------DTE------HI------
Q65JX8_BACLD/54-123-------------------------------------SKVSK--VE-I-K-G-----------.NK------NV------
DIVIB_BACAN/53-121-------------------------------------SNIKK--IS-V-F-G-----------.NH------YM------
DIVIB_ENTFA/126-197-------------------------------------SRLSE--VT-V-S-G-----------.NK------SV------
Q8F8E7_LEPIN/47-113-------------------------------------..LNK--LI-I-T-G-----------.HE------KL------
DIVIB_LISMO/51-118-------------------------------------SKLDK--IA-V-S-G-----------.NK------QL------
Q99YV5_STRP1/126-195-------------------------------------.KKKE--FS-V-R-G-----------.NH------QT------
Q9PF78_XYLFA/35-103-------------------------------------.PLAK--LR-V-S-G-----------DFK------RV------
FTSQ_RICPR/73-141-------------------------------------FRLEN--VI-I-E-G-----------.QQ------NV------
S5VEM4_STRC3/60-128-------------------------------------.RLER--VS-V-S-G-----------.TR------ML------

PF17243

Q5F5H0_NEIG1/53-127-----------------------------------------P--VR-I-D-T----------.QDS......EI------
B3PF57_CELJU/28-104-----------------------------------------E--IE-I-S-G----------.GIK......SL------
E1SF31_PANVC/25-101-----------------------------------------R--LQ-V-D-G----------.LTG......DL------
Q7MYW2_PHOLL/25-100-----------------------------------------R--LK-I-E-G----------.LTG......KL------
G4E3B1_9GAMM/37-113-----------------------------------------V--IT-I-E-G----------.VSE......AQ------
U2FWP7_9GAMM/36-116-----------------------------------------N--VN-I-D-G----------.IND......PL------
E1VG33_9GAMM/24-96-----------------------------------------D--VN-V-S-G----------.GTQ......AL------
A0A089WUQ1_9PSED/27-103-----------------------------------------V--VR-I-K-P----------.ANK......AL------
D5BUM0_NITHN/26-104-----------------------------------------E--VE-V-Q-G----------.VEG......KV------
F0LSE4_VIBFN/2-73-----------------------------------------D--LT-I-K-G----------.LEG......GL------
J4UW94_9PAST/75-152-----------------------------------------D--VS-V-E-G----------.IKNKDK...AA------
I1XJZ2_METNJ/35-114-----------------------------------------K--IE-L-E-G----------.IEK......DW------
E8RB68_DESPD/51-130-----------------------------------------E--II-I-S-G----------DLSE......NQ------
Q88IV7_PSEPK/30-106-----------------------------------------L--VK-V-K-P----------.ANK......AL------
C0B0J8_9GAMM/14-89-----------------------------------------R--LK-V-E-G----------.LEG......QL------
A0A078L5K0_9CHLA/31-107-----------------------------------------K--FK-.-.-.----------..........GI------
W0DW72_MARPU/18-99-----------------------------------------K--VE-V-D-G----------.LEG......KE------
M4WYA6_PSEDE/23-95-----------------------------------------D--VR-I-T-P----------.AIP......AL------
A0A0N0VJQ7_9PSED/27-99-----------------------------------------D--VR-V-K-P----------.AND......EL------
A3N0I9_ACTP2/53-130-----------------------------------------D--LE-V-K-G----------.IADKDK...DA------
I3DD68_HAEPH/46-123-----------------------------------------D--LE-V-R-G----------.IANRDK...DA------
B0UW15_HISS2/34-110-----------------------------------------D--LK-V-V-G----------.VTGV.....QK------
A8H5B9_SHEPA/25-98-----------------------------------------T--LK-I-N-G----------.VEG......SL------
W0TJZ2_9GAMM/59-138-----------------------------------------D--IR-I-S-G----------.IEG......EL------
V4IYU2_9DELT/43-121-----------------------------------------E--VF-V-T-G----------.VEG......EL------
A0A097AV25_9VIBR/23-94-----------------------------------------D--LS-V-K-G----------.LSG......EL------
G2FFV9_9GAMM/23-101-----------------------------------------E--VQ-I-E-G----------.LDR......EQ------
A0A0D8PQX7_9GAMM/25-98-----------------------------------------S--LK-V-K-G----------.LNS......SL------
H8KZN7_FRAAD/34-111-----------------------------------------V--LQ-V-K-G----------.LPD......DL------
A0A077DGZ1_9BURK/23-96-----------------------------------------Q--GM-T-P-.----------..........EV------
Q8P3I6_XANCP/81-162-----------------------------------------K--IE-I-K-G----------.LDGDDDA..EM------
A0A097QYG2_HAFAL/25-100-----------------------------------------R--LK-V-E-G----------.LSG......SL------
A0A0B5FPQ4_9DELT/43-123-----------------------------------------E--LR-V-D-G----------.VRD......DA------
A4A831_9GAMM/27-99-----------------------------------------R--YK-V-E-G----------.VNK......EV------
Q881Y2_PSESM/26-98-----------------------------------------D--VR-I-K-P----------.ANP......DL------
F7YKQ1_VIBA7/24-95-----------------------------------------A--LT-I-N-G----------.LEG......EL------
D8MMC1_ERWBE/17-93-----------------------------------------R--LQ-V-T-G----------.LSG......EL------
E3BGE0_9VIBR/25-94-----------------------------------------N--IS-I-Q-G----------.VEG......EL------
B1KIB2_SHEWM/32-105-----------------------------------------K--LD-I-S-G----------.VSG......EL------
A0A0F6A239_9GAMM/26-101-----------------------------------------D--FD-I-K-G----------.LDD......AL------
A0A060BAA3_9GAMM/33-101-----------------------------------------N--AS-I-N-G----------.VSS......EV------
A0A089YTB8_9PSED/27-99-----------------------------------------D--VR-V-N-P----------.ANP......AL------
W0LAB6_9GAMM/25-100-----------------------------------------R--LQ-V-Q-G----------.LSG......EL------
A0A0F4QH72_9GAMM/40-104-----------------------------------------E--..-.-.-.----------.LTD......EA------
Q15Z96_PSEA6/29-105-----------------------------------------S--VD-I-E-G----------.ADDS.....RL------
K8WZC7_9GAMM/39-114-----------------------------------------R--LN-I-E-G----------.LEG......QL------
A7TAA7_NEMVE/26-104-----------------------------------------S--IE-I-R-G----------.VDK......AQ------
F9Q9H7_9PAST/9-84-----------------------------------------D--IE-V-R-G----------.IKGE.....RA------
J1EHC7_9BURK/78-159-----------------------------------------D--VQ-V-R-A----------.PG.......TV------
K4KLG1_SIMAS/22-98-----------------------------------------E--LL-L-D-G----------.VRG......DV------
G7UU66_PSEUP/27-104-----------------------------------------Q--VQ-I-K-G----------.LDENDEVQRAM------
A4C5K4_9GAMM/25-96-----------------------------------------K--IV-I-K-G----------.VDS......AL------
H2ISU6_RAHAC/25-100-----------------------------------------R--LQ-L-E-G----------.LDG......DL------
H8GM81_METAL/32-108-----------------------------------------E--TA-I-R-G----------.IEG......EA------
A0A0F4PJY1_9GAMM/31-102-----------------------------------------G--YS-I-N-G----------.LSG......EL------
G4E418_9GAMM/42-129-----------------------------------------E--VR-L-E-G----------.LSG......EA------
Q5ZUJ2_LEGPH/26-94-----------------------------------------L--LE-I-D-G----------.IKG......KV------
Q3JE50_NITOC/35-113-----------------------------------------E--TE-V-E-G----------.VKG......EA------
G3IU04_9GAMM/26-102-----------------------------------------K--VS-V-T-G----------.LES......EA------
C4K4K7_HAMD5/18-88-----------------------------------------S--LD-I-E-G----------.VGG......EV------
C5BRL5_TERTT/13-89-----------------------------------------D--MS-I-H-G----------.VDG......QI------
A0A0N1EM58_9GAMM/26-95-----------------------------------------D--YE-I-N-G----------.ING......DL------
A0A0F6A4Z6_9GAMM/28-97-----------------------------------------A--IE-V-Y-S----------.ENE......QV------
R4VJ26_9GAMM/30-104-----------------------------------------R--VS-V-N-G----------.VEG......EV------
H8Z3L7_9GAMM/45-126-----------------------------------------K--VE-V-T-G----------.LRG......EQ------
TAMA_HAEIN/27-102-----------------------------------------D--IE-V-Q-G----------.IRGF.....RA------
A1WYH1_HALHL/24-97-----------------------------------------E--VV-I-E-G----------.VSG......EL------
Q0VRK8_ALCBS/36-113-----------------------------------------S--LE-I-T-G----------NASE......AV------
Q5E819_VIBF1/25-98-----------------------------------------E--LE-I-E-G----------.LEG......PL------
Q7VL30_HAEDU/47-124-----------------------------------------D--LD-V-K-G----------.IKEKDE...DA------
F9TAI0_9VIBR/25-96-----------------------------------------D--LS-I-E-G----------.LEG......EL------
G0A4A7_METMM/26-102-----------------------------------------E--VT-L-S-G----------.LPD......QA------
B8F3L0_HAEPS/24-100-----------------------------------------L--LE-V-D-G----------.IKDK.....DL------
I3BWR7_9GAMM/38-115-----------------------------------------K--VS-I-Q-G----------.ADT......AL------
C5BF89_EDWI9/25-100-----------------------------------------R--LV-V-E-G----------.LSG......QL------
S6AFW0_PSERE/29-101-----------------------------------------E--VR-I-K-P----------.SNR......AL------
I1DU11_9GAMM/19-91-----------------------------------------T--LN-I-T-G----------.IKG......EL------
A1AU38_PELPD/53-132-----------------------------------------E--VV-V-S-G----------.IEG......EA------
A4VLJ6_PSEU5/59-131-----------------------------------------D--VR-V-E-P----------.ENR......TL------
D7N4I4_9NEIS/66-140-----------------------------------------P--VR-V-E-T----------.DHS......EI------
A1S617_SHEAM/29-102-----------------------------------------R--IN-V-S-G----------.VDE......AL------
C4LDD3_TOLAT/34-106-----------------------------------------T--YD-V-R-G----------.VKG......EL------
A0A0M2VJT9_9GAMM/23-96-----------------------------------------S--LR-L-K-G----------.LDG......EL------
D3UYW3_XENBS/25-100-----------------------------------------R--LK-V-E-G----------.LSG......EL------
A0A0F2P3L4_9GAMM/23-107-----------------------------------------E--LD-I-N-G----------.VGA......TL------
A0A0E3Y7U5_9ENTR/24-103-----------------------------------------Q--IK-L-E-G----------.LND......VL------
Q084L9_SHEFN/13-86-----------------------------------------T--IN-V-T-G----------.VPK......KI------
W0BDN3_9GAMM/32-98-----------------------------------------N--VE-I-T-G----------.IKG......SV------
F7NXK5_9GAMM/22-95-----------------------------------------Q--IE-L-K-G----------.VSG......PL------
C1DLX0_AZOVD/8-80-----------------------------------------E--VR-V-E-P----------.AEA......SL------
E0WR26_9ENTR/91-165-----------------------------------------Q--FQ-V-K-G----------.LSG......EL------
Q65VW8_MANSM/38-113-----------------------------------------E--LK-V-E-G----------.IANE.....KL------
N8TH50_ACIGI/255-325-----------------------------------------G--VS-V-T-G----------.APT......VL------
Q7MPD6_VIBVY/25-96-----------------------------------------S--LS-L-E-G----------.VSG......AV------
K2J2F3_9GAMM/34-104-----------------------------------------K--YD-L-K-G----------.LDG......AL------
Q9PDZ7_XYLFA/52-133-----------------------------------------K--IQ-I-K-G----------.LDKGDDV..EM------
W0VDJ6_9BURK/80-150-----------------------------------------D--..-.-.-.----------..........PL------
J3VTA7_9ENTR/27-102-----------------------------------------T--LQ-V-E-G----------.ISG......DL------
Q3IIS7_PSEHT/43-112-----------------------------------------D--YE-I-K-G----------.IND......DL------
W8UAH7_YEREN/25-100-----------------------------------------R--LQ-V-E-G----------.LSG......DL------
A3QEZ0_SHELP/53-126-----------------------------------------K--VE-V-D-G----------.ANE......SL------
Q0ABA0_ALKEH/9-82-----------------------------------------E--VR-V-E-G----------.VSG......AL------
I3D8U3_9PAST/31-106-----------------------------------------E--LS-V-Q-G----------.IKNK.....EL------
C9R2Q8_AGGAD/67-143-----------------------------------------D--LQ-V-S-G----------.IKNE.....KL------
D3HRD5_LEGLN/26-95-----------------------------------------S--IT-L-H-G----------.VSG......KV------
A4XV24_PSEMY/27-99-----------------------------------------D--VR-I-T-P----------.ANS......AL------
A0A0F5ASB1_9GAMM/25-95-----------------------------------------D--ID-I-E-G----------.LDG......IA------
K1KFQ2_9BURK/25-95-----------------------------------------R--ID-I-K-G----------.LDG......DL------
F4GR00_PUSST/29-103-----------------------------------------P--GG-V-P-P----------..........QA------
Q1LSN1_BAUCH/27-108-----------------------------------------C--LQ-L-T-G----------.LNG......NL------
I4N4G8_9PSED/27-99-----------------------------------------V--VQ-V-K-P----------.ANA......EL------
A0A0F7K051_9GAMM/40-116-----------------------------------------S--ID-L-V-G----------.VSG......AL------
A0A090ALX5_9GAMM/33-113-----------------------------------------Q--IQ-I-E-G----------.VKG......EM------
A0A0C5VP27_9GAMM/23-96-----------------------------------------V--FQ-I-T-G----------.NNK......AA------
A0A0A7EIJ4_9GAMM/31-102-----------------------------------------Q--IT-V-K-A----------.NDE......TL------
V4L9I2_9GAMM/39-120-----------------------------------------E--VE-V-E-G----------.VEG......EE------
W8KKG5_HALHR/15-91-----------------------------------------R--VE-I-S-G----------.GDS......EI------
A0A0F4RB08_9GAMM/35-107-----------------------------------------D--AE-I-V-G----------.IEG......DM------
A6D4A9_9VIBR/7-78-----------------------------------------S--LD-I-N-G----------.LSG......AL------
A0A0A7RZ09_9GAMM/25-96-----------------------------------------G--LV-V-K-G----------.LPD......AL------
F5SWL6_9GAMM/30-108-----------------------------------------T--VK-I-N-G----------.VDA......SM------
X2H7P2_9GAMM/12-82-----------------------------------------K--LS-I-K-G----------.LSG......EL------
M4NH26_9GAMM/26-103-----------------------------------------Q--LV-V-D-G----------.VAD......PL------
Q9I0U1_PSEAE/29-101-----------------------------------------S--VR-V-T-P----------.ANA......AL------
Q12P36_SHEDO/30-103-----------------------------------------S--IK-V-T-G----------.VKG......KL------
B7S2R2_9GAMM/29-101-----------------------------------------D--VQ-L-N-G----------.LEG......ES------
A0A078KVS5_9GAMM/33-99-----------------------------------------N--FD-I-S-G----------.VKG......KL------
E1VCV5_HALED/26-98-----------------------------------------D--AS-I-K-G----------.VKG......KL------
Q6LV64_PHOPR/26-99-----------------------------------------S--LT-I-K-G----------.LKG......NL------
A4BTF3_9GAMM/22-102-----------------------------------------K--IK-I-S-G----------.IDD......EL------
Q9KP31_VIBCH/35-106-----------------------------------------K--LE-I-T-G----------.ISG......AE------
M4R5B2_BIBTR/25-102-----------------------------------------L--LK-M-E-G----------.LDKGS....EL------
E6WX89_PSEUU/31-111-----------------------------------------K--VE-I-D-G----------.LEKEP....AI------
I3YHA7_THIV6/47-128-----------------------------------------D--VK-V-E-G----------.LEG......QP------
B8GL28_THISH/24-100-----------------------------------------R--LN-I-T-G----------.VGA......EL------
I4WC80_9GAMM/30-107-----------------------------------------L--LV-V-D-G----------.VED......PL------
B0VM47_ACIBS/241-311-----------------------------------------T--AE-V-T-G----------.APD......DL------
A0A0F7M6Y8_9GAMM/32-126-----------------------------------------A--.D-I-S-G----------.ADDSLDS..AI------
K0CID5_ALCDB/39-118-----------------------------------------V--LT-I-K-G----------DLHD......EV------
Q2LXE7_SYNAS/45-124-----------------------------------------E--VA-V-T-G----------.IEG......EK------
F4HFI8_GALAU/26-102-----------------------------------------T--LK-V-E-G----------IKNK......AA------
F9U5H8_9GAMM/65-146-----------------------------------------D--VE-V-T-G----------.LEG......EQ------
W8X5B9_CASDE/43-115-----------------------------------------P--P.-.-.-.----------..........KV------
M1NGG1_DESSD/41-119-----------------------------------------S--VD-L-T-G----------.LEA......PF------
E1SNG0_FERBD/142-214-----------------------------------------E--LK-V-E-G----------.VRG......NL------
K0C4U5_CYCSP/32-110-----------------------------------------S--VQ-L-D-G----------.APE......GK------
A0A0F2N8M6_9DELT/4-82-----------------------------------------E--VT-V-F-G----------.IKD......PL------
A1U274_MARHV/32-106-----------------------------------------R--VE-V-E-G----------.DYD......QL------
B2FP46_STRMK/43-124-----------------------------------------K--VD-I-K-G----------.LDKGDDA..AI------
Q481M1_COLP3/42-113-----------------------------------------K--VT-L-D-G----------ELSK......AV------
W0I1Y1_9GAMM/27-102-----------------------------------------R--LQ-V-E-G----------.LSG......DL------
R5EJH3_9GAMM/81-157-----------------------------------------S--IE-V-K-G----------VKSE......EV------
F3KCM4_9GAMM/8-84-----------------------------------------D--FM-L-S-G----------.IPN......AI------
F5ZG84_ALTNA/45-117-----------------------------------------T--YK-I-N-G----------VKQD......KL------
I1YE94_METFJ/23-103-----------------------------------------S--VE-I-Q-G----------.VND......TI------
Q5QXU5_IDILO/24-102-----------------------------------------E--VA-V-S-G----------.VEG......DE------
G9ZFZ7_9GAMM/52-131-----------------------------------------D--ID-I-R-G----------IDNI......QQ------
A0KIJ0_AERHH/45-117-----------------------------------------T--YQ-I-K-G----------.LKG......EN------
E0SEC4_DICD3/41-116-----------------------------------------R--LQ-L-T-G----------.LEG......EL------
A0A0A3W7U2_9GAMM/233-298-----------------------------------------E--..-.-.-.----------.AYK......NL------
Q83EW0_COXBU/33-112-----------------------------------------E--VQ-I-A-G----------.LPP......TP------
H3KF74_9BURK/135-211-----------------------------------------S--VQ-V-K-G----------.LQG......AV------
A0A0F3KYT3_9GAMM/26-103-----------------------------------------V--LN-V-D-G----------.VDE......NL------
M4U484_9GAMM/45-118-----------------------------------------S--FQ-I-E-G----------.LDR......DE------
A0A0F5EY31_AVIPA/36-112-----------------------------------------D--LK-V-I-G----------.VKGV.....KA------
D5WZA8_THIK1/95-170-----------------------------------------E--..-.-.-.----------..........DL------
U4K8U4_9VIBR/25-96-----------------------------------------D--LE-I-E-G----------.LKG......EL------
Q8EF72_SHEON/35-108-----------------------------------------T--LS-V-N-G----------.VDE......AL------
A6VL94_ACTSZ/58-133-----------------------------------------D--VR-V-D-G----------.IRDD.....RL------
B9LYY6_GEODF/30-109-----------------------------------------E--IV-V-T-G----------.VED......EA------
A0A0B4XLV3_9GAMM/38-114-----------------------------------------S--LQ-L-S-G----------.VDG......EP------
I3DI46_9PAST/12-87-----------------------------------------D--IE-I-R-G----------.IKGE.....RA------
L0GVE6_9GAMM/28-109-----------------------------------------Q--VS-V-T-G----------.LSG......EY------
I4W4N9_9GAMM/26-103-----------------------------------------Q--LT-V-D-G----------.VAD......PL------
C0N1X6_9GAMM/31-109-----------------------------------------S--VE-I-T-G----------.VEN......TM------
L0DRI3_THIND/19-95-----------------------------------------E--LR-I-D-G----------.GTT......EQ------
K6YZU2_9ALTE/36-112-----------------------------------------E--VS-L-E-G----------.IKDG.....DL------
I8TC00_9GAMM/1-78-----------------------------------------M--V.-V-E-G----------.IDG......DE------
Q6ANA1_DESPS/46-124-----------------------------------------E--VT-V-E-G----------.VEP......EL------
H0J6T1_9PSED/10-82-----------------------------------------S--VR-V-Q-P----------.ANN......AL------
B7RZ71_9GAMM/20-101-----------------------------------------Q--VT-L-N-G----------.LED......DI------
Q6F9T5_ACIAD/236-306-----------------------------------------S--AD-V-K-G----------.APT......EL------
M9X0F4_MANHA/58-133-----------------------------------------T--LE-V-K-G----------.IQGK.....DA------
M1FHL3_9ALTE/33-110-----------------------------------------K--VQ-V-Q-G----------.NYP......QL------
D3SD66_THISK/46-123-----------------------------------------G--LV-L-E-G----------.GTE......FQ------
N8ZR61_9GAMM/246-316-----------------------------------------T--AS-V-S-G----------.APD......IL------
F9R7U5_VIBSN/25-96-----------------------------------------D--LS-I-R-G----------.LKG......KV------
A1SW22_PSYIN/24-98-----------------------------------------I--FS-I-K-G----------IDNK......DV------
N9GN96_ACIHA/239-309-----------------------------------------S--AD-V-S-G----------.APP......AL------
C9P280_VIBME/24-95-----------------------------------------D--LT-I-R-G----------.LSG......DL------
B8KVC4_9GAMM/60-132-----------------------------------------E--YR-I-E-G----------.VSK......AV------
B5E9K3_GEOBB/44-124-----------------------------------------E--IE-V-T-G----------.VEG......DA------
W0H9Y5_PSECI/26-98-----------------------------------------D--VR-I-K-P----------.ANP......EL------
A5EYC6_DICNV/37-117-----------------------------------------E--IE-I-Q-G----------IKDK......KQ------
A0A023NUA5_9GAMM/24-101-----------------------------------------Q--LS-V-D-G----------.VDD......PL------
A0A098G5T9_9GAMM/25-94-----------------------------------------S--LD-I-K-G----------.VTG......KV------
D0Z0D3_PHODD/26-99-----------------------------------------S--LK-I-K-G----------.LDG......KL------
F6AEQ8_PSEF1/15-87-----------------------------------------V--VS-V-Q-P----------.ANN......AL------
F4R1T0_BREDI/26-101-----------------------------------------R--AQ-I-R-G----------EIDG......DL------
A0A0A1AWH5_9GAMM/25-101-----------------------------------------R--LQ-L-E-G----------.LNG......EL------
G2E3U5_9GAMM/45-126-----------------------------------------D--VK-V-E-G----------.LSG......AR------
H1G3I7_9GAMM/38-114-----------------------------------------R--IR-I-S-D----------.VGD......EI------
A0A0F5V817_9GAMM/26-99-----------------------------------------E--LT-I-V-G----------.LKG......SL------
Q39RU8_GEOMG/46-126-----------------------------------------E--TV-V-E-G----------.VEG......EA------
A0A0F4NYM5_PSEO7/35-102-----------------------------------------N--IE-V-K-V----------.ENG......GV------
Q3A843_PELCD/51-130-----------------------------------------R--LE-L-L-G----------.LEG......DL------
B7VKX1_VIBTL/24-95-----------------------------------------S--LE-T-K-G----------.LDG......AL------
A0A090K8A0_9GAMM/8-81-----------------------------------------D--FE-I-K-G----------.VSG......DI------
Q1QWE3_CHRSD/29-101-----------------------------------------E--AS-V-E-G----------.LDG......PA------
A0A0C5WYE8_9GAMM/26-97-----------------------------------------S--LT-I-K-G----------.LKG......SL------
A0A077LKB7_9PSED/12-84-----------------------------------------E--VD-I-S-P----------.ANA......AL------
J3TGA3_9ENTR/28-104-----------------------------------------K--LK-L-E-G----------.LSD......EI------
V2UTL7_9GAMM/227-297-----------------------------------------S--VT-V-N-G----------.APK......AL------
W8RUQ6_PSEST/28-100-----------------------------------------D--VT-V-E-P----------.SNR......AL------
C6RNI3_ACIRA/259-329-----------------------------------------T--AT-V-E-G----------.APP......EL------
A0A024HHG6_PSEKB/30-103-----------------------------------------E--VR-I-N-P----------.SNS......AL------
A0A098GEG6_TATMI/22-88-----------------------------------------N--FY-I-I-G----------.VKG......KL------
I2JK10_9GAMM/20-88-----------------------------------------S--LE-I-D-G----------.GKS......EL------
I4VVY4_9GAMM/24-101-----------------------------------------Q--LA-V-D-G----------.VEE......PL------
D4ZL79_SHEVD/32-105-----------------------------------------T--LN-I-S-G----------.VNS......AL------
Q9CK26_PASMU/34-110-----------------------------------------E--LQ-V-K-G----------.IQNT.....QL------
C8ND15_9GAMM/55-134-----------------------------------------K--ID-I-R-G----------IKDK......TR------
G4T286_META2/54-130-----------------------------------------D--IV-I-S-G----------.VSS......GQ------
I3IFC5_9GAMM/27-103-----------------------------------------E--ID-I-T-G----------.GTK......GL------
I3CD79_9GAMM/43-124-----------------------------------------V--VN-I-T-G----------.VSD......TL------
E8UG99_TAYEM/32-105-----------------------------------------S--GL-S-P-.----------..........EE------
D3RSV5_ALLVD/31-112-----------------------------------------E--VR-V-E-G----------.LKG......ER------
H2FUT9_OCESG/17-89-----------------------------------------D--LR-L-R-G----------.LDG......EL------

PF17287

FHAC_BORPE/165-222--------------------------------------RIKG--WL-I.D-GKPLEG..............TRD------
A0A024HPR4_PSEKB/151-204--------------------------------------HLEG--FD-N.S-SLA...................S------
A0A068QSM5_9GAMM/152-206--------------------------------------KIRQ--VR-Y.S-D.E.SD................Q------
A0A068QWP1_9GAMM/153-204--------------------------------------FVEA--IE-G.G-D.....................R------
A0A077DEF9_9BURK/155-215--------------------------------------KIHA--IA-Y.D-QHE.AKETH...........IHR------
A0A077DEL8_9BURK/159-217--------------------------------------RVRH--TI-I.A-DAS..............RIPWFS------
A0A077DG26_9BURK/166-226--------------------------------------KIHE--II-Y.R-TTN.WNGRQ...........SEK------
A0A077FF06_9PSED/155-210--------------------------------------YLEN--IR-T.T-AGS.GL................S------
A0A077LIX7_9PSED/146-201--------------------------------------KLEK--LG-S.E-GPG.KV................S------
A0A089UNE9_9ENTR/153-207--------------------------------------KVRA--VR-Y.K-D.D.AD................S------
A0A089W4Y4_9ENTR/147-199--------------------------------------KLQA--IR-I.E-....GA................P------
A0A089WHP9_9PSED/110-165--------------------------------------KLEN--LR-S.D-AAE.GF................T------
A0A089Y7U6_9PSED/151-204--------------------------------------FVES--IE-F.A-DDS...................L------
A0A097QNW4_9VIBR/155-207--------------------------------------KIEQ--IL-L.N-....GA................P------
A0A0A1AZE4_9GAMM/149-203--------------------------------------HVGQ--LK-L.A-E.G.SS................D------
A0A0A1AZR9_9GAMM/137-191--------------------------------------KIRH--VA-M.T-P.D.SS................R------
A0A0A1B1E0_9GAMM/147-197--------------------------------------RIDK--II-I.Q-NNDVRH.................------
A0A0C4YLT9_9BURK/178-231--------------------------------------VIGQ--LR-F.A-EPD...................L------
A0A0D5V6B3_9BURK/190-245--------------------------------------KLGR--IY-F.A-GND.YT................G------
A0A0D5VBL5_9BURK/174-227--------------------------------------IVHQ--LR-F.V-DPE...................T------
A0A0D5VJY2_9BURK/187-259--------------------------------------KVSA--FT-L.N-GKPLRPRDPEEPWYTTHGGGLLT------
A0A0F3KZP8_9GAMM/162-215--------------------------------------TVRA--VR-F.A-PGS...................A------
A0A0G3WHT9_9BACT/148-209--------------------------------------YIED--VV-F.Q-NAAGKKYPK...........FFN------
A0A0K8J9J5_9FIRM/159-212--------------------------------------TIGE--IR-F.A-DKN...................T------
A0A0L0GTD6_9ENTR/141-193--------------------------------------RLQQ--IR-L.E-....GV................P------
A0A0N0GNX9_9NEIS/169-224--------------------------------------KVGA--IA-F.Q-PDS.PA................A------
A0A0N0VK45_9PSED/154-209--------------------------------------KLEG--LK-G.A-EGS.GI................S------
A0A0N0XI56_9NEIS/174-242--------------------------------------TIEG--FT-L.N-GQPFRPTQA....PEARNGGGLT------
A4ELV7_9RHOB/88-141--------------------------------------ELAA--VT-F.N-GED...................K------
A4W4W2_ENT38/162-214--------------------------------------KLAE--IR-L.E-....GK................T------
A6T6A6_KLEP7/149-202--------------------------------------KVGA--ID-Y.A-DGS...................D------
A7I3H8_CAMHC/146-203--------------------------------------KIDT--IN-I.N-DKNSTK................N------
A7MPM4_CROS8/152-206--------------------------------------TISD--IV-F.K-G.D.GE................E------
A8ETC5_ARCB4/143-192--------------------------------------KIED--IE-S..-......................E------
A8GK57_SERP5/151-203--------------------------------------KLEK--IQ-L.E-....KQ................D------
A8GL33_SERP5/148-202--------------------------------------RVNS--IK-L.S-D.D.SS................G------
A9BSR0_DELAS/158-217--------------------------------------RIEQ--LL-F.N-GTPVGP..G...........DDQ------
A9I252_BORPD/159-211--------------------------------------RISA--VQ-S.T-G.....................G------
IBPB_HISS2/173-229--------------------------------------KVND--IL-V.E-EQQASL..............FKD------
B2FLM0_STRMK/159-213--------------------------------------VIRQ--IR-FNA-EEI...................P------
B2FUC7_STRMK/181-235--------------------------------------RFRE--AV-F..-..S.DPQ..............GR------
B2JV22_PARP8/174-227--------------------------------------TVRH--LR-F.A-DPD...................T------
B2JXG1_PARP8/187-256--------------------------------------RIET--YT-V.N-GQPVHRLKRDE...RAAGGGWLT------
B2UCG2_RALPJ/151-205--------------------------------------RIGA--IR-N.A-SDN...................N------
B4EST2_PROMH/115-167--------------------------------------KIKS--IF-I.D-NMT.SP.................------
B4F0Z8_PROMH/151-202--------------------------------------FVER--IE-G.G-D.....................R------
B9JE38_AGRRK/160-215--------------------------------------TLSD--IY-I.N-GKP.AP................G------
B9NWW3_9RHOB/159-213--------------------------------------RIEG--YV-YGT-GKP...................A------
C0AU17_9GAMM/159-213--------------------------------------RIHE--IR-F.D-D.N.VS................W------
C0AWE4_9GAMM/75-126--------------------------------------FIEK--IE-G.G-D.....................R------
C0B146_9GAMM/156-210--------------------------------------IIRN--VK-F.T-D.D.SD................K------
C0N7I3_9GAMM/155-211--------------------------------------KIEK--LM-L.D-NNTLGA................R------
C3KAG1_PSEFS/153-208--------------------------------------KLEG--VK-G.G-PGS.TV................T------
C4GNC2_9NEIS/182-241--------------------------------------KVRS--VR-F.E-Q.K.DAQEH...........TER------
C5AEA8_BURGB/199-252--------------------------------------VISA--IR-F.A-DPS...................I------
C5B941_EDWI9/171-225--------------------------------------FVHD--VR-L.T-P.D.SS................T------
C5BAK3_EDWI9/164-218--------------------------------------IVRD--VQ-L.T-P.S.SS................S------
C5BBG6_EDWI9/155-206--------------------------------------FIER--IE-G.S-D.....................R------
C6JLC2_FUSVA/140-194--------------------------------------HIEE--IR-F.K-DKS..................KG------
C6JMM4_FUSVA/140-195--------------------------------------HVEK--IV-F.K-GEE.................GQK------
C7LTZ9_DESBD/162-218--------------------------------------EVES--VM-L.N-EDS.AA................D------
C8NAG2_9GAMM/162-214--------------------------------------KIAQ--VR-..E-NKT...................N------
C8NB14_9GAMM/167-223--------------------------------------YAGT--VS-L.A-PESAGQ................R------
C9LS33_SELS3/149-202--------------------------------------RIHA--VR-F.T-EGS...................D------
D0GKG4_9FUSO/102-157--------------------------------------KIEE--VV-LDK-DTG..................KD------
D0IXU8_COMT2/175-229--------------------------------------VLRS--IR-F.T-PDSTGD.................------
D1BMQ4_VEIPT/212-265--------------------------------------RVES--VL-Y.K-TYA...................Q------
D1BNY4_VEIPT/156-209--------------------------------------YVED--II-L.T-NPK...................A------
D2RM30_ACIFV/149-203--------------------------------------IFHG--FR-N.P-D.G.TA................V------
D2TSU8_CITRI/142-196--------------------------------------VVRH--VR-L.T-P.D.SD................D------
D3V2Y6_XENBS/38-92--------------------------------------TVRH--IR-Y.T-D.D.SD................K------
D3VA35_XENNA/161-213--------------------------------------KVGA--IL-L.D-....GE................T------
D4GL27_PANAM/168-220--------------------------------------KLDT--II-L.D-....GK................H------
D4S825_9FIRM/155-208--------------------------------------YMGE--IK-Y.A-EGS...................P------
D5V606_ARCNC/143-192--------------------------------------KIED--IK-S..-......................K------
D8INY9_HERSS/172-225--------------------------------------IIHA--IR-F.K-DPA...................I------
D8J1G4_HERSS/166-220--------------------------------------KIRA--IR-F.A-D.N.AD................P------
D8MR72_ERWBE/151-205--------------------------------------KISH--IT-R.T-D.P.SD................R------
D8MSB0_ERWBE/148-200--------------------------------------RLDS--IR-L.D-....GA................H------
CDIB_DICD3/152-204--------------------------------------RLEK--IT-I.N-....NQ................T------
E1SHC2_PANVC/149-201--------------------------------------RLEE--IR-L.Q-....GA................R------
E1SI81_PANVC/161-215--------------------------------------KVGK--IV-L.N-K.S.GE................D------
E1SJQ8_PANVC/157-211--------------------------------------RIRN--VE-L.S-P.A.SS................R------
E2CR53_9RHOB/145-199--------------------------------------RIEA--VE-L.Y-Q.N.GV................R------
E3BH39_9VIBR/168-219--------------------------------------EIEA--IV-G.D-S.....................E------
E5AMD0_PARRH/229-282--------------------------------------VIHA--VR-F.S-EPT...................I------
E5UJT7_NEIMU/157-208--------------------------------------KIRE--IT-G.G-.....................SR------

PF06898

F6B8F3_DESCC/8-408KRKLLAIGSVVFLVTLYILSSFVWFIDV..TG..TD.KLSKAEVQRIAAEAGLKRGVLKQQL.DTK------LV------
D4JTF7_9FIRM/10-387KRWGLVTGALCCCAVIVLLSQFVWRIDI..IG..NS.EVTDTQICAVMEKNGLMPGCSRKSF.DEW------VC------
R5L248_9CLOT/7-384GRWGVFCGMLFFVLLVSFMGGFIWNITV..IG..NQ.TLETSKIVDYLAQNGFKTGVRWSET.DKE------NL------
R7QWQ5_9FIRM/7-391RRKLFFGGILLFFLILILLSQFIWNIEI..NG..NS.YITDETVLAYLKEQDLSFGTPKKKI.DAE------KL------
L0FBK0_DESDL/7-397RRKFLLGGILLIGITLAILSQMILSISV..SG..NT.TISSVEIFDSAEKHGLRTWTWQDSV.DLS------KV------
R6I0K6_9FIRM/6-384RRAVFLLAFVLCVSLAAVSSLFLWRIEI..SG..ND.KLSDAEILRKLAECGVDYGAYWPAL.SSD------EI------
L0EFM5_THECK/10-388RRKFFAAGLVLFFIGLYLLSSLIWRIEI..EG..NE.RLTDEQILAAARAEGLHVFQWSFRLPGAE------EL------
U5MNL2_CLOSA/5-371RRMSLVIGAGVFFLVIYCLSNYIWAIDI..QT..KN.NLSPFEVRQQLTAVGIKPGLKKSQI.NVY------DI------
R6SYS4_9FIRM/4-378GRGGLVIGTAAVMLSCFYLSNVVVRFDILSDD.....ENIRKGVMSVLKEEGVETGTYIPSI.DLI------VT------
R7F0N3_9BACI/3-369KKYYLVIGAFLFCLILYILSSFCFQVTILEND.....AEFREVLKNELERYGIAPLHLQVSYAKKE------EI------
R7P4H2_9CLOT/3-367CEKIFIISLLIGLITLILLSNMIFKIEIIHEN.....KDIRDLIKEELDNYDIKVLHFKKSYKDLN------KI------
Q0AWN4_SYNWW/7-394RRLGFWVGAVIFIAALYFMASFIWFIDV..SG..NQ.KVDKSRIIMTAARYGIYPGAPRWTF.SRS------EV------
I0JP38_HALH3/8-385QRKALMAAFMLSVVVVFLLANTLWSIKV..EG..LT.PELEANVEKKLKTYGVSPGKLTIGMDDPN------DI------
R7H622_9FIRM/5-371FRFGIPIGLLLAAAFLFYTSNVVMKIEI..QG..NQ.TVTEEEILTVLAQEGVERGSWMPSL.RYA------HC------
B2A1M5_NATTJ/8-399ERKLLTGGIIFTLVVLSYLSSYIWFIDI..TG..ND.RVNDEEIHEILAKHDLQQGVKRSAV.DIH------EI------
A5N6N1_CLOK5/11-376KRITLVTGIILFIGIIYYLSTFIWSIEI..TS..DK.GLPPYIIRQQLKNYGIKPGINKSKV.NIY------KI------
C8W3N7_DESAS/8-411RRKMLLAGAIIFVVSLYSLTSFIWFIEV..TG..TS.KISNEAVLRAAKNAGLKRGVLKWNL.DTA------EF------
R6MSI1_9FIRM/8-382QRVGLLIGAIIGIVLIAVLSKFIWYIDAPPTK.....SLSTSQILSALEEDNVKVGSYINSI.DTE------NT------
B8CXJ2_HALOH/7-376QNYFLLVGFLILFLILYVGSNFLLFIGI..EG..LE.KIPEERIINILKEEGVRPGILKNRV.NPE------RL------
W6RVC1_9CLOT/10-376SRISLVIGIVIFFLSLMLFNEIIWSIDI..KT..EK.NISPFEIRNLLYKEGIKEGTFKRKI.NYE------DL------
D4LTE1_9FIRM/6-388KRKAFFIGIFACALLLAVLSGRVWEIDV..LG..NV.RNSTQEILDFLKEEGIVHGMQRSKI.SCS------AI------
K0B1J4_CLOA9/8-387YRKMLLLGLVFSIFIIGYLTSFIWTIDI..VG..NE.NIKDEVIRKNLESINVKQGIRKKDL.DIE------DI------
R5NSB5_9CLOT/8-384KRKVFLIGLILVILSIYSLSKFIWNVEV..EG..NE.RISKDEIINVFKEDGLKPGIVKSKV.NVQ------EI------
R5HMY8_9FIRM/8-391RRYALLAGVALCLVLFAIGSRTVLTIDV..TG..NE.TVTREEIISQLRLCGVSVGTYGPGI.PIR------EV------
C0ZB79_BREBN/7-385RRSGLAIGAALFFIGLYMLSSFVWSVEV..SG..TK.MVDPRRVIQAAEQVGIKEGAWKVKLKEPL------VL------
R6XDX7_9CLOT/8-386KRKIFVIGLAMVLITIFTLSKFIWNIEV..IG..NE.KINADEIIQIANENNLKIGKFKNKV.DTK------KI------
A8MG63_ALKOO/8-387KRKMLLVGAFFCFTLLIFSSTFIFSIEV..SG..NH.QLERGKIIGILNDLGLKPGANRYKI.NIK------DI------
J7J0E9_DESMD/7-385RRKGLLIGIVIIASVLTILSQLVLSISV..TG..NK.NLVAADVIERAEKLGLRTWVYSKDL.DLN------GI------
B8I730_CLOCE/8-390NRKAFIIGSAACIITFFIISSFIWDVSV..TG..NE.KVSTEIILGKLYENGIKPGAFKFSI.NPD------NV------
Q97JI9_CLOAB/7-373NRLSILVGIAAFIACVFYLSTFIWQIDI..VT..EK.NIAPYDVRQDLREIGVQPGMKKSSL.DVY------KI------
R5T3J2_9CLOT/7-380KNYIFYTAIILGLILLFILSKMIFSIEVIHSN.....KDIRDLIYKELNYHGINTFTFKKDYHKLE------SI------
R6C1Q2_9CLOT/6-386KRKAFLFGLCLACFFWFVSTRFVWEISI..TG..NN.SLTDDRFTTFLQEEGIFVGCQKKNV.DIE------SL------
K4LIU5_9FIRM/7-395KRKGLIFGVFIIIAALTVLSQYVLSISV..EG..NS.RVSANQIIAEAGKAGLNKWVLKSSL.DLD------QM------
R6UCV3_9CLOT/10-387KRKLIFVFLFLIIVFSIAFSTFIWDIDI..VG..NE.RVSKEIIISKLKDSGLYIGRNKIGL.DKK------EV------
R6N4A7_9CLOT/7-383HRLGLLAGIALFFATIWFLSLHVWVINV..SG..ND.EITEEQVISVMDEIGIRPGVRTSGL.DAE------LL------
I3VX08_THESW/8-382RRKMLVLGAVACVVLAYLFSMFIWSIEI..DG..GQ.NISEASIISELDKLGLKAGVLKPSI.DIH------KI------
B0TAE5_HELMI/7-400RQRSLVIGVISFVLTILIMSTFVWDVEV..IG..ND.RVDKQQLLQAAAEKGIRLGRWRPLI.DVR------EA------
R5TPA1_9CLOT/8-390KRKLYAAGLASFFVLLYILSIFIWDIEF..EG..NH.MYTYDTLLKYCETEEIRYGMVKSRI.DCD------AL------
R5QI90_9FIRM/5-375KRAGLALGFILAAALIFVSTLFVWDIRI..VG..AE.NTEEEEIFAALERRGFRIGAYIPSL.DKE------RI------
R5KWN8_9CLOT/12-386KRKIVVLLVALAIFVSIASSTFIWNIDI..DG..NS.YISTDELRKALKESGIFIGSCKIGI.DKK------EV------
N0B454_9BACI/7-385RNSGIFVGAFLFLFIVLFLSNMVWRVEI..SG..AN.PATEYKIYKQLDKMGIKTGRLQFFIDDVE------TI------
F8I923_SULAT/7-394RQPWIWAGFLGALALVLYASLHIWVVDVTATN..LS.PAETQALLKAARSAGLAPGVWRNRL.DIP------RI------
D3E517_GEOS4/9-385KRKAFVIGVVAFFMILLTLSSMVWNVEV..EG..NE.TIASEDVLDAAKQEGIYPFQWIFKLQSMD------KL------
R6H3U2_9CLOT/8-388KRKLFFGFLLLIIIMLGITSNFVWNIQIVKQD..EN.NLDLNSIYQDIAEAGLTVGVKKSKI.NTK------EI------
R7F7B5_9CLOT/8-387KRKFFLAMFLIIILALFILSKFIWNIEIKITG..DD..LTEEKILSSLNENGLFIGERKSDI.DIK------EI------
R7M7L8_9CLOT/8-385KRKIFALLFLLVIIAMFTLSNFIWNIEV..VG..NN.KISKDEIIKSLSDNKFKIGMSKFDL.NTK------ET------
R6TJX8_9FIRM/7-385RRYVLLAGLGLCAAAMVYGSFFIWDFQV..EG..NE.TVPDEEILRALEQNGVGIGTFSFSL.DPE------GL------
Q67S30_SYMTH/7-404RRPFLLAGALGGLAALVWAGSHLWVVDVRING..PG.YLDPRAILAVAAEAGLRQGAWKARI.DLD------HV------
R5F5D4_9CLOT/9-390KRWYYGAGIMAFFLVLYVMSLFIWDIQF..EG..NY.RYTYDTLVRFLDTQDIDYGMLKARI.NCE------DL------
R5Q8Y0_9CLOT/8-386KRKVFLIVIILVFALLFGLSRFIWNIKI..EG..LD.KIEKREIETILNDNGLTTGKLKSAI.NKQ------KI------
R6M0R0_9CLOT/7-380KNRFILLFLLLSMIIIFILSNMIFSVEVIHSN.....SKIIKLVTEELKDRGIKKYAFAKSYSEVE------KI------
R5YC97_9FIRM/7-392KRKIFFAILAAMLVFTTILSTRIWRIEI..IG..NT.SIGEETLLSYLRKHDISYGTQKESI.DND------AM------
Q8RB55_CALS4/13-387KRKGIVLGFLLSVLLVYLFSTFIWEIDVKTVN.....GLKEEEVAKKLSEMGLKSGVSKFKI.DIN------KL------
F4LSY6_TEPAE/8-387KRKAFLFGALLFVVAIYLMSSFIWNIEIKCSD.....NDLSTSIIQDLREWGLREGTFKYGL.DKQ------YY------
R6LHZ6_9FIRM/6-383KRPLFPLLLALAILMGTSLPRFVWFYEV..TG..NE.RVPAQKILRELDALGVGFGTYGKSI.QPQ------WV------
A4XKI6_CALS8/4-376TFK..LISILFCILLLFLFSLFIFDVKI..KSHDSN.KLVDDKIVQTLKNYNIKPFTLKMKI.DQE------KL------
R5T032_9CLOT/3-372RNRVFFVGLVISYIYLLLLSNIIFSVDVIHSK.....AYIRELLYSELKSHGISKYNIVKSYKTKE------KI------
R5B397_9CLOT/7-382FRKALLYGWMVVLALIIAASRYVWIVDV..SG..CD.RVDADKLIASLKDMGVGIGTHKRAV.ATY------SL------
R7DBV9_9FIRM/6-388KRKAFFLGLLLCAGLLLFLSGRLWEIDV..EG..NV.RNSTPEILDFLEQKGIRHGMAKERL.SCS------EI------
R7FM48_9CLOT/8-386KRKLFFVFLLVIIIGLGISSNFVWNIQIVEED..KG.SIE..NLYQDVVESGLEIGKMKSKI.NTK------DI------
B1I691_DESAP/9-398RRKTLALGVVFFLTALYVLSSFVWFVEV..EG..NV.KVGEHEILQAAREAGFYRGAPKWRF.EVF------AV------
R7IV24_9CLOT/8-386KRKIFVITLLVVTILIGISTKYVWNINI..QI..DS.NMEMIGIEEDVKEAGLNVGMKKEKI.NVQ------EI------
C9RAM9_AMMDK/7-391RRRAFLGGALFFLALIYFLSLFVWRVEV..TG..AQ.KLSPAEILKVAAQAGLKPGVLHRQV.NGK------EV------
R5XPL9_9CLOT/8-386KRKIFAIALVSIICVIIYLSNFIWNIEI..VG..TD.KINQNELIKTINSEGLTIGKLKRKV.DLK------SI------
A6LRP5_CLOB8/4-370RKISLVIGMGLFFAVIYILSNYIWAIDI..ET..QR.NLSPFEVRQQLSSIGIKPGLNKSQV.NVY------QI------
Q892R7_CLOTE/11-377RRRALILGCILFAIIIYYLSTYIWRIDI..IT..EK.NLSPYEIRMELLNYGVKEGVKKKNI.DIY------KL------
R7HMN6_9FIRM/7-380KDIFILSSLLISLLLIYTLSNIIFKIEVIHSN.....NNIIKLVTKELEDNGIKKYKFVKNYQEIE------KI------
E6U532_ETHHY/8-382RHLGILVGLAVFLALVWFFSSFVWEVDV..AG..NQ.SVSSAQVEHVLADLGLRPGAFSMFL.QVR------YI------
D9R1A2_CLOSW/7-388KRKLYAAGFASFFLILYSLSLFIWDIEF..DG..NR.MYTYDTLIKFCESEEIRYGMRKSKI.DCD------VL------
R7L9N0_9CLOT/9-386KRKIFALLIFIILIIIAILSNFVWNIQI..EG..TE.KISKDELIQTLKEEGLSIGKFKPGI.ETR------EI------
A5D3V9_PELTS/9-406RRKALVLGAVFFIGTLYLLSSFVWFIEV..KG..NE.RLSAAEILEAAAEAGLVRGAPKWRF.DAA------GV------
E3E8L2_PAEPS/9-385KRKFFLAGLALFWIGLLLMSSLIWDIEV..KG..ND.KLPTESILKAARQEGLYPFQWSFRLSSQD------KL------
R7I713_9CLOT/7-390KQKGVILGFVSGIMLMYGLSLFLWDISF..TG..QS.YYTEEQLLSYLNTIQIHTGIPIHRI.NCQ------DI------
E6TW41_BACCJ/7-385KRNGLLFGAAAFFALLYILSNMVWGIEI..EG..AS.APVEHDLREAVTDLGIKQGAFQFRLPPPE------EI------
X4ZFY3_9BACL/8-384KRKFFATGLLLFGIVLVMLSSLVWTVRV..EG..ND.RLASEDVLDAARKEGIYPYQWIWRMDSPD------KL------
R5CSR2_9FIRM/6-384RRFVLCIGVGVCIVLLAISSLFVWRIDI..TG..ND.TISDGVILRALSECGLKNGVFWPAL.SSD------EV------
E6UAB1_RUMA7/4-383TRPGLIFGALLSALLMAYYSNVILTITV..DT..DD.PAIYGKVMDVLDTDGVKPGAYLPDI.DLV------LE------
R5D9M1_9FIRM/7-386RRYVLLAGAVLALVLMFGGNLVIWDFQV..SG..ND.TVPTETILRALEDYGITVGSPGLHI.DQE------TM------
Q8EPX5_OCEIH/7-397KKRFLVIGILVGVLFFLFLSNLLWSVNI..TG..VP.KEIEEKIKVQLDSYGIHSGVWLFSVDSPK------DI------
R5IHX3_9FIRM/8-382KRPALLILLAAAIAAGIVVPKYVFFYEV..EG..NE.AVPSAQILRELRELGVGFGTYGPSI.KPQ------EL------
Q24SU1_DESHY/7-393RRKFLLAGIMIIGVALAVLSQMILSISV..SG..NT.TISSQEIFDSAEKHGLKTWTRQDSV.DLN------EV------
Q9KD59_BACHD/9-387NRVGFVGGIGLAIVLMFILSNIVWSIEI..KG..AS.PKVEHELRQLVEELGVKRGAFQFTLPSVE------DL------
R5XQE7_9CLOT/3-370RYKTMVFSAIVSLFLLLLTTQFVTDIYI..DC..PE.GIDKKVLRQELEECGLKPGVYKKTI.NRK------II------
Q3AEZ9_CARHZ/5-371KRPGIIAGLFLLLGIIYSLTGFIWFIEI..DGFSGR....QREILDILKARKVKPFVRKKAV.DEK------ML------
F6CMU5_DESK7/8-406RRKALAFGAVLFVLGLYLLSSFVWTIEV..TG..NS.RVPTKEILSVASAAGLNRGVPKWRL.DCP------AV------
F2JQA7_CELLD/7-387KRRFFVAGIVVFIAMLWLLSSFVWLVEV..EG..TE.RINSLDIIKSLEKKGYETGKLKSKM.NLR------EA------
U5LCI4_9BACI/7-385KNSGFLFGAASFLVILILLSNMVWGIEI..KG..AD.PATEYKIRRQLDEMGIRKGKLQFFVKNVE------GI------
A8FFB9_BACP2/7-386KNIGFTLGIVFFLATILALSNMVWKIDI..KG..AN.PETEHQMRKHLDEIGVQKGRFQFLMGTPE------KI------
L7VHP9_CLOSH/8-388KRKGFVAGLIVFAVLIYLMTSIIWSVEI..TG..NY.NLSRETLMQQLNEMGIFRGATKRSI.NPK------HV------
R6D0A8_9CLOT/8-382KRIGLLTGVLVFALVLLLSGEFVWEIRV..NG..NE.LVSEQEILQSLEEMGLKRGVWKNSL.DVQ------KL------
Q65H67_BACLD/7-386RNSGFTFGVAAFFIIMFLLSNMLWKIDI..TG..AN.PETEHQIRQQLDQIGVKKGRFQFSMLTPE------KI------
D9QV99_ACEAZ/7-405VRKSLLVGVVVAVMMLYLLSSFIWSVEI..HG..LS.ELSEEKIVNLLKDSGFEYGMLKHTV.DIE------EL------
C8WY36_ALIAD/8-383RRKAFAVGAVAFVAILYALSSIVWRVEI..VG..AEGEDQEAELRQAAAEAGLQVGQWKSHLAPPV------EL------
Q2RKW7_MOOTA/8-408GRQLLLAGVLFFLVAIYILSACVWVVDVRPEKGTLR.QVTPDQVIAAARAEGLKPGAWKGRI.DIR------AL------
YQFD_BACSU/7-386LNIGFTIGFAIFFILLFLLSNMVWKIDV..TG..AK.PETEHQMRQHLNEIGVKKGRLQFLMMSPE------KI------
Q5KX07_GEOKA/7-385RNSGFWLGLLLFIAIVFLLSNIVWKIEI..KG..AA.PETEHQIARELKRMGVERGVFQFLLDDPE------TL------
R6XTI8_9CLOT/8-386KRKIFVGLLAIIFIALFMMSKFIWNIEV..KG..NT.RISKIEILEELSKNGLKIGTYKGKI.NAN------SV------
R6NIT4_9CLOT/8-386KRKIFLILLILITCFIGFSSNFVWNVEIKEEN..GQ.KLE..NIEKDIENAGLKTGILKSKV.KTK------EV------
R6G2U3_9CLOT/4-369KRYSIVIAVVVFFAIIFFLSTYIWSIDI..TV..GK.NVTPFEIREQLKEIGISPGVRKASL.DEK------EI------
R6QWU5_9CLOT/7-381IRSGLLVGAILYIAISIILSGYIWNININTSG.....SINEYELREELRSLGLYEGAKISDI.NIQ------DI------
F4A357_MAHA5/8-386RRYMFIAGFILFFVIIYILSSFIWTVEI..SG..NA.RVSGQRILEELADSGLKPGIRREGL.SIN------DI------
R5ITB3_9CLOT/7-378INRSFIFSIIIGVILLILLSNMIFTIEVSHTD.....NYLKELVLKELNKYGIKEYRFKKSFDELT------DI------
R7IQG8_9FIRM/7-393KRVPFCFGIATSFVMIYVLSLFIWDMQV..DG..NY.TYSSYEILRFLKEEGVSTGVKKAQV.NCD------AV------
F6DMW5_DESRL/8-408QRKLLAIGAVVFLVTLYLLSSFVWFIDV..TG..TD.KLSPQQIKGIASQAGLRPGMAKWNL.DVK------AV------
R7L3Q3_9FIRM/6-381KRYGLVIGFMLSVGITAFLNDRVMMIEI..GG..NE.TISDSRIISLLEDTGISIGSRISDI.DLR------QA------
K0J274_AMPXN/9-396NFHQLLISLFIACLVFLYLTQSILFIQI..EG..VP.TEMEKQLLTSLNNYGIKKGKLKLLMDKPD------QI------
I4DAP4_DESAJ/7-400RRKGLIAGAAVIAVGLTILSQLVLIISV..TG..NK.NIQTSDILQRAEKLGLKTWIYSKGL.DLN------QI------
D7CNW5_SYNLT/8-391RRRMLMWGAGLFVLALYLLSSFIWVIEV..NG..NV.NLSTETILKAAARHGLYEGAMKWNL.AKT------DV------
R5Y9N3_9FIRM/7-382ARWGIFAGILFFVAFNSFMGGFIWNVTV..VG..GT.ALQQGKIVDYLAQNGFKTGARWSDT.DKE------NL------
R4KCE0_9FIRM/7-406RRRALLGGALCFVIALYALSSFIWFIDI..TG..NQ.SVTEDKIARVAREAGLYRGAPKRSL.DTA------EL------
R6YI22_9CLOT/2-369KNKVFIIMAILGLLFLIYLSNTIFSVNIISMN.....KDLNEKIIKELDSYGIKKYHLKKSYDSIE------KI------
G8M1A5_CLOCD/7-388RRKTFVAGAVLFVLLFYFMTSFVWSIEV..TG..NE.KLETEVIMDKVYQLGVKPGVLKYRI.NPH------DV------
K4LKI1_THEPS/8-398RRRMLLVGAVVFCLILYCLSSFIWTVEV..SG..TR.RISQQKVKELAAEAGLRPGSIRFQV.QRD------EV------
G4KWF7_OSCVS/7-385RRQALVACLIVCALALFFGSFFIWDITV..DG..AV.TVPEEEILRALEKNGVGFGTFGFSI.DGE------DL------
R6NSX8_9FIRM/7-390KRYLFLIGFALCIIFFAVSAQFIWVVEI..NG..VE.NSDINGIISTLDSIGIKSGALKAKLPDGM------ES------
R6RMK3_9CLOT/7-391KRKPLAAGFICFFLLLYGLSFFIWDISF..EG..NL.RFTDQMLLHYMETLPVACGMRKSAV.SCE------EL------
A3DEC5_CLOTH/8-389HRKTFLLGAAVFVVLFYIMTSFVWSVEV..VG..NK.KIETDGILKCLEKYGVKPGVLKYRI.NPE------EV------
R6GJ09_9CLOT/6-381KRKGIFVGILCFGLTLYFLSLYIWSIDV..QG..AT.TLDKNELSNLIGGLGVSAGTLKSEI.DTP------ML------
D9S2Q3_THEOJ/8-389RRKALIGGVLFFIAIMYILSSIVWSVQV..NT..QD.ETLKLSILKDLEEWGLKPGVFKHNI.DKK------YY------
D4LCN8_RUMC1/4-373FRYGAVLGVLGILLVFFWVSNLIVKVEV..TG..NA.AVPEAQIRRVLEEIGIDQGAWIPGI.DFR------MC------
C5D4T1_GEOSW/7-385TNSGFLVGVCFFFVIVFFLSNMVWGIEI..KG..AK.PETEYRILKELKQMGVEKGALQFLIDDPE------TI------
W0EAS0_9FIRM/7-398RRKTLMAGIFIIGMSLIALSQMVLSIQV..TG..VK.MIPEEQLLQSAEMHGLKTWVWQKDV.NTR------EI------
F9VJJ5_ARTSS/9-374VYFTLSIGIGVSIGIIMFLSMFIWRIDI..EG..DK.HVSPYEIRQAIKDLGVHKGMLKFKI.DTD------KL------
A0Q1Q5_CLONN/8-374KRKTLLIGIGIFVGIIYYLSGFIWNVNI..IT..EN.NVTPYEIRSQLKDMGIKPGIRKNKI.NVY------NI------
F0SVD9_SYNGF/7-392RRKGLIAGIFVFLLSLIVTSQFVLTVSI..EG..NN.NISSQQIAVKAGELGIKKWAYKNSL.DLN------GL------
D9SW54_CLOC7/9-375ERKIIMTFPIIFIVVIYLLSSRVWIINI..KT..QN.HLAPFEVRGILKDLGIKEGIKKANL.NVF------KL------
G2TNK7_BACCO/7-385KNAGFLFGFFLFLAVITVLSNMVWGVEI..KG..AT.PKTEHEIRKQLDKLGIQTGHSQFFLDDIE------TI------
Q8XIU3_CLOPE/5-374KSISIFVGVLIFLVGLYIYSGFIWRIDI..ET..KK.NIAPFEIRTMLNDFDIKPGVKKSSV.NVY------GL------
R5HCW7_9MOLU/9-376LNMFLLLFSLFGIFIIVFLSNVIFKIEVVHNS.....SDVRKFILNELETYNIKERTFKKSFNELQ------TI------
R7MJV7_9FIRM/5-378LRFGIVIGILAFIFTCFYFSNTVMTIEV..NG..NS.RVKESVILSVLNDMGVKKGTCLNDI.NYS------KC------
R5AEU1_9CLOT/3-374QRKTLLLGLAAALACIVIASTRILFIRV..SG..CS.RVAEQTVLRALAAEGLTVGAGNRGW.DLP------EL------
R5JAK2_9FIRM/6-375ISKHLIILTIIAFAIFLFFTHVIFDVEVIHSN.....KDIRNLLLNELKAEGIKKLSFKKSYNEIS------KI------
R5JWC6_9CLOT/7-386KRKLLVLGALIGCGLVYWGSLFIWDVNV..HG..TY.FYTDAQVADYIEQNAVQLGCRKAEV.DCH------QL------
L0KBA1_HALHC/7-398GRKVLAIGIVFVIVSIYIMSHFVLFIEI..KG..TK.ELKEEEIISLLNQVEIYPGVLKSSI.PLH------DL------
R5X7Q5_9FIRM/6-388KRKAFFLGIFLCGMLLLMLSGRIWNIHI..EG..NR.ANSTPEILKFLEDQGVSHGMKKKSL.NCS------AI------
R7NE92_9MOLU/3-369KNNLIIIGIIFASIVFLILSNVIVKINVIHEN.....SELRELIMDSLKEKGVTTLSFKKSYDEYE------AI------
D3FY22_BACPE/7-385LRAGFVAGLAACLAVIIVLSNMVWKVEV..EG..AS.PHVEHELRQVVAEMGIKPWTFQFSLPSVE------QI------
Q5WHE5_BACSK/7-385IRAGFAIGMVAFFMLMLFSSSMVWGIHI..KG..AS.PHVEQELREVIDEIGIKRGAFQFKLPQPD------EV------
B2TM04_CLOBB/5-371RKLSLCIGAGVFLLVLYVLSNYIWAIDI..QT..RN.NLSPFEVRKELTSIGIKPGLKKSDI.NVY------NI------
A6TSK6_ALKMQ/8-387KRKMLLLGAFFSLLLLIFTASFIFTIEL..IG..ND.KIQEEEILEALNESGLKIGSNRYLI.DRN------EI------
G7MCG1_9CLOT/5-371KRISLVIGAMLFFVVIYLLSNYIWAIDI..QT..ER.NLSPFEIRQQLSSIGIRPGLSKSSV.NVY------QL------
Q182D1_PEPD6/3-370KHKGMWICALVSLFLLMSTSQFVTDVYI..QS..PE.GIKKEALRNELYKVGVRPGVYKKSI.DRK------EV------
B7GKD9_ANOFW/7-385KNSGIVVGLVAFICIVFLLSNMIWRIEI..TG..AN.PAVEHTVRQQLKKIGIERGALQFVIPSPE------TI------
R6CV47_9CLOT/2-371ENYTFVISLIIGFLFLFLISNTILEINVVHNN.....SDLRNLIYDELKDNNISCFHFVPSFKKRK------KI------
D5XAQ9_THEPJ/8-405RRKMMVVGALTCVAVLYILSSFVWFIDV..AG..NK.KVSTDIILKTAEKAGLYTGTAKWKL.DSS------EV------
A5I631_CLOBH/5-371RRFSLVIGIFIFSFIIYFMSTFIWDIDI..TS..TN.GVTPYEIRQQLKKYGIKPGINKNTI.DVY------KI------
R6CYS5_9FIRM/7-389RRYVLLAAALVLPLLLAVGSAFIWDFEV..TG..ND.TVPTESVLQALERCGVRVGTRGVGL.DQD------EL------
R6BC91_9CLOT/8-386KRKIFAFFVILIAILLIVTSKFVWNIRV..EG..NN.KINQSEIVSMLEQKGLKVGTLKSRV.NSQ------EI------
R4KBT4_CLOPA/9-375NRIAMVLGIFIFIGIISYLSNYIWGIDI..TT..EK.NIAPYEIRDELKNIGIAPGINKKNI.NVY------DI------
C6CTU6_PAESJ/7-385KRKFFAIGIGLFFVGIYLLSSLVWSIEV..KG..NV.KLTEEQILTAAKKEGIFPMQWSFKLKDKD------LL------
R5AR68_9FIRM/7-385RYRGACAGLLVAVLAVLTSSLFIWRIDV..TG..NE.TLTTGQILRCLDECGVRPGTYWPAL.SND------LV------
M1LPE2_9CLOT/3-366KKFSLVIGAVMFFGVIYILSNYIWAIDI..ET..QR.NLSPFEIRQQLFSIGIKPGLSKSQI.NVY------DI------
R5A1X4_9CLOT/2-368TNKYMILSIIISLLLLRLLTSTIFEININTED.....QELKKEIFSSLNENGIDIYKKKKTFSELN------II------
R6Z4S5_9CLOT/6-387KRKLWAAGFFSFFMILYLCSLFIWDIEF..QG..NL.RHSDQELLNFLKTEEISCGVRKGGI.DCE------EL------
R5ACZ0_9CLOT/8-391KHKGMVLGALGGTAIYIFLSGFCWGVTV..TG..TE.VLTKTHVLETAAEKGVFVGASLRDL.DPK------EA------
A4J7E2_DESRM/8-408KRKLLVMGGIVFLIALYVLSSFVWFITV..TG..NE.KLTDAEIKKIAAEVGLTPGAAKWDL.DPK------LI------

PF07244

Q5F5H0_NEIG1/221-295PEQ-T.VSGLA..-...R.F..........Q-P--G...........----------------.TPYD..L---------
TP326_TREPA/186-273TES-V.LKKVL..-...S.T..........Q-E--ARF.......LT----------------SGVFK..E---------
Q98MC3_RHILO/107-184KDN-A.LAAAV..-...Q.L..........K-P--R...........----------------.GTFS..Q---------
Q6ARL5_DESPS/92-170KQE-D.VQAVA..-...N.I..........K-E--H...........----------------.RIIN..P---------
Q5NEP7_FRATT/354-428NDY-V.FRRQL..-...Q.Y..........Y-E--Q...........----------------.SQYN..K---------
Q5FPE9_GLUOX/347-432KQR-Y.LMNRL..-...E.L..........K-E--G...........----------------.ELYR..P---------
Q8KFQ6_CHLTE/212-301KES-K.LRGVL..-................K-E--TSQNSWWRKIFG----------------QPKLD..K---------
Q73JH4_TREDE/105-183RKA-D.LLSAI..-...K.V..........K-K--G...........----------------.DIFN..E---------
O84244_CHLTR/185-272EAS-D.LGDIV..-...L.TKQYSTTTSWFT-G--A...........----------------.GVYH..P---------
Q9I0U1_PSEAE/190-268EEE-L.LRRMV..-...P.F..........K-A--G...........----------------.QPYD..S---------
Q8EGG7_SHEON/97-177KDE-Q.LQESLD.-.GSG.V..........K-V--G...........----------------.ESLD..R---------
Q8KFQ6_CHLTE/304-389ATT-QILDTTF..-...G.I..........K-K--G...........----------------.DLYN..A---------
Q9KUB9_VIBCH/347-418SDL-L.LLNRL..-...N.L..........E-P--A...........----------------.QKLS..T---------
Q73JH4_TREDE/186-274PEK-A.LKKVLVS-KEAWLL..........Q-K--G...........----------------..FFR..E---------
Q98MC3_RHILO/360-433RDY-V.IRREF..-...D.V..........S-E--G...........----------------.DAFN..Q---------
Q6MAE9_PARUW/218-306EEH-E.ILSQM..-...M.TKKYNIFLSWFS-E--E...........----------------.GTYN..E---------
Q8XZI3_RALSO/98-178DKD-T.LRRSLR.-.GVG.V..........A-E--A...........----------------.RYYD..K---------
Q8EGG7_SHEON/352-426EDE-V.MRREL..-...R.Q..........M-E--G...........----------------.AWLN..S---------
Q604T9_METCA/124-204GSE-D.LLKALK.-.GIG.L..........A-E--G...........----------------.KVFD..R---------
Q8D271_WIGBR/189-264HKS-Y.LKNIS..-...N.N..........Y-Y--N...........----------------.KLYN..I---------
Q82VX0_NITEU/116-201ARA-EQLRAEW..-...P.L..........T-P--G...........----------------.KVFR..S---------
Q87LW2_VIBPA/354-425SDV-L.LTNRL..-...E.L..........E-T--G...........----------------.RKIE..T---------
Q6MAE9_PARUW/390-467KTS-VILHETL..-.....M..........I-P--G...........----------------.EIFN..T---------
Q6LKQ8_PHOPR/351-422SDP-A.LLALL..-...D.L..........P-V--D...........----------------.RVIS..T---------
O84244_CHLTR/275-353SKR-L.LDKQL..-...L.V..........G-P--N...........----------------.SLYC..P---------
Q5NZG7_AROAE/348-422RDE-V.VRREM..-...R.Q..........M-E--G...........----------------.AWYD..A---------
O67326_AQUAE/374-446RDY-V.IRREM..-...R.V..........Q-E--N...........----------------.ELAL..K---------
Q5NNB2_ZYMMO/333-411LDA-KHISHIA..-...R.F..........K-E--G...........----------------.QRYD..S---------
Q7VHH5_HELHP/344-416ADR-I.IRREI..-...L.L..........A-P--G...........----------------.DTYS..L---------
Q98MC3_RHILO/187-275SSR-R.LSDVI..-...N.T..........K-R--SSWVS...FILR----------------DDVYD..E---------
Q6FCG7_ACIAD/270-348KPQ-E.LEALK..-...I.Y..........K-D--G...........----------------.DTYS..Q---------
Q6MMX9_BDEBA/120-198KSE-D.IADAT..-...G.I..........K-P--Y...........----------------.QLLN..M---------
Q8XZI3_RALSO/353-427RDE-V.VRREM..-...R.Q..........M-E--S...........----------------.SWFD..G---------
Q7MIG8_VIBVY/266-344KEE-E.FKALV..-...P.F..........E-A--G...........----------------.ETYN..G---------
BAMA_HELPY/312-391PLK-T.LEKAL..-...K.V..........K-R--K...........----------------.DVFN..I---------
Q8RHT4_FUSNN/251-335KDY-V.IDREI..-...E.I..........Q-P--G...........----------------.KIFN..V---------
Q6D152_PECAS/230-304RDD-Y.LQNLV..-...P.F..........H-E--G...........----------------.DVYT..S---------
Q5E2U2_VIBF1/342-414TES-M.LLDRL..-...N.L..........E-E--G...........----------------.RSYS..A---------
Q89NX1_BRADU/319-398DPA-A.LRSYS..-...R.V..........N-A--G...........----------------.SLYN..V---------
Q92Q48_RHIME/107-184KDD-K.LQGVV..-...R.T..........Q-P--L...........----------------.GPYS..E---------
Q5R0Z1_IDILO/176-264ADE-L.LLDTF..-...E.L..........R-D--SLPWW...NFIG----------------EKRYQ..K---------
Q5E3E7_VIBF1/92-172KEE-Q.MQQNLE.-.ASS.I..........R-V--G...........----------------.EALD..R---------
Q8D2H0_WIGBR/95-175EKN-N.IKNILK.-.SKN.I..........K-I--G...........----------------.NPLY..P---------
Q5FPY9_GLUOX/117-194KDE-D.LRKEI..-...S.L..........R-P--R...........----------------.AVFS..S---------
Q8KFQ6_CHLTE/132-209KTK-E.LLNTA..-...N.L..........N-P--G...........----------------.RRIS..N---------
Q83DT2_COXBU/99-179STK-K.LRPILN.-.KLN.I..........S-E--G...........----------------.QPYD..P---------
Q6FCG7_ACIAD/179-267SDD-D.IKQAF..-...A.I..........K-E--SGWSS...IVTR----------------NDRYA..R---------
Q6N5Q8_RHOPA/187-275SSY-R.LKDVI..-...K.T..........R-E--SNLLS...FLGN----------------GDVYD..P---------
Q6ATX4_ORYSJ/67-146KEE-L.IEAEV..-...A.E..........L-L--R...........----------------.AAPT..V---------
Q7MHW3_VIBVY/361-432SDG-L.LTRRL..-...D.L..........E-T--G...........----------------.RVLK..T---------
Q7MAB6_WOLSU/88-166EQE-A.LYKEI..-...G.I..........K-K--G...........----------------.DVYD..E---------
BAMA_DESVH/301-383TDE-R.LLKVV..-...K.LDD......HKK-D--N...........----------------.QYFA..L---------
Q5NEP7_FRATT/96-176SKD-N.LEKVFT.-.DAG.I..........Y-V--G...........----------------.NVYN..P---------
O67326_AQUAE/290-371AYS-ELVDNILK.-.KNE............R-K--G...........----------------.RYFR..R---------
BAMA_DESVH/131-209GHD-D.ILAAM..-...S.S..........K-T--G...........----------------.SVLN..D---------
Q7UK20_RHOBA/180-256NDR-E.LSGRS..-...G.I..........T-E--G...........----------------.DPLS..E---------
Q7MXJ3_PORGI/386-461YED-V.VRREL..-...Y.T..........K-P--G...........----------------.QLFS..R---------
Q98K30_RHILO/218-292DRD-F.TEYMT..-...G.L..........K-R--G...........----------------.KQYS..P---------
Q82U03_NITEU/346-420RDE-V.IRREF..-...R.Q..........M-E--G...........----------------.GWHS..T---------
Q5R0Z1_IDILO/93-173KDE-Q.LQESLV.-.DNN.I..........V-T--G...........----------------.EPLD..R---------
Q7MXJ3_PORGI/302-383PSE-Y.LERVL..-...G.I..........K-S--G...........----------------.DVYN..Q---------
Q88IV7_PSEPK/195-269DED-L.LQRMV..-...S.F..........K-P--G...........----------------.TPYD..S---------
Q74AT3_GEOSL/270-348KEE-D.LTKVL..-...R.L..........K-S--G...........----------------.DVFS..R---------
Q5NND8_ZYMMO/397-485SDA-Q.LRKAM..-...A.T..........K-Q--ARFWR...FMSS----------------GASYD..P---------
Q5FPY9_GLUOX/370-443HDD-V.IRRNL..-...P.M..........A-E--G...........----------------.DPYT..P---------
Q6MAC6_PARUW/256-330KKS-F.FYKKL..-...H.W..........N-Q--G...........----------------.ELYD..P---------
Q82U03_NITEU/265-343PEE-E.LRKLI..-...K.L..........E-P--G...........----------------.GIFV..R---------
Q8EGG7_SHEON/271-349REE-L.MKSIL..-...P.I..........K-A--G...........----------------.DMYN..G---------
BAMA_BUCAI/175-263SKE-K.ILSLF..-...K.L..........Q-D--YHSWW...NLLS----------------KSTYS..P---------
Q6MKB1_BDEBA/93-170STS-E.AASLF..-...G.V..........K-A--D...........----------------.DVFD..Q---------
Q65R79_MANSM/88-168PTD-A.LKQNLD.-.ANG.F..........K-A--G...........----------------.EVLN..R---------
Q5LSU6_RUEPO/196-284SDR-R.LRRIL..-...E.T..........K-Q--AGFLR...TFIR----------------SDTFI..A---------
Q74AT3_GEOSL/179-267NAS-K.LRGVM..-...E.T..........K-E--KWFLS...WLTG----------------AGTYK..D---------
Q9A711_CAUCR/345-418LDY-V.LRREL..-...E.V..........A-E--G...........----------------.DAYN..R---------
Q7VYC2_BORPE/276-354LDS-E.INNLV..-...E.I..........K-P--G...........----------------.EVFS..A---------
BAMA_HELPY/138-216EKD-G.LKSQM..-...G.I..........K-K--G...........----------------.DTFD..E---------
Q7MPD6_VIBVY/100-183NDK-D.FLQLLE.-..KSPL..........K-Q--G...........----------------.AILN..H---------
Q7MXJ3_PORGI/45-119DDF-V.LRNLS..-...G.L..........A-V--G...........----------------.DEVLIPG---------
Q5NZG7_AROAE/267-345PEE-E.YRKLA..-...A.I..........K-P--G...........----------------.EIFS..R---------
Q9RXD5_DEIRA/97-179FKQ-S.VAELL..-...N.I..........A-P--G...........----------------.AVLN..T---------
Q8DI03_THEEB/90-161LEQ-L.VYQVI..-...S.T..........R-P--G...........----------------.STTT..R---------
Q604T9_METCA/298-376PPE-Q.LVPLV..-...R.I..........G-P--E...........----------------.DIFS..R---------
Q886N5_PSESM/91-171STE-D.LMKGLK.-.QSG.L..........A-E--G...........----------------.EIFQ..R---------
Q8EGG7_SHEON/180-268TDA-E.LIGML..-...E.L..........K-D--YVAWW...DLFG----------------ERRYQ..K---------
Q74AT3_GEOSL/99-176STD-K.VRDAL..-...G.L..........K-A--N...........----------------.TIFS..Q---------
Q89KQ1_BRADU/278-357DPN-S.MRAYS..-...R.V..........N-V--G...........----------------.SLYN..V---------
Q87SW5_VIBPA/101-182EDE-E.FTNLIA.-.KSP.L..........K-V--G...........----------------.RILN..Q---------
A9CJ61_AGRFC/186-274SDG-R.LAAVI..-...N.T..........K-K--SNMLS...FLTR----------------KDVYN..E---------
Q8XZI3_RALSO/272-350KQA-E.MEKLI..-...K.L..........K-Q--G...........----------------.DVFS..S---------
Q6MMX9_BDEBA/201-289GDS-S.LKSKM..-...L.T..........Q-E--GGFFS...GISG----------------SGQYK..Q---------
Q7CWM5_AGRFC/240-314DGD-F.IRRYS..-...R.L..........N-G--G...........----------------.EPYS..P---------
Q6MMX9_BDEBA/48-119EKD-A.ILTKI..-...V.T..........K-V--G...........----------------.ESYS..A---------
BAMA_HELPY/394-466SDR-I.IRREL..-...L.L..........G-P--K...........----------------.DKYN..L---------
Q5R0Z1_IDILO/267-345HDE-L.VGKIA..-...K.I..........E-K--G...........----------------.TLYN..A---------
Q8A1E1_BACTN/46-120EDY-V.LIGLS..-...G.L..........S-V--G...........----------------.QTITVPG---------
Q5E819_VIBF1/104-185ADE-D.FINAVD.-..NSGL..........N-L--G...........----------------.QVIN..H---------
Q5LSU6_RUEPO/369-442LDQ-V.IRRQF..-...R.T..........V-E--G...........----------------.DPFN..P---------
Q5R0Z1_IDILO/348-422KDR-V.LRREM..-...R.Q..........L-E--G...........----------------.AWLS..D---------
TAMA_ECOLI/189-263RDE-Y.LQNLV..-...P.F..........K-E--G...........----------------.DEYE..S---------
Q7NVY6_CHRVO/267-345PEA-E.LMKLM..-...Q.V..........K-R--G...........----------------.DTFN..N---------
Q6MAE9_PARUW/309-387CDE-E.IDRLF..-...G.I..........R-Q--G...........----------------.EFFS..I---------
Q92LN9_RHIME/217-291DPD-F.VKDYS..-...R.L..........N-H--G...........----------------.RPYS..P---------
O51735_BORBU/103-180WNS-E.LVEKV..-...N.I..........K-T--N...........----------------.EPLN..L---------
Q7UK20_RHOBA/97-179STT-D.ILAEL..-...Q.T..........R-K--G...........----------------.RFYS..E---------
A9CJ61_AGRFC/359-432RDY-V.IRREF..-...D.I..........S-E--G...........----------------.DAFN..Q---------
Q82U03_NITEU/174-262PED-D.LVDLF..-...S.L..........K-T--PGFMT...WFTK----------------DDQYS..K---------
Q9SRL6_ARATH/77-155KDH-I.IEAEV..-.....D..........A-V--R...........----------------.EATT..L---------
Q7VRD8_BLOFL/101-181KTE-M.IQSILN.-.SKN.I..........K-I--G...........----------------.STLN..D---------
Q6MMX9_BDEBA/292-370PKS-E.LREVI..-...K.I..........D-D--N...........----------------.GVFA..Y---------
Q8KFQ6_CHLTE/392-467KDH-V.IRREL..-...Y.T..........I-P--G...........----------------.DTFS..R---------
Q6LN32_PHOPR/175-263TDA-E.LSSKF..-...N.L..........K-A--DIPWW...NFLA----------------DEKYQ..K---------
Q604T9_METCA/207-295SDD-D.LTQDF..-...E.L..........S-T--SNLLS...FYTK----------------DDQYS..K---------
Q8KC70_CHLTE/372-447PEK-EISDTFL..-...P............I-T--G...........----------------.KLYT..S---------
Q6ARL5_DESPS/20-91DSG-A.ILRKI..-...N.S..........K-A--G...........----------------.DIYD..P---------
Q7VRD8_BLOFL/184-272SQK-K.LLKQF..-...S.I..........Y-K--QIKWN...NIFH----------------RNVYK..K---------
Q5FPY9_GLUOX/197-285SEA-R.LSQVI..-...S.S..........K-E--TIWYR...FFSS----------------SDEYN..P---------
O66463_AQUAE/72-149RDE-D.VKNVL..-...G.I..........E-E--G...........----------------.IPLI..E---------
Q73JH4_TREDE/358-431KDN-V.ILREI..-...L.L..........K-E--G...........----------------.DVFS..K---------
Q7UK20_RHOBA/349-427TEE-S.LRKRL..-...E.L..........K-A--N...........----------------.DTFS..G---------
BAMA_BUCAI/266-344PYQ-KLITNLI..-...N.I..........N-P--N...........----------------.EFYN..R---------
Q7P0N3_CHRVO/181-255PEK-V.ALGMA..-...D.F..........N-P--G...........----------------.SPYS..Q---------
Q7NVY6_CHRVO/348-422RDE-V.IRREL..-...R.Q..........L-E--G...........----------------.APYN..A---------
Q6MKB1_BDEBA/419-500TPE-E.LLKVT..-...R.L..........R-P--G...........----------------..PLK..L---------
Q8DI03_THEEB/242-318RDF-V.ISREM..-...D.T..........Q-P--G...........----------------.VVLN..Q---------
Q7VAN9_PROMA/238-314TQS-I.IRDIF..-...K.T..........D-F--G...........----------------.KTLN..L---------
Q7MAB6_WOLSU/344-416LDR-V.VRREI..-...L.L..........A-P--G...........----------------.EMYE..A---------
O66463_AQUAE/152-225QKK-E.LIKAS..-...G.L..........V-I--G...........----------------.SIFD..I---------
Q7MYW2_PHOLL/190-266RED-Y.LNHLV..-...P.F..........S-E--G...........----------------.DFYT..S---------
Q6MKB1_BDEBA/503-577TDY-V.IHKEL..-...E.F..........D-K--G...........----------------.DLLT..P---------
Q7MXJ3_PORGI/120-199ERE-D.LEMKI..-...G.L..........R-E--G...........----------------.IQMT..R---------
Q5NND8_ZYMMO/317-394KED-K.IRPEI..-...K.L..........A-P--R...........----------------.QIFT..R---------
Q8EF72_SHEON/112-195DDR-A.FDKWLA.-.DVN.I..........K-P--G...........----------------.DTLN..H---------
Q6N5Q8_RHOPA/107-184KDE-Q.LSAEI..-...Q.S..........K-P--R...........----------------.GTLS..R---------
Q5NEP7_FRATT/273-351PKS-E.LESLV..-...K.I..........K-Q--G...........----------------.EVFS..K---------
Q7U8Q8_SYNPX/217-301KEW-V.ITREI..-...S.V..........Q-P--G...........----------------.DTFN..R---------
Q886N5_PSESM/346-420EDE-V.LRREM..-...R.Q..........M-E--G...........----------------.GWAS..T---------
Q6ARL5_DESPS/262-340DKK-T.LAKLV..-...S.V..........R-N--E...........----------------.PYLN..R---------
BAMA_DESVH/212-298SES-E.VKDIL..-...A.LSERG.MFSWFT-G--T...........----------------.GVLK..D---------
O84244_CHLTR/104-182PTH-K.ILKTL..-...E.L..........Y-K--N...........----------------.DLFD..R---------
Q5SKT2_THET8/83-163PEE-R.LLTFLEQ-NFAI............G-K--G...........----------------.ATYN..P---------
Q92Q48_RHIME/278-357DAE-E.LRGLV..-...Q.S..........R-E--G...........----------------.TVYK..A---------
Q83DT2_COXBU/182-270SAR-T.LRNQF..-...K.L..........T-T--PGLFT...WISH----------------RDRYS..Q---------
O84244_CHLTR/356-435KHD-V.ILHET..-...S.L..........F-P--G...........----------------.DTFD..R---------
Q98MC3_RHILO/278-357DSK-S.LESVV..-...E.T..........H-K--G...........----------------.DVYN..A---------
Q7VYC2_BORPE/185-273SEG-E.LLDQF..-...D.L..........T-T--PGWLT...WYTN----------------TDKYS..R---------
Q7NVY6_CHRVO/93-173SKD-Q.LKKALK.-.DNG.F..........A-E--S...........----------------.LIFD..Q---------
Q7VHH5_HELHP/87-166EKE-T.LYSQI..-...G.I..........K-K--G...........----------------.DSYD..E---------
Q89NX1_BRADU/148-225KDE-Q.LSAEV..-...Q.S..........K-P--R...........----------------.GAFS..R---------
A9CJ61_AGRFC/277-356DGS-E.LQGLV..-...E.T..........R-Q--G...........----------------.ASYS..A---------
Q7NVY6_CHRVO/176-264AQS-K.LLDEF..-...S.L..........T-T--GGWLS...WITK----------------DDQYS..K---------
Q6FCG7_ACIAD/351-425ADD-V.LRREM..-...R.Q..........M-E--G...........----------------.ALAS..N---------
Q6ARL5_DESPS/173-259DAG-E.LEDIL..-...E.T..........K-E--KSWLT...WLTA----------------AGLLD..M---------
Q8A1E1_BACTN/203-291KTS-K.LKKVM..-...K.KTNEKGKLLNLF-R--T...........----------------.KKFV..P---------
Q8XZI3_RALSO/181-269SEG-D.LRDEM..-...Q.L..........S-T--PNWLS...WYTK----------------NDLYS..K---------
Q8D2H0_WIGBR/178-266SKK-N.LINKIE.-.LCE.Y..........N-S--SLSF......FQ----------------KCIYQ..K---------
O67326_AQUAE/203-287SDR-K.LKGLM..-...E.L..........K-E--PNIFL....FRL----------------HPAFS..E---------
Q7VHH5_HELHP/262-341EEK-E.LRKVL..-...K.V..........K-K--G...........----------------.TYFN..I---------
Q9A711_CAUCR/263-342DGN-L.LAQIL..-...P.V..........R-T--G...........----------------.QLYE..D---------
Q9WYS9_THEMA/270-342TDQ-E.LLRAS..-...G.L..........S-T--D...........----------------.ETYT..N---------
Q5E3E7_VIBF1/347-421KDE-V.LRREM..-...R.Q..........M-E--G...........----------------.AWLN..S---------
Q8I576_PLAF7/116-193NAE-I.LNELM..-................K-Q--N...........----------------.KLLTIRY---------
Q87ME5_VIBPA/266-344EEA-T.FERLV..-...P.F..........E-D--N...........----------------.ETYN..G---------
BAMA_BUCAI/92-172ASS-V.LDPYL..-...KKLN........IE-T--G...........----------------.KSFN..N---------
Q83DT2_COXBU/354-428DQE-V.LRREM..-...R.Q..........Y-E--G...........----------------.SLYS..L---------
Q9A711_CAUCR/172-260SDN-D.LRDVI..-...V.T..........K-E--SRWYK...ILTS----------------NDNYD..P---------
Q7MAB6_WOLSU/169-259SAS-K.LEIPT..-.....V..........N-K--EREFMGWMWGFN----------------DGKLK..V---------
BAMA_HELPY/219-309KRR-M.IESLS..-.....A..........N-K--QRDFMGWMWGLN----------------DGKLR..L---------
Q6N5Q8_RHOPA/278-357DGN-S.MRSFS..-...R.V..........N-V--G...........----------------.SLYN..A---------
Q83DT2_COXBU/273-351FKD-Q.LYRLV..-...K.L..........K-R--G...........----------------.DIFS..R---------
Q6N5Q8_RHOPA/360-433RDY-V.IRREF..-...D.I..........S-E--G...........----------------.DAYN..R---------
Q5E3E7_VIBF1/266-344KEE-E.FKKLI..-...P.F..........E-N--G...........----------------.EVYN..G---------
Q6FCG7_ACIAD/96-176PKE-A.LTEGLK.-.KMG.V..........V-E--G...........----------------.DVLK..S---------
Q82VX0_NITEU/204-278KPD-V.VQNSV..-...P.F..........R-P--G...........----------------.DPYR...---------
Q5E3E7_VIBF1/175-263TDE-Q.LLSRF..-...N.L..........N-V--DVAWW...NFLA----------------DEKYQ..K---------
Q5LSU6_RUEPO/116-193KDE-T.LEGAI..-...G.S..........Q-S--R...........----------------.RVFT..P---------
Q8KFQ6_CHLTE/57-131KES-E.LLKSL..-...P.I..........K-I--N...........----------------.DRITVPG---------
Q8A1E1_BACTN/121-200ERT-D.FESKL..-...G.M..........V-K--G...........----------------.MQIT..P---------
Q5SKT2_THET8/164-238PEE-E.LRKGL..-...E............A-L--K...........----------------.GSFD..F---------
Q9RXD5_DEIRA/180-256PQA-T.VQNIF..-...RPL..........Q-T--S...........----------------.KRFT..T---------
Q7UK20_RHOBA/259-346SES-R.LKKVI..-...Q............S-R--GPMMGI..MSYI----------------NNVAD..M---------
O67326_AQUAE/18-90PDE-L.IRGLL..-...S.V..........R-K--G...........----------------.SEFS..L---------
O51735_BORBU/277-353SLE-E.LKSFI..-...T.F..........S-E--G...........----------------.DIFN..D---------
Q8EF72_SHEON/198-271EPD-I.LTKLI..-...P.F..........K-E--D...........----------------.ASYS..T---------
Q73JH4_TREDE/277-355STK-E.LSEKF..-...K.L..........K-K--G...........----------------.DVFN..L---------
Q9RXD5_DEIRA/329-402PTA-Q.LQAAI..-...K.T..........K-P--G...........----------------.DVYS..P---------
Q82U03_NITEU/91-171DKD-K.LKEGLK.-.QAG.L..........S-E--S...........----------------.RIFS..R---------
Q886N5_PSESM/174-262SDE-D.LTDLF..-...E.L..........K-T--SNWLS...FFKN----------------DDKYA..R---------
BAMA_BUCAI/347-421QDR-V.LRRKI..-...K.Q..........M-E--G...........----------------.KYFN...---------
Q5NZG7_AROAE/93-173DKE-A.LKKGLR.-.EVG.L..........A-E--S...........----------------.RIFD..R---------
Q65R79_MANSM/260-339MQD-E.LQPIL..-...KTI..........H-V--G...........----------------.EMYR..R---------
Q886N5_PSESM/265-343PED-Q.VKSLL..-...L.V..........Q-P--G...........----------------.QVFS..R---------
Q7V0C8_PROMP/253-325KDW-V.IKREL..-...K.T..........I-P--G...........----------------.SIFN..R---------
Q8EJN5_SHEON/337-408SLN-L.LKETL..-...E.L..........K-P--G...........----------------.QNIT..K---------
Q74AT3_GEOSL/351-424RDK-V.IRREL..-...K.V..........A-E--G...........----------------.ETYS..S---------
Q8D2H0_WIGBR/348-422KEH-V.IRRNL..-...K.Q..........L-E--R...........----------------.STLE..I---------
Q5NEP7_FRATT/179-270ADS-D.LDSSV..-...A.F..........E-V--PSIWNLWGFLAP----------------FDSYS..P---------
Q8KBW3_CHLTE/43-133TTE-E.IREVM..-...STS..........T-R--NSFFGTGLFAGA----------------RRPFI..A---------
BAMA_DESVH/386-459RDN-V.VLREM..-...R.I..........A-D--G...........----------------.DMFE..G---------
Q6LN32_PHOPR/266-344DNK-D.LNELV..-...T.I..........K-E--G...........----------------.DIYN..G---------
Q7VYC2_BORPE/102-182DSK-A.ITKSLA.-.QVG.F..........G-E--G...........----------------.RIFD..Q---------
Q6ARL5_DESPS/343-416RDN-V.IRREL..-...R.I..........V-E--G...........----------------.GLFD..S---------
Q604T9_METCA/379-453RDE-V.LRREM..-...R.Q..........M-E--A...........----------------.AWAS..T---------
Q6LMH9_PHOPR/358-429SDQ-A.LLDRL..-...D.L..........H-S--G...........----------------.EKMS..S---------
Q92Q48_RHIME/187-275SDG-R.LQSVI..-...A.T..........K-E--SGIFS...FLTR----------------KDVYN..P---------
Q9HXY4_PSEAE/265-343PEE-E.VKRLL..-...L.V..........Q-K--G...........----------------.QVFS..R---------
Q5NND8_ZYMMO/488-566KAE-N.FKSLV..-...K.I..........K-K--G...........----------------.QWYN..A---------
Q6MAE9_PARUW/137-215STN-R.LQKEL..-...G.I..........G-C--F...........----------------.VTFE..R---------
P73472_SYNY3/425-496RDF-I.ITREM..-...R.L..........K-P--G...........----------------.DVFN..R---------
Q5NZG7_AROAE/176-264KDS-E.VLGLF..-...Q.L..........T-T--PGWLT...WYTK----------------NDQYS..R---------
Q65R79_MANSM/342-416ADS-T.LRQEM..-...R.Q..........Q-E--G...........----------------.SWLS..S---------
BAMA_DESVH/59-130DPD-V.VLMRL..-...S.T..........R-K--G...........----------------.DPID..P---------
Q881Y2_PSESM/187-261DED-L.LKRMV..-...P.F..........K-E--N...........----------------.TPYD..S---------
Q74AT3_GEOSL/27-98ETA-A.ITNAL..-...S.L..........K-T--G...........----------------.DLLY..A---------
Q5NND8_ZYMMO/569-643RDK-V.IRREF..-...R.L..........A-E--G...........----------------.DVFN..L---------
O51735_BORBU/183-274KSS-T.LRKSLAS-RVVSLF..........S-D--G...........----------------.KYLK...---------
Q7VYC2_BORPE/357-431RDE-V.VRREM..-...R.Q..........Q-E--A...........----------------.AWYD..A---------
Q6MMX9_BDEBA/373-447RDK-V.IRREL..-...K.V..........H-E--G...........----------------.ELYN..E---------
BAMA_PHOLL/266-344YQS-E.ITKLA..-...A.I..........E-P--G...........----------------.SLYN..G---------
Q9A711_CAUCR/92-169KED-K.LKDEV..-...Q.I..........R-P--R...........----------------.GIFT..R---------
Q9KPW0_VIBCH/266-344KEA-E.FTSLI..-...P.F..........E-I--G...........----------------.ETYN..G---------
Q7VHH5_HELHP/169-259KVS-E.VEELS..-.....A..........N-R--AKQFMGWLWGRN----------------DGKLK..L---------
Q8YUR6_NOSS1/395-466QDY-I.ITREV..-...E.L..........K-P--G...........----------------.QVFN..R---------
A9CJ61_AGRFC/106-183KDD-K.LAGIV..-...Q.T..........Q-P--M...........----------------.GPFN..Q---------
Q7VRD8_BLOFL/356-430QDF-V.IRREI..-................K-Q--L...........----------------.......E---------
Q7MAB6_WOLSU/262-341GVE-E.LMDEV..-...R.L..........T-E--G...........----------------.KRFN..I---------
B9KGV5_ANAMF/358-430LDH-V.MRRKL..-...G.I..........H-E--G...........----------------.DVYS..T---------
G1UBA5_HAEDU/89-168PKN-A.LEQNLK.-.ANL.I..........V-A--G...........----------------.EVYD..K---------
BAMA_ECOLI/176-263TTD-E.LISHF..-...Q.L..........R-D--EVPWW...NVVG----------------DRKYQ..K---------
BAMA_HAEIN/175-259SSS-T.LQEQM..-...E.L..........Q-P--DSWW.....KLW----------------GNKFE..G---------
Q2YPP8_BRUA2/234-307DPQ-F.VAWMT..-...G.L..........K-P--G...........----------------.QEYD..P---------
Q2YRQ2_BRUA2/108-184KDP-D.LARAV..-...Q.L..........K-P--R...........----------------.APFD..M---------
Q2YRQ2_BRUA2/278-357DTQ-A.LDRLV..-...K.T..........R-T--G...........----------------.KPYS..A---------
Q31PR1_SYNE7/195-269PDS-V.IQETF..-...K.D..........D-Y--G...........----------------.KILN..L---------
Q5ZY66_LEGPH/369-442GDY-V.LRNVI..-...R.Q..........D-E--G...........----------------.GLLS..L---------
Q63T20_BURPS/183-270KTS-T.LRDEM..-...Q.LSTPN.WFSWYT-K--N...........----------------.DLYS..K---------
Q63W94_BURPS/223-295PEK-I.VHDVN..-...P.L..........A-A--G...........----------------.EIYD..A---------
Q8F3T2_LEPIN/54-124PDA-D.LESMI..-...E.I..........K-V--G...........----------------.KILT..K---------
Q8PAW1_XANCP/129-208KSE-E.LLKGLG.-.DIG.L..........T-E--G...........----------------.GTFD..R---------
Q8RHT4_FUSNN/101-171TTS-E.LLDIT..-...Q.L..........K-A--G...........----------------.EYFS..R---------
BAMA_YERPE/267-344HQS-E.AEKLT..-...K.I..........E-P--G...........----------------.ELFN..G---------
Q9CJL1_PASMU/262-340MSA-E.LAPIL..-...DAI..........Q-L--N...........----------------.GLFR..R---------
Q9CJL1_PASMU/89-168PDE-A.IKQNLD.-.ANG.F..........K-V--G...........----------------.DVLN..R---------
Q9FFG3_ARATH/74-151KDH-V.IEAEV..-...D.V..........V-R--Q...........----------------.ATTL..Q---------
BAMA_NEIMB/267-343PKA-E.LEKLL..-...T.M..........K-P--G...........----------------.KWYE..R---------
Q9PEI2_XYLFA/272-347PQE-K.IEKLV..-...I.P..........K-T--G...........----------------.DIFS..R---------
Q9ZE03_RICPR/176-263SDS-E.LKSIV..-...L.T..........K-E--SRWFR...FLES----------------NDTYD..P---------

PF08479

Q8XQ41_RALSO/70-145PTA.V-LEALV------A-D----------L-N--G----------------------------GTRT--L---------
Q8RI18_FUSNN/32-109LNEIE-KENIL------G-K----------Y-I--D----------------------------KDLG--S---------
Q7NU30_CHRVO/77-152WLA.W-LQPLA------D-A----------G-L--A----------------------------GCVD--L---------
Q7N2L1_PHOLL/77-152SQS.V-REKLI------Q-S----------Y-L--S----------------------------RCLT--L---------
Q7N9T5_PHOLL/77-152PLP.I-KQHLI------H-P----------Y-L--S----------------------------HCLS--L---------
Q88MW8_PSEPK/83-158SNS.A-LAPTI------R-A----------L-T--P----------------------------ACMG--I---------
Q7N107_PHOLL/69-145PHWLP-FRLVA------Q-Q----------G-E--N----------------------------HCLG--D---------
Q605Q3_METCA/48-123DQR.V-VEKTV------Y-G----------F-L--G----------------------------PGKS--I---------
Q9JY36_NEIMB/87-166ALK.R-ALRET------G-F----------Q-A--G----------------------------KCLH--A---------
Q8YM25_NOSS1/96-171PPE.K-FTPIT------D-P----------F-V--G----------------------------REVS--F---------
Q7N1B0_PHOLL/77-152SKS.V-KQNVI------H-P----------Y-L--S----------------------------HCLT--L---------
Q89H68_BRADU/98-173SRD.R-IAAVY------Q-P----------Y-L--G----------------------------KKVS--Q---------
Q9HVN7_PSEAE/59-134DDR.R-LLALL------H-D----------L-P--G----------------------------QELN--L---------
Q8XQZ3_RALSO/84-163ALP.A-ADPSD------D-P----------A-T--G----------------------------RCLG--T---------
Q880E0_PSESM/77-152SPA.E-RDALI------K-P----------F-Q--N----------------------------KCLG--V---------
Q8XYH9_RALSO/79-151.FN.W-LPYLL------Q-P----------V-N--G----------------------------QCVG--K---------
Q8DLP0_THEEB/81-156GPA.E-FDPIL------K-P----------L-E--G----------------------------QQVT--L---------
Q8XQX3_RALSO/69-144PFP.E-IAAHF------A-P----------M-A--G----------------------------HDVT--V---------
Q7MRX6_WOLSU/59-134QEE.K-KQSLY------R-Q----------Y-V--G----------------------------KCNT--L---------
Q9I792_PSEAE/71-146GES.A-RRQLL------A-P----------Y-Q--G----------------------------RCLG--V---------
Q8XPV1_RALSO/81-156DAD.T-VERVT------Q-P----------F-L--N----------------------------RALG--T---------
Q7VLT7_HAEDU/59-128DPL.P-YL...------.-P----------K-K--N----------------------------ECLN--Q---------
Q7NWR3_CHRVO/87-160SRE.E-VTAL.------G-P----------P-R--G----------------------------TCLD--I---------
Q6FDM4_ACIAD/101-180ALN.E-ITQGT------H-N----------I-I--G----------------------------RCLG--V---------
Q63JI8_BURPS/74-148HSR.E-IDRIV------E-R----------Y-R--G----------------------------ATMG--Q---------
Q9AAJ4_CAUCR/8-83PPH.D-LQPAW------Q-N----------F-V--G----------------------------KPVA--L---------
Q63TR3_BURPS/65-140PFE.E-ISQRF------T-P----------L-V--G----------------------------KDIT--I---------
Q89Q77_BRADU/73-148TPA.E-LDEIA------K-K----------Y-V--G----------------------------KDVD--I---------
Q9HVG7_PSEAE/71-146DKA.V-LESYY------Q-H----------M-L--G----------------------------EQVS--L---------
Q6DA64_PECAS/107-183PGWLP-LQRLA------D-Q----------A-V--N----------------------------QCLG--G---------
Q8RGK0_FUSNN/41-115EDF.Q-IDALL------R-K----------Y-V--G----------------------------KD..--.---------
Q9PAG8_XYLFA/106-185ALT.A-ANPPH------D-P----------A-I--G----------------------------RCLG--T---------
Q74E11_GEOSL/79-154TED.D-LRQVV------A-P----------L-E--G----------------------------KEVS--I---------
Q8YWF4_NOSS1/18-93KN..E-IAKLI------E-P----------F-E--K----------------------------RQVT--F---------
Q7N910_PHOLL/78-154PHWLP-LKRLA------Q-Q----------G-E--N----------------------------QCLG--T---------
IBPB_HISS2/99-172L...D-FDEVT------K-H----------Y-L--N----------------------------QPLS--A---------
Q88QC1_PSEPK/91-166PLG.D-LREHY------Q-P----------L-I--G----------------------------RETT--L---------
Q7NY08_CHRVO/92-167DNK.T-LLELV------A-D----------A-K--G----------------------------KELN--L---------
Q9I5N4_PSEAE/47-122DNR.A-IEAAV------Y-P----------F-L--G----------------------------PQRS--L---------
B4F0Z8_PROMH/77-150TEK.D-LNSL.------S-P----------L-P--D----------------------------QCIK--S---------
C5BBG6_EDWI9/81-153SLR.D-LRAL.------D-A----------L-P--A----------------------------HCIR--S---------
D3VFR1_XENNA/80-152SIR.D-LNTL.------S-A----------L-P--D----------------------------SCIT--S---------
FHAC_BORPE/92-164RLF.D-PAPLV------Q-D----------Y-L--N----------------------------RPLD--N---------
HXUB1_HAEIN/73-150VTD.E-LAHIL------K-N----------Y-V--G----------------------------KEVS--L---------
Q0WFB2_YERPE/81-154SSQ.D-LNQI.------D-H----------I-L--G----------------------------ECIS--E---------
Q6D5C4_PECAS/75-150SEK.D-KNTLN------K-D----------Y-I--N----------------------------RCIN--V---------
Q74QU0_YERPE/90-165PNAAH-LKEKA------E-E----------A-H--G----------------------------RCLG--E---------
Q7CJ53_YERPE/77-153PRWLP-LQRIA------N-Q----------A-L--G----------------------------QCLG--G---------
Q7N9K7_PHOLL/79-152SVR.D-LSTL.------S-A----------L-S--P----------------------------ACIS--S---------
Q7VX34_BORPE/76-148PFD.Q-VAAFL------T-P----------L-A--G----------------------------KEIT--V---------

PF08478

FTSQ_VIBF1/50-120TAD-D-IREAI------D-S----------M-D.SI----------------------------GTFM..T---------
FTSQ_SHEON/52-121TDK-D-IQIAL------Q-D----------L-M.Q.----------------------------RSFF..S---------
DIVIB_BACSU/54-123SKK-E-IIDLS------D-I----------N-S.GD----------------------------TEFW..S---------
FTSQ_RHIME/89-157SEI-D-ILQQL------G-L----------D-G..T----------------------------TSLV..A---------
Q5P6Z9_AROAE/37-106TTA-Q-LEYVA------R-T----------A-I..R----------------------------GNFF..S---------
O83403_TREPA/55-123SPE-Y-LMKAA------G-L----------T-G..K----------------------------EKWM..S---------
DIVIB_CLOTE/54-122KKE-S-IIKSS------Q-I----------S-N..E----------------------------NNIF..Y---------
FTSQ_ECOLI/55-126RND-D-IRQSI------L-A----------L-G.EP----------------------------GTFM..T---------
Q8D2Z8_WIGBR/41-111PQE-D-IRQIF------L-N----------L-K.LS----------------------------KNFV..K---------
Q83N06_TROWT/56-124KTD-D-IVA..------A-L----------R-GEFN----------------------------KPLA..F---------
Q8E185_STRA5/122-193PDD-I-LIEKT------N-I----------Q-KNDY----------------------------FFSL..I---------
Q5SJC7_THET8/24-91SRE-A-VLQTL------R-L----------A-P..G----------------------------DPWL..W---------
Q5R0N0_IDILO/43-112ASE-E-VRQAL------.-T----------A-E.PL----------------------------GSFF..T---------
Q6F706_ACIAD/59-128EQN-Q-LQQHI------Q-P----------I-I..K----------------------------DNYF..T---------
Q728V1_DESVH/71-139SKD-E-ILATA------G-L----------V-E..G----------------------------ANSI..A---------
FTSQ_HAEIN/54-124TAD-D-IKESL------L-K----------M-G.EL----------------------------KGFW..G---------
DIVIB_STRR6/153-223TAD-D-IRQAS------G-I----------Q-DSDY----------------------------TINL..L---------
Q9CPA8_PASMU/55-125TYD-D-IRDVV------L-K----------M-G.DL----------------------------KGFF..G---------
Q7MNU9_VIBVY/53-123TAD-D-VQHAF------G-S----------I-T.HI----------------------------GTFM..S---------
Q7NQ02_CHRVO/37-106TAE-Q-LKFIA------E-H----------E-L..S----------------------------GTFF..T---------
Q5YYX7_NOCFA/42-110PED-E-VMAQL------Q-V----------P-E..G----------------------------RSLL..R---------
Q8DVE1_STRMU/126-197IES-Q-LIEEL------G-I----------K-KSDY----------------------------LTTL..L---------
Q82AD6_STRAW/56-125TEG-Q-VREAA------D-V----------S-L..G----------------------------SPLI..S---------
Q8YQH2_NOSS1/56-126SQE-A-IKSLL------V-L----------S-Y..P----------------------------QSLW..R---------
Q98KB7_RHILO/92-160SEI-D-ILDRL------E-L----------D-G..W----------------------------TSLI..G---------
FTSQ_COXBU/46-115KMA-E-LKDIV------V-H----------H-I..Q----------------------------GGFF..S---------
Q5HQ08_STAEQ/219-287STS-K-IKKEL------N-V----------T-S..R----------------------------SRMY..T---------
Q8DMI0_THEEB/61-130KTE-A-LQAQL------P-L----------Q-Y..P----------------------------ESLL..R---------
Q87WY8_PSESM/73-142SQQ-A-VQQRI------A-P----------Y-V..A----------------------------SSFF..K---------
Q5FUJ1_GLUOX/84-152SEA-S-IQEAL------G-T----------S-V..G----------------------------RPIF..G---------
DIVIB_GEOKA/50-118TAE-R-IISLS------G-I----------T-K..R----------------------------TSFW..K---------
Q7V8M1_PROMM/59-128QTN-T-VIKAG------A-L----------H-F..P----------------------------QPLL..G---------
DIVIB_LACLA/153-224SSE-Q-VALAS------G-I----------Q-TSDS----------------------------IFNI..L---------
Q65RZ0_MANSM/55-125TNA-D-VRDMI------L-K----------M-G.EL----------------------------KGFF..G---------
Q6AE66_LEIXX/96-164DPQ-A-IRQKL------G-D----------Q-L..G----------------------------RPLP..L---------
P73457_SYNY3/54-123SRE-T-LYEDL------D-L----------E-Y..P----------------------------QAVW..Q---------
Q73NF1_TREDE/62-130SSI-E-VKKLA------G-I----------E-S..N----------------------------TKWL..S---------
Q6AJ56_DESPS/51-120SSA-D-LYRQT------G-I----------L-R.YQ----------------------------NSLF..S---------
Q9RWN7_DEIRA/101-171AAD-E-VRRLA------G-L----------P-A.GE----------------------------SPFG..W---------
Q604W1_METCA/56-127DPA-S-VEDTV------R-E----------K-LVTG----------------------------NTYF..G---------
Q6NGD0_CORDI/29-97SAE-E-VETAS------G-I----------A-K..G----------------------------TNIV..R---------
Q7VMY3_HAEDU/61-131HNA-D-IREKL------S-I----------E-P.AL----------------------------KGYF..G---------
Q8CXI4_OCEIH/50-118NEE-K-IIKYS------E-L----------T-T..D----------------------------TNIW..T---------
Q5WFH0_BACSK/51-119AEE-T-ILKAS------G-L----------E-E..G----------------------------MNIW..H---------
Q7U5Q7_SYNPX/51-120NST-I-VSEVA------Q-F----------N-F..P----------------------------QLLW..E---------
FTSQ_BLOFL/45-115TND-D-INYII------L-K----------S-G.VL----------------------------GTFI..T---------
FTSQ_VIBCH/52-122SAL-D-VQRVL------A-R----------L-D.HI----------------------------GTFM..S---------
Q6N416_RHOPA/110-178TQD-E-ILAIG------G-I----------T-G..R----------------------------SSLL..F---------
FTSQ_NEIG1/37-106SDK-K-ALGSL------A-K----------E-Y.IH----------------------------GNIL..R---------
Q67Q43_SYMTH/58-125SQA-E-VMAIA------G-V----------M-P..G----------------------------DLKW..E---------
FTSQ_GEOSL/67-135KRD-D-VIAQA------G-V----------R-P..G----------------------------DSML..G---------
Q9CCE5_MYCLE/151-219TRE-E-VLDAA------G-V----------Q-L..G----------------------------TPLL..Q---------
FTSQ_CORGL/30-98DPD-Q-VLEVS------G-I----------V-E..G----------------------------ENLF..R---------
Q8R9G8_CALS4/29-97SYN-D-IKEIS------K-I----------Q-A..G----------------------------TNIF..K---------
Q8XJA3_CLOPE/42-109TKE-S-VIGEN------D-I----------L-N..Q----------------------------.NIF..L---------
Q7NNV9_GLOVI/69-138QLD-Q-LQRVL------K-L----------D-Y..P----------------------------QPIL..S---------
Q6A9Q0_PROAC/48-116TAS-Q-VEQVA------K-I----------P-K..G----------------------------QPLA..R---------
Q5FKV1_LACAC/77-148PVK-E-IVKIS------K-I----------K-A..S----------------------------DKVFDYL---------
Q8FNU2_COREF/30-98DTE-V-AREVS------G-I----------T-A..G----------------------------DNLL..R---------
DIVIB_CLOAB/41-109KSD-N-IIENS------K-L----------K-K..G----------------------------NNIF..Y---------
Q6LMF8_PHOPR/51-121TTD-D-VRQAI------W-H----------L-D.HL----------------------------SSFM..T---------
Q9K9T2_BACHD/50-118DDE-T-IIEAS------K-L----------S-N..E----------------------------TSIW..S---------
FTSQ_CAUCR/94-162AQA-D-ILKAS------G-L----------Y-L..D----------------------------QPTL..G---------
B1W0J1_STRGG/62-130TRE-E-VEAVA------A-V----------P-V..G----------------------------APLV..S---------
B9KHS4_ANAMF/69-137STA-E-ILN..------M-I----------N-K..D----------------------------SSII..L---------
FTSQ_ZYMMO/97-165DRQ-A-IYDIA------S-T----------Q-Q..N----------------------------LAMP..L---------
D4ZDU0_SHEVD/36-105SDK-E-IRTAL------Q-D----------L-M..Q----------------------------RSFF..S---------
G3XCS0_PROMA/62-129PNR-E-IVKAM------G-I----------N-L..P----------------------------TSLL..E---------
G8AFN1_AZOBR/99-167DPA-S-ILRVL------G-V----------Q-R..G----------------------------DPIL..A---------
H7C7L9_BORBU/34-101SKE-D-IIKIS------G-I----------K-P..N----------------------------TYYH..N---------
I6T797_ENTHA/66-137TSQ-I-AIADS------H-L----------A-I..D----------------------------GNVWSQY---------
FTSQ_MYCTU/125-192SRE-E-VLDAA------R-V----------R-P..A----------------------------TPLL..Q---------
DIVIB_STAA8/195-262STS-K-INKVL------G-V----------K-N..D----------------------------SRMY..T---------
Q2YLY9_BRUA2/68-136SDI-D-ILGQL------N-L----------D-G..E----------------------------TSLV..G---------
Q5M4Y0_STRT2/105-175LPE-D-VKVAS------G-I----------L-DTDY----------------------------ITHV..F---------
Q5ZSA8_LEGPH/39-107THK-E-LENVL------A-K----------Y-L..D----------------------------ASFF..L---------
FTSQ_BURPS/37-106NAP-T-VRAGV------V-G----------R-L..K----------------------------GNFF..T---------
Q65JX8_BACLD/54-123SKE-Q-IISLS------S-I----------H-K.GQ----------------------------TEFW..S---------
DIVIB_BACAN/53-121TDE-Q-VMKES------G-V----------T-Y..D----------------------------TSYF..R---------
DIVIB_ENTFA/126-197ESQ-A-IIQQS------K-L----------E-T..G----------------------------SGLWEQY---------
Q8F8E7_LEPIN/47-113KTE-E-IVRML------E-I----------Q-P..G----------------------------TSFD..S---------
DIVIB_LISMO/51-118TEN-E-VRKES------G-L----------E-I..G----------------------------EFVI..G---------
Q99YV5_STRP1/126-195NLD-E-LIKAS------K-V----------K-ASDY----------------------------WLTL..L---------
Q9PF78_XYLFA/35-103SPE-E-LRAAV------L-P----------Y-V..R----------------------------SGFF..A---------
FTSQ_RICPR/73-141DEL-T-ILKVL------N-A----------N-K..S----------------------------SPIF..S---------
S5VEM4_STRC3/60-128TPA-D-VREAA------S-V----------P-V..G----------------------------APLV..S---------

PF17243

Q5F5H0_NEIG1/53-127KDM---VEEHL------P-L----------I-T--Q----------------------------QQEEVLD......KEQ
B3PF57_CELJU/28-104REN---IRHYL------S-I----------A-E--E----------------------------SCTTQPW........R
E1SF31_PANVC/25-101QRN---VRARL------S-T----------I-G--S----------------------------DEVSNDG.........
Q7MYW2_PHOLL/25-100EKN---ARIHL------S-T----------I-S--T----------------------------DEVAPDG.........
G4E3B1_9GAMM/37-113EAN---IRAYL------S-L----------D-R--L----------------------------GCTLTET........Q
U2FWP7_9GAMM/36-116LAN---VRNSL------S-V----------A-A--K----------------------------HEAPWSA.......GK
E1VG33_9GAMM/24-96RQN---VKLHL------S-D----------L-D--T----------------------------RDLLQPR.........
A0A089WUQ1_9PSED/27-103KAN---VEGYI------G-S----------L-G--N----------------------------RDEEALL.........
D5BUM0_NITHN/26-104LKN---VMAYL------S-I----------V-H--H----------------------------QEDPKLT......VGQ
F0LSE4_VIBFN/2-73KDN---VDAYL------S-S----------I-P--K----------------------------SDYSTQL.........
J4UW94_9PAST/75-152WNN---VKVYL------G-Q----------I-A--N----------------------------EYADGSE.........
I1XJZ2_METNJ/35-114SET---IVNGL------S-I----------N-R--Q----------------------------KNSPRLD......SRS
E8RB68_DESPD/51-130RRN---IRSYL------S-L----------A-R--L----------------------------PEDEPPT......ALM
Q88IV7_PSEPK/30-106KAN---VEGYI------G-T----------L-G--D----------------------------RDEEALL.........
C0B0J8_9GAMM/14-89EKN---ARVQL------S-N----------I-T--T----------------------------EEVAPDG.........
A0A078L5K0_9CHLA/31-107SKE---QISFL------E-S----------I-S--Q----------------------------LASLEKD.....KPKT
W0DW72_MARPU/18-99RDN---VLALL------D-I----------Y-Q--E----------------------------RDGAGLD......LPR
M4WYA6_PSEDE/23-95KAN---IEAYV------G-S----------L-G--E----------------------------RDQAALR.........
A0A0N0VJQ7_9PSED/27-99KSN---VEGYI------G-S----------L-G--D----------------------------RGERALE.........
A3N0I9_ACTP2/53-130WAN---VQIYL------G-Q----------I-A--K----------------------------EYADGSE.........
I3DD68_HAEPH/46-123WAN---VQIFL------S-Q----------I-A--P----------------------------EYADGSD.........
B0UW15_HISS2/34-110TTN---VDAYI------N-T----------I-D--E----------------------------EERDGSE.........
A8H5B9_SHEPA/25-98ERN---VKAHL------G-A----------L-P--E----------------------------SSVQRRA.........
W0TJZ2_9GAMM/59-138LDN---ARAYL------G-L----------E-Q--K----------------------------KNDPLLS......SLW
V4IYU2_9DELT/43-121YDN---VMARL------R-I----------N-V--F----------------------------RRDTILS......EAE
A0A097AV25_9VIBR/23-94EKN---VDAYL------S-S----------I-P--A----------------------------EEYNTSL.........
G2FFV9_9GAMM/23-101EAN---VRAFL------S-L----------E-R--E----------------------------KEREALT......KGR
A0A0D8PQX7_9GAMM/25-98EDN---VDAYL------S-A----------I-S--K----------------------------NDYSNTL.........
H8KZN7_FRAAD/34-111QQA---VISAS------G-L----------S-A--Y----------------------------ATRSVSE.......AQ
A0A077DGZ1_9BURK/23-96LQT---VSKAL------D-A----------V-I--R----------------------------TLDDEDT.......KE
Q8P3I6_XANCP/81-162IEN---IEVSL------S-L----------Y-E--A----------------------------VGKEQGE.......SR
A0A097QYG2_HAFAL/25-100EQN---VRASL------S-T----------I-E--N----------------------------DEVSNDG.........
A0A0B5FPQ4_9DELT/43-123LAN---VEQAL------E-L----------P-R--G----------------------------LVRDGRI.....NKLW
A4A831_9GAMM/27-99REN---IRAYL------G-E----------S-P--S----------------------------ERGAVER.........
Q881Y2_PSESM/26-98KSN---VEGYV------G-D----------L-G--D----------------------------RDAKALR.........
F7YKQ1_VIBA7/24-95ENN---VEAYL------S-S----------I-P--E----------------------------SDYSTHL.........
D8MMC1_ERWBE/17-93QKN---VRARL------S-T----------I-S--S----------------------------DEVSADG.........
E3BGE0_9VIBR/25-94GDN---VDAYL------Q-S----------I-A--E----------------------------QDYSTSL.........
B1KIB2_SHEWM/32-105DRN---IKAHL------G-Q----------L-P--N----------------------------SNVQRRA.........
A0A0F6A239_9GAMM/26-101EQN---VSIYL------D-A----------I-P--A----------------------------SERRLTF.........
A0A060BAA3_9GAMM/33-101EAN---INAYL------Q-N----------I-N--E----------------------------EQYTDV..........
A0A089YTB8_9PSED/27-99KSN---VEGYI------G-S----------L-G--D----------------------------RDGEALV.........
W0LAB6_9GAMM/25-100ERN---VRVRL------S-G----------I-T--Q----------------------------EEVSAEG.........
A0A0F4QH72_9GAMM/40-104RDN---VMRFL------A-S----------Y-V--G----------------------------KPFTPRR.........
Q15Z96_PSEA6/29-105EEN---IETHI------G-I----------I-G--A----------------------------PVGCELT.........
K8WZC7_9GAMM/39-114NQN---VRIQL------S-N----------I-S--Q----------------------------DEVQPNG.........
A7TAA7_NEMVE/26-104EQN---ARAML------S-I----------S-A--L----------------------------DGKEVSS......ASR
F9Q9H7_9PAST/9-84IEN---TNLNV------N-L----------I-A--K----------------------------EEMDGSD.........
J1EHC7_9BURK/78-159RET---LEKHL------E-L----------Q-R--F----------------------------RQLPDLQ......ASE
K4KLG1_SIMAS/22-98ADN---ILVHT------S-L----------N-D--E----------------------------PCDAPRW........R
G7UU66_PSEUP/27-104AEN---IRVAL------T-L----------N-D--A----------------------------LGRRLGE.......AR
A4C5K4_9GAMM/25-96EDN---VRSYL------A-D----------T-L--D----------------------------AEPSA...........
H2ISU6_RAHAC/25-100ERN---VRVRL------S-S----------I-Q--S----------------------------DEVGANG.........
H8GM81_METAL/32-108AKN---VELSL------S-L----------A-R--E----------------------------QCDASRW........M
A0A0F4PJY1_9GAMM/31-102EEN---VALYL------A-Q----------L-K--G----------------------------EVPSR...........
G4E418_9GAMM/42-129LRN---VQGLL------S-L----------V-R--A----------------------------QQQAPQETQAVLSPPL
Q5ZUJ2_LEGPH/26-94LAN---VETRL------G-E----------L-S--Q----------------------------IKPLSQF.........
Q3JE50_NITOC/35-113LEN---VMAYL------S-I----------A-H--Q----------------------------KEDAQLA......EGV
G3IU04_9GAMM/26-102KKN---VQLML------S-L----------S-E--E----------------------------KCASPEW........K
C4K4K7_HAMD5/18-88ARN---VKARL------F-M----------I-N--T----------------------------EDTTDNH.........
C5BRL5_TERTT/13-89EEN---IRAHV------K-L----------A-G--E----------------------------SCSLPAW........R
A0A0N1EM58_9GAMM/26-95KNN---VALYL------K-Q----------L-E--G----------------------------EKANR...........
A0A0F6A4Z6_9GAMM/28-97DEN---IALYL------K-K----------Y-Q--S----------------------------KVFSHRQ.........
R4VJ26_9GAMM/30-104RDN---VLAFI------D-A----------D-V--D----------------------------LDSELAA.........
H8Z3L7_9GAMM/45-126EKN---VLALL------G-I----------Y-Q--E----------------------------RADKDIS......ALR
TAMA_HAEIN/27-102VRN---TDLNV------N-L----------I-N--K----------------------------EEMDGSE.........
A1WYH1_HALHL/24-97ADQ---VRGHV------G-E----------P-A--S----------------------------ADPAAIT.........
Q0VRK8_ALCBS/36-113THN---IQALI------D-L----------S-R--Y----------------------------PCHPPQA........Q
Q5E819_VIBF1/25-98LSN---VEAYI------S-G----------I-P--E----------------------------EDYSVSL.........
Q7VL30_HAEDU/47-124WQN---VQIYL------A-Q----------I-N--N----------------------------EYADGSE.........
F9TAI0_9VIBR/25-96NDN---VEAYL------S-S----------I-P--E----------------------------TEYKTSL.........
G0A4A7_METMM/26-102ATN---VKLTL------S-L----------E-K--E----------------------------SCDSPEW........K
B8F3L0_HAEPS/24-100YQN---VRIYL------S-Q----------L-S--N----------------------------DDADSSE.........
I3BWR7_9GAMM/38-115ADN---LRAFM------P-S----------L-R--N----------------------------LKCDSSS.......AR
C5BF89_EDWI9/25-100QQN---VRATL------S-T----------I-G--E----------------------------DEISNDG.........
S6AFW0_PSERE/29-101RAN---IEAHI------G-T----------L-G--D----------------------------RDEEALR.........
I1DU11_9GAMM/19-91KDN---VAIYL------Q-K----------F-T--E----------------------------DEVSAGT.........
A1AU38_PELPD/53-132REN---VRQWL------A-L----------P-D--E----------------------------LAAGDSV.....DRLW
A4VLJ6_PSEU5/59-131REN---IENYI------G-D----------L-G--D----------------------------RDARELL.........
D7N4I4_9NEIS/66-140KKM---IEEYL------P-L----------I-T--Q----------------------------QQEEELD......SEQ
A1S617_SHEAM/29-102EKN---IRAHL------G-S----------L-P--E----------------------------SEVQRRA.........
C4LDD3_TOLAT/34-106LDN---VNYYL------A-A----------L-P--V----------------------------IDSQRVE.........
A0A0M2VJT9_9GAMM/23-96EKN---VSIFI------E-Q----------Y-S--A----------------------------ADISGSL.........
D3UYW3_XENBS/25-100EKN---ARVQL------S-N----------I-S--T----------------------------EEVAPDA.........
A0A0F2P3L4_9GAMM/23-107SRN---IRAHL------G-L----------D-S--I----------------------------SCRVSEA........R
A0A0E3Y7U5_9ENTR/24-103RSH---IESKL------S-S----------I-R--S----------------------------NDIVIDQ.........
Q084L9_SHEFN/13-86EKN---IFAHL------G-T----------L-P--D----------------------------NDVQRRA.........
W0BDN3_9GAMM/32-98LEN---VQYRL------N-E----------L-Y--E----------------------------NKPISQE.........
F7NXK5_9GAMM/22-95AEN---IELYL------D-R----------L-P--A----------------------------KNNLGSR.........
C1DLX0_AZOVD/8-80KEN---IEGYI------G-D----------L-G--E----------------------------RDEQTLR.........
E0WR26_9ENTR/91-165EKN---VNARL------S-T----------I-K--G----------------------------DNVNFDG.........
Q65VW8_MANSM/38-113REN---VQLYL------A-T----------L-D--K----------------------------EDADGSE.........
N8TH50_ACIGI/255-325ATN---LKAKL------G-T----------F-T--Q----------------------------EAYSDFN.........
Q7MPD6_VIBVY/25-96EEN---IEAHL------T-S----------I-D--E----------------------------KDYSTSL.........
K2J2F3_9GAMM/34-104EDN---VEIYL------A-Q----------L-P--S----------------------------VPLDGAG.........
Q9PDZ7_XYLFA/52-133MKN---ITVSL------S-L----------Y-S--V----------------------------VGKEQGE.......FR
W0VDJ6_9BURK/80-150DDL---LEKNL------D-L----------F-R--F----------------------------QDNPRTD......REQ
J3VTA7_9ENTR/27-102QRN---VCARL------Y-T----------I-D--S----------------------------EQVTASM.........
Q3IIS7_PSEHT/43-112EKN---VALYL------K-Q----------L-I--G----------------------------EKPTL...........
W8UAH7_YEREN/25-100ERN---VRARL------S-T----------I-G--T----------------------------DEVTADG.........
A3QEZ0_SHELP/53-126KRN---ITAHL------G-A----------L-P--G----------------------------SEVQRRA.........
Q0ABA0_ALKEH/9-82RDN---VEAWL------G-E----------P-A--G----------------------------DSRRALR.........
I3D8U3_9PAST/31-106KEN---VRLYL------D-T----------L-D--K----------------------------DTANGSE.........
C9R2Q8_AGGAD/67-143NEN---VQIYT------N-A----------I-E--K----------------------------EDMDGSD.........
D3HRD5_LEGLN/26-95EAN---VEKRL------Q-E----------L-Q--K----------------------------LKPLAQF.........
A4XV24_PSEMY/27-99RTN---IEGYV------G-S----------L-E--G----------------------------RDLQSLR.........
A0A0F5ASB1_9GAMM/25-95QDN---VETYL------A-A----------I-A--P----------------------------EERDGSY.........
K1KFQ2_9BURK/25-95AAN---ARAWV------E-P----------L-E--K----------------------------AGYTDTP.........
F4GR00_PUSST/29-103LQA---INGAV------E-A----------I-T--R----------------------------LAEDQDG.......GE
Q1LSN1_BAUCH/27-108LSQ---VRNRL------S-S----------L-S--I----------------------------IDANEDN.....MDAT
I4N4G8_9PSED/27-99KAN---VEGYI------G-S----------L-G--D----------------------------RDAEALE.........
A0A0F7K051_9GAMM/40-116RDN---MLAGL------S-L----------A-S--E----------------------------SCDAPAW........R
A0A090ALX5_9GAMM/33-113LDN---VRAYL------S-L----------E-Q--Q----------------------------KNHPQLS......ASR
A0A0C5VP27_9GAMM/23-96EEN---IKALL------P-P----------S-F--G----------------------------DDRTSLE.........
A0A0A7EIJ4_9GAMM/31-102KRN---VELYL------N-E----------L-K--Q----------------------------QTFSPSL.........
V4L9I2_9GAMM/39-120QKN---VLAML------G-I----------Y-Q--E----------------------------QEDQELS......IAR
W8KKG5_HALHR/15-91RDN---IRAHL------G-L----------A-R--E----------------------------GCDLPPW........R
A0A0F4RB08_9GAMM/35-107ANN---VEVYL------Q-G----------L-D--G----------------------------SQY............R
A6D4A9_9VIBR/7-78KDN---VDAYI------S-A----------I-E--P----------------------------SEYSTSL.........
A0A0A7RZ09_9GAMM/25-96QNN---VDARL------S-L----------L-D--P----------------------------DQIDDTP.........
F5SWL6_9GAMM/30-108GKT---LLNGL------S-I----------E-K--Q----------------------------KESERLN......KRY
X2H7P2_9GAMM/12-82ADN---VDARI------S-L----------I-E--P----------------------------NKINNSP.........
M4NH26_9GAMM/26-103KAA---VIAGV------E-L----------S-Q--Y----------------------------AGRDVSD.......AQ
Q9I0U1_PSEAE/29-101KAN---IEAYV------G-S----------L-G--E----------------------------RDEAALQ.........
Q12P36_SHEDO/30-103ARN---IRAHL------G-A----------D-P--E----------------------------SDVQRRA.........
B7S2R2_9GAMM/29-101RDN---ALAWL------G-V----------S-P--E----------------------------TSQARAN.........
A0A078KVS5_9GAMM/33-99LKN---IQSRL------T-E----------L-D--Q----------------------------QKPLSSQ.........
E1VCV5_HALED/26-98ADN---IEIYL------D-G----------L-D--E----------------------------TQYQAE..........
Q6LV64_PHOPR/26-99QDN---VDAYV------S-A----------I-P--K----------------------------DDYSTTL.........
A4BTF3_9GAMM/22-102LNN---VQVFL------S-I----------A-Q--E----------------------------NKTVEKK....IPDRK
Q9KP31_VIBCH/35-106KDN---VEAYL------S-S----------I-A--A----------------------------QDYSTSL.........
M4R5B2_BIBTR/25-102YNN---VRIYL------S-Q----------V-S--N----------------------------DEADGSE.........
E6WX89_PSEUU/31-111EQN---VRLGL------G-L----------N-D--V----------------------------LGKEQGE.......SR
I3YHA7_THIV6/47-128QAN---VLALL------A-I----------Y-Q--E----------------------------RDDRDLI......PER
B8GL28_THISH/24-100EDN---IRVHL------S-I----------A-R--E----------------------------DCELPAW........R
I4WC80_9GAMM/30-107KGA---VVAGV------D-L----------S-Q--Y----------------------------ATREVSD.......AQ
B0VM47_ACIBS/241-311AKN---IKGKL------S-T----------F-T--Q----------------------------ESFEDFN.........
A0A0F7M6Y8_9GAMM/32-126QDN---IRAHL------S-A----------D-N--L----------------------------PCSTSER........S
K0CID5_ALCDB/39-118RDN---VRVLV------G-L----------D-D--A----------------------------ACQPGPG........Q
Q2LXE7_SYNAS/45-124LDN---VRAAL------D-L----------P-S--G----------------------------IVRNGDV.....NMPW
F4HFI8_GALAU/26-102YNN---VMVHL------S-S----------L-K--T----------------------------IPVENSD.........
F9U5H8_9GAMM/65-146ETN---VLALL------S-I----------Y-Q--E----------------------------RAQEDMT......PAR
W8X5B9_CASDE/43-115LQA---ITDAV------G-A----------I-T--R----------------------------LTEDQDV.......RE
M1NGG1_DESSD/41-119RQN---VLLFL------D-I----------N-K--M----------------------------KNDEDLT......PRW
E1SNG0_FERBD/142-214ARN---LRAHL------S-P----------L-P--K----------------------------TAAERAS.........
K0C4U5_CYCSP/32-110KDT---LLSGL------S-I----------V-K--H----------------------------QKNQLLS......SKR
A0A0F2N8M6_9DELT/4-82RTN---VLARL------T-L----------N-L--H----------------------------KDNERLQ......ANA
A1U274_MARHV/32-106QEN---AEILL------G-E----------V-Q--D----------------------------RTADGLR.........
B2FP46_STRMK/43-124IEN---IQESL------S-L----------Y-D--T----------------------------IGKEQGE.......SR
Q481M1_COLP3/42-113EKN---IHSYL------G-T----------L-P--T----------------------------SDLERSA.........
W0I1Y1_9GAMM/27-102QRN---VRARL------S-T----------I-G--S----------------------------DEVTADA.........
R5EJH3_9GAMM/81-157EQN---INAYL------A-T----------L-P--T----------------------------ISKSRAR.........
F3KCM4_9GAMM/8-84EKP---LLEHL------Q-N----------I-D--A----------------------------NCDAGPA........A
F5ZG84_ALTNA/45-117KDN---IRLHL------N-N----------L-D--V----------------------------ETELLND.........
I1YE94_METFJ/23-103KKS---LQNGL------S-I----------F-Q--Q----------------------------RDSQRLT......ERR
Q5QXU5_IDILO/24-102YAN---VMALL------Q-I----------A-R--L----------------------------DKDKSYA......DYR
G9ZFZ7_9GAMM/52-131HDN---AKTYL------T-L----------E-K--S----------------------------VGEKIEQ......PDY
A0KIJ0_AERHH/45-117KDN---VEAYL------N-A----------L-P--V----------------------------YQERQYR.........
E0SEC4_DICD3/41-116QKN---VRARL------S-T----------I-T--P----------------------------DEVNADG.........
A0A0A3W7U2_9GAMM/233-298EAN---IENKL------S-S----------F-T--Q----------------------------ESFSDFQ.........
Q83EW0_COXBU/33-112LEN---VFKRL------S-E----------K-H--E----------------------------TIKHDFV......PAT
H3KF74_9BURK/135-211LEN---VNAHL------M-S----------V-P--K----------------------------DITVRG..........
A0A0F3KYT3_9GAMM/26-103KNA---VVAGV------E-L----------S-Q--Y----------------------------AARDVTD.......AQ
M4U484_9GAMM/45-118SAN---VTFYL------E-T----------L-P--V----------------------------TNNAKNS.........
A0A0F5EY31_AVIPA/36-112IEN---VDIYT------K-M----------I-D--S----------------------------EEADGSD.........
D5WZA8_THIK1/95-170RAL---LSNNL------D-L----------L-R--W----------------------------RNFPGLQ......ADQ
U4K8U4_9VIBR/25-96DTN---VSAYL------S-A----------I-D--P----------------------------SEYSTSL.........
Q8EF72_SHEON/35-108KRN---ILAHL------G-A----------M-P--D----------------------------SEVQRRA.........
A6VL94_ACTSZ/58-133SEN---VRIYL------E-A----------M-D--K----------------------------NEADGSE.........
B9LYY6_GEODF/30-109RTN---VQEAL------A-L----------P-P--G----------------------------MVREGKV.....DRLW
A0A0B4XLV3_9GAMM/38-114RDN---ILAHV------A-I----------G-N--E----------------------------PCELASW........R
I3DI46_9PAST/12-87IRN---TDMNV------K-L----------I-D--K----------------------------GEMDGSD.........
L0GVE6_9GAMM/28-109EEN---VLALL------A-I----------Y-Q--E----------------------------RNDDSLT......VGR
I4W4N9_9GAMM/26-103KAA---AISGV------E-L----------S-Q--Y----------------------------AKREVSD.......AQ
C0N1X6_9GAMM/31-109AET---LRNGL------T-I----------E-R--H----------------------------KNSERIS......QRY
L0DRI3_THIND/19-95RDN---IRAFL------P-M----------T-R--Y----------------------------SCELPEF........R
K6YZU2_9ALTE/36-112ENN---IEAHL------S-T----------L-S--A----------------------------PGDCSLS.........
I8TC00_9GAMM/1-78LAN---VETRL------T-I----------R-Q--Q----------------------------RERKDLD......DTL
Q6ANA1_DESPS/46-124REN---ILATL------R-L----------Y-V--Y----------------------------RDSERMQ......EKN
H0J6T1_9PSED/10-82RDN---IQAYI------G-S----------V-E--G----------------------------RDVAGLQ.........
B7RZ71_9GAMM/20-101RNN---ALASL------E-I----------A-R--R----------------------------SKDAELS......SAN
Q6F9T5_ACIAD/236-306ANN---IKAKL------S-S----------Y-S--Q----------------------------EAFQDFN.........
M9X0F4_MANHA/58-133KKN---VELYL------D-Q----------I-A--N----------------------------EYADGSE.........
M1FHL3_9ALTE/33-110QDN---AEAFI------G-D----------V-E--G----------------------------RSTSNLR.........
D3SD66_THISK/46-123REN---IRNSL------N-L----------A-R--Q----------------------------PCDLPGF........R
N8ZR61_9GAMM/246-316AQN---IKAKL------S-S----------F-T--V----------------------------ESFSDYN.........
F9R7U5_VIBSN/25-96KDN---VDAYL------T-S----------I-P--E----------------------------KEYDTSL.........
A1SW22_PSYIN/24-98KEN---IVVFL------K-G----------L-S--Q----------------------------PQNANSQ.........
N9GN96_ACIHA/239-309ATN---IKAKL------S-S----------F-T--Q----------------------------EAFEDFN.........
C9P280_VIBME/24-95KDN---VDAYL------S-S----------I-S--T----------------------------SDYSTQL.........
B8KVC4_9GAMM/60-132HAN---IRAHL------G-N----------N-P--G----------------------------TELAAER.........
B5E9K3_GEOBB/44-124LEN---ARQAL------A-L----------P-Y--G----------------------------LVRDGKV.....DRLW
W0H9Y5_PSECI/26-98KAN---VEGYV------G-S----------L-G--E----------------------------RDAEALK.........
A5EYC6_DICNV/37-117LEN---ARAFL------A-L----------S-R--V----------------------------KNEKITQ......PSY
A0A023NUA5_9GAMM/24-101KLA---VTSGV------D-I----------S-Q--Y----------------------------ANRDVTE.......AQ
A0A098G5T9_9GAMM/25-94LAN---VEKRL------N-E----------L-Q--E----------------------------IKPLDEL.........
D0Z0D3_PHODD/26-99ESN---VEAYL------S-G----------I-P--K----------------------------EDYSATL.........
F6AEQ8_PSEF1/15-87KSN---VEGYI------G-N----------L-G--E----------------------------RDAEALQ.........
F4R1T0_BREDI/26-101KRQ---LEQAI------G-D----------G-D--G----------------------------APSSRFE.........
A0A0A1AWH5_9GAMM/25-101QKN---VRARL------S-T----------I-D--T----------------------------DEVTADG.........
G2E3U5_9GAMM/45-126ESN---VLALL------D-I----------Y-R--E----------------------------RGDADLT......PAR
H1G3I7_9GAMM/38-114TDN---IRAHL------G-L----------A-R--E----------------------------GCDLPEW........R
A0A0F5V817_9GAMM/26-99KKN---VDIYV------A-A----------I-P--K----------------------------EDYSTSL.........
Q39RU8_GEOMG/46-126LEN---VKKAL------A-L----------P-Y--G----------------------------LVRDGKV.....DTQW
A0A0F4NYM5_PSEO7/35-102EDN---ITGFL------K-S----------Y-K--G----------------------------KPKVPRV.........
Q3A843_PELCD/51-130RAN---VEAAL------A-F----------P-S--G----------------------------LVRDDQV.....DRRW
B7VKX1_VIBTL/24-95ANN---VDAYL------S-A----------I-P--E----------------------------EEYSVSL.........
A0A090K8A0_9GAMM/8-81EDN---VSAYL------S-T----------I-S--P----------------------------PKGKNYS.........
Q1QWE3_CHRSD/29-101ATN---VVNFL------E-P----------L-D--T----------------------------RNISEAR.........
A0A0C5WYE8_9GAMM/26-97KDN---VDAYV------S-A----------I-P--E----------------------------DDYSTSL.........
A0A077LKB7_9PSED/12-84KEN---VEGYI------G-S----------L-G--D----------------------------RNAQALE.........
J3TGA3_9ENTR/28-104QHK---INSNI------S-I----------L-Q--G----------------------------NKISDNP.........
V2UTL7_9GAMM/227-297QDN---IKNKL------E-T----------F-T--T----------------------------EAYADYN.........
W8RUQ6_PSEST/28-100REN---VESYV------G-D----------L-G--D----------------------------RNEAQLL.........
C6RNI3_ACIRA/259-329AAN---IRGKL------S-S----------F-T--Q----------------------------ESFEDFN.........
A0A024HHG6_PSEKB/30-103KAN---IEAFV------G-T----------V-E--G----------------------------RDQAALR.........
A0A098GEG6_TATMI/22-88LTN---IQSRL------M-E----------I-E--Q----------------------------TKSLNQE.........
I2JK10_9GAMM/20-88QKN---IRAHL------D-L----------D-D--I----------------------------PCNTTEA........R
I4VVY4_9GAMM/24-101KAA---VISAV------E-L----------S-Q--Y----------------------------ATRDVSD.......AQ
D4ZL79_SHEVD/32-105TRN---VKAHL------G-N----------L-P--T----------------------------SNVQRRA.........
Q9CK26_PASMU/34-110NNN---VRIYV------G-M----------I-D--K----------------------------EEADGSE.........
C8ND15_9GAMM/55-134HDN---AKVYL------S-L----------E-K--V----------------------------VGEKIDQ......PDY
G4T286_META2/54-130KAN---VRAFL------S-L----------S-K--E----------------------------ACDAPQW........R
I3IFC5_9GAMM/27-103REN---VRLHL------S-L----------A-E--E----------------------------SCTTPLW........R
I3CD79_9GAMM/43-124LNN---IKAFL------S-I----------E-Q--Q----------------------------KEHPNLN......PNR
E8UG99_TAYEM/32-105LTA---VQKAI------S-A----------V-V--R----------------------------QADDQDG.......GE
D3RSV5_ALLVD/31-112EAN---VLALL------S-I----------Y-N--E----------------------------RTEADLT......ATR
H2FUT9_OCESG/17-89KDN---TQVYL------D-Q----------L-P--A----------------------------IEVEQFP.........

PF17287

FHAC_BORPE/165-222RMM---VFSAM------P-G----------W.Q--D----------------------------KVLN--V---------
A0A024HPR4_PSEKB/151-204DRE---LGMAF------P-G----------R.P--G----------------------------ELLD--L---------
A0A068QSM5_9GAMM/152-206YAT---LYTAM------P-A----------R.P--G----------------------------HVLD--L---------
A0A068QWP1_9GAMM/153-204WVN---SQTLF------P-R----------L.A--N----------------------------NPLN--L---------
A0A077DEF9_9BURK/155-215LSS---LGTQF------P-F----------K.A--G----------------------------DVLN--L---------
A0A077DEL8_9BURK/159-217KLT---AKTAI------A-F----------E.Q--G----------------------------DILN--V---------
A0A077DG26_9BURK/166-226RLD---SLSAL------P-S----------Q.S--G----------------------------DFLN--I---------
A0A077FF06_9PSED/155-210ARE---LAMSF------P-G----------R.E--G----------------------------ELLS--L---------
A0A077LIX7_9PSED/146-201ERE---LAMAF------P-G----------K.P--G----------------------------EVLN--L---------
A0A089UNE9_9ENTR/153-207RAI---ITTAM------P-V----------K.A--G----------------------------DLLD--L---------
A0A089W4Y4_9ENTR/147-199SRQ---LTMAF------P-G----------L.E--G----------------------------KILN--L---------
A0A089WHP9_9PSED/110-165ARE---LAMTF------P-G----------K.E--G----------------------------ELVN--L---------
A0A089Y7U6_9PSED/151-204PLS---LRGAF------P-D----------L.L--G----------------------------EPLH--L---------
A0A097QNW4_9VIBR/155-207SSS---LNMVL------P-R----------A.M--R----------------------------GVLN--L---------
A0A0A1AZE4_9GAMM/149-203NIY---LNAAF------P-L----------R.P--G----------------------------DLLD--L---------
A0A0A1AZR9_9GAMM/137-191RFW---LYSAF------P-A----------H.D--G----------------------------DLLD--L---------
A0A0A1B1E0_9GAMM/147-197...---..EIL------P-F----------A.T--G----------------------------DILN--I---------
A0A0C4YLT9_9BURK/178-231RGT---WRSAF------P-A----------R.P--G----------------------------DLLN--L---------
A0A0D5V6B3_9BURK/190-245DQA---ARLSF------P-G----------S.P--G----------------------------DVLN--L---------
A0A0D5VBL5_9BURK/174-227RGT---LKSAF------P-V----------S.G--G----------------------------DLLD--L---------
A0A0D5VJY2_9BURK/187-259DAG---TAWAF------G-D----------S.T--G----------------------------DVLR--L---------
A0A0F3KZP8_9GAMM/162-215SGF---WRTAL------P-S----------R.P--G----------------------------ALLN--L---------
A0A0G3WHT9_9BACT/148-209ALQ---SFSFY------P-F----------A.A--G----------------------------SLLN--I---------
A0A0K8J9J5_9FIRM/159-212WGT---WKNAF------S-V----------R.H--G----------------------------DLLN--I---------
A0A0L0GTD6_9ENTR/141-193QRT---LAMTF------P-G----------L.E--G----------------------------KILN--L---------
A0A0N0GNX9_9NEIS/169-224AGA---VRMAL------P-G----------L.Q--D----------------------------KPLN--L---------
A0A0N0VK45_9PSED/154-209ERE---LKMSF------P-G----------R.Q--G----------------------------DLLN--L---------
A0A0N0XI56_9NEIS/174-242DAG---TAWAF------P-D----------H.A--G----------------------------QVLN--L---------
A4ELV7_9RHOB/88-141PVW---EAIVF------P-N----------L.I--G----------------------------KSAN--L---------
A4W4W2_ENT38/162-214PFM---LKMAF------P-G----------L.K--D----------------------------RVLN--L---------
A6T6A6_KLEP7/149-202TTR---LWNSL------P-T----------S.S--G----------------------------TILR--L---------
A7I3H8_CAMHC/146-203KIS---LFGAF------G-G----------DKK--D----------------------------KNLN--L---------
A7MPM4_CROS8/152-206YIH---AINSF------P-E----------R.E--G----------------------------DVLD--L---------
A8ETC5_ARCB4/143-192DIN---VLNLY------P-N----------Y.K--N----------------------------KILN--I---------
A8GK57_SERP5/151-203DRM---LKMAF------P-G----------L.Q--G----------------------------KILN--L---------
A8GL33_SERP5/148-202HFN---LASVF------P-L----------K.A--G----------------------------DILN--I---------
A9BSR0_DELAS/158-217APG---VHLAL------A-M----------K.Q--G----------------------------DVLR--L---------
A9I252_BORPD/159-211IGW---WRTVV------P-G----------G.P--G----------------------------DALN--Q---------
IBPB_HISS2/173-229KAM---LF.VL------P-N----------L.K--G----------------------------KVLR--I---------
B2FLM0_STRMK/159-213DSM---WKSAF------P-A----------R.P--G----------------------------DVLN--L---------
B2FUC7_STRMK/181-235HPA---LANAL------P-I----------R.S--G----------------------------SLLN--L---------
B2JV22_PARP8/174-227RGT---WKSAF------P-A----------R.D--G----------------------------DLLN--L---------
B2JXG1_PARP8/187-256DVG---YENVF------P-A----------S.P--G----------------------------DPLR--L---------
B2UCG2_RALPJ/151-205IGW---ARMVL------L-A----------G.P--G----------------------------DLLN--Q---------
B4EST2_PROMH/115-167..M---VDILF------P-S----------Y.Q--D----------------------------KRLN--L---------
B4F0Z8_PROMH/151-202GVN---TTLLF------P-R----------I.K--G----------------------------QPLK--L---------
B9JE38_AGRRK/160-215SGM---LATAF------P-G----------M.K--G----------------------------HITN--L---------
B9NWW3_9RHOB/159-213DAR---LNAAF------P-P----------G.R--G----------------------------DLLN--L---------
C0AU17_9GAMM/159-213RAR---LWNAI------P-T----------S.S--G----------------------------NILN--L---------
C0AWE4_9GAMM/75-126GVN---TALLF------P-H----------I.E--G----------------------------EPLE--L---------
C0B146_9GAMM/156-210YAL---LYTSM------P-A----------H.K--K----------------------------QLLD--L---------
C0N7I3_9GAMM/155-211NIN---LATAL------P-A----------S.S--G----------------------------DVLN--L---------
C3KAG1_PSEFS/153-208DRE---LAMAF------P-G----------K.V--G----------------------------EPLN--L---------
C4GNC2_9NEIS/182-241ITA---FHNEF------P-I----------R.A--G----------------------------ELLN--L---------
C5AEA8_BURGB/199-252YGT---WRNAF------P-T----------R.P--G----------------------------QLLN--L---------
C5B941_EDWI9/171-225YAT---LYTAF------P-A----------H.R--G----------------------------NVLD--L---------
C5BAK3_EDWI9/164-218RFS---LYSAM------P-A----------R.R--G----------------------------NLLD--V---------
C5BBG6_EDWI9/155-206GVN---RRWLF------P-G----------A.I--G----------------------------KPLR--L---------
C6JLC2_FUSVA/140-194KIN---IFTSF------P-T----------S.K--G----------------------------DVLN--I---------
C6JMM4_FUSVA/140-195KLK---LFTSF------P-V----------S.K--G----------------------------KILN--I---------
C7LTZ9_DESBD/162-218RRR---IAMTF------P-S----------GIV--G----------------------------KPLN--L---------
C8NAG2_9GAMM/162-214VQR---TPGVF------N-Y----------L.Q--N----------------------------KTIN--L---------
C8NB14_9GAMM/167-223APF---FASTV------P-V----------S.T--G----------------------------EKLS--L---------
C9LS33_SELS3/149-202TLY---TYNLF------P-F----------R.E--G----------------------------DVLN--V---------
D0GKG4_9FUSO/102-157KRK---IFFAF------T-N----------E.N--G----------------------------KVLN--I---------
D0IXU8_COMT2/175-229.TS---LIAAL------P-S----------K.P--G----------------------------ELLQ--L---------
D1BMQ4_VEIPT/212-265PLT---WQNAF------P-I----------R.E--G----------------------------DILN--I---------
D1BNY4_VEIPT/156-209RTN---WRSAF------P-V----------R.P--G----------------------------YVLR--R---------
D2RM30_ACIFV/149-203YGS---MARAF------P-I----------H.P--G----------------------------DVLN--L---------
D2TSU8_CITRI/142-196YIQ---LYSSF------P-A----------H.E--G----------------------------SLLD--L---------
D3V2Y6_XENBS/38-92YAT---LYTAM------P-A----------R.E--G----------------------------KLLD--L---------
D3VA35_XENNA/161-213PLA---LKMAF------P-N----------V.A--G----------------------------KILN--L---------
D4GL27_PANAM/168-220PRL---LRMVF------P-G----------L.E--G----------------------------KILN--L---------
D4S825_9FIRM/155-208HIP---WRNSF------P-I----------R.K--G----------------------------DVLN--L---------
D5V606_ARCNC/143-192KLY---TKNSF------F-R----------L.K--G----------------------------DYLN--L---------
D8INY9_HERSS/172-225TAS---YRSAF------P-T----------Q.A--G----------------------------ALLN--L---------
D8J1G4_HERSS/166-220RAT---QWNAL------P-A----------S.P--G----------------------------DLLN--L---------
D8MR72_ERWBE/151-205YVT---LATAL------P-S----------R.E--G----------------------------QLYD--L---------
D8MSB0_ERWBE/148-200ARI---LQTTF------P-G----------M.E--G----------------------------GILN--L---------
CDIB_DICD3/152-204ERM---TRTAF------P-A----------R.E--G----------------------------EILN--L---------
E1SHC2_PANVC/149-201SRQ---LKMAF------P-T----------G.A--G----------------------------RILN--L---------
E1SI81_PANVC/161-215YIN---LTSTL------P-F----------K.T--G----------------------------DVLE--L---------
E1SJQ8_PANVC/157-211YVS---LWPTL------P-A----------H.A--G----------------------------NLLD--L---------
E2CR53_9RHOB/145-199RHR---GEGII------P-V----------R.K--G----------------------------EILH--I---------
E3BH39_9VIBR/168-219TIN---VDLLF------P-N----------G.V--G----------------------------NPLN--L---------
E5AMD0_PARRH/229-282RGT---WKSAF------P-A----------R.A--G----------------------------DALN--L---------
E5UJT7_NEIMU/157-208TVN---VDTLF------P-N----------H.Q--G----------------------------KPLN--I---------

PF06898

F6B8F3_DESCC/8-408EKN---IRDKIPA.VAWVGV----------RVE--GTRVVIEIAERK..LVPVEPNKG.....PAHIVATKAGLIKEVLV
D4JTF7_9FIRM/10-387EQS---AMAEISR.LSWVAV----------ERQ--GSRVSVKVAETNDPEPAEIPIET.....PCNVISDFDGQLIYTEI
R5L248_9CLOT/7-384EFA---VMADFDR.VAWISI----------NRI--GCLAQVEIRETT..PKPEIENNNL....ITNVTAKKDGVIVKVTA
R7QWQ5_9FIRM/7-391EES---FRMAFDD.VIWTSV----------KIS--GTKMTIDLQENIKNKERERPNDGK....AYDIIAEKDAVIDTVIT
L0FBK0_DESDL/7-397SKT---LVEEFPD.AAWIGI----------RRY--GTRVEIKVVQKI..RPQVPGE.......AGNLVASKAGLVQQVMV
R6I0K6_9FIRM/6-384RSR---IVSEMPE.IAWLSL----------NVR--SSKAEIIVHERI..DKPDIVNEKS....PCDIIASKSGVIRKMSV
L0EFM5_THECK/10-388SRR---LNTVLPG.TAWVGV----------EKR--GTLVTIRIVETT..EP.EPRTLLS....PRHLIAKEDAVVTRITA
U5MNL2_CLOSA/5-371ERK---LEDLNDQ.IMWIRV----------RIQ--GSTLKLVIEEKV..NPPSTEKTL.....PNSVVAKMDGEIKRVYT
R6SYS4_9FIRM/4-378ERA---LKQKVEG.ISWAGI----------TRK--GDTLIIDVIETE..GDTKRESNRY....PSNLVACENGVIEKVEV
R7F0N3_9BACI/3-369EQK---ILETYPKELEWIEI----------SLQ--GTHYVVHVERR...KINDETSEVA....PRNLVAKKDALITKIEA
R7P4H2_9CLOT/3-367RKE---ILDKYPDKLDWMEF----------VVN--GLNLSVKVEER...IITDINKDNS....VCDIIAKKSGVISDIYV
Q0AWN4_SYNWW/7-394EGA---MLRDLSE.LAYVKI----------DIQ--GVKATIEVVEKI..FPREEISG......PCHIVAAKEGVVEEVLV
I0JP38_HALH3/8-385QRK---LLDDIPD.LLWIGV----------NKK--GTSYQLYGVEKTRHDTNKNLR.......PSDLVAEKKGMIVKTFI
R7H622_9FIRM/5-371ERQ---LQIKLSP.LCWAAM----------RHT--GNRLVVEVREAT..EKPEMYLDRQ....PCNLVAAKPAQIVDLSI
B2A1M5_NATTJ/8-399EDD---IIATHDE.ILWAGI----------NIR--GTRAEVNINEKE..EEPEQIEG......PSNIIAKTDAYIVDTMV
A5N6N1_CLOK5/11-376EEE---LMKNNDS.IMWIKV----------RIE--GSKLAVKTIERK..SPPNIVKEDS....PCNLVANKDGKVLRIYT
C8W3N7_DESAS/8-411ERD---IREQLPE.ISWTGI----------EIK--GTKAIIEIVEKK..LPETSENQ......PAHIVASKEGLVKEVLV
R6MSI1_9FIRM/8-382ERR---LILKNEQ.IGWISL----------NIT--GSTMSVNIEEKA..PKPDTPDFKT....PCNIKANNDGVITSIKT
B8CXJ2_HALOH/7-376ESI---ILKEEPR.LAWVDV----------KWQ--GSRLFIETVEKK......IVEKTE....PGHLIAAKSGVIKEIIV
W6RVC1_9CLOT/10-376EEK---LKSDHSK.ISWVSI----------RPY--GSKLLIDVREKQ..LPPSLIKDDT....KKDLVAKKDGIISRVYT
D4LTE1_9FIRM/6-388AAA---IRENYND.ITWVSA----------RIE--GTRLVLTVKEGI..FTEAVKTDEK...NPCNLTADQNGVIVRMIT
K0B1J4_CLOA9/8-387KSK---ILINVDE.LSYLSL----------NIK--GVKLTVEVKERD..TESKIVEDES....PCNIIAGKKAVIEKVVA
R5NSB5_9CLOT/8-384INK---IRMERTD.IAWIGV----------EIK--GTNAIIKVVEAD..EKPEIVDENE....YTNIVASKDAVVERVFA
R5HMY8_9FIRM/8-391ENR---MMMAMDA.LSYFSL----------NLH--GTRAEVIVREGD..PAPEIRAETV....PTDVVSSATGVITHIEP
C0ZB79_BREBN/7-385QKE---LLSLLPE.ASWVGI----------EIQ--GTKVMLQVVEKE..APVKPLATG.....PRHLVAKKRAVVHKILP
R6XDX7_9CLOT/8-386INK---LRLERDD.IAWIGI----------EIK--GTNAIIKIVESI..PKPNIIDDEE....FCNIVATKDAIIKKISA
A8MG63_ALKOO/8-387ETQ---MLLDMEE.LAWVGI----------EIK--GIKARVEIAEKR..LAPDIIDKNT....PCNVVASKKGVIEKVIA
J7J0E9_DESMD/7-385AKS---LQEQLPD.AAWIGI----------ERQ--GTSIQIRVSEKT..RPSIPDE.......VGNLVASRAGIVKEIMV
B8I730_CLOCE/8-390IDN---IMLGIND.LSRISV----------SVR--GTRVFVDVSERV..KPPDLIDKKI....PCNLIAAKDGVIYSIVA
Q97JI9_CLOAB/7-373EEK---LMQKNNN.IMWARV----------RVY--GSKLKVKIVERQ..EIPDVKPNNE....ARDVLAKKSGQILRVYT
R5T3J2_9CLOT/7-380ENK---ILSDNKDKLEWIEI----------NIS--GTKYIVKVLER...KLNNNNVDDN....IYNVVASKNAIISKVKA
R6C1Q2_9CLOT/6-386EKE---ARKTFPE.ITWISA----------KFS--GTELAISIKEAD..GASQSAREEG....FADLYAEKEGTIVSMVV
K4LIU5_9FIRM/7-395SKQ---VQESMPD.LVWMTM----------EER--GTNIKIRVVEKT..LPQTVLF.......QGDLLAAKTGYVEDVIV
R6UCV3_9CLOT/10-387VNE---LRAMENE.LSWVGI----------EID--GTRAIVKVVEKT..RMDEKNIQQT...SIGDIKATKSGVITKLVS
R6N4A7_9CLOT/7-383EQA---AMVKLKD.VSWMAI----------NFQ--GSVVNVELKERD..APPEAIPMEE....PCNLKSSYPGQIVRLEV
I3VX08_THESW/8-382QQE---FLMDEKD.VAWIGI----------DIK--GTKAIVKVVKKT..APPAVIDENV....PCNIIAKKDGIIYKMTV
B0TAE5_HELMI/7-400EQA---IMGAVPG.LEWVGI----------TAK--GTRVVIEVQEKVLPKKPAVDG.......PCNIIATKDGIIQRLMV
R5TPA1_9CLOT/8-390EES---LRSAFPE.ITWVSA----------RVS--GTRLLVKIKENE..VLSEIPAKDE...SPCDIVASKDGVITSMIV
R5QI90_9FIRM/5-375AME---ITKDDGR.FSWFKI----------NMR--GTVATIDIHERT..GRDGIEALTP....PSNLIAACDAQIELLDV
R5KWN8_9CLOT/12-386VNN---VRVNVPD.ISWAGF----------EFD--GTKAVLKVVEKT..KLNEKDKQNT...NIGNIVVEKSGIITKIVP
N0B454_9BACI/7-385QRK---LTNNIQA.LTWVGV----------ELK--GTTFHLQVVEKK..EPEQPKV.VG....PQNLVAKKEAVITKIYV
F8I923_SULAT/7-394RQA---MEHQLPRQYSWIGI----------HVH--GAVAQIDAIPVH..RRPPAHL.......FPRLVADAGGTVTAVYV
D3E517_GEOS4/9-385SGN---LTVRLPG.TSWVGV----------ERN--GTRIRIQIVEAA..VP.EKPPLQS....PRHLISTQDAVITHMYA
R6H3U2_9CLOT/8-388INK---IRTKRND.ISWMGI----------EIK--GTNVVVKVVKAT..EKPDIINEED....YCNIVAEKPGIITKINA
R7F7B5_9CLOT/8-387VNN---IRLARSD.IAWIGI----------ELK--GTNAIVEVVEAE..EKPEIIAQDE....YCNIVSDKEGKIVKINA
R7M7L8_9CLOT/8-385INK---IRLERND.LAWIGI----------EIQ--GTNAIVKIVEAD..MKPEIIQEDE....YCNIVATKDAMIVKVNA
R6TJX8_9FIRM/7-385RNQ---VLLEIPE.LSWLTV----------NVS--GCRATVQVRERV..KKPEMVDERT....PTNVVARRAGLVLTIQS
Q67S30_SYMTH/7-404TQH---LKSRVEE.LSWAVV----------RVD--GTRAVIEVVEKGAVTPPDQAQ.......CVHLVARKAGVVEQVIP
R5F5D4_9CLOT/9-390EAS---MRTSFPE.ITWVSA----------RVS--GTRLLIHIKENE..VLSTIPEKDE...TPCDIVASQPGVITSMVV
R5Q8Y0_9CLOT/8-386INE---IRMRRDD.ISWVGI----------SIE--GTNATVKVVEAN..SKPEIINDED....YCSIISTKDAQIVKVSA
R6M0R0_9CLOT/7-380EKE---ILNNNKDNLEWLEI----------IRN--GTKYTVRVEER...IINKEIDDNK....NYDIVSSKNAVIRVIEA
R5YC97_9FIRM/7-392ELS---LRQDFDP.IIWASV----------YEE--GTKLVVCVQEKIASDRIEPEETTG....YTDLVAKQDAVVSSIIT
Q8RB55_CALS4/13-387EKE---FLLNNEE.VAWIGI----------NVR--GTKAFVKVVGKT..KPQKVLSKEE....PCNIIAKRDGIIYKMTV
F4LSY6_TEPAE/8-387LNK---LLTKYKN.ISWAEI----------EIR--GSKLIVELVKKQ..LPPELEENT.....PCDIIASKDGIIEEIIN
R6LHZ6_9FIRM/6-383KNH---MLFRIPE.LQWLTV----------TQN--GACATVVVRERP..EAEPVDDRKT....ARNVVAARAGLVTRVSV
A4XKI6_CALS8/4-376SKK---LLADLEE.LMWVKV----------KKE--GGLLIVEYVKKE.....EGDLKNK....WGKIFAKSSGVIQKLIL
R5T032_9CLOT/3-372EKE---ILSNNKDKLEWIEI----------ERS--GVKYIIKVEER...IIKNPKEDEA....PRDIVAKKDGIIMRLNA
R5B397_9CLOT/7-382GQR---LMATDER.IAWAGV----------SIS--GVVLKIEISEAGE.TKPDTSQSTE....PTSLYAAKDGIVTELKV
R7DBV9_9FIRM/6-388AAE---IRKKYPD.ITWVSA----------KLE--GTRLLLTVREGI..FIQTTEEKDK...SACDIMAERDGEIIKMIT
R7FM48_9CLOT/8-386INK---VRLKRND.IAWMGI----------ELK--GTNAIVKVVKAT..AKPEIVDDNE....YCNIVSDKQGIITKINA
B1I691_DESAP/9-398EEK---IKERLPA.VAWVGL----------EIR--GTRALITVAEKKF.LPPDHDG.......PSDILAAKAGLVRDVLV
R7IV24_9CLOT/8-386ANK---IRLKRND.ISWIGI----------ELK--GTNAIVRVVKAK..EAPEIVDEKE....YSNIIAKKSGVITKIIA
C9RAM9_AMMDK/7-391ERV---LKEQLPQ.LAWVGV----------EVR--GTQAIIKVVEKK..LPEPAAG.......PAHIVARKAGLIKELLV
R5XPL9_9CLOT/8-386INK---IRLDRKD.IAWIGI----------DLK--GTNAIVKVVEAD..AKPEIIKEDE....YCNIVSDKEASIIKVNA
A6LRP5_CLOB8/4-370EKK---MEDLNSQ.IMWIRV----------RIE--GSTLKLVIKEKV..NPPSTEKTL.....YNQVVAKMDGEVKRVYT
Q892R7_CLOTE/11-377EEE---IMKNNDS.IMWIRI----------RTE--GSLLKITASERQ..SPPKVILMDD....PCNLVAKKDGEVVRVYT
R7HMN6_9FIRM/7-380KKK---ILEENKDTLEWLEI----------IRE--GTKYTIRVEER...IINNKPKDNK....IYNIVASKNAVIKNIYA
E6U532_ETHHY/8-382QNG---LLLRIPE.LSGVTI----------NLH--GSTAYVRVRERR..YPPDIVPQAV....PCNVKAAWDGQIVRMEV
D9R1A2_CLOSW/7-388EES---FRSKFPE.ITWVSA----------RVS--GTRLLVKIKENE..VLSEIPVKDE...TPCDIVAEKNGVITSMIV
R7L9N0_9CLOT/9-386INK---VRLDRDD.IAWIGI----------EIT--GTNAIVKVVEAE..EKPEIVDEDE....YCNIVATKDGVVTKIMA
A5D3V9_PELTS/9-406EAK---IQEKFPI.VSWAGV----------YVK--GTRVTVEVNERV..VPAEEDRR......PAHVVAAKAGLVREILV
E3E8L2_PAEPS/9-385SRA---LMQKLPE.ASWIGV----------ERQ--GTLVTIQVVEAS..QP.TPPSLYS....PRHLISKADAVVTEIFA
R7I713_9CLOT/7-390EEQ---IRISYPN.IGWVST----------ELE--GTKLSISIVETR..LPTKKTLDDN....ACHMIASEKGKIVNIVT
E6TW41_BACCJ/7-385QSI---VTDKITD.ATWIGV----------TKK--GTTYHFQVVEKQ..LA.EKEPKEA....PGHIVAKQKAVVYDLFV
X4ZFY3_9BACL/8-384SKH---LAARLPG.VSWIGI----------ERN--GTFVKIQIVEAK..LP.EAKPLNS....PRHLISRTDAVITDIYA
R5CSR2_9FIRM/6-384RSD---MLMKLPD.IAWLSV----------NVH--NSCVEVVIHERI..AKPDIVNETE....RTDVKAAKSGYITKLSV
E6UAB1_RUMA7/4-383ERS---LKRQIDD.ISWVGI----------SRT--GSGIAIDVIENI..RSDRGITVGM....PCHLVACEDGIIEEIEL
R5D9M1_9FIRM/7-386RNH---VLLALPE.VSWLAV----------NVR--GCVAHVQVVERH..RPPKAADRST....VTNIVARRAGLITKVEA
Q8EPX5_OCEIH/7-397QRN---LLDDVPE.LLWAGV----------ELR--GTTLYLEGVEKL..IV.EELDPGE....PGNIVAAKEGVITRMYV
R5IHX3_9FIRM/8-382KNQ---MLLRIPK.LQWLTV----------QQS--GMCARVVVRERP..DKAPVLDRKV....PTDVIASRAGVLTRVEA
Q24SU1_DESHY/7-393SKL---LVEEFPD.AAWVGI----------SKH--GTRVEIKVVQKV..RPQVPGE.......AGNLVASKAGLVQQVMV
Q9KD59_BACHD/9-387QRE---VTEQLSG.ATWIGV----------RQN--GTTYQFEVVEQQ..LPEEAER.IS....PRHLVAKKKAIVHSVFV
R5XQE7_9CLOT/3-370RDH---IMQEIDE.VAYLSI----------NVK--GTNVFVTITKKD..DENTQTAKSN....YCNIIASKNGIIEKVIA
Q3AEZ9_CARHZ/5-371KRE---ILAQMPE.ISWVGI----------EKK--GVRLIITGKMRQ.....EYRQKYK....KADIVAKRDGIIKEILV
F6CMU5_DESK7/8-406ERA---LKANLPA.ISWTGV----------YVR--GTRVTIEVVEKT..IPEEKNQS......PAHIVAIKAGVIKEVLV
F2JQA7_CELLD/7-387ETY---LLQQYPD.IVWTGI----------TYE--GTRMMVRVAESV..PKPEMSEMNEK...PKMLIAKRDALVTYIAV
U5LCI4_9BACI/7-385QRE---LSNEVDE.ITWVGV----------ELK--GTTYHFQVVEKN..EPDKPEL.LS....PRHLVAKKKAVILDMFV
A8FFB9_BACP2/7-386QKS---LTANIQS.ITWVGV----------ELN--GTTFQMKVVEKN..EP.EKEKYTS....PQHIVAKKKAVITRMYV
L7VHP9_CLOSH/8-388ADK---LMLNNRG.LAWVGV----------ELK--GTKLIISVREGI..EPPRVVPMDQ....PCNVVAERDGIVISVRA
R6D0A8_9CLOT/8-382ALS---LRREYHE.IGWAAV----------NLI--GSVAEIEIGERD..EGDEVVEDSS....PCNVVASRGGQIVSMEV
Q65H67_BACLD/7-386QQA---LTKRVEN.ITWVGI----------ELN--GTALHMKVVEKN..EP.DKEKYIG....PRHIVAKKGATISKMFV
D9QV99_ACEAZ/7-405EKK---IESHRK..IAWADI----------ELQ--GTKLDVEIVEKV..LVEEKDRTDK....VVDVVAKKTGLIEEIIV
C8WY36_ALIAD/8-383AER---MVARAPN.YVWVGV----------EVK--GSVAVVRGIPKIPGVPQASQQ.......PCNIVATRPGVILDVQA
Q2RKW7_MOOTA/8-408EYG---LEQRLPQ.LAWVGV----------SFH--GTRAEIKVVEKI..PPPAGDDYEL....PASIIAAKDGVIKQILV
YQFD_BACSU/7-386QKS---LTNGIDN.ITWVGV----------DLK--GTTIHMKVVEKN..EP.EKEKYVS....PRNIVAKKKATITRMFV
Q5KX07_GEOKA/7-385QKK---LTERVPD.ITWVGV----------EWK--GTSLHFRVVEKE..IP.EPKKPIP....PRHLVAKKEAVIADLFV
R6XTI8_9CLOT/8-386INK---IRLDRED.IAWIGI----------DIE--GTNAIVEIKETS..KAPEIINENE....YCNIISNKEGMITKINV
R6NIT4_9CLOT/8-386INN---IRLQRKD.VAWIGI----------ELK--GTNAIVKLVKAD..EKPEIIDENE....YCSIVSNKSGIITKISA
R6G2U3_9CLOT/4-369EKK---LESLNSE.ILWLRV----------RVE--GSTLKVVITEKV..NPPVKDEGK.....YGNLVADMDGQIKRVYT
R6QWU5_9CLOT/7-381EQQ---ATIDMDN.IAWISI----------NIT--GTLVNIELSPRVDKKAPTDKT.......PSNIIASSDGVITGIEA
F4A357_MAHA5/8-386END---MLIKMPE.LSWIGI----------ELR--GTKAIVRIVEAV..MPPERIDIDQ....PCDIIASKDGVISKITV
R5ITB3_9CLOT/7-378KNK---ILEDNKKIIEWLEI----------EVS--GTKYIVKIEER...KINNKKKDNT....YQDIISTRDAVIKNIVA
R7IQG8_9FIRM/7-393EKS---IRNHYFD.ITWVSV----------EIT--GTRLIVHIKENEEEIRRASENTDEASGESYDLVATKQAVVTSVVM
F6DMW5_DESRL/8-408EKE---IRDQLPS.VAWAGI----------TVE--GTRVTIEIAERK..LVTEDVNKG.....PAHIIAGKAGLIKEVLV
R7L3Q3_9FIRM/6-381ERR---IKGMDKD.VGWIGI----------RHT--GSRVVVEISELT..EPPEMQSKNT....PCNIVASRDAQIKNVRL
K0J274_AMPXN/9-396QSK---ILTDYPN.ILWVGI----------TPN--GVNYQLEVITK...KQPEVKERQQ....RTHIYAKKDGVISEMFV
I4DAP4_DESAJ/7-400AKN---LQEELPD.AAWVGM----------ERN--GTEIKIKISEKI..RPSIPKE.......AGNLVASHAGLVKEIMV
D7CNW5_SYNLT/8-391EDG---ILKDLLQ.LSYVEV----------NIK--GVKAQIKVVEKV..LPNQPEG.......PCHIVARKDGIIESVLV
R5Y9N3_9FIRM/7-382EFS---VLADFDD.VAWISI----------NKF--GCLAQIEIRQTT..PKPAITNNTV....ITNVKAKKAGIIVSVTA
R4KCE0_9FIRM/7-406EKT---IMQQVND.LAWVGV----------SVD--GTRVLIKVVEKV..LPPDNGEH......PVDIVALKDGLIKEILV
R6YI22_9CLOT/2-369KKK---ITDKYKDSIEWIEI----------TDI--GTKYEVKIVER...KKQSNNVSTE....YTNIVAKKSGVIKKIYA
G8M1A5_CLOCD/7-388ANS---LRFDIKD.LSWVSV----------VIK--GTKVKIEVAEGV..EKPKLVDKNT....PCDIVAAKDGVIKSIIV
K4LKI1_THEPS/8-398VDH---LLRELPE.IAYAEV----------NV.--GPRSRIRISEKQ..LPEPGVG.......YCHIVAEKEGVIESVLT
G4KWF7_OSCVS/7-385RNH---ILLEIPE.LSWLTV----------NVS--GCRAYVQVRERV..MAPELANRRA....PCNVTARRDGLVLEVHA
R6NSX8_9FIRM/7-390KAA---IINNNDH.IAWAWV----------YIE--GAKARVEIYEQI..IPPNILDKDT....PCDIVAACDGIINHMVV
R6RMK3_9CLOT/7-391EES---LRNQFAE.ITWVSA----------EIK--GTRLTVRIKENE..AMLSPVEPDR...TPCDLTAEKDGVIERCVV
A3DEC5_CLOTH/8-389ANG---VILDIDG.LSYVNV----------LVR--GTKVKVEVAEGV..KRPSIIPLNV....PCDIVAKKDGVIKSVIV
R6GJ09_9CLOT/6-381EKT---IMKNFDN.IAWVSV----------NIK--GSTLSFELKERV..IPPQIIPKTA....PCNVKSNSDGQITRMEI
D9S2Q3_THEOJ/8-389LDK---ILFNYKN.IAWAEI----------EIR--GTRVIIDLVSKE..MPPRIEDDT.....PCNIVASKDGVIEEVIP
D4LCN8_RUMC1/4-373ETK---LRLAIPE.LRWAGI----------RHT--GGRVVVDVAEAT..PQPGMLHDRV....PCNYVATRDACIQSIMP
C5D4T1_GEOSW/7-385QKK---LTDRMDV.VTWIGV----------ELK--GTTLYFQVVEKN..QPKEPEK.IG....VRHLVAKKKAVITDMFV
W0EAS0_9FIRM/7-398VKA---LVEEFPD.AAWIGI----------EHQ--GTRININVKEKI..RPVVQTE.......RGNLVANKTGIIHELMV
F9VJJ5_ARTSS/9-374EEE---IVANNKN.LLWSKV----------RVQ--GSTLQIEVIESF..KPPVIEVDSS....LGDIVADKDGEIVRVYT
A0Q1Q5_CLONN/8-374EEQ---IVRKNGA.IMWSRV----------RVE--GVKLKVKIAERQ..EPPEIEKKES....PSNVVASKDGEIRRIYS
F0SVD9_SYNGF/7-392NEK---MLESIPE.LSWVSI----------EEK--GTEVKIRVAEKT..LPEKILL.......GGDLIAGKTGIVQDLMV
D9SW54_CLOC7/9-375QEE---IMSKNEN.ISWIKI----------RID--GSTLNVEVTEKK..TPPAIEQIRD....SGDVVAKKDGVITRLYS
G2TNK7_BACCO/7-385QRK---LTNNLPD.VTWVGV----------ELR--GTTYHFTVVEKN..MP.EPVKHPG....PQHLVASQKAVVENMFV
Q8XIU3_CLOPE/5-374ERK---LENGHGD.IMWVNA----------RIE--GGTLKIKVEEKV..SPKIKEENENKE..FKNIVASMDGEIKRIYT
R5HCW7_9MOLU/9-376KNS---ILEKYKDKIEWLEI----------ESL--GTKYIVRLQERL..TIPKNTESNK.....VHIVSSKDAIIKNVVA
R7MJV7_9FIRM/5-378ERE---LRIRIDK.ISWTAI----------RRT--GNRIVVDVTEIV..DIPEMLKKRT....PCNIISDKNAQITNVSV
R5AEU1_9CLOT/3-374NER---LRTYDDR.IAWIGL----------ALD--GTVLRVKVVETA..VKNDAWDDDA....PADVVAQKSGVITEIVA
R5JAK2_9FIRM/6-375KEK---ILNKYPDKIEWLEI----------EEI--GTKYTVRVEER...TIVKEDESNT....PRNIIAAKDGVLKKVIA
R5JWC6_9CLOT/7-386EEE---LREVFPE.IAWVSC----------EIK--GTQLNVEIKETL..EGTETIQTDA...TPQDIVAAKDGVIVEMIT
L0KBA1_HALHC/7-398TDF---IIENKPR.VSWANV----------YFQ--GTKLIVQIVEKE..LLDTEIN.......PSDIIAEKSGVIKELIV
R5X7Q5_9FIRM/6-388AAS---IREEYPQ.TAWVSA----------RTE--GTRLVITVKEGD..FQNKKKKEKA...EPCNLTATESGTVVKIIT
R7NE92_9MOLU/3-369IES---IKEEYPDQIEWLEI----------DVE--GMVINVRVEER...IINNYEKDYS....TCHIVASKSGIIKSIKS
D3FY22_BACPE/7-385QRD---VTEQVSG.ATWVGV----------RQK--GTTYQFEVVEQK..LPEEAER.VS....PRHLVAKKKAIIHDIFV
Q5WHE5_BACSK/7-385QRI---VTEYIDE.ATWIGV----------RKK--GTTFEFEVVEQV..RQEAPEL.LS....PRHLVAAKKAVIHKMFV
B2TM04_CLOBB/5-371EKK---MEDLDSE.VMWVRA----------RIE--GSTLRVIVAEKV..NPPVTEKIS.....PEQVLAKMDGEVKRVFT
A6TSK6_ALKMQ/8-387EEE---LMIRFSD.LAWVGI----------EIR--GIQARVEIVEKT..TPPVRVERDT....PSHVVARKNAVIERIVA
G7MCG1_9CLOT/5-371EKK---MEDLNDQ.IMWIRV----------RIE--GSTLKLVIKEKV..NPPSTEKTL.....YNQVVASMDGEVKRVYT
Q182D1_PEPD6/3-370RDH---MMSKFND.VAYLSI----------NVK--GTNIFVTVTKKA..ESLKSTDQSN....YCNVIALKNGIIEKVIP
B7GKD9_ANOFW/7-385QRT---LMNHMDT.VTWIGV----------EWR--GTTLYCRVVEKK..QPTETKS.NT....PQHLVAKKKAVITYMFV
R6CV47_9CLOT/2-371INK---IVSDNKDKIEWLEI----------ERY--GSKLTIKVTER...KLNKEKEDDK....PRHIVAKKDGVIMKIEA
D5XAQ9_THEPJ/8-405EKR---IKTELSG.ISWVGI----------NIT--GTKAIIRVAEKV..TPPVEDDR......PAHIVANKTGLIEEVLV
A5I631_CLOBH/5-371EEK---LIKDIDN.IMWVKA----------RIE--GGKLVVKAEERQ..SPPTIVKEDE....PCNLVAKKDGEVQRVYT
R6CYS5_9FIRM/7-389RNR---VLPLLPD.VVYLAV----------NVK--GCTAHVQVVERV..RPPHLYRDSD....VQNIVAARDGLITKIEA
R6BC91_9CLOT/8-386INE---IRLKRAD.IAWIGI----------SIE--GTNAIVKIVEAE..AKPEIINEED....YCNIIATKDAQIVKISA
R4KBT4_CLOPA/9-375EEK---LKTNNEN.IMWVRV----------RIQ--GSKLKVTATERQ..SPPEVINDDS....PCNLVAKKDGQIVRIYT
C6CTU6_PAESJ/7-385SKE---LVTDLPG.TTWVGV----------EKK--GTRIVIQVVEST..EA.EKAELQS....PRHLVASNDAVITEIYT
R5AR68_9FIRM/7-385RND---MILHLPE.LRWLTV----------NVH--GSRAEVIVREKD..PLPDITPDDT....PVSIYASATGVILSMDV
M1LPE2_9CLOT/3-366EKK---MENINDQ.ILWIRT----------RVE--GSTLKIIIKEKV..NPPLTEKTL.....YNQVIAKMDGEVKRVYS
R5A1X4_9CLOT/2-368KNN---ILKSNEDILEWIEI----------VEK--GCSYTINLTKRV..KKKSDMETNT....PSDIVASKDGLIKYITN
R6Z4S5_9CLOT/6-387EGR---IRSRYPD.VTWVSA----------RVK--GTRLYVHIKEND..VVLTVPEKDQ...TPADLAAAENGTIVSMVV
R5ACZ0_9CLOT/8-391ALA---IQNALPE.ATWLSV----------NTD--GCFVEVALQEAL..PAPEVVDDRE....WSNIVASRAGTVISVEA
A4J7E2_DESRM/8-408ERT---IREKIPA.VAWAGV----------YVK--GTRVIIEIAERK..LVTERPNKE.....PAHIVARKAGLIKEVLV

PF07244

Q5F5H0_NEIG1/221-295--DLL......LDFQQ.....---.---------------------------------------ALEQNGH.YS.---GA
TP326_TREPA/186-273--NAL......EADKAAV..H---S---------------------------------------YYAERGY.IDA---RV
Q98MC3_RHILO/107-184--ATL......DSDVEAV..K---A---------------------------------------AYRRIGR.DDA---GV
Q6ARL5_DESPS/92-170--AQI......SAAKEAI..I---S---------------------------------------LYESKGF.YNC---TV
Q5NEP7_FRATT/354-428--EAI......DKSQR.....---.---------------------------------------RLEQLPY.VG.---AA
Q5FPE9_GLUOX/347-432--SRI......EAARQ.....---.---------------------------------------DLASTGV.FA.---SV
Q8KFQ6_CHLTE/212-301--DKF......EEDKNLL..V---E---------------------------------------FYRDNGY.RDA---RI
Q73JH4_TREDE/105-183--VNI......KNAERAL..K---D---------------------------------------FYIEKGF.TKA---EI
O84244_CHLTR/185-272--DMV......EQDLFAI..T---N---------------------------------------YFQNKGY.ADA---KV
Q9I0U1_PSEAE/190-268--ELI......AELNQ.....---.---------------------------------------NLQSSGY.FE.---GV
Q8EGG7_SHEON/97-177--TML......TGIEKGL..Q---D---------------------------------------FYYGVGK.YGA---KV
Q8KFQ6_CHLTE/304-389--KKINERLNFSQDHSDV..S---S---------------------------------------LYLDRGY.LSF---RA
Q9KUB9_VIBCH/347-418--EEI......EASIE.....---.---------------------------------------DLYALDR.FE.---LV
Q73JH4_TREDE/186-274--DAL......QADKNAI..K---L---------------------------------------LYGEHGY.IDA---HV
Q98MC3_RHILO/360-433--VLI......QRAKK.....---.---------------------------------------RLEDLNY.FD.---KV
Q6MAE9_PARUW/218-306--DAI......QQDRLII..T---N---------------------------------------YLQNQGY.ADA---SV
Q8XZI3_RALSO/98-178--SLI......DRAEQEL..K---R---------------------------------------QYVSRGY.YAA---DV
Q8EGG7_SHEON/352-426--AQV......EQSKA.....---.---------------------------------------RLNRLGF.FE.---TV
Q604T9_METCA/124-204--QIL......DKVEQEL..R---R---------------------------------------QYYSRGK.YSL---KI
Q8D271_WIGBR/189-264--ELI......SDLNN.....---.---------------------------------------KLISTNW.FN.---SV
Q82VX0_NITEU/116-201--ARW......EDAKSAL..L---S---------------------------------------SIANRDF.ATA---RI
Q87LW2_VIBPA/354-425--AEI......EKAVE.....---.---------------------------------------NLYALDR.FE.---LI
Q6MAE9_PARUW/390-467--IKL......KATEQRL...---.---------------------------------------..INIGYFKHV---NV
Q6LKQ8_PHOPR/351-422--EEL......EQAVE.....---.---------------------------------------RLHAQDN.FS.---RI
O84244_CHLTR/275-353--DKI......WTGAQKI..R---S---------------------------------------AYARYGY.VNT---NV
Q5NZG7_AROAE/348-422--EEI......NRSRT.....---.---------------------------------------RIDRLGH.FE.---EV
O67326_AQUAE/374-446--KGI......ERSKT.....---.---------------------------------------RIMNLGY.YE.---DV
Q5NNB2_ZYMMO/333-411--QMV......DDLRQ.....---.---------------------------------------ALAATSL.FS.---HV
Q7VHH5_HELHP/344-416--SDL......KESEN.....---.---------------------------------------ALKRLGY.FG.---KV
Q98MC3_RHILO/187-275--DKL......RADQELL..R---R---------------------------------------FYYNHGY.ADF---QV
Q6FCG7_ACIAD/270-348--EKV......NAVKQLL..L---R---------------------------------------KYGNAGY.YFA---EV
Q6MMX9_BDEBA/120-198--AKV......KEAVEKI..Q---K---------------------------------------LYEDKGF.FLA---KI
Q8XZI3_RALSO/353-427--EKL......QLSQN.....---.---------------------------------------RINRTGY.FT.---DT
Q7MIG8_VIBVY/266-344--SAV......TTLEENI..K---R---------------------------------------VLGEAGY.AYP---KV
BAMA_HELPY/312-391--EHL......RADAQIL..K---T---------------------------------------EIADKGY.AFA---VV
Q8RHT4_FUSNN/251-335--KEY......DATVD.....---.---------------------------------------NLMRLGI.FK.---NV
Q6D152_PECAS/230-304--EDL......GELNR.....---.---------------------------------------RLSASGW.FN.---SV
Q5E2U2_VIBF1/342-414--DEL......EEHIR.....---.---------------------------------------DLYVIDR.FE.---RV
Q89NX1_BRADU/319-398--ELV......EKSVEDM..Q---I---------------------------------------EASRRGF.AFA---VV
Q92Q48_RHIME/107-184--ATV......ETDIQAI..R---D---------------------------------------AYAAIGR.SDV---TV
Q5R0Z1_IDILO/176-264--QQL......SGDLETL..E---S---------------------------------------FYRDRGY.LRF---RV
Q5E3E7_VIBF1/92-172--TTL......SNIEKGL..E---D---------------------------------------FYYSVGK.YNA---TV
Q8D2H0_WIGBR/95-175--SAS......QEIKISL..K---N---------------------------------------IYDYIGK.YNS---EI
Q5FPY9_GLUOX/117-194--QTT......AADRQKI..L---N---------------------------------------QYAGKAR.FGA---TV
Q8KFQ6_CHLTE/132-209--QEL......LNAENRI..E---K---------------------------------------QYAAKGY.LTA---GV
Q83DT2_COXBU/99-179--TKL......HEIEVGL..E---Q---------------------------------------QYGAMGY.HAA---TV
Q6FCG7_ACIAD/179-267--EKM......AASLESL..R---A---------------------------------------LYLNKGY.INF---NI
Q6N5Q8_RHOPA/187-275--DRV......EADRDLI..R---R---------------------------------------FYLKHGF.ADV---QV
Q6ATX4_ORYSJ/67-146--QDL......LRNASIA..S---A---------------------------------------RLRQLDV.FD.---SV
Q7MHW3_VIBVY/361-432--GEI......EAAIE.....---.---------------------------------------NLYALDR.FE.---LI
Q7MAB6_WOLSU/88-166--SKV......ERARKSI..M---A---------------------------------------ALEKKGF.YDT---VV
BAMA_DESVH/301-383--DVM......QTDDKLL..S---D---------------------------------------YYADYGY.AFA---EI
Q5NEP7_FRATT/96-176--NTM......FLLKQSL..L---N---------------------------------------QYSMMGL.YGA---KI
O67326_AQUAE/290-371--EVI......EKIKNRI..R---E---------------------------------------KYAEIGF.LNT---SV
BAMA_DESVH/131-209--KLL......AQDLQKV..T---E---------------------------------------LYRKEGF.YLA---HV
Q7UK20_RHOBA/180-256--FAI......ETGKRRL..L---D---------------------------------------YYHEEGF.NQA---AI
Q7MXJ3_PORGI/386-461--EDI......INSIR.....---.---------------------------------------LINQLGH.FDA---EK
Q98K30_RHILO/218-292--QEI......SDARD.....---.---------------------------------------RLLALEV.FN.---SV
Q82U03_NITEU/346-420--EQI......NRSRQ.....---.---------------------------------------RVDRLDF.FT.---GV
Q5R0Z1_IDILO/93-173--TTI......SGIEKGL..E---D---------------------------------------FYHSVGK.YNA---SV
Q7MXJ3_PORGI/302-383--RRLAK..RLNEDEDAV..G---N---------------------------------------LYYNNGY.IFA---WV
Q88IV7_PSEPK/195-269--ELV......AELNN.....---.---------------------------------------DLQSSGY.FE.---GV
Q74AT3_GEOSL/270-348--ANL......RTDVMTL..T---D---------------------------------------LYADKGF.AFV---NV
Q5NND8_ZYMMO/397-485--DKL......AYDQQKL..R---Q---------------------------------------FYLVNGY.ADF---RV
Q5FPY9_GLUOX/370-443--FDR......KYSKL.....---.---------------------------------------GLQDLGY.FS.---SV
Q6MAC6_PARUW/256-330--KKL......EKTQE.....---.---------------------------------------ALELSGL.FS.---SI
Q82U03_NITEU/265-343--EKL......TESIKLI..S---D---------------------------------------RLGNDGY.AFA---NV
Q8EGG7_SHEON/271-349--GDV......TFAEEMY..S---K---------------------------------------YLGRFGY.AYP---EV
BAMA_BUCAI/175-263--KEL......NNDLEHL..K---N---------------------------------------FYLSNGY.YYF---NV
Q6MKB1_BDEBA/93-170--QTL......IEGGEKL..R---Q---------------------------------------AYRDIGF.YNA---VI
Q65R79_MANSM/88-168--EKL......EAFRQGI..Q---E---------------------------------------HYESTGR.YNA---KV
Q5LSU6_RUEPO/196-284--DRI......EFDKQVL..R---D---------------------------------------FYLSRGH.VDF---RV
Q74AT3_GEOSL/179-267--EVV......KNDANLI..A---D---------------------------------------LYFNNGY.VNV---KV
Q9A711_CAUCR/345-418--VLV......DRSKN.....---.---------------------------------------NMRRLGF.FK.---EV
Q7VYC2_BORPE/276-354--AKA......NNSAKAI..T---N---------------------------------------YLGDLGY.AFA---NV
BAMA_HELPY/138-216--QKL......EHAKTAL..K---T---------------------------------------ALEGQGY.YGS---VV
Q7MPD6_VIBVY/100-183--GDY......DTLKSSI..R---N---------------------------------------LALQKGY.FKG---DF
Q7MXJ3_PORGI/45-119--DAM......SAAVN.....---.---------------------------------------RIMRQGY.FS.---..
Q5NZG7_AROAE/267-345--EKL......TETTKAV..A---D---------------------------------------RLGNEGY.AFA---NV
Q9RXD5_DEIRA/97-179--QRL......EQAKEAL..A---Q---------------------------------------NYRQEGFPFVP---..
Q8DI03_THEEB/90-161--TQL......QQDTN.....---.---------------------------------------AIFATGF.FA.---DV
Q604T9_METCA/298-376--KLA......TETQKGI..S---D---------------------------------------RLGEEGY.IFA---NV
Q886N5_PSESM/91-171--ATL......EGVRNEL..Q---R---------------------------------------QYVAQGR.YSA---EV
Q8EGG7_SHEON/180-268--QKL......QADLETI..K---T---------------------------------------YYHNKGY.IRF---EV
Q74AT3_GEOSL/99-176--KEL......TLAGKRV..K---K---------------------------------------LYGDEGY.YLA---EV
Q89KQ1_BRADU/278-357--ESV......EKSVEEM..Q---I---------------------------------------EASRRGY.AFA---VV
Q87SW5_VIBPA/101-182--GEY......DSLKSGI..R---N---------------------------------------LALQRGY.FNG---DF
A9CJ61_AGRFC/186-274--DKL......RADEEAL..R---Q---------------------------------------FYYNRGY.ADF---RV
Q8XZI3_RALSO/272-350--AKL......SATTKAI..T---D---------------------------------------LLGTYGY.AFA---TI
Q6MMX9_BDEBA/201-289--EMF......ERDVQIL..R---F---------------------------------------LYWNQGY.VQA---KV
Q7CWM5_AGRFC/240-314--EKL......RKAAD.....---.---------------------------------------RLRQLGV.FS.---SL
Q6MMX9_BDEBA/48-119--QHI......REDVQ.....---.---------------------------------------ALFNMGF.FN.---DI
BAMA_HELPY/394-466--TKL......RNSEN.....---.---------------------------------------SLRRLGF.FS.---KV
Q5R0Z1_IDILO/267-345--AQV......TYIEDMI..S---R---------------------------------------FYGRYGY.A