Sequence alignment for CL0194

PF00136

DPOD_YEAST/555-991------GQQIK-----------------VVSQLFRKCLEIDTVIPNMQSQ..............................
DPOL_GPCMV/556-1073------GQQIR-----------------IYSCILEEAGERNMILPSFLTAKRPGELATESSPVASFE.............
DPOL2_AERPE/390-793------SVGFR-----------------LEWRLIREAAKLGELVPNRVER..............................
O40910_HHV8/533-1006------GQQIR-----------------VFSCLLEAAATEGYILPVPKGD..............................
DPOL1_SULSO/450-869------EISTW-----------------VKNLYYWEHRKRNWLIPLKEEILAKSS.........................
Q89604_9ALPH/639-1203------GQQIR-----------------VFTCLLRLARARGFLLPDTQKRLAGAEAGAARGAGRGRGERFACWADAAR..
Q9YQZ6_9VIRU/602-1028------RRAVE-----------------VPLATVRLRIDKAVSLARGAEDRLM...........................
Q9WSY3_9ALPH/582-1139------GQQIR-----------------VYTCLLRLAGSRNFILPNKPQVRAGTEFENSIASTDEF..............
DPOL_ARCFU/361-774------GRGKQ-----------------VDWLLLSEAKKIGEIAPNPPE...............................
DPOL_RCMVM/533-1077------GQQIR-----------------IYTCILEECSARGMVLPSLPSSPPSSGGDGAGLEGGDGGTAGRRKKKRSGSA
Q9YW56_MSEPV/569-1067------TSSNT-----------------ATGQLLYTLLQEKQMFKKYIT...............................
DPOL_ASFL6/457-978------GHKVC-----------------NMLIAYAIHDEYGRIACSTIAR..............................
DPOD1_CAEEL/520-978------GQQIK-----------------ILSMMLRRCKQNNFFLPVIEAN..............................
DPOL_FOWPN/483-977------RASTL-----------------IKGPLLKLLLEERVIYTRKITK..............................
DPOL_HHV21/617-1200------GQQIR-----------------VFTCLLRLAGQKGFILPDTQGRFRGLDKEAPKRPAVPRGEGERPGDG.....
Q9Q6Z6_9GAMA/520-997------GQQIR-----------------VFSCLLASAKNRGYILPMPQNG..............................
Q59691_PYROC/388-793------GVGFR-----------------LEWYLMRAAYDMNELVPNRVER..............................
O36638_9PHYC/422-974------GQQIK-----------------CLSLILDRVHGEFVCNKASRVL..............................
DPOL_IIV6/578-1226------GQQVK-----------------FFNQVYKYCYDHKTVTDKETYK..............................
Q69281_9ALPH/606-1168------GQQIR-----------------VYTCLLRLEIDG.FILPEKNKKFAETVSLTCEEDQTEICE............
DPOL_EHV1B/611-1173------GQQIR-----------------VYTCLLKLARERNFILPDNRRRFDSQADAASETSELAMDSQSHAFDST....
DPOL_MUHVS/543-1050------GQQIR-----------------IYTCLLEECSGRDMILPNMPSLGHGAAAAIEEAAA.................
DPOD1_MESAU/546-1005------GQQVK-----------------VVSQLLRQAMRQGLLMPVVKTE..............................
DPOLA_ORYSJ/834-1303------SRAQR-----------------VEYLLLHAFHARKFIVPDKFARSKEFNSTKRKMNPDTEAA............
DPOL_RSIV/397-938------GQQVR-----------------VFAQIYRDCTPMDVVDKVYVIPDGG...........................
DPOL1_SULAC/448-867------EVSTW-----------------IKNLYYWEHRKRNWLIPLKEEILVRSN.........................
Q9Y1T1_TOXGO/1006-1612------QRAER-----------------NAFLLLHEFHREKFICPDKDDPYARGPPVRRPHAGPGRGGPRRGPSASGARD
DPOL1_SULOH/448-867------EVSTW-----------------IKNLYYWEHRRRNWLIPLKEEILTRSS.........................
DPOL_BPT4/383-855------HVKQS-----------------FPGAFVFEPKPIARRYIMSFDLTSLYP.........................
Q98207_MCV1/494-994------RASTL-----------------IKGPLLRLMLRERVVYVRTQEP..............................
DPOLA_OXYNO/783-1270------ARAER-----------------NEMLLLHEFKKKKFVLPDKKQLNAKDLKKNMFA...................
DPOL_EHV2/530-1004------GQQIR-----------------VFSCLLDVAGREGYILPVDRHA..............................
DPOL_ORFN2/499-998------RASTC-----------------IKGPLMKLLLENRTVMVRADTK..............................
DPOLA_DROME/805-1258------GRSER-----------------NEFLLLHAFHEKNYIVPDKKPVSKRSGAGDTD....................
DPOD1_PLAFK/544-1000------GQQIK-----------------VTSQLYRKCKELNYVIPSTYMK..............................
DPOL_VZVD/597-1136------GQQVR-----------------IYTCLLGLASSRGFILPDGGYPATFEYKDVIPDVGDV...............
O41930_MHV68/528-1001------GQQIR-----------------VFSSLLDAARRENYILPSNQAK..............................
DPOL_TUHV2/556-1135------GQQIR-----------------IYTCLLEEAAARQMVVPTFRSGAQRGA.........................
DPOD1_DROME/534-994------GQQIK-----------------VLSQLLRKAKTKGFIMPSYTSQ..............................
DPOL_THEGO/348-763------STGNL-----------------VEWFLLRKAYERNELAPNKPDER.............................
Q9WT26_HHV6H/517-998------GQQKK-----------------IFPCILTEAKRRNMILPSMVSS..............................
DPOL_EBVB9/532-1013------GQQIR-----------------VFSCLLAAAQKENFILPMPSAS..............................
DPOD_CANAX/484-939------GQQIK-----------------VISQLFRKCLQEDIVIPNLKSE..............................
DPOLA_TRYBB/684-1157------ARSER-----------------IEYLLLHAFHNLKFVTPDKKKRDLKRG.........................
DPOL_BPR69/386-859------HPVQP-----------------YPGAFVKEPIPNRYKYVMSFDLTSLYP.........................
DPOA_YEAST/792-1248------TRAGR-----------------NEYILLHEFSRNGFIVPDKEGNRSRAQKQR......................
DPOL_SFAVA/492-1090------KQQRR-----------------MFHLMFSECMRENVAMQDDFGLANAAP.........................
DPOL_VACCA/497-995------RASTV-----------------IKGPLLKLLLETKTILVRSETK..............................
O74046_CENSY/420-835------GVSQW-----------------IRSLLYYEHRQRNALIPRRDELEKRSQ.........................
Q9Q8R2_MYXVL/498-996------RASTL-----------------IKGPLLKLLLEKKIIMTRSEKK..............................
O93043_FHV1/606-1159------GQQIR-----------------VYTCLLKLARDRNFILPDNRNRFCGDPNIPSEDIENINTCDSMEG.......
DPOD_SCHPO/534-990------GQQIK-----------------VISQLFRKALQHDLVVPNIRVN..............................
DPOLA_OXYTR/809-1299------ARAER-----------------NEMLLLHEFKKKKFILPDKKAPFAKDFKRNMFADE.................
Q9QEL0_9ALPH/621-1171------GQQIR-----------------VYTCLLRLAGEKGFILPDSRRQGAAIEAAAPDQPGDATDECLD.........
DPOL_METVO/393-818------NSSQM-----------------VEFLLLKRSFEQNMISPNRPSSSS............................
O92827_9BETA/515-999------GQQKK-----------------IFPCILHEAKNLNMILPSMNTNF.............................
DPOZ_YEAST/919-1384------GSQFK-----------------VESFLIRICKSESFILLSPGKKD.............................
DPOL1_AERPE/535-951------QISNW-----------------IRGLMYWEHRRRRWLIPSRGEIEKLSS.........................
DPOLA_HUMAN/783-1246------GRSER-----------------NEFLLLHAFYENNYIVPDKQIFRKPQQKLGDED...................
Q69390_9ALPH/516-1008------GQQIR-----------------VFTCLLKLAGSRGFVLPDKRRAI.............................
DPOL_RHCM6/533-1017------GQQIR-----------------IYTSLLDECACRDFIMPNHKGADN............................
DPOL_PBCVN/432-881------GQQVR-----------------AFSCLVGKARQMNYAIPDDKMW..............................
DPOL_ALHV1/550-1026------GQQIR-----------------VFTCLLAAAQERDYILPMPVTG..............................
Q59690_PYROC/488-905------QVSAW-----------------VKSLFYWEHRRRGYLIPSREEIIRLKG.........................
DPOD1_SOYBN/511-969------GQSIK-----------------VLSQLLRRARQKNLVIPNAKQA..............................
DPOL_SHV21/522-994------GQQIR-----------------VFSCLLAAARAENYILPVSNDV..............................
DPOA_SCHPO/773-1222------TRAER-----------------NEYILLHEFKKNGYIVPDKQQSIRRHAEAFG.....................

PF08490

Q7Q7P3_ANOGA/1540-1943-------TVKN-----------------LYTSERIALLT..TSDEHGEDM------------------------------
DPOE_CRYNJ/1526-1917-------NPLK-----------------FYTDRVERAER........GVF------------------------------
DPOE_DEBHA/1533-1917-------NMDK-----------------IYREIFEAKKD..RLGKMYSII------------------------------
Q7RWE3_NEUCR/1533-1926-------NINK-----------------LYADMLARRNQEAAGAEWQECF------------------------------
DPOE_ASHGO/1492-1878-------ALEA-----------------AYEQQYLKKVK..NFEKFRHYF------------------------------
DPOE_EMENI/1495-1885-------NVDK-----------------IYSELLARKLQ.GQGDQAEGAF------------------------------
Q6K777_ORYSJ/1562-1941-------FLEK-----------------QYRDACQALGS...........------------------------------
DPOE_YEAST/1527-1920-------SLGQ-----------------IYKQMFEKKKG..KIETYSYLV------------------------------
DPOE1_HUMAN/1525-1925-------SLGA-----------------LYSAEHGLLLE.....KVGPEL------------------------------
DPOE_SCHPO/1497-1886-------SISK-----------------IYEELRSKFDN....LIKESSI------------------------------
DPOE_KLULA/1497-1883-------AIES-----------------LYNEIYEKKFE..KLDKYYDLI------------------------------
DPOE_YARLI/1513-1873-------DISK-----------------EYARLRRGERY.KQNMDDCTVF------------------------------
DPOE_CANGA/1524-1916-------TIIG-----------------IFKEQYHKRKD..RITKFNKYI------------------------------
Q95R46_DROME/3-405-------NMRQ-----------------LYTAERLALLK..NLTAEEQDK------------------------------
Q59SM7_CANAL/1518-1902-------NIHK-----------------IYREIFESKRE..KLDKVSNVV------------------------------
O62218_CAEEL/1467-1869-------NMDS-----------------LYTSAYTKMMS....TERGQLC------------------------------
Q9ZVC8_ARATH/1484-1864-------ALER-----------------QFRDRCQELSP.........EP------------------------------

PF03175

DPOL_ADEB2/267-751KIN.....RNF-----------------MPRNGKILFNDISFCLPNPKYE------------------------------
DPOL_BPPRD/1-440MPR.....RSR-----------------KKVEYKIAAFDFETDPFKHDRI------------------------------
Q39432_BETVU/147-571KMN....PEIQ-----------------TVYFHNFSRFDGILILRHLVLH------------------------------
DPOL_ADEG1/238-751KCD.....RSF-----------------MPRVGRLLFNDIIFRMPNPNYV------------------------------
DPOM_NEUIN/400-868KSIMLRKYDGY-----------------KVYTHNFSYFDGIFIIDILSRL------------------------------
DPOL_ADE12/306-791KIS.....RNF-----------------IPRAGKILFNDITFALPNPHYK------------------------------
DPOL_BPM2/50-485EIQ.......A-----------------DLYFHN.LKFDGAFIVNWLEQ.------------------------------
O78938_AGRAE/66-524NDICIRKYKNY-----------------KVYLHNFAKFDGYFLVKYLSKL------------------------------
DPOL_ADE02/300-785RIT.....RNF-----------------MPRAGKILFNDVTFALPNPRSK------------------------------
DPOM_CLAPU/431-902QEMMRYKYRNV-----------------LFYAHNLGKFDAVFLLKELLRF------------------------------
Q9XNK1_PLEOS/737-1218LDLMVIENDNR-----------------FYYAHNLSDFDGMFVLKSLINT------------------------------
O99973_PORPU/80-490ARN........-----------------IAYFHNLSGFDGIYLIPLLITI------------------------------
DPOM_NEUCS/366-859KDML..KYDKH-----------------TVYCHNFSKFDINFIIKILVQE------------------------------
Q83895_ADEO7/318-798KLT.....RSF-----------------MPRAGKLLFNDITLSLPNPCFK------------------------------
DPOL_ADECT/391-876EIC.....RNF-----------------MPRAGRLLFNDITYSLPNPSYV------------------------------
DPOL_BPPZA/50-485KVQ.......A-----------------DLYFHN.LKFDGAFIINWLER.------------------------------
DPOM_MAIZE/299-733RRG.....SSM-----------------VVYFHNLSQFDGIMILSFLTKS------------------------------
O11414_9ADEN/323-802NIT.....RNF-----------------LPRAGKLLFNDITFSLPNPQYK------------------------------
DPOM_ASCIM/588-1048KTLLKSTNHGK-----------------KFYVHNLAHFDSVFILDTLSKL------------------------------
DPOM_PODAS/449-902GINTIVEDDKK-----------------IKVKKKKPISDVNKKSQNKDHY------------------------------
Q9WF13_ADE17/335-820RIT.....RNF-----------------MPRAGKILFNDVTFALPNPLSK------------------------------
Q9TEH5_9PEZI/309-758IIN.....LPG-----------------YIYVHNLTKFDAYFILKIIYDN------------------------------
DPO2_KLULA/409-873SYN.....VDI-----------------ILYAWYGSGYDYQHVLPYMKSK------------------------------
Q35599_PHYPO/7-446QLN.....TLY-----------------ILKYKDIIKNQIPFNLFPVIN.------------------------------
Q9YUR6_9ADEN/338-828TVE.....RNF-----------------MPRQGRILFNDITIKFPNPDYY------------------------------
Q09038_LACKL/414-878NLK.....KNV-----------------ILYAWFGSGYDYQHVLPYFKKK------------------------------
DPOL_BPCP1/56-488KTYTETGEDEF-----------------IIFFHN.LKFDGSFLLSFFLN.------------------------------
DPOL_ADE04/437-922RIT.....RNF-----------------MPRAGKILFNDVTFALPNPAYK------------------------------
Q9QM79_9ADEN/238-780RCD.....RFF-----------------MPRVGRLLFNDVLFHLPNPNYD------------------------------
DPO1_KLULA/415-878DICGELNISSV-----------------ELIAHNGGGYDFHYILSSMYNP------------------------------
DPOL_ADE40/433-918KIT.....RNF-----------------MPRAGKILFNDITFALPNPSSK------------------------------
O21376_PICKL/474-939KDMC.VKANNY-----------------TFYCHNLSGFDSVYIMSALIKY------------------------------
Q96206_BPGA1/50-490NSN.......S-----------------DIYFHN.LKFDGSFILPWWLR.------------------------------
DPOL_ADEB3/262-744KVS.....RNF-----------------MPRCGKILFNDLTFALPNPTHA------------------------------
O74719_DEBHN/418-882DICSELKNKNI-----------------ELIAHNGGAYDFHYILSSMYKS------------------------------

PF03337

Q1HTT9_9POXV/3-657GFLARVCSDGEWVLDDTDSVTPVLAEA.KSSTVAALTPEGRGVLATVHNMAAVRST...IDV------------------
Q3I8X2_MONPV/3-635NRIQTLMKTAN..N...YETIEILRNYLRLYIILARNEEGRGILIYDDNIDSVMSM...MNI------------------
Q8V3R9_SWPV1/2-644NIIKSLKSYNN..N..NLTISSALNEY.KFCIILARTNYGKGIIVYSGNLVYVQSM...VDI------------------
Q070L3_CPRV/15-686CLLDAEPGGGD....SLESVTSMIRVNGDL.VVSIKTRHGP.FCLSAENLERYQRL...YGD------------------
Q08FW7_DPV83/4-651QIFKSLSDDNN..DDENNHIITALEEY.KFSIVLARTKCGKGIIVYSSNLSMVKSM...IDL------------------
Q6TUY6_YMTV5/6-640NLFNNKKSTDD........VSSFLNRY.KYSIILARNNDGKGVIVHANNASHAKCM...LNL------------------
Q2F8G6_ORFV/3-635GFWGKVCGGVPDRQAWDEP.PPTDLVPGEY..ALAKARDGKTMIFDAEGARAAAVVLPSLKS------------------
Q9Q8S1_MYXVL/3-624KLLGLLHDTKK..E....VVVHTLKEH.PRAVVLTKTRHGKGVVVYAGNLEDVKSM...VSV------------------
Q6TVH8_9POXV/3-637GFWGKVCNSLTSKQAWDEQLVATDLVPGEY..ALAKARDGKTIIFDAQSVRDAAIVLPSLKS------------------
Q98188_MCV1/3-654RLLGISCMTAR..ASDTDEVRATLQKQ.PCSEVYARLPCGRGVVVNADTFQSTARL...CAL------------------
A7XCD4_9POXV/6-641KFFNNSKKCTN.......DISSFLSEY.KYSIILARNSDGKGVIVYSNNVSYAKSM...LDL------------------

PF00136

DPOD_YEAST/555-991.......................................ASDDQYEGATVIEPIR.-GYYDVPIA....TLDFNSLYP-S
DPOL_GPCMV/556-1073...................EDSEQTSDSSLGEVSSQGSSDGGVGYQGATVLEPDV.-GFYDTPVA....VFDFASLYP-S
DPOL2_AERPE/390-793........................................SEGRYAGAIVLRPKP.-GVHEDIA.....VLDFASMYP-N
O40910_HHV8/533-1006........................................AVSGYQGATVISPSP.-GFYDDPVL....VVDFASLYP-S
DPOL1_SULSO/450-869................................NIRTSALIKGKGYKGAVVIDPPA.-GIFFNIT.....VLDFASLYP-S
Q89604_9ALPH/639-1203.........GEEEEEDEGGEEDGGNEGRAGAADRPRAAGGRAVGYQGAKVLDPES.-GFHVDPVM....VLDFASLYP-S
Q9YQZ6_9VIRU/602-1028.................................PAIYRRGQKIEIKGGYVAEPLTG-LTFACEKQGPEVTLDFASLYP-S
Q9WSY3_9ALPH/582-1139....................EGEPSPSNPKASSSFHGNGGRVVGYQGAKVLDPIS.-GFHVDPVV....VFDFASLYP-S
DPOL_ARCFU/361-774........................................HAESYEGAFVLEPER.-GLHENVA.....CLDFASMYP-S
DPOL_RCMVM/533-1077P.....DGEDEDDPEGGDEGENGECRENGLEKEGSQGSASGNVGYQGATVLAPEC.-GYHHNPIL....VFDFASLYP-S
Q9YW56_MSEPV/569-1067........................................EKDEYEGAYVFDPKVK-KKYITEPI...ILEDYTSLYP-T
DPOL_ASFL6/457-978.....................................GKREHGKYPGAFVIDPVK.-GLEQDKPT...TGLDFASLYP-S
DPOD1_CAEEL/520-978......................................SGDGEGYEGATVIDPIR.-GFYNEPIA....TLDFASLYP-S
DPOL_FOWPN/483-977........................................VRYPYIGGKVFLPSQ.-KTFENNVM....IFDYNSLYP-N
DPOL_HHV21/617-1200............NGDEDKDDDEDGDEDGDEREEVARETGGRHVGYQGARVLDPTS.-GFHVDPVV....VFDFASLYP-S
Q9Q6Z6_9GAMA/520-997........................................NFQGYQGATVIAPLS.-GFYNTPVL....VVDFASLYP-S
Q59691_PYROC/388-793........................................RGESYKGAVVLKPLK.-GVHENVV.....VLDFSSMYP-S
O36638_9PHYC/422-974.......................................PGGVKFQGATVIDATK.-GFHNKDPV...VCLDFASLYP-S
DPOL_IIV6/578-1226......................................VDEKERYRGAEVFDPVP.-GLKRNVVP.....LDFASLYP-S
Q69281_9ALPH/606-1168..................HDSPQEPIHNIKQSSLCHSNSGRTIGYQGAKVLDPIS.-GFHVHPVM....VFDFASLYP-S
DPOL_EHV1B/611-1173...........DEPDGVDGTPDAAGSGATSENGGGKPGVGRAVGYQGAKVLDPVS.-GFHVDPVV....VFDFASLYP-S
DPOL_MUHVS/543-1050........................GGEGDETSEGENSNNSRTVGYQGATVLEPEC.-GFHHVPVC....VFDFASLYP-S
DPOD1_MESAU/546-1005........................................GGEDYTGATVIEPLK.-GYYDVPIA....TLDFSSLYP-S
DPOLA_ORYSJ/834-1303..................RPDEADPSIDDEGHHVDQGKTKKGPSYAGGLVLEPKK.-GLYDKYVL....LLDFNSLYP-S
DPOL_RSIV/397-938..................................CDSDVVSPSSYTGAYVYEPVP.-GVYKNVIP.....MDFQSLYP-S
DPOL1_SULAC/448-867................................QVKTAAVIKGKKYKGAVVIDPPA.-GVYFNVV.....VLDFASLYP-S
Q9Y1T1_TOXGO/1006-1612EDPWEVEGGGQEVGVAGEGRDEEEAANEGHREGEEKVGARAKASYAGGLVLEPRV.-GLYDTFVL....LLDFNSLYP-S
DPOL1_SULOH/448-867................................QIKTAAIIKGKRYKGAVVIDPPA.-GVFFNVV.....VLDFASLYP-S
DPOL_BPT4/383-855................................SIIRQVNISPETIRGQFKVHPIH.-EYIAGTAP...KPSDEYSCSP-N
Q98207_MCV1/494-994........................................ARYTYGGGKVFLPRQ.-KLFDTNVM....VFDYNSLYP-N
DPOLA_OXYNO/783-1270.........................DEYEEGDGKTKGGKRKKAAYAGGLVIEPKA.-GFYDNIIL....LLDFNSLYP-S
DPOL_EHV2/530-1004........................................DAEGYQGATVIDPSP.-GFYNTPVL....VVDFASLYP-T
DPOL_ORFN2/499-998........................................SKFFYEGGRVMAPKQ.-KMHNKHVL....IFDYNSLYP-N
DPOLA_DROME/805-1258...........................ATLSGADATMQTKKKAAYAGGLVLEPMR.-GLYEKYVL....LMDFNSLYP-S
DPOD1_PLAFK/544-1000......................................VNTNEKYEGATVLEPIK.-GYYIEPIS....TLDFASLYP-S
DPOL_VZVD/597-1136......................EEEMDEDESVSPTGTSSGRNVGYKGARVFDPDT.-GFYIDPVV....VLDFASLYP-S
O41930_MHV68/528-1001.......................................CSNSGYQGATVIDPIT.-GFYNTPVL....VVDFASLYP-S
DPOL_TUHV2/556-1135...............................APGAGGGGGEETTYQGATVFEPTV.-GYHHAPVA....VFDFASLYP-S
DPOD1_DROME/534-994.......................................GSDEQYEGATVIEPKR.-GYYADPIS....TLDFASLYP-S
DPOL_THEGO/348-763....................................ELARRRESYAGGYVKEPER.-GLWENIV.....YLDFRSLYP-S
Q9WT26_HHV6H/517-998.....................................HNRQGIGYKGATVLEPKT.-GYYAVPTV....VFDFQSLYP-S
DPOL_EBVB9/532-1013........................................DRDGYQGATVIQPLS.-GFYNSPVL....VVDFASLYP-S
DPOD_CANAX/484-939.......................................GSNEEYEGATVIEPER.-GYYDVPIA....TLDFSSLYP-S
DPOLA_TRYBB/684-1157...............................REDDDDEGKRKTKYQGGMVLEPKS.-GLYSEYIL....LLDFNSLYP-S
DPOL_BPR69/386-859................................SIIRQVNISPETIAGTFKVAPLH.-DYINAVAE...RPSDVYSCSP-N
DPOA_YEAST/792-1248............................QNEENADAPVNSKKAKYQGGLVFEPEK.-GLHKNYVL....VMDFNSLYP-S
DPOL_SFAVA/492-1090...............................FETVAATQKKQLSYSGAYVKDPEP.-GLYSMVGS.....LDVNNMYP-T
DPOL_VACCA/497-995........................................QKFPYEGGKVFAPKQ.-KMFSNNVL....IFDYNSLYP-N
O74046_CENSY/420-835................................QVSNDAVIKDKKFRGGLVVEPEE.-GIHFDVT.....VMDFASLYP-S
Q9Q8R2_MYXVL/498-996........................................NKYPYEGGKVFAPKQ.-KMFINNVL....IFDYNSLYP-N
O93043_FHV1/606-1159..............DYTEEFDQQSSTVAECVAPTPSQATSRSVGYQGAKVLDPIS.-GFHIDPVV....VLDFASLYP-S
DPOD_SCHPO/534-990.......................................GTDEQYEGATVIEPIK.-GYYDTPIA....TLDFSSLYP-S
DPOLA_OXYTR/809-1299........................FEELKSGKGPKKGGKRKKAAYAGGLVIEPKA.-GFYDNIIL....LLDFNSLYP-S
Q9QEL0_9ALPH/621-1171...............GDVEEENDEEAERPVADAGSRPSGGRHVGYQGAKVLDPVA.-GFHVSPVV....VFDFASLYP-S
DPOL_METVO/393-818....................................YRERAKFSYEGGYVREPLK.-GIQEDIV.....SLDFMSLYP-S
O92827_9BETA/515-999....................................NKGKENVGYKGATVLEPKI.-GYYATPTV....VFDFQSLYP-S
DPOZ_YEAST/919-1384.....................................VRKQKALECVPLVMEPES.-AFYKSPLI....VLDFQSLYP-S
DPOL1_AERPE/535-951...............................AGARVGAIIKDKKYRGAIVLDPPV.-GIFFRVL.....VLDFASLYP-S
DPOLA_HUMAN/783-1246..........................EEIDGDTNKYKKGRKKAAYAGGLVLDPKV.-GFYDKFIL....LLDFNSLYP-S
Q69390_9ALPH/516-1008....................................ADEDDGGGYQGAKVLEPDS.-GFHVDPVL....VLDFASLYP-S
DPOL_RHCM6/533-1017....................................SSEPTDVSYQGATVFEPEV.-GYYSDPVV....VFDFASLYP-S
DPOL_PBCVN/432-881.......................................TVDGKYEGATVLDAKK.-GAYFTSIA....ALDFASLYP-S
DPOL_ALHV1/550-1026........................................SQEGYQGATVINPIS.-GFYNTPVL....VVDFASLYP-S
Q59690_PYROC/488-905................................TTRSEALIKGKKYQGALVLDPPS.-GIYFNIV.....VLDFASLYP-S
DPOD1_SOYBN/511-969......................................GSEQGTFEGATVLEARA.-GFYEKPIA....TLDFASLYP-S
DPOL_SHV21/522-994........................................NADGFQGATVINPIP.-GFYNNAVL....VVDFASLYP-S
DPOA_SCHPO/773-1222............................AEDGLQEESLGKKKDKYKGGLVFEPQK.-GLYETCIL....VMDFNSLYP-S

PF08490

Q7Q7P3_ANOGA/1540-1943-------------------------------------LPPSDMTFEVFMEIDAKQ--VYQRVTRA----LSAYRDEKR-G
DPOE_CRYNJ/1526-1917-------------------------------------SYPDMLDFTTSYHSSESS--AFKALGKD----LQAINH...-G
DPOE_DEBHA/1533-1917-------------------------------------EYPDEMKFETTYFHDTAK--IFKKMDNC----ISKIYESRS-N
Q7RWE3_NEUCR/1533-1926-------------------------------------PYQEKLNIKITQVTTRRK--AFLEVGDI----VKKLRKEES-G
DPOE_ASHGO/1492-1878-------------------------------------MPAESAKFELHHFTDKSV--LLRSLSKV----VSSWSELKG-S
DPOE_EMENI/1495-1885-------------------------------------QYQEKIHFRTTQITTRRK--AYLEVSDL----IKKLRNDES-L
Q6K777_ORYSJ/1562-1941-------------------------------------.LHENITFLVDYHTSIDA--GSKHVQRM----LLEYRQQHP-G
DPOE_YEAST/1527-1920-------------------------------------DIKEDINFEFVYFTDISK--LYRRLSQE----TTKLKEERG-L
DPOE1_HUMAN/1525-1925-------------------------------------LPPPKHTFEVRAETDLKT--ICRAIQRF----LLAYKEERR-G
DPOE_SCHPO/1497-1886-------------------------------------EYPDTLSCNVIFSGNERK--AYKLIDEK----LLQYFSTKT-K
DPOE_KLULA/1497-1883-------------------------------------KINKNVSFNVNDYTELKR--LLKDLSKM----LQNIKEEKG-S
DPOE_YARLI/1513-1873-------------------------------------SFPDTMQYEVEYCSNHRR--MLQKVSKA----CDSLSGSRN-G
DPOE_CANGA/1524-1916-------------------------------------NLSDNVDMNSNHYTDKKK--LFKAINQE----FAMIKEQKG-Q
Q95R46_DROME/3-405-------------------------------------IPVEDYTFEVLIEVDVKQ--IYRHIQRA----LTTYKQEHQ-G
Q59SM7_CANAL/1518-1902-------------------------------------NYPAEMSFDVKYYHESAK--LFKKLNQV----IGKIHESRS-N
O62218_CAEEL/1467-1869-------------------------------------HTSESMPFTVKRFSSNTE--CERQLGRA----LRVYREVSS-K
Q9ZVC8_ARATH/1484-1864-------------------------------------FSWDGILFQVEYVDHPEA--ATKFLQKA----LCEYREENC-G

PF03175

DPOL_ADEB2/267-751-----------------------K..............RKDFADWECGKLTAADH--KYQFVKFM----VRDTFALTH.T
DPOL_BPPRD/1-440-----------------------P..................KPFSWG.FYNGEI--YKDYWGDD----CIEQFIYWL.D
Q39432_BETVU/147-571-----------------------N..........................DEYEI--RPLMRNGR----LYEVVVYFKKR
DPOL_ADEG1/238-751-----------------------KK............DASRVERWSRGIVSHQDA--RSVFVRFM----VRDTLQLTSGA
DPOM_NEUIN/400-868-----------------------GEV.........KPFMRNGKILKLTFNFTLPN--SKRKYTLY----FMDSLLILP.D
DPOL_ADE12/306-791-----------------------K..............RTNFLLWEHGGCDDQDF--KYQYLKVM----VRDTFALTH.T
DPOL_BPM2/50-485-----------------------.................HGFKWSNE...GLPN--TYNTIISK----MGQWYMIDI.C
O78938_AGRAE/66-524-----------------------G..............FIDNIIINKGRIITLKF--IYNKYSIT----FKDSYLLLP.S
DPOL_ADE02/300-785-----------------------K..............RTDFLLWEQGGCDDTDF--KYQYLKVM----VRDTFALTH.T
DPOM_CLAPU/431-902-----------------------NLTTEGLNNPYEFPAPLTRNSDILKLTIKRTV--DGKTRKVT----IMDSFALLP.R
Q9XNK1_PLEOS/737-1218-----------------------SKSHDL....KIKVLSKNDGTIISLEIKKILI--NKKIIKIT----LLDSLHLLP.F
O99973_PORPU/80-490-----------------------K.................TIWEGAKYIKLIYT--ILTTHILS----LRDSLNLLP.M
DPOM_NEUCS/366-859-----------------------FVVEKI...ISKDLDILSIKISYKFEPKKKGG--KAERHTIT----IADSCRLLP.G
Q83895_ADEO7/318-798-----------------------KP............SHTTYERWKNGIINFEDM--KWQGIKFM----VRDTFLLTH.S
DPOL_ADECT/391-876-----------------------P..............AKSYEHWEQGQVLASDL--KSQYIKFM----VRDTFSLTH.T
DPOL_BPPZA/50-485-----------------------.................NGFKWSAD...GLPN--TYNTIISR----MGQWYMIDI.C
DPOM_MAIZE/299-733-----------------------Y.................KN.......CHIEP--IMRNDCIY----SIKLYKVSK.N
O11414_9ADEN/323-802-----------------------KP............SRGTFDRWQNGMLDKQDL--KWQGVKFM----VRDTYLLTH.T
DPOM_ASCIM/588-1048-----------------------GKI.........DIIMRDDKIMKLKITFKIPG--KNTEYSIS----FLDSLLMLP.N
DPOM_PODAS/449-902-----------------------EI............STILRDDRILKCVIKVKT--PSGYNKIT----FIDSYNILP.D
Q9WF13_ADE17/335-820-----------------------K..............RTDFELWEHGGCDDSDF--KYQFLKVM----VRDTFALTH.T
Q9TEH5_9PEZI/309-758-----------------------FVVKP.....LYKDRTILQLDMTLKTFETNTK--KCKNKRMV----LKDSYLLLP.E
DPO2_KLULA/409-873-----------------------C..............IKDKYIIKNNMITYGEL--YYENAIIY----LKDPYLFIL.T
Q35599_PHYPO/7-446-----------------------...................NVDNLNIFSLFDF--LLKEKNAN----NYWYLYSYEIT
Q9YUR6_9ADEN/338-828-----------------------VAKEE.....KKNNKSEILSQIKEGIPHPESI--KNLYIKSM----VRDTFQITH.T
Q09038_LACKL/414-878-----------------------C..............IKDKYIIKNNMITYSEL--YFKHSKII----LKDPFLFIL.T
DPOL_BPCP1/56-488-----------------------.............................NDI--ECTYFIND----MGVWYSITL..
DPOL_ADE04/437-922-----------------------K..............RTDFQLWEQGGCDDIDF--KHQFLKVM----VRDTFALTH.T
Q9QM79_9ADEN/238-780-----------------------KK............DPTRLHRWARGVVAPSDS--RTVFVRFM----VRDTLQFTSGA
DPO1_KLULA/415-878-----------------------A..............AIKNILIRNNSFISFNF--AHDGVKFS----VKDSYSFLL.C
DPOL_ADE40/433-918-----------------------K..............RTDYRLWEQGACDDSDF--KYQFLKVM----VRDTFALTH.T
O21376_PICKL/474-939-----------------------TRVKGSE.SDITFKIIRREAKVLKMTVRYMDE--SGKESQMV----MLDSLTVLN.A
Q96206_BPGA1/50-490-----------------------.................NGYVHTEEDRTNTPK--EFTTTISG----MGQWYAVDV.C
DPOL_ADEB3/262-744-----------------------A..............RKDFKDWEEGTPTSADY--KFQFVKFM----VRDTFALTH.T
O74719_DEBHN/418-882-----------------------S..............DIKNILIRNNNFISFSF--VHDDITFN----IKDSYSFLL.C

PF03337

Q1HTT9_9POXV/3-657-----------------------RRLTVAKVCG.LRPEAPPVLPHPRLFMNSSETD.CYFSPRTCQTPPLVQILSKCA-E
Q3I8X2_MONPV/3-635-----------------------TILEVIGLTHCTKLRSSPPIPMSRLFMDEIDHE.SYYSPKTSYY.PLIDIIRKRS-H
Q8V3R9_SWPV1/2-644-----------------------SDLEIIGITKYVEPYPKPIKPIGNLFIDELDTE.LFYSPKTSIS.PLIDILKKRF-C
Q070L3_CPRV/15-686-----------------------CSVRVVDA...VQRPPPSERDLRTMRLRGEDVPRRHFAPSHGD..CLAKILARRA-S
Q08FW7_DPV83/4-651-----------------------TTLEIAGITKYVEPCPPPMGPISKLFIDESESD.NYYSPATARS.PLIDILIKRA-S
Q6TUY6_YMTV5/6-640-----------------------SLLEIVGITKYVEPSPLPDKPISNLHIQSVDTE.TYYSPETSTS.PLIDILRLKS-K
Q2F8G6_ORFV/3-635-----------------------VRISCTFIDARADALAPPPA.TQRFAIVSRHDP.DCYIPDSSS..PFLDILRQRA-E
Q9Q8S1_MYXVL/3-624-----------------------SELDVVGVTPHAEPVSLPASPINSLCIHETDTD.VYYFPKTCKS.PLLDILKKRF-K
Q6TVH8_9POXV/3-637-----------------------TRITCTFVDPHRDALDPPAASTQRFAIVSRDDP.ACYIPESSS..PFLDILRRRS-E
Q98188_MCV1/3-654-----------------------QSARVLAACP.VREMPSPPAPA..LVMAALETD.SFFSPQSSAT.PLAKILFHRA-S
A7XCD4_9POXV/6-641-----------------------SSLEIVGVTKYVEPAPPPVKPISNLYIQSVETE.TFYSPETSIS.PLIDILKLKS-T

PF00136

DPOD_YEAST/555-991IMMAHN.....LCYTTLCNK............................................................
DPOL_GPCMV/556-1073IIMRHN.....LCYSTYLPL............................................................
DPOL2_AERPE/390-793IMVKYN.....VGPDTLVRP............................................................
O40910_HHV8/533-1006IIQAHN.....LCYSTLIPGD................................................S..........
DPOL1_SULSO/450-869IIRTWN.....LSYETVDIQQ...........................................................
Q89604_9ALPH/639-1203IIQAHN.....LCFTTLVRRE...........................................................
Q9YQZ6_9VIRU/602-1028NMMDAN.....VGPDAVLDV............................................................
Q9WSY3_9ALPH/582-1139IIQAHN.....LCFTTLINDD...........................................................
DPOL_ARCFU/361-774IMIAFN.....ISPDTYGCR............................................................
DPOL_RCMVM/533-1077IIMSNN.....LCYSTLLVD............................................................
Q9YW56_MSEPV/569-1067IMRQIN.....ASPEKIIKVIT...............................................S.N........
DPOL_ASFL6/457-978LIMAYN.....FSPEKFVASR...........................................................
DPOD1_CAEEL/520-978IMIAHN.....LCYTTLLKS............................................................
DPOL_FOWPN/483-977VCIYGN.....LSPEKLVCILL..............................................NS.NK.......
DPOL_HHV21/617-1200IIQAHN.....LCFSTLSLRP...........................................................
Q9Q6Z6_9GAMA/520-997IIQAHN.....LCYSTLIHNE................................................D..........
Q59691_PYROC/388-793IMIKYN.....VGPDTIVDDP...........................................................
O36638_9PHYC/422-974IIRWKN.....LCYTTYLDSD................................................E..........
DPOL_IIV6/578-1226LIIARN.....MCYSTFVDNDDIPDEMCHVMEWDDHVACSHDPKVIRKNAITEELEKLKKIANAKKMYTQGTRTYKKMMC
Q69281_9ALPH/606-1168IIQAHN.....LCFTTLVHDD...........................................................
DPOL_EHV1B/611-1173IIQAHN.....LCFTTLALDE...........................................................
DPOL_MUHVS/543-1050IIMSNN.....LCYSTLLVE............................................................
DPOD1_MESAU/546-1005IMMAHN.....LCYTTLLRP............................................................
DPOLA_ORYSJ/834-1303IIQEYN.....ICFTTVDRS............................................................
DPOL_RSIV/397-938IIISKN.....ICYSTLVDQGGEEYAWQEH..............................EGCEHDPQYA.KQHALGVEI
DPOL1_SULAC/448-867IIKNWN.....ISYETIDIDE...........................................................
Q9Y1T1_TOXGO/1006-1612IIQEYN.....VCFSTVKRPVRT............................................RIS.RVQ......
DPOL1_SULOH/448-867IIRNWN.....ISYETVDVEN...........................................................
DPOL_BPT4/383-855GWMYDKHQEGIIPKEIAKVFFQ...............................................R.K........
Q98207_MCV1/494-994VCIFGN.....LSPETLVGVVA..............................................NA.HR.......
DPOLA_OXYNO/783-1270IIQEYN.....LCFTTVNRRPTKN...........................................FDG.SEM......
DPOL_EHV2/530-1004IIQAHN.....LCYSTMIPGD................................................R..........
DPOL_ORFN2/499-998VCIYAN.....LSPETLVGVVV..............................................SD.NR.......
DPOLA_DROME/805-1258IIQEYN.....ICFTTVQQP............................................................
DPOD1_PLAFK/544-1000IMIAHN.....LCYSTLIKS............................................................
DPOL_VZVD/597-1136IIQAHN.....LCFTTLTLNF...........................................................
O41930_MHV68/528-1001IIQAHN.....LCYSTIIPDN................................................K..........
DPOL_TUHV2/556-1135IIMAHN.....LCYSTWLRDDPGTPARPPETPARPPETP............AAGPSGAAHAGGVPGATFR.TPFRTPAGV
DPOD1_DROME/534-994IMMAHN.....LCYTTLVLG............................................................
DPOL_THEGO/348-763IIITHN.....VSPDTLNREG...........................................................
Q9WT26_HHV6H/517-998IMMAHN.....LCYSTLVLDE...........................................................
DPOL_EBVB9/532-1013IIQAHN.....LCYSTMITPG................................................E..........
DPOD_CANAX/484-939IMMAHN.....LCYTTLLNK............................................................
DPOLA_TRYBB/684-1157LIQEFN.....VCYTTIDRD............................................................
DPOL_BPR69/386-859GMMYYKDRDGVVPTEITKVFNQ...............................................R.K........
DPOA_YEAST/792-1248IIQEFN.....ICFTTVDR.............................................................
DPOL_SFAVA/492-1090LMIAYN.....LCYSTVVDEHSPSAFTDDHFEYIRWEDHVGCEHD.PVQVELKSLRSMFEMKALTDKRKR.IGVTAITKY
DPOL_VACCA/497-995VCIFGN.....LSPETLVGVVV..............................................ST.NR.......
O74046_CENSY/420-835IIKVRN.....LSYETVRCV............................................................
Q9Q8R2_MYXVL/498-996VCLFGN.....LSPETLVCVFV..............................................AN.NK.......
O93043_FHV1/606-1159IIQAHN.....LCFTTLTTER...........................................................
DPOD_SCHPO/534-990IMQAHN.....LCYTTLLDSN...........................................................
DPOLA_OXYTR/809-1299IIQEYN.....LCFTTVNRRPTKN...........................................FDG.SEV......
Q9QEL0_9ALPH/621-1171IIQAHN.....LCFSTLALDA...........................................................
DPOL_METVO/393-818ILISHN.....ISPETVIYEE...........................................................
O92827_9BETA/515-999IMMAHN.....LCYSTLVVDE...........................................................
DPOZ_YEAST/919-1384IMIGYN.....YCYSTMIGRVR..............................................EI.N........
DPOL1_AERPE/535-951LIKQWN.....LSYETVNNP............................................................
DPOLA_HUMAN/783-1246IIQEFN.....ICFTTVQRVA...........................................................
Q69390_9ALPH/516-1008IIQAHN.....LCFTTLALA............................................................
DPOL_RHCM6/533-1017IIMAHN.....LCYSTFVAP............................................................
DPOL_PBCVN/432-881IIRAHN.....MSPETLVMDK................................................R..........
DPOL_ALHV1/550-1026IIQAHN.....LCYSTLIKQQ................................................D..........
Q59690_PYROC/488-905IIKRWN.....LSYETVNPVY...........................................................
DPOD1_SOYBN/511-969IMMAYN.....LCYCTLVIP............................................................
DPOL_SHV21/522-994IIQAHN.....LCYSTLIPHH................................................A..........
DPOA_SCHPO/773-1222IIQEYN.....ICFTTVDRS............................................................

PF08490

Q7Q7P3_ANOGA/1540-1943PTLLCL-----QTALGLHKL------------------------------------------------------------
DPOE_CRYNJ/1526-1917LNVIAL-----CSPFEHSYY------------------------------------------------------------
DPOE_DEBHA/1533-1917RALLAV-----QSPY.TTKV------------------------------------------------------------
Q7RWE3_NEUCR/1533-1926PTMVVI-----QSSQ.RNLL------------------------------------------------------------
DPOE_ASHGO/1492-1878QLLLLL-----QSPT.PSRL------------------------------------------------------------
DPOE_EMENI/1495-1885PAIMII-----QSQQ.RSRL------------------------------------------------------------
Q6K777_ORYSJ/1562-1941PVIGVI-----ECPK.LQAL------------------------------------------------------------
DPOE_YEAST/1527-1920QFLLLL-----QSPF.ITKL------------------------------------------------------------
DPOE1_HUMAN/1525-1925PTLIAV-----QSSWELKRL------------------------------------------------------------
DPOE_SCHPO/1497-1886NSLLII-----ESSL.PHIL------------------------------------------------------------
DPOE_KLULA/1497-1883HTMVIL-----QSPY.THRV------------------------------------------------------------
DPOE_YARLI/1513-1873QLVFAL-----HSPD..RNV------------------------------------------------------------
DPOE_CANGA/1524-1916QVLLLM-----QSPF.PSLI------------------------------------------------------------
Q95R46_DROME/3-405PTILCL-----QTALSARKL------------------------------------------------------------
Q59SM7_CANAL/1518-1902KAFLAI-----QSPY.SSRI------------------------------------------------------------
O62218_CAEEL/1467-1869TAIVLL-----LSDTDPFRL------------------------------------------------------------
Q9ZVC8_ARATH/1484-1864ATVAVI-----ECPD.FNTT------------------------------------------------------------

PF03175

DPOL_ADEB2/267-751SLRNAA-----GAYELP...------------------------------------------------------------
DPOL_BPPRD/1-440TIEEPH-----VIYAHN...------------------------------------------------------------
Q39432_BETVU/147-571MLFRFR-----DSLNLL...------------------------------------------------------------
DPOL_ADEG1/238-751KLSKAA-----AAYALD...------------------------------------------------------------
DPOM_NEUIN/400-868SLDKLS-----NFFNNK...------------------------------------------------------------
DPOL_ADE12/306-791SLRKAA-----QAYALP...------------------------------------------------------------
DPOL_BPM2/50-485FGYKGK-----RKLHT....------------------------------------------------------------
O78938_AGRAE/66-524SLRKLC-----KSFNTQ...------------------------------------------------------------
DPOL_ADE02/300-785SLRKAA-----QAYALP...------------------------------------------------------------
DPOM_CLAPU/431-902SLRDLC-----KDYNID...------------------------------------------------------------
Q9XNK1_PLEOS/737-1218SLRDLG-----KVFSLKKNS------------------------------------------------------------
O99973_PORPU/80-490SLNDLG-----KSFINR...------------------------------------------------------------
DPOM_NEUCS/366-859SLDKLA-----KDHNII...------------------------------------------------------------
Q83895_ADEO7/318-798SLRDAA-----TAYQLS...------------------------------------------------------------
DPOL_ADECT/391-876SLKNAA-----KAYSLT...------------------------------------------------------------
DPOL_BPPZA/50-485LGYKGK-----RKIHT....------------------------------------------------------------
DPOM_MAIZE/299-733GDKRLV-----LTFMDS...------------------------------------------------------------
O11414_9ADEN/323-802SLRNAA-----TAYQLP...------------------------------------------------------------
DPOM_ASCIM/588-1048SLDNLS-----KAFNIE...------------------------------------------------------------
DPOM_PODAS/449-902KLDNLA-----KSFGTE...------------------------------------------------------------
Q9WF13_ADE17/335-820SLRKAA-----QAYALP...------------------------------------------------------------
Q9TEH5_9PEZI/309-758SLKRLG-----TNFNTN...------------------------------------------------------------
DPO2_KLULA/409-873SLDKAS-----KAFNV....------------------------------------------------------------
Q35599_PHYPO/7-446QLFNLL-----KSLQDS...------------------------------------------------------------
Q9YUR6_9ADEN/338-828SLKEAA-----KAYNLK...------------------------------------------------------------
Q09038_LACKL/414-878SLDKAA-----KAFNV....------------------------------------------------------------
DPOL_BPCP1/56-488....EF-----PDFTL....------------------------------------------------------------
DPOL_ADE04/437-922SLRKAA-----QAYALP...------------------------------------------------------------
Q9QM79_9ADEN/238-780KLSKAA-----AAYALE...------------------------------------------------------------
DPO1_KLULA/415-878SLANAS-----KAFLN.E..------------------------------------------------------------
DPOL_ADE40/433-918SLRKAA-----QAYTLP...------------------------------------------------------------
O21376_PICKL/474-939SLRKTS-----PLFELE...------------------------------------------------------------
Q96206_BPGA1/50-490INTRGK-----NKNHV....------------------------------------------------------------
DPOL_ADEB3/262-744SLRNAA-----AAYALP...------------------------------------------------------------
O74719_DEBHN/418-882SLANAA-----KAFLSGN..------------------------------------------------------------

PF03337

Q1HTT9_9POXV/3-657TNS..A-----LMRAICLHW------------------------------------------------------------
Q3I8X2_MONPV/3-635EQG..D-----IALAL.ER.------------------------------------------------------------
Q8V3R9_SWPV1/2-644NDD..N-----IKTII.GS.------------------------------------------------------------
Q070L3_CPRV/15-686EQGLAE-----LAAAL.AEP------------------------------------------------------------
Q08FW7_DPV83/4-651SEK..E-----IENNI.KK.------------------------------------------------------------
Q6TUY6_YMTV5/6-640QYH..D-----LNEFV.LK.------------------------------------------------------------
Q2F8G6_ORFV/3-635TEP..E-----LRAAF.EDS------------------------------------------------------------
Q9Q8S1_MYXVL/3-624HDP..L-----IRTLQ.ER.------------------------------------------------------------
Q6TVH8_9POXV/3-637DEP..E-----LLAAF.EEN------------------------------------------------------------
Q98188_MCV1/3-654GEDNED-----LLRAL.LQP------------------------------------------------------------
A7XCD4_9POXV/6-641KYN..D-----LKEAI.VNF------------------------------------------------------------

PF00136

DPOD_YEAST/555-991............................................ATVERL......NLKIDE..DYVITPNGDYFVT..T
DPOL_GPCMV/556-1073.........................................GRDDGLSDD........DVFL..LEFDDGTRYGFVR..E
DPOL2_AERPE/390-793...........................................GEEYGEEEV..YTAPEVGH..KF.......RKSP..P
O40910_HHV8/533-1006........................................LHLHPHLSPD........DYET..FVLSGGP.VHFVK..K
DPOL1_SULSO/450-869........................................CKKPYEVKDET......GEVLH..IV.......CMDR..P
Q89604_9ALPH/639-1203.........................................AAPAGLTPGA.......DYAT..FDVGGRA.LHFVR..A
Q9YQZ6_9VIRU/602-1028..........................................RRVAQFRG......WIVFDWRQIEEGFGLASLMYTPSK
Q9WSY3_9ALPH/582-1139.........................................RKLADLRPRD.......DYME..IDVQGKS.LHFAK..P
DPOL_ARCFU/361-774...........................................DDCYEA........PEVGH..KF.......RKSP..D
DPOL_RCMVM/533-1077..........................................GSPPVPDE........DVLE..VVVGEATRYRFVR..E
Q9YW56_MSEPV/569-1067.......................................DNIMNAKIDNYIFNTYNYPEYMYIDITNSNKLTTFIIT..D
DPOL_ASFL6/457-978.........................................DEANSLMAKGESLHYVSFHFNNRLVEGWFVRHNNVPDKM
DPOD1_CAEEL/520-978...........................................PQGVENE.......DYIR.......TPSGQYFAT..K
DPOL_FOWPN/483-977.......................................LESEINMRTIKSKYPYPEYVCVSCESRLSDYYSEIIVY..D
DPOL_HHV21/617-1200.........................................EAVAHLEADR.......DYLE..IEVGGRR.LFFVK..A
Q9Q6Z6_9GAMA/520-997........................................LHKYPQLKED........DYET..FLISSGP.VHFVK..K
Q59691_PYROC/388-793.........................................SECPKYGG..C..YVAPEVGH..RF.......RRSP..P
O36638_9PHYC/422-974........................................FANIPGVHYER......FEISP.......GVYETFAT..R
DPOL_IIV6/578-1226SYLVMENTKEKTEMSKHLKDLDRENNELLNIVNKQTPGYIESIKKKISDLTSERSEITKKLSKSVMCVSNRRYRFLKEPK
Q69281_9ALPH/606-1168.........................................TNLSNLRPQD.......DYLE..INVQGKL.LRFVK..P
DPOL_EHV1B/611-1173.........................................VDLAGLQPSV.......DYST..FEVGDQK.LFFVH..A
DPOL_MUHVS/543-1050..........................................GSPEVPEK........DVLR..VEIGDQC.HRFVR..E
DPOD1_MESAU/546-1005...........................................GAAQKLG.......LKPD...EFIKTPTGDEFVK..S
DPOLA_ORYSJ/834-1303...........................................ADGNVPN..........LP.................A
DPOL_RSIV/397-938G..............................VLQCNMAALPRRATQERARMRERISEMKIQYASMTPSVVKCNVFSFRFT
DPOL1_SULAC/448-867.........................................CTKKVWVEDE.....TGEKLH..YV.......CMDK..P
Q9Y1T1_TOXGO/1006-1612......................................ATNGPDGEIADAFR..EPDDRNLP..HAAEEDVQGIAST..P
DPOL1_SULOH/448-867.........................................CKNKEYVRDE.....TGEVLH..YI.......CKDK..P
DPOL_BPT4/383-855........................................DWKKKMFAEEM.....NAEAIK..KI.......IMKG..A
Q98207_MCV1/494-994.......................................LDAEINMQELRRRFPEPAFLHVLCEARARDGYSEIAVF..D
DPOLA_OXYNO/783-1270......................................KNQYKKGENGEEEV..DIEEADLP.....DKNVN...LK..D
DPOL_EHV2/530-1004........................................LCLHPHLGPG........DYET..FELASGP.VHFVK..K
DPOL_ORFN2/499-998.......................................LDAEVAAVDVRRMFPAPRYIAVPCEPRSPELVAEVAIF..D
DPOLA_DROME/805-1258..............................................VDAD......ELPTLP..D..............S
DPOD1_PLAFK/544-1000..........................................NHEVSDLQ.......NDDIT..TIQ.GKNNLKFVK..K
DPOL_VZVD/597-1136.........................................ETVKRLN.PS.......DYAT..FTVGGKR.LFFVR..S
O41930_MHV68/528-1001........................................LQMFPNLTPA........DYET..FTLPSGT.VHFVK..K
DPOL_TUHV2/556-1135PAAAAGGAG.............AGPPGGGAVSSASVGGRAAVSPSETPAEREPEPAPEDVFV..VHVGQGVSYRFVR..E
DPOD1_DROME/534-994...........................................GTREKLRQQ...ENLQDD...QVERTPANNYFVK..S
DPOL_THEGO/348-763.........................................CEEYDVAP.........QVGH..KF.......CKDF..P
Q9WT26_HHV6H/517-998.........................................RQIAGLSES........DILT..VKLGDET.HRFVK..P
DPOL_EBVB9/532-1013........................................EHRLAGLRPGE.......DYES..FRLTGGV.YHFVK..K
DPOD_CANAX/484-939...........................................NSIKAFG.......LTED...DYTKTPNGDYFVH..S
DPOLA_TRYBB/684-1157...........................................ENTVSAEV.....P.PPES..LICLSCRAAGLPS..P
DPOL_BPR69/386-859........................................EHKGYMLAAQR.....NGEIIK..EA.......LHNP..N
DPOA_YEAST/792-1248............................................NKEDID......ELPSVP..P........SEVD..Q
DPOL_SFAVA/492-1090FKPIQGPRIIQKIMD.DRYAESTCRYDDGDEFCENDDEKEVIAAIKTPLEMQRAAIRLKVLKSRASGGSVLCAKQCVKIL
DPOL_VACCA/497-995.......................................LEEEINNQLLLQKYPPPRYITVHCEPRLPNLISEIAIF..D
O74046_CENSY/420-835...........................................HPECRKNT.....IPDTNH..WV.......CTKN..N
Q9Q8R2_MYXVL/498-996.......................................LEAEINKQEIQKMYPGPRYISVQCEPRSEDLVSEIAVF..D
O93043_FHV1/606-1159.........................................QSLETLRPGI.......DFSE..FDVGGHK.LYFVD..S
DPOD_SCHPO/534-990........................................TAELLKLKQDV.............DYSVTPNGDYFVK..P
DPOLA_OXYTR/809-1299.....................................KSQFKAAGTDANEGN..EVEEADLP.....DKNVN...VK..D
Q9QEL0_9ALPH/621-1171.........................................EAVGGLEAGR.......DYME..ITVGGDT.VYFVK..A
DPOL_METVO/393-818.........................................KERENME...............................L
O92827_9BETA/515-999.........................................NAVIGLHAD........DILT..VHVGPVT.HRFVK..K
DPOZ_YEAST/919-1384.......................................LTENNLGVSKFSLPRNILALLKN..DVTIAPNGVVYAK..T
DPOL1_AERPE/535-951..........................................NCRDTIEVP.......EVGH..RV.......CREF..K
DPOLA_HUMAN/783-1246.........................................SEAQKVTEDGE..QEQIPELP..D..............P
Q69390_9ALPH/516-1008..........................................RPAGLR.ED.......EFSA..FEVNGER.LYFVH..A
DPOL_RHCM6/533-1017...........................................GGESPPE.......SDVLT..VELESGLSYRFVK..N
DPOL_PBCVN/432-881........................................FENLPGIEYY........EIET..GLGTFKYPQKNDE..T
DPOL_ALHV1/550-1026........................................LPKFTNLTAN........DYET..FMISGGP.VHFVK..K
Q59690_PYROC/488-905.........................................CPESKLVEVP.......DVGH..KV.......CMSI..P
DPOD1_SOYBN/511-969...........................................EDARKLN.......IPPE...SVNRTPSGETFVK..S
DPOL_SHV21/522-994........................................LHNYPHLKSS........DYET..FMLSSGP.IHFVK..K
DPOA_SCHPO/773-1222..........................................PSNSDSDD......QIPDTP..S........ASAN..Q

PF08490

Q7Q7P3_ANOGA/1540-1943-------------------------------------------NQHLPIC--------LEFPEVSIHIADDAALLSG--L
DPOE_CRYNJ/1526-1917-------------------------------------------QAKAPVY--------SNFPFITYRLGKEED..PG--L
DPOE_DEBHA/1533-1917-------------------------------------------LNLLKST--------SSFPTIKM..NVSELSLPA--V
Q7RWE3_NEUCR/1533-1926-------------------------------------------VHEIPIL--------GEFPVMPLRYDQGDSSLPP--L
DPOE_ASHGO/1492-1878-------------------------------------------LKSIRIL--------NQLPVVQL..STCELAFPT--L
DPOE_EMENI/1495-1885-------------------------------------------CHDIPIL--------KEYPILSVKPEVSDMNLPP--L
Q6K777_ORYSJ/1562-1941-------------------------------------------KSAVRAL--------DDFPCVTIPCNARDNNYQA--L
DPOE_YEAST/1527-1920-------------------------------------------LGTIRLL--------NQMPIVKL..SLNEVLLPQ--L
DPOE1_HUMAN/1525-1925-------------------------------------------ASEIPVL--------EEFPLVPICVA.DKINYGV--L
DPOE_SCHPO/1497-1886-------------------------------------------KANVKQI--------EELPYIMI..PRLESNIQS--L
DPOE_KLULA/1497-1883-------------------------------------------AKLLQPL--------NAFPVVEI..ATAETHLPA--L
DPOE_YARLI/1513-1873-------------------------------------------DEKVAAL--------ARIPCIRL..RPVPPSTAA--V
DPOE_CANGA/1524-1916-------------------------------------------KKNIRYS--------TQIPIIEL..SMNILALPQ--L
Q95R46_DROME/3-405-------------------------------------------SLAMPIL--------LEFPQAQIHISDDASLLSG--L
Q59SM7_CANAL/1518-1902-------------------------------------------LNVLNTT--------DDFPTIKM..NISELSLPA--V
O62218_CAEEL/1467-1869-------------------------------------------ARKLPNL--------GLFPNVQLHITEPSSLLNQ--I
Q9ZVC8_ARATH/1484-1864-------------------------------------------KEGVKAL--------EDFPCVRIPFNDDDNSYQP--V

PF03175

DPOL_ADEB2/267-751--------------------------------........VEKGSCPYEAVNEFYRIGSYQQ..DEDGFPSLRYWKSSEE
DPOL_BPPRD/1-440--------------------------------..........GGKFDFLFLMKYFRG........KLKIVNGRILEVEHG
Q39432_BETVU/147-571--------------------------------..........PGSLDYLSSN...............LCPELGN..KGSF
DPOL_ADEG1/238-751--------------------------------........LCKGHCPYEAINEFISTGRFHA..DADGFPVERYWEDPSV
DPOM_NEUIN/400-868--------------------------------........VKKLFFPHSFLDDNTIPINYVGKCPDYKYFPKAYTEDFTI
DPOL_ADE12/306-791--------------------------------........VEKGCCPYKAVNQFYMLGSYRA..DANGFPLEEYWKDKEE
DPOL_BPM2/50-485--------------------------------.............VIYDSLK........K.....LPFPVKKIAKDFQL
O78938_AGRAE/66-524--------------------------------........TQKDIFPYLLDDIN.Y.........IGEVPDYKYFCNLEM
DPOL_ADE02/300-785--------------------------------........VEKGCCAYQAVNQFYMLGSYRS..EADGFPIQEYWKDREE
DPOM_CLAPU/431-902--------------------------------........NPKSYFPYLFSVDSHLF..Y.....TGATPNINYYLDIPK
Q9XNK1_PLEOS/737-1218--------------------------------FYNETKNIIGKGNFPHDFIQKLGIDKALE...YKGLVPDIKYFDNLSE
O99973_PORPU/80-490--------------------------------................SKLD...............INPIFTL......
DPOM_NEUCS/366-859--------------------------------........TKKGKFPYKFVNKDNLEY.......VGLLPDYEYYIDPKK
Q83895_ADEO7/318-798--------------------------------........VSKGYCPYRAINDFFMLGEYEK..ENNGYPVQKYWNSFEE
DPOL_ADECT/391-876--------------------------------........VSKGCCPYQAVNEFYMLGSYQQ..DADGFPDLKYWKDQEE
DPOL_BPPZA/50-485--------------------------------.............VIYDSLK........K.....LPFPVKKIAKDFKL
DPOM_MAIZE/299-733--------------------------------..........YLLLKVKLAD.............LADSFCPELGGKGSF
O11414_9ADEN/323-802--------------------------------........ISKGCCPYEAVNEYLMTGNYEQ..ETNGYPTLKYWNNADE
DPOM_ASCIM/588-1048--------------------------------........NKKSVFPLKFTNGAVTPFNYIGAVPGYEYFYNTPNKKFTK
DPOM_PODAS/449-902--------------------------------........IQKGLFPYEFVKSNTLN.......YVGITPSIEYYKINNE
Q9WF13_ADE17/335-820--------------------------------........VEKGCCPYKAVNHFYMLGSYRA..DDRGFPLREYWKDDEE
Q9TEH5_9PEZI/309-758--------------------------------........IQKGYFPYDFVNENRLE..Y.....IGEIPNYQYFKNQLT
DPO2_KLULA/409-873--------------------------------........INKGEFPHSIIHSWEDLNKILPNWVKIQKRMIEYKDDNKL
Q35599_PHYPO/7-446--------------------------------...........SFYTFKQFT...............YQNIMYS.LEISC
Q9YUR6_9ADEN/338-828--------------------------------........IHKGCCPFKAINEYMSTNSLST..DSDSFPSEKYWSSKEE
Q09038_LACKL/414-878--------------------------------........INKGSFPHSLIKDWPDLQKIYPHWIKTQRKIIEFKHDNKL
DPOL_BPCP1/56-488--------------------------------.............TFRDSLK.............ILNFSIATMAGLFKM
DPOL_ADE04/437-922--------------------------------........VEKGCCAYKAVNQFYMLGSYRA..DQDGFPLEEYWKDREE
Q9QM79_9ADEN/238-780--------------------------------........LSKGQCPYEAVNEHVSIGGYEQ..DSDGFPVARYWEDPSV
DPO1_KLULA/415-878--------------------------------......ETFKKTDFPHHDLKTADDLYKVYKEWSSVNTEINHVVEKEKL
DPOL_ADE40/433-918--------------------------------........VEKGCCPYKAVNEFYMLGSYRA..DERGFPAEDYWKDREE
O21376_PICKL/474-939--------------------------------........HQKGYLPYDWVSTNTN..........YMGPIPQSFNDDVK
Q96206_BPGA1/50-490--------------------------------.............VFYDSLK........K.....LPFKVEQIAKGFGL
DPOL_ADEB3/262-744--------------------------------........VEKGCCPYKAVNEFYMLGTYRT..DADSFPQRDYWSSDEE
O74719_DEBHN/418-882--------------------------------......HDFGKTDFPHHDVRSKADLEKVYRKWRSIDNIIDIEIEKEKL

PF03337

Q1HTT9_9POXV/3-657----------------------------------------PGNDKMTTVAAINTWMCRHGLARNRLLRMPAARRLGLGN.
Q3I8X2_MONPV/3-635----------------------------------------YGIENTDSISEINEWLSSKGLACYRFVKFNDYRKQQMYRK
Q8V3R9_SWPV1/2-644----------------------------------------MTICGNVSVSEINYWMYRNGLYKYRFMNYRDSKITKD...
Q070L3_CPRV/15-686----------------------------------------RAPDALAGAAAANQWLARHGLERFRVVNYKDAAALAAR..
Q08FW7_DPV83/4-651----------------------------------------LDIKGNVTVSEINYWMCCNGLAKYRFMNYRDDKIKE....
Q6TUY6_YMTV5/6-640----------------------------------------LSKQGNVSISEINNCMCLNGMSKYRFFNYKDERFIEKEK.
Q2F8G6_ORFV/3-635----------------------------------------PPPRDALSMDELNQWLSDVGLYDLRMVSHDAVRRLGTPL.
Q9Q8S1_MYXVL/3-624----------------------------------------.....DYTVSEINYWLYCNGLEAYRFVNYKDEKAND....
Q6TVH8_9POXV/3-637----------------------------------------PPPAGARSIDELNQWLSDAGLYHLRMVSTDAVRRLGTPV.
Q98188_MCV1/3-654----------------------------------------GEPPG.LSLTDINWWLQTRGLGRYCFMTLSTFRARELPR.
A7XCD4_9POXV/6-641----------------------------------------LNLQGNVSVSELNNWMCINGMSKYRFLNYKDEKFFENNL.

PF00136

DPOD_YEAST/555-991KRRRGILPIILDELIS......ARKRAKKDLRDEKDPFK............RDVLNGRQLALKISANSVYGFTGATVG.K
DPOL_GPCMV/556-1073HVRKSILGELLARWLA......KRKSVRKVLAECQDEVE............KLILDKYQLALKVTCNAFYGFTGVSSG.M
DPOL2_AERPE/390-793GFFKKILERFLSWRRQ......IRSEMKKHPPDS...PE............YKLLDERQKAIKLLANASYGYMGWPHA.R
O40910_HHV8/533-1006HKRESLLAKLLTVWLA......KRKEIRKTLASCTDPAL............KTILDKQQLAIKVTCNAVYGFTGVASG.I
DPOL1_SULSO/450-869GITAVITGLLRD..FR......VKIYKKKAKNPNNSEEQ............KLLYDVVQRAMKVFINATYGVFGAETF.P
Q89604_9ALPH/639-1203HVRESLLSVLLRDWLA......MRKAIRARIPTAAPEE.............AVLLDKQQAAIKVVCNSVYGFTGVSNG.L
Q9YQZ6_9VIRU/602-1028RRFLTTTTGSLNSYLS......MRANHKQAMTQAGDNKA...........LYSYHDIQQSEMKVCANSHYGVAPGACQ..
Q9WSY3_9ALPH/582-1139HIRESLLGILLKDWLA......MRKAIRAKIPASSDDT.............AVLLDKQQAAIKVVCNSVYGFCGVANG.L
DPOL_ARCFU/361-774GFFKRILRMLIEKRRE......LKVELKNLSPES...SE..........YKLLD..IKQQTLKVLTNSFYGYMGWNLA.R
DPOL_RCMVM/533-1077HVRRSLLAELLVRWLK......QRKLVRDAMKACGDEKQ............RMFMDKQQLALKVTCNAFYGFTGVAAP.M
Q9YW56_MSEPV/569-1067CRKDGIIPLMLKQGME......KRSFYKKKMNDAKKANDD.........ILYNVYNSMQYTTKIFINSIYGLMASETF.M
DPOL_ASFL6/457-978GLYPKVLIDLLNKRTALKQELKKLGEKKECIHESHPGFKEL.......QFRHAMVDAKQKALKIFMNTFYGEAGNNLS.P
DPOD1_CAEEL/520-978SKRRGLLPEILEDILA......ARKRAKNDMKNEKDEFK............RMVYNGRQLALKISANSVYGFTGATVG.K
DPOL_FOWPN/483-977RREKGIIPKLLEMFIG......KRKEYKNLLKTASTTIE............STLYDSLQYIYKIIANSVYGLMGFSNS.T
DPOL_HHV21/617-1200HVRESLLSILLRDWLA......MRKQIRSRIPQSPPEE.............AVLLDKQQAAIKVVCNSVYGFTGVQHG.L
Q9Q6Z6_9GAMA/520-997HISESLLSNLLTTWLA......KRKMIRKELTACADPKL............RTILDKQQLAIKVTCNAVYGFTGVASG.M
Q59691_PYROC/388-793GFFKTVLENLLKLRRQ......VKEKMKEFPPDS...PE..........YRLYD..ERQKALKVLANASYGYMGWSHA.R
O36638_9PHYC/422-974PGHKGILSAIEEDLGE......ARRQTKAAMKVEKDSKK............LQLLNSKQLAQKVTMNSLYGFCGTVNG.C
DPOL_IIV6/578-1226GILPTIIQNLLDARKNTRTEIKNYKSRLALLMEKENKSKEDIDEITSIENLLPILDKRQNSYKISANSMYGATGVRVG.A
Q69281_9ALPH/606-1168HIRESLLAILLKDWLA......MRKAIRAKIPESCDEI.............AVLLDKQQAAIKVVCNSVYGFCGVSNG.L
DPOL_EHV1B/611-1173HIRESLLGILLRDWLA......MRKAVRARIPTSTPEE.............AVLLDKQQSAIKVICNSVYGFTGVANG.L
DPOL_MUHVS/543-1050NVHRSLLAELLVRWLT......QRKLVREAMKQCTNEMQ............RMIMDKQQLALKVTCNAFYGFTGVAAG.M
DPOD1_MESAU/546-1005SVRKGLLPQILENLLS......ARKRAKAELAQETDPLR............RQVLDGRQLALKVSANSVYGFTGAEVG.K
DPOLA_ORYSJ/834-1303SKTTGVLPELLKSLVE......RRRMVKSWLKTASGLK.............RQQFDIQQQALKLTANSMYGCLGFSNS.R
DPOL_RSIV/397-938HAHEGVLPRVLRNLLE.....S.RARVRARIKTTDDPDI...........R.AVLDKKQLAYKISANSVYGTMGTQRG.Y
DPOL1_SULAC/448-867GITAVITGLIRD..FR......VKVYKKKAKYSNISEEQ............RSLYDVVQRAMKVFINATYGVFGAENF.P
Q9Y1T1_TOXGO/1006-1612GLLPRILRQLVQ..RR.......RAVKASMK.GESNPVK..........RATQE..IKQLALKLTANSIYGCLGFXRS.R
DPOL1_SULOH/448-867GITAVITGLLR..DFR......VKVYKKKAKSQNISEEQ..........RSVYD..VVQRAMKVFINATYGVFGAENF.P
DPOL_BPT4/383-855GSCSTKPEVERYVKFSDDFLNELSNYTESVLNSLIEECE..........KAATLANTNQLNRKILINSLYGALGNIHF.R
Q98207_MCV1/494-994RRRQGIIPKLLGTFME......QRARYKALMRAASSGLE............RTLYDSMQYVYKVVANSVYGLMGFYNS.S
DPOLA_OXYNO/783-1270AVLPMVLRDLVQ..KR.......KAVKDKMK.TEKDHVK..........LSQLE..IRQKAIKLTANSMYGCLGFGSS.R
DPOL_EHV2/530-1004HKAVSLLATLLNVWLA......KRKAIRRELATVSDEAV............RTILDKQQLAIKVTCNAVYGFTGVASG.I
DPOL_ORFN2/499-998REAKGIIPMLLRSFLD......ARAKYKKLMKAAETAVD............REIYNSMQYTYKITANSVYGLMGFRNS.A
DPOLA_DROME/805-1258KTEPGILPLQLKRLVE......SRKEVKKLM.AAPDLSP..........ELQMQYHIRQMALKLTANSMYGCLGFAHS.R
DPOD1_PLAFK/544-1000NVKKGILPLIVEELIE......ARKKVKLLIKNEKNNIT............KMVLNGRQLALKISANSVYGYTGASSGGQ
DPOL_VZVD/597-1136NVRESLLGVLLKDWLA......MRKAIRARIPGSSSDE.............AVLLDKQQAAIKVVCNSVYGFTGVAQG.F
O41930_MHV68/528-1001HKKCSLLSRLLTKWLA......KRKEIRTQLAACEDPIT............KTILDKQQLAIKVTCNSVYGFTGVASG.M
DPOL_TUHV2/556-1135NVRASILSELLRRWLA......QRRAVREAMRECEDETR............RLLLDKEQLALKVTCNAFYGFTGFSQG.M
DPOD1_DROME/534-994EVRRGLLPEILESLLA......ARKRAKNDLKVETDPFK............RKVLDGRQLALKISANSVYGFTGAQVG.K
DPOL_THEGO/348-763GFIPSLLGDLLEERQK......VKKKMKATIDP....IE..........KKLLD..YRQRAIKILANSFYGYYGYAKA.R
Q9WT26_HHV6H/517-998CVRESVLGSLLKDWLA......KRREVKAEMQNCSDPMM............KLLLDKKQLALKTTCNSVYGVTGAAHG.L
DPOL_EBVB9/532-1013HVHESFLASLLTSWLA......KRKAIKKLLAACEDPRQ............RTILDKQQLAIKCTCNAVYGFTGVANG.L
DPOD_CANAX/484-939NLRKGILPTILDELLT......ARKKAKADLKKETDPFK............KDVLNGRQLALKISANSVYGFTGATVG.K
DPOLA_TRYBB/684-1157CLHKCILPKVIRGLVD......SRREIKRMMKSEKDPGN............LAMLEIRQLALKLTANSMYGCLGFEYS.R
DPOL_BPR69/386-859LSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQ..........RTEVAGMTAQINRKLLINSLYGALGNVWF.R
DPOA_YEAST/792-1248GVLPRLLANLVD..RR.......REVKKVMK.TETDPHK..........RVQCD..IRQQALKLTANSMYGCLGYVNS.R
DPOL_SFAVA/492-1090KTRRGILPDLVECLLQ......ARKRVRGNMKSVTDPMA...........R.DILDKSQLAYKVTANSIYGSTGASNG.K
DPOL_VACCA/497-995RSIEGTIPRLLRTFLA......ERARYKKMLKQATSSTE............KAIYDSMQYTYKIVANSVYGLMGFRNS.A
O74046_CENSY/420-835GLTSMIIGSLR..DLR......VNYYKSLSKSQSITEEQ..........RQQYT..VISQALKVVLNASYGVMGAEIF.P
Q9Q8R2_MYXVL/498-996RSVEGIIPKLLKTFLT......ERLKYKKMIKETNDVVE............KAIYDSMQYTYKIIANSVYGLMGFKNS.A
O93043_FHV1/606-1159HVREEPAGVLLRDWLA......MRKAIRARIPDSTSDE.............AILLDKQQAAIKVVCNSVYGFAGVANG.L
DPOD_SCHPO/534-990HVRKGLLPIILADLLN......ARKKAKADLKKETDPFK............KAVLDGRQLALKVSANSVYGFTGATNG.R
DPOLA_OXYTR/809-1299AVLPNVLRDLVQ..KR.......KAVKEKMK.NEKDAVK..........LSQLE..IRQKAIKLTANSMYGCLGFGSS.R
Q9QEL0_9ALPH/621-1171HVRESLLSILLRDWLA......MRKQIRAHIPSSAPEE.............AVLLDKQQAAIKVVCNSVYGFTGVQRG.L
DPOL_METVO/393-818GIIPKTLNELLSRRKH......IKMLLKDKIQKNEFDEE..........YSRLE..HEQKSIKVLANSHYGYLAFPMA.R
O92827_9BETA/515-999TVRESILASLLKKWLD......KRKEVKMQMKMCNNPVM............EMLLDKKQLALKTTCNSVYGVTGATHS.L
DPOZ_YEAST/919-1384SVRKSTLSKMLTDILD......VRVMIKKTMNEIGDDNT..........TLKRLLNNKQLALKLLANVTYGYTSASFSGR
DPOL1_AERPE/535-951GISNEIVGMLR..DFR......VRLYKKKSKDKSLREEE..........RLWYD..VVQSAMKVYINASYGVFGSEKF.S
DPOLA_HUMAN/783-1246SLEMGILPREIRKLVE......RRKQVKQLMKQ.QDLNP..........DLILQYDIRQKALKLTANSMYGCLGFSYS.R
Q69390_9ALPH/516-1008GVRESLLSILLRDWLA......MRKAIRARIPTSAPEE.............AVLLDKQQAAIKVVCNSVYGFTGVANG.L
DPOL_RHCM6/533-1017TVRNSVLSELLTKWVS......QRRAVRETMRSCHDPVK............RMLLDKEQLALKVTCNAFYGFTGVVNG.M
DPOL_PBCVN/432-881GEGQGVVPALLDDLAK......FRKQAKKHMAEAKKNDDE.........FREALYDAQQRSYKIVMNSVYGFLGASRG.F
DPOL_ALHV1/550-1026HKTESLLASLLKTWLA......KRKSIKKELEQCQDAKM............KTILDKQQLAIKVTCNSVYGFTGVASG.M
Q59690_PYROC/488-905GLTSQIVGLLR..DYR......VKIYKKKAKDKSLPDDV..........RAWYN..TVQAAMKVYINASYGVFGAESF.P
DPOD1_SOYBN/511-969NLQKGILPEILEELLT......ARKRAKADLKEAKDPLE............KAVLDGRQLALKISANSVYGFTGATIG.Q
DPOL_SHV21/522-994HIQASLLSRLLTVWLS......KRKAIRQKLAECEDLDT............KTILDKQQLAIKVTCNAVYGFTGVASG.L
DPOA_SCHPO/773-1222GIFPRLIANLVE..RR.......RQIKGLLKDNSATPTQ..........RLQWD..IQQQALKLTANSMYGCLGYTKS.R

PF08490

Q7Q7P3_ANOGA/1540-1943DWQRHGARSMIRHFLN------LGRVLQMMLEQCLYFQL-------------PLGNMPPDTVLFGADLFFARLLHRHN-F
DPOE_CRYNJ/1526-1917MWLLQTSRRMIGLYLR------LSSWLKEQIQIASHFDV-------------PIGNLGADIAVFLADIEFARRLKQQD-M
DPOE_DEBHA/1533-1917GWQSLIIKRVVNHYFV------LASWIKKLISLAKYGNV-------------PLCNLQIENMGYLIDIEYARRLSQSN-I
Q7RWE3_NEUCR/1533-1926GWQSVVARRLVNHYLS------LGSWITHMTALARYGDV-------------PLCNLERDDPRFLIDIAYARRLMANN-V
DPOE_ASHGO/1492-1878NWQDQLIKKTVSHILQ------LGSWLSNLTILSNYTRI-------------PICNLNLTNLGYVIDIMYARRLKLEN-I
DPOE_EMENI/1495-1885GWQSFIAKRLVTHYLY------LSSWVQHLTMLARYGDV-------------PLCNLESDDPRFLIDISYARRLQQNN-V
Q6K777_ORYSJ/1562-1941GWQATAGRTSMQRCAA------STQWFNERISLARYAHV-------------PLGNFELDWLLFTADVFFSRALRDQQ-Q
DPOE_YEAST/1527-1920NWQPTLLKKLVNHVLS------SGSWISHLIKLSQYSNI-------------PICNLRLDSMDYIIDVLYARKLKKEN-I
DPOE1_HUMAN/1525-1925DWQRHGARRMIRHYLN------LDTCLSQAFEMSRYFHI-------------PIGNLPEDISTFGSDLFFARHLQRHN-H
DPOE_SCHPO/1497-1886SWKQHIATKMIQHFLA------IGSWLFHRIQLSRFSDI-------------PLCNFESDDIQYSIDVVYSRKLKEHN-I
DPOE_KLULA/1497-1883NWQGQLMRKAVNHILS------LGSWISNLITLSKYSNI-------------PICNLKVDNLGYIIDLMYARQLKKNN-I
DPOE_YARLI/1513-1873GWQRDLVRRLIASFLS------HGANISYLVEMARYAKM-------------PLCHVQ.DTRD.VIDVSYARRLIQNS-V
DPOE_CANGA/1524-1916NWQNVMINKLCSYIIS------TSYWVSHLVSLSQHSNV-------------PICNINLEKMDFVIDVIYARRLKLDN-I
Q95R46_DROME/3-405DWQRQGSRAVIRHFLN------LNNVLDLMLDQCRYFHV-------------PIGNMPPDTVLFGADLFFARLLQRHN-F
Q59SM7_CANAL/1518-1902GWQSLISKRVINHYFV------LGSWIKNLVAFAKYANV-------------PLCNLQIENIGFLVDIEYARRLSENN-I
O62218_CAEEL/1467-1869DWQKVVARRVLQHYFN------SFFFLADYLEWARYLRV-------------PIGNLPADHALFGLDLLFARNLQKSG-H
Q9ZVC8_ARATH/1484-1864SWQRPAAKIAVLRCAS------AIQWLDRRIAQSRYAHV-------------PLGNFGRDWLTFTVDIFLSRALRDQQ-Q

PF03175

DPOL_ADEB2/267-751YQLNKALWR.EK.NVG------.AYDIIQQTLHYCVQDV------------LVTSALVNKLQESYKNFIASQVNLPDA-S
DPOL_BPPRD/1-440IHKFRDSYAILP..VP------LAASDEKIEIDYGKMER------------ETREQHKAEILEYLKGDCVTLHKMVSL-F
Q39432_BETVU/147-571DHSSMNLEN.VK....------...KKRDVVIEYMKQDI------------RLLG....GVMQKAQDIYWNLFEV..D-L
DPOL_ADEG1/238-751IAEQKNLWQ.KE.HPG------QQYDIVQACLEYCMQDV------------RVTQKLAHTLHDSYDAYFQRELGM.EG-H
DPOM_NEUIN/400-868EQYQEYANK.FK...N------NNWDLKKELIKYCEIDT------------IALY....QVLVSFQRKIYEKFMI...-D
DPOL_ADE12/306-791YLLNQELWK.KK.GEK------.NYNLIGETLNYCALDV------------LVTASLVEKLRSSYAQFVTDAVGLDAA-H
DPOL_BPM2/50-485PLLKGDIDY.HT.ERP------VGHEITPEEYEYIKNDI------------EIIAR...ALDIQFKQGLDRMTAG.SD-S
O78938_AGRAE/66-524EEYNNYKSN.FK....------.VWNFREEAIKYCNLDC------------ISLY....EILYKFNTLVFNKFEL...-N
DPOL_ADE02/300-785FVLNRELWK.KK.GQD------.KYDIIKETLDYCALDV------------QVTAELVNKLRDSYASFVRDAVGLTDA-S
DPOM_CLAPU/431-902AEYLKLVKD.......------.DWDFKDETLEYLNLDL------------ISLH....QVLVKVNKAINFLFDIEFT-S
Q9XNK1_PLEOS/737-1218EDYITEIVNRIKNEEN------GVWDCEKELLKYLNGDI------------DTLY....SVMYTFGEFIFDKFNINIT-R
O99973_PORPU/80-490...ERISKE..K....------......NFIIKYLTNDI------------EMLR....DIIISFENMVNESYNMICH-N
DPOM_NEUCS/366-859GEMITLFEW.AA.MYT------NKWSMRKETIIYLEKDI------------KALY....QLMMEMSNNTYSTFRINIT-R
Q83895_ADEO7/318-798YLQNKPKHN.Q.....------.KYNLLEEAKEYCIDDV------------IVTAQLVEKLIEGYQEFCTTSLKL.EC-S
DPOL_ADECT/391-876YSFNKDLWI.KE.KKG------.AYDIIQQTLDYCALDV------------QVTAQLVNKLIESYQIFIKNSVNLPET-S
DPOL_BPPZA/50-485TVLKGDIDY.HK.ERP------VGYEITPDEYAYIKNDI------------QIIAE...ALLIQFKQGLDRMTAG.SD-D
DPOM_MAIZE/299-733DHQNVTVDK.LP....------...SIREDSLTYLKQDI------------LITA....AVMQRAKAIIWEEYGI..D-I
O11414_9ADEN/323-802YHQNKIKG........------.PYDILKEALIYCIADV------------KVTSQLTRKLIEGYQSFCNDQIKL.TC-Q
DPOM_ASCIM/588-1048DDYKKYCKD.FN....------NNWDFNKELKNYCEIDC------------LALH....DILTLFAKMIHNEFSV...-D
DPOM_PODAS/449-902VISQELYNE.LI...V------PQWDLRKQTLHYLERDL------------LSLL....EIINTYNHYVYKRYNV..Q-L
Q9WF13_ADE17/335-820YALNRELWE.KK.GEA------.GYDIIRETLDYCAMDV------------LVTAEFVAKLQDSYAHFIRDSVRLPHA-H
Q9TEH5_9PEZI/309-758QTEYDEIKN.SP..DS------SKRDLKKETIKYLEQDI------------KTLC....EVLIKFSDEIWEEREN...-I
DPO2_KLULA/409-873NIYYKNIEI.FE.NDR------NYNTILENAIEYCKVDV------------LAME....KVWIKFKKLLEKNLNI.TV-S
Q35599_PHYPO/7-446FLYPKKKIL.IK....------..DLYNFFSENIIYNDV------------VKDY....KLLAILYNEIQTAYNININ-R
Q9YUR6_9ADEN/338-828YNEQKEIWL.EK..KE------VKYDIVKELIDYCIKDV------------KITEELTKTLLNTFDTFIKEELNL.KC-N
Q09038_LACKL/414-878NIKI.NTTL.EEDNIT------NNSTIIEKAIEYCSIDV------------IAMK....QVWQKFKKLVKENLQI.SI-S
DPOL_BPCP1/56-488PIAKGTTPL.LK.HKP------..EVIKPEWIDYIHVDV------------AILAR..GIFAMYYEENFTKYTSA.SE-A
DPOL_ADE04/437-922FLLNRELWK.QK.GQL------.KYDIIQETLDYCALDV------------LVTAELVAKLQDSYAHFIRDSVGLPHA-H
Q9QM79_9ADEN/238-780IAEQKALWR.QE.HPG------RPYDIVQACLEYCMQDV------------RVTQKLALTLYDSYDKYFKDELGM.HG-D
DPO1_KLULA/415-878LITSEHIVN.FT.KND------KSKTLIEWSKDYCRNDV------------LVLS....KVWLEFKNAVEDIFNC.EL-V
DPOL_ADE40/433-918YLLNRELWE.KK.QCP------.HYDLVRETLDYCALDV------------LVTAALVQKLRESYAQFIRDAVGLPEA-S
O21376_PICKL/474-939AYLLELFPN......G------.MMNTKMATKTYTDTDV------------RLLT....MIMDKFKNIMYSTARVDLT-K
Q96206_BPGA1/50-490PVLKGDIDY.KK.YRP------VGYVMDDNEIEYLKHDL------------LIVAL...ALRSMFDNDFTSMTVG.SD-A
DPOL_ADEB3/262-744YLLNKSLWL.QE.NSG------.AYDIVQRTLDYCAMDV------------LVTAELVKKLQASYLDFVHTSVGLPHC-N
O74719_DEBHN/418-882LISSHNIIN.YE.TDG------KSKKLLDWSREYCCNDV------------IVLA....KVWLEFKIAVYEIFSA.KV-V

PF03337

Q1HTT9_9POXV/3-657TGARTVIDDMTVCDIG------YHAILVKDPVRYSRPEI--------------DI.YLHDVEAMADESMWSRL.RPDVPR
Q3I8X2_MONPV/3-635FSRYTIVDSMIIGHIG------HHYIWIKNLETYTRPEI--------------DV.LPFDIKCISRDELWARISSSLDQT
Q8V3R9_SWPV1/2-644.CEYTMIDEMVITYIG------NHYIWVKNK.AYNRPEL--------------DI.LPYNVENISLKNNWSKI.FPYNRD
Q070L3_CPRV/15-686.PQATVVDDMRIRNLG------YYAIWVRDVRVYARPEM--------------DIDYGVSLADLCDLRHWGPV.DLEEPR
Q08FW7_DPV83/4-651.TSYTLIDEMIITYIG------NHYIWVKDKLSYTRPEL--------------DI.LPYDIQSISQKNMWSKI.YPYNRH
Q6TUY6_YMTV5/6-640.NLYTFLDEMNISYIG------HHYIWVKDK.NYVRPDL--------------DI.LPYNIKSINFNAEWKKL.PMFNEQ
Q2F8G6_ORFV/3-635.RRQTLLDLMNVCCVG------SYAIWIKDPSTYSRPDT--------------EV.LSHDVRTAASADSWAQP.HVHTPS
Q9Q8S1_MYXVL/3-624.SQYTLIDDMIISYIG------NHYIWVKKKEAYQRPEI--------------DV.YPYDLERLSSPSNWTEL.RP.NKQ
Q6TVH8_9POXV/3-637.RKQTLLDIMNVCYVG------VYAIWVKDPASYTRPDT--------------EV.LAHDARTAAQASSWAQP.HLHSPS
Q98188_MCV1/3-654.GSLTLIDDMVVGCLG------YHAIWVKDPERYTRPEI--------------DI.HRYDVQAVAAPENWAPL.RARTAR
A7XCD4_9POXV/6-641.NTYTFLDEMSISYIG------HHYIWVKNK.NYIRPEL--------------DI.LPYNIRDINFKLEWKKL.FILGKQ

PF00136

DPOD_YEAST/555-991LPCLA---ISSSVTA--------------YGRTMI---------------------------------------------
DPOL_GPCMV/556-1073MPCLP---IAAAITR--------------IGRDML---------------------------------------------
DPOL2_AERPE/390-793WYCRE---CAEAVTA--------------WGRSII---------------------------------------------
O40910_HHV8/533-1006LPCLN---IAETVTL--------------QGRKML---------------------------------------------
DPOL1_SULSO/450-869LYAPA---VAESVTA--------------LGRYVI---------------------------------------------
Q89604_9ALPH/639-1203LPCLA---VAATVTT--------------IGRDML---------------------------------------------
Q9YQZ6_9VIRU/602-1028.....---..VLITG--------------LGRHKI---------------------------------------------
Q9WSY3_9ALPH/582-1139LPCID---VAATVTT--------------IGRDML---------------------------------------------
DPOL_ARCFU/361-774WYCHP---CAEATTA--------------WGRHFI---------------------------------------------
DPOL_RCMVM/533-1077LPCLP---IAASITK--------------IGRDML---------------------------------------------
Q9YW56_MSEPV/569-1067FNSKY---CAQFCTA--------------LGRKCI---------------------------------------------
DPOL_ASFL6/457-978FFLLP---LAGGVTS--------------SGQYNL---------------------------------------------
DPOD1_CAEEL/520-978LPCLE---ISQSVTA--------------FGRKMI---------------------------------------------
DPOL_FOWPN/483-977LYSYS---SAKTCTT--------------IGRNMI---------------------------------------------
DPOL_HHV21/617-1200LPCLH---VAATVTT--------------IGREML---------------------------------------------
Q9Q6Z6_9GAMA/520-997LPCLK---IAETITM--------------QGRAML---------------------------------------------
Q59691_PYROC/388-793WYCKR---CAEAVTA--------------WGRNLI---------------------------------------------
O36638_9PHYC/422-974LPLVA---IAAAVTC--------------TGRSMI---------------------------------------------
DPOL_IIV6/578-1226LPFMP---IAMCTTY--------------MGRKSI---------------------------------------------
Q69281_9ALPH/606-1168LPCID---VAATVTT--------------IGRNML---------------------------------------------
DPOL_EHV1B/611-1173LPCLR---IAATVTT--------------IGRDML---------------------------------------------
DPOL_MUHVS/543-1050LPCLP---IAASITK--------------IGRDML---------------------------------------------
DPOD1_MESAU/546-1005LPCLE---ISQSVTG--------------FGRQMI---------------------------------------------
DPOLA_ORYSJ/834-1303FYAKP---LAELITL--------------QGREIL---------------------------------------------
DPOL_RSIV/397-938LPFMA---GAMTTTY--------------CGRKLI---------------------------------------------
DPOL1_SULAC/448-867LYAPA---VAESVTA--------------IGRYII---------------------------------------------
Q9Y1T1_TOXGO/1006-1612FYAKE---IAAFITQ--------------QGRNIL---------------------------------------------
DPOL1_SULOH/448-867LYAPA---VAESVTA--------------IGRYVI---------------------------------------------
DPOL_BPT4/383-855YYDLR---NATAITI--------------FGQVGI---------------------------------------------
Q98207_MCV1/494-994LYSYS---SAKCCTT--------------IGRVMI---------------------------------------------
DPOLA_OXYNO/783-1270FHAQA---IAALITR--------------TGRETL---------------------------------------------
DPOL_EHV2/530-1004LPCLK---IAETVTF--------------QGRRML---------------------------------------------
DPOL_ORFN2/499-998LFSYA---SAKSCTA--------------IGRTMI---------------------------------------------
DPOLA_DROME/805-1258FFAQH---LAALVTH--------------KGREIL---------------------------------------------
DPOD1_PLAFK/544-1000LPCLE---VAVSITT--------------LGRSMI---------------------------------------------
DPOL_VZVD/597-1136LPCLY---VAATVTT--------------IGRQML---------------------------------------------
O41930_MHV68/528-1001LPCLQ---IAETITF--------------QGRKML---------------------------------------------
DPOL_TUHV2/556-1135LPCLP---VAASITT--------------IGRDML---------------------------------------------
DPOD1_DROME/534-994LPCLE---ISGSVTA--------------YGRTMI---------------------------------------------
DPOL_THEGO/348-763WYCKE---CAESVTA--------------WGRQYI---------------------------------------------
Q9WT26_HHV6H/517-998LPCVA---IAASVTC--------------LGREML---------------------------------------------
DPOL_EBVB9/532-1013FPCLS---IAETVTL--------------QGRTML---------------------------------------------
DPOD_CANAX/484-939LPCLA---ISSSVTA--------------FGREMI---------------------------------------------
DPOLA_TRYBB/684-1157FYAQP---LAELVTR--------------QGRLAL---------------------------------------------
DPOL_BPR69/386-859YYDLR---NATAITT--------------FGQMAL---------------------------------------------
DPOA_YEAST/792-1248FYAKP---LAMLVTN--------------KGREIL---------------------------------------------
DPOL_SFAVA/492-1090LPCQN---VAKVTTA--------------LGRMTI---------------------------------------------
DPOL_VACCA/497-995LYSYA---SAKSCTS--------------IGRRMI---------------------------------------------
O74046_CENSY/420-835LYFLP---AAEATTA--------------VGRYII---------------------------------------------
Q9Q8R2_MYXVL/498-996LYSYA---SAKSCTA--------------IGRQMI---------------------------------------------
O93043_FHV1/606-1159LPCLQ---IAATVTT--------------IGRDML---------------------------------------------
DPOD_SCHPO/534-990LPCLA---ISSSVTS--------------YGRQMI---------------------------------------------
DPOLA_OXYTR/809-1299FHAQA---IAALITK--------------TGRDTL---------------------------------------------
Q9QEL0_9ALPH/621-1171LPCLP---VAATVTT--------------IGRDML---------------------------------------------
DPOL_METVO/393-818WYSDK---CAEMVTG--------------LGRKYI---------------------------------------------
O92827_9BETA/515-999LPCVA---IAASVTC--------------LGREML---------------------------------------------
DPOZ_YEAST/919-1384MPCSD---LADSIVQ--------------TGRETL---------------------------------------------
DPOL1_AERPE/535-951LYSLP---VAESVTA--------------LGRAVL---------------------------------------------
DPOLA_HUMAN/783-1246FYAKP---LAALVTY--------------KGREIL---------------------------------------------
Q69390_9ALPH/516-1008LPCLP---VAATVTT--------------IGRDML---------------------------------------------
DPOL_RHCM6/533-1017MPCLP---IAASITR--------------IGRDML---------------------------------------------
DPOL_PBCVN/432-881IPCVP---IAASVTA--------------TGRKMI---------------------------------------------
DPOL_ALHV1/550-1026LPCLM---IAETVTL--------------QGRTML---------------------------------------------
Q59690_PYROC/488-905FYAPP---VAESVTA--------------IGRYTI---------------------------------------------
DPOD1_SOYBN/511-969LPCLE---ISSSVTS--------------YGRQMI---------------------------------------------
DPOL_SHV21/522-994LPCIS---IAETVTL--------------QGRTML---------------------------------------------
DPOA_SCHPO/773-1222FYARP---LAVLITY--------------KGREAL---------------------------------------------

PF08490

Q7Q7P3_ANOGA/1540-1943VLWFS---GG.ARPD--------------LGGREA---------------------------------------------
DPOE_CRYNJ/1526-1917LIWWS---ST.PRPD--------------LGGSEE---------------------------------------------
DPOE_DEBHA/1533-1917VLWLS---SR.PLPD--------------HGGFEM---------------------------------------------
Q7RWE3_NEUCR/1533-1926VLWWS---PS.PRPD--------------HAGYEK---------------------------------------------
DPOE_ASHGO/1492-1878VLWWN---QKQPLPD--------------RGGIQN---------------------------------------------
DPOE_EMENI/1495-1885VLWWS---ST.AKPD--------------HAGYEK---------------------------------------------
Q6K777_ORYSJ/1562-1941VLWIS---DD.GIPD--------------LGGTYE---------------------------------------------
DPOE_YEAST/1527-1920VLWWN---EKAPLPD--------------HGGIQN---------------------------------------------
DPOE1_HUMAN/1525-1925LLWLS---PT.ARPD--------------LGGKEA---------------------------------------------
DPOE_SCHPO/1497-1886ILWWN---KG.PTPD--------------LGGIEK---------------------------------------------
DPOE_KLULA/1497-1883VLWWN---DKSPLPD--------------HGGVER---------------------------------------------
DPOE_YARLI/1513-1873VLWWS---AA...LS--------------TGGALT---------------------------------------------
DPOE_CANGA/1524-1916ILWWN---EQSPLPD--------------HGGMEN---------------------------------------------
Q95R46_DROME/3-405VLWWS---AS.TRPD--------------LGGREA---------------------------------------------
Q59SM7_CANAL/1518-1902VLWWS---PN.PLPD--------------LGGFEM---------------------------------------------
O62218_CAEEL/1467-1869ALWAT---RA.SRPD--------------LGGKEM---------------------------------------------
Q9ZVC8_ARATH/1484-1864VLWVS---DN.GVPD--------------LGDINN---------------------------------------------

PF03175

DPOL_ADEB2/267-751FNIFQRPTISSNSHA--------------IFKQILYREV.........................................
DPOL_BPPRD/1-440IAEFG....MRLTIG--------------GTAMNE.............................................
Q39432_BETVU/147-571VDWIT...VASQALG--------------IFRMNFF............................................
DPOL_ADEG1/238-751FNIFVRPTIPSNTHA--------------FWKQLTFSNYVREQRATCPPSVP............................
DPOM_NEUIN/400-868CTKYP..TIPSLAFA--------------IFRKKY.............................................
DPOL_ADE12/306-791FNVFQRPTISSNSHA--------------IFRQILYRAE.........................................
DPOL_BPM2/50-485LKGFK...DILSTKK--------------FNKVFP.............................................
O78938_AGRAE/66-524INKYP..TLPSLSFA--------------LFKTKY.............................................
DPOL_ADE02/300-785FNVFQRPTISSNSHA--------------IFRQIVFRAE.........................................
DPOM_CLAPU/431-902CATVS.....SLANK--------------IFLSKFY............................................
Q9XNK1_PLEOS/737-1218IRTYS.....GLAFL--------------IYTSRYY............................................
O99973_PORPU/80-490NLTST.....SLSYK--------------IFKKYY.............................................
DPOM_NEUCS/366-859VKTASALAFLVYRTI--------------FLPNEVEEENETNSPNN..................................
Q83895_ADEO7/318-798FNIFQRPTISSNTQA--------------LFKQIFYNEE.........................................
DPOL_ADECT/391-876FNVFQRPTISSNSHA--------------IFKQILYKAE.........................................
DPOL_BPPZA/50-485LKGFK...DIITTKK--------------FKKVFP.............................................
DPOM_MAIZE/299-733LKVLT...ISALALK--------------IFRRVYY............................................
O11414_9ADEN/323-802FHIFQRPTISSNTHA--------------LFKQILYRAE.........................................
DPOM_ASCIM/588-1048ITRYV..SLSSITFA--------------IFRTNF.............................................
DPOM_PODAS/449-902TESLT...IARLALN--------------IYLKRY.............................................
Q9WF13_ADE17/335-820FNIFQRPTISSNSHA--------------IFRQIVFRAE.........................................
Q9TEH5_9PEZI/309-758TKCSS...LSGLAYL--------------IFKTNY.............................................
DPO2_KLULA/409-873VKTFT...LSQLSMK--------------IMESKL.............................................
Q35599_PHYPO/7-446KYILS...TASLSLR--------------IFKKSF.............................................
Q9YUR6_9ADEN/338-828FNIFKRPTISSNSHA--------------IFRQLHFKQN.........................................
Q09038_LACKL/414-878EKTFT...LSQLSMK--------------IMEASL.............................................
DPOL_BPCP1/56-488LTEFK..RIFRKSKR--------------KFRDFF.............................................
DPOL_ADE04/437-922FNIFQRPTISSNSHA--------------IFRQIVYRAE.........................................
Q9QM79_9ADEN/238-780FNIFLRPTIPSNTHA--------------FWKQLTFTAYVEEQERASTVERPPSKYKRKVALKKNDIKGNPHDADVHDVE
DPO1_KLULA/415-878DQTMT...LAGLSYK--------------LFQANM.............................................
DPOL_ADE40/433-918FNVFQRPTISSNSHA--------------IFRQILYRTV.........................................
O21376_PICKL/474-939CMTIS.....KLALS--------------MYSNMC.............................................
Q96206_BPGA1/50-490LNTYK...EMLGVKQ--------------WEKYFP.............................................
DPOL_ADEB3/262-744FNVLQRPTISSNSHA--------------IFRQVVYRSQ.........................................
O74719_DEBHN/418-882DQSYT...LAGMSFK--------------LFESNL.............................................

PF03337

Q1HTT9_9POXV/3-657S.CVYAVVVHAMLRG..NAPVPFMISTYPPGNVFV---------------------------------------------
Q3I8X2_MONPV/3-635HIKTIAVSVYGAITD..NGPIPYMISTY.PGNTFV---------------------------------------------
Q8V3R9_SWPV1/2-644LIKIIAISINAVITP..TGPSIYMITTYPPGKTFI---------------------------------------------
Q070L3_CPRV/15-686ARAVPVVCFQTMV....HGREPVAVATYPGGRAYF---------------------------------------------
Q08FW7_DPV83/4-651FLKIFSIYVNAIITP..TGPSIYMISVY.PGKCFI---------------------------------------------
Q6TUY6_YMTV5/6-640FLNFFTFSINSIITS..TGPSIYMISTY.PGKCFV---------------------------------------------
Q2F8G6_ORFV/3-635GNSVAAWFVYRFGSD..GTVRLNSIATN.AGPVF.---------------------------------------------
Q9Q8S1_MYXVL/3-624YLKFITILVNATITP..NGASVYMITTH.PGRCFT---------------------------------------------
Q6TVH8_9POXV/3-637TSCVAAWFCYRCGGD..GRVQLHSIVMN.TGMVF.---------------------------------------------
Q98188_MCV1/3-654A.PMRAMLLYARASTGCTPPEPYMISVYPEGRVFF---------------------------------------------
A7XCD4_9POXV/6-641FLKIFTFSVNSIITS..TGPSIYMITTH.PGKCFV---------------------------------------------

PF00136

DPOD_YEAST/555-991------------------LKTKTAVQEK.....YCIKNGY...............................KHDAVVVYG
DPOL_GPCMV/556-1073------------------MSVVDYVNTY.........MGHAEFWLRYL...............GEEDLTGDALNVKVIYG
DPOL2_AERPE/390-793------------------RTAIRKAGE..........L...................................GLEVIYG
O40910_HHV8/533-1006------------------ERSQAFVEA.IS.PE.RLAGLLRRPI.......................DVSPDARFKVIYG
DPOL1_SULSO/450-869------------------TSTVKKARE..........E...................................GLTVLYG
Q89604_9ALPH/639-1203------------------LETRRYIHERWA.TPEALVRDFPAAGP....................AAAAAGRYRVRVVYG
Q9YQZ6_9VIRU/602-1028------------------KIVERFIKEA.............................................GFVHNYG
Q9WSY3_9ALPH/582-1139------------------LTVRDYVKVKWG.TRDALLREFPALTN.....................YMLGDDYSVSVIYG
DPOL_ARCFU/361-774------------------RTSAKIAES..........M...................................GFKVLYG
DPOL_RCMVM/533-1077------------------LATSAYMERHCN.DVEFLVSEVGVPRE.....................AVDRDALRVKIVYG
Q9YW56_MSEPV/569-1067------------------KYTADILNNSYN.INGIFTVNNVINIFTKTHI...........QTKYNSNIQECFTLEIVYG
DPOL_ASFL6/457-978------------------KLVYNFVINK.............................................GYGIKYG
DPOD1_CAEEL/520-978------------------DMTKLEVERIYK.KGALDGKC................................PADAKVIYG
DPOL_FOWPN/483-977------------------TYLDSIMNGAVWENDKLILADFPRNIFSGETMF.........NKELEVPNMNESFKFRSVYG
DPOL_HHV21/617-1200------------------LATRAYVHARWA.EFDQLLADFPEAAG.....................MRAPGPYSMRIIYG
Q9Q6Z6_9GAMA/520-997------------------EKTKVFVEN.LS.HE.DLRSICKVGSIP...................QSSNVFDKPFKVIYG
Q59691_PYROC/388-793------------------LTAIEYARK..........L...................................GLKVIYG
O36638_9PHYC/422-974------------------KTTADFIRT..........E..................................MGGTVIYG
DPOL_IIV6/578-1226------------------VEVSQYLKEL.............................................GGRVVYG
Q69281_9ALPH/606-1168------------------LTVRDYIHKQWG.TRDALLREFPNLSN.....................FMRPEDYSVSVIYG
DPOL_EHV1B/611-1173------------------LKTRDYVHSRWA.TRELLEDNFPGAIG.....................FRNHKPYSVRVIYG
DPOL_MUHVS/543-1050------------------LATAGHIEDRCN.RPDFLRTVLGLPPE.....................AIDPEALRVKIIYG
DPOD1_MESAU/546-1005------------------EKTKQLVESKY..TL..ENGY................................NANAKVVYG
DPOLA_ORYSJ/834-1303------------------QNTVDLVQNN.........L...................................NLEVIYG
DPOL_RSIV/397-938------------------EKAAHLLKT..........V..................................VGATIVYG
DPOL1_SULAC/448-867------------------TTTYKQAEK..........L...................................NLKVIYG
Q9Y1T1_TOXGO/1006-1612------------------MAAKDKVERI.........L...................................RLEVVYG
DPOL1_SULOH/448-867------------------TTTVNYCRSI.............................................GLQVLYG
DPOL_BPT4/383-855------------------QWIARKINEY.........LNKVC...........................GTNDEDFIAAG
Q98207_MCV1/494-994------------------TYLDRVVDGATL.CAGVLRLAAEPRNPLLASAPPR....ARDVDVSAALGHELELRFRSVYG
DPOLA_OXYNO/783-1270------------------LRTKDIAENK.........L...................................GFNVVYG
DPOL_EHV2/530-1004------------------ENSKRYIEG.VT.PE.GLADILGRRV.......................ECAPDASFKVIYG
DPOL_ORFN2/499-998------------------AYLERTLDGASV.CGTRLSLAAAPDNPLLRDEAFAGRAAELEIDAAVAGERTERVGFRSVYG
DPOLA_DROME/805-1258------------------TNTQQLVQK..........M...................................NYDVVYG
DPOD1_PLAFK/544-1000------------------EKTKERVESFY..CK..SNGY................................EHNSTVIYG
DPOL_VZVD/597-1136------------------LSTRDYIHNNWA.AFERFITAFPDIES....................SVLSQKAYEVKVIYG
O41930_MHV68/528-1001------------------EKSRAYIEN.MS.SA.TLGALMHKT.........................YNPDAYFRVIYG
DPOL_TUHV2/556-1135------------------SRTSAYIEAHFA.EPAFLARFFEPGDL....................PRADEPPPTVRVIYG
DPOD1_DROME/534-994------------------EMTKNEVESHY..TQ..ANGY................................ENNAVVIYG
DPOL_THEGO/348-763------------------ETTIREIEEK.........F...................................GFKVLYA
Q9WT26_HHV6H/517-998------------------CSTVDYVNSKMQ.SEQFFCEELGLTA......................SDFTGDLKVEVIYG
DPOL_EBVB9/532-1013------------------ERAKAFVEA.LS.PA.NLQALAPSPDA....................WAPLNPEGQLRVIYG
DPOD_CANAX/484-939------------------EKTKNEVQEYY..SK..KNGH................................PYDAKVIYG
DPOLA_TRYBB/684-1157------------------QNTVELIPQI....S...P....................................SIRVIYG
DPOL_BPR69/386-859------------------QWIERKVNEY.........LNEVC...........................GTEGEAFVLYG
DPOA_YEAST/792-1248------------------MNTRQLAES..........M...................................NLLVVYG
DPOL_SFAVA/492-1090------------------LQAIEIART..........E..................................RNVTTIYS
DPOL_VACCA/497-995------------------LYLESVLNGAEL.SNGMLRFANPLSNPFYMDDRD......INPIVKTSLPIDYRFRFRSVYG
O74046_CENSY/420-835------------------MQTISHCEQM.............................................GVKVLYG
Q9Q8R2_MYXVL/498-996------------------HYLNSVLNGCKL.SSGKFQLAAYPINPFFQDDRS......VDLYASTNLPTEYNYDFKGVYG
O93043_FHV1/606-1159------------------LNTKHYVESRWA.TREGVESDFPEAMT....................VTIPDKPYNVQVIYG
DPOD_SCHPO/534-990------------------EKTKDVVEKRY..RI..ENGY................................SHDAVVIYG
DPOLA_OXYTR/809-1299------------------LRTKDIAENK.........L...................................GFNVVYG
Q9QEL0_9ALPH/621-1171------------------LATRDYVHSRWV.SFDGLVMDFPEAAA.....................IRGEGEYSMRIIYG
DPOL_METVO/393-818------------------QETIEKAEE..........F...................................GFKVIYA
O92827_9BETA/515-999------------------CKTVDYVDSAMY.SDTFFIEKFGLTR......................GDFSGTFGIEVIYG
DPOZ_YEAST/919-1384------------------EKAIDIIEK.....D....ET.................................WNAKVVYG
DPOL1_AERPE/535-951------------------RGTLEKSREL.............................................NLHIVYG
DPOLA_HUMAN/783-1246------------------MHTKEMVQK..........M...................................NLEVIYG
Q69390_9ALPH/516-1008------------------VATRDYVQTRWA.TRELLERDLPAR........................PPAGEYAVRVVYG
DPOL_RHCM6/533-1017------------------MRTSQFVEENFA.EPCFLHNFFNRED.......................YSGDPVAVKVIYG
DPOL_PBCVN/432-881------------------EHTAKRVTEL.........L..................................PGSEVIYG
DPOL_ALHV1/550-1026------------------EKTKQFVEN.VT.VE.YLQKICNFEVQ....................CLPQHPNPKFRVVYG
Q59690_PYROC/488-905------------------KQTLQKAGEL.............................................GLRVLYG
DPOD1_SOYBN/511-969------------------EHTKKLVEDKF..TT..LNGY................................EHNAEVIYG
DPOL_SHV21/522-994------------------EKSKIFIEA.MT.PD.TLQEIVPHIV.......................KHEPDAKFRVIYG
DPOA_SCHPO/773-1222------------------MNTKELADQ..........M...................................GLQVIYG

PF08490

Q7Q7P3_ANOGA/1540-1943------------------D.DSRLLAE---------------------------------------------------FE
DPOE_CRYNJ/1526-1917------------------D.....ANS---------------------------------------------------SE
DPOE_DEBHA/1533-1917------------------D....KAQD---------------------------------------------------FE
Q7RWE3_NEUCR/1533-1926------------------D...DVVGP---------------------------------------------------LD
DPOE_ASHGO/1492-1878------------------EYNPHTLSL---------------------------------------------------AT
DPOE_EMENI/1495-1885------------------D...DITGP---------------------------------------------------LE
Q6K777_ORYSJ/1562-1941------------------G....DTCF---------------------------------------------------AD
DPOE_YEAST/1527-1920------------------DFDLNTSWI---------------------------------------------------MN
DPOE1_HUMAN/1525-1925------------------D.DNCLVME---------------------------------------------------FD
DPOE_SCHPO/1497-1886------------------DSILQIASP---------------------------------------------------KD
DPOE_KLULA/1497-1883------------------DFDPRKAEL---------------------------------------------------MT
DPOE_YARLI/1513-1873------------------D........---------------------------------------------------..
DPOE_CANGA/1524-1916------------------DFDQNTSWI---------------------------------------------------MN
Q95R46_DROME/3-405------------------D.DSRLLAE---------------------------------------------------FE
Q59SM7_CANAL/1518-1902------------------D....RMID---------------------------------------------------FD
O62218_CAEEL/1467-1869------------------D.DVRLSVD---------------------------------------------------WN
Q9ZVC8_ARATH/1484-1864------------------E....ETFL---------------------------------------------------AD

PF03175

DPOL_ADEB2/267-751.............RPNKANLDNVLLAP--------------------------------------S.HEMYDYVRQSIRG
DPOL_BPPRD/1-440..................LKQFHPYDP--------------------------------------VRKGFDEAMRPFYFG
Q39432_BETVU/147-571.................NDMDFHIHIP--------------------------------------N.RNEDTFIRRGYYG
DPOL_ADEG1/238-751.EPPKKKGRTKKKKQPSPDYVAEVYAP--------------------------------------H.RPMFKYIRQALRG
DPOM_NEUIN/400-868..................LVEDMIPNI--------------------------------------K.SKLHNIIKLSYFG
DPOL_ADE12/306-791.............KPQRTHLGPNILAP--------------------------------------S.HELYDYVRASIRG
DPOL_BPM2/50-485..................KLSLPMDKE--------------------------------------I.RKAYRGGFTWLND
O78938_AGRAE/66-524..................LKENEVHML--------------------------------------S.GSIATNIRKSYTG
DPOL_ADE02/300-785.............QPARSNLGPDLLAP--------------------------------------S.HELYDYVRASIRG
DPOM_CLAPU/431-902.................DDKNKAIPLV--------------------------------------KDIDLFNDIHEAYYG
Q9XNK1_PLEOS/737-1218.................DSIKKPIFLT--------------------------------------T.GKIDNYIRNAYYG
O99973_PORPU/80-490..................LKTHKIEVP--------------------------------------K.TYYDKFIRKAYYG
DPOM_NEUCS/366-859......ILSLFDKKEEKKLTPKYFLPK--------------------------------------LKGRLERAVRAAYFG
Q83895_ADEO7/318-798.............DHPSEFLRN.LEAP--------------------------------------S.EKMYDFVRMSLRG
DPOL_ADECT/391-876.............KPNTHHLSTILMAP--------------------------------------S.NEMYEYVRLSIRG
DPOL_BPPZA/50-485..................TLSLGLDKE--------------------------------------V.RYAYRGGFTWLND
DPOM_MAIZE/299-733................KDDDDNWIYIP--------------------------------------D.DNEAQFIREGYYG
O11414_9ADEN/323-802.............KGQTEHLPG.LQAP--------------------------------------S.EKMYDHIRKSVRG
DPOM_ASCIM/588-1048..................LPENKIPNI--------------------------------------TCTKLHYILKQAYTG
DPOM_PODAS/449-902..................LGDNLIPVV--------------------------------------LNNSLFTSIKAAYYG
Q9WF13_ADE17/335-820.............QPQRTNFGPGLLGP--------------------------------------S.HELYEYVRASIRG
Q9TEH5_9PEZI/309-758..................IKDSKLSMV--------------------------------------K..GVAHEIWEAYYG
DPO2_KLULA/409-873..................PKYVKLYVP--------------------------------------T.LEEYSKIRNAIYG
Q35599_PHYPO/7-446.................PEKYRLIPHL--------------------------------------T.RDEDNYIRKSYIG
Q9YUR6_9ADEN/338-828..............GTKASTLPDIVAP--------------------------------------S.DEMYSFIRQSVRG
Q09038_LACKL/414-878..................DRNIELYVP--------------------------------------T.SEEYQFIRNSIYG
DPOL_BPCP1/56-488.................PILDEKVDDF--------------------------------------C.RKHIVGAGRLPTL
DPOL_ADE04/437-922.............KPSRANLGAGLLAP--------------------------------------S.HELYDYVRATIRG
Q9QM79_9ADEN/238-780RASANKNTKKRKKRLPSPEYVAEIYAP--------------------------------------H.RPMFKYIRQALRG
DPO1_KLULA/415-878..................PFDVELRHP--------------------------------------N.KEDYFNMREALIG
DPOL_ADE40/433-918.............KPQRSDLGGSLLAP--------------------------------------S.HEMYDYVRASIRG
O21376_PICKL/474-939.................HDETKKMPLM--------------------------------------SSTMDDTFMRKALFG
Q96206_BPGA1/50-490..................VLSLKVNSE--------------------------------------I.RKAYKGGFTWVNP
DPOL_ADEB3/262-744.............RPNRSSLGNFLLAP--------------------------------------S.NEMYDYVRESIRG
O74719_DEBHN/418-882..................DPNIDLRHP--------------------------------------K.KEDYMNMKDSLIG

PF03337

Q1HTT9_9POXV/3-657----------------DVNDPAALISAFLEWLRGAMVGDVR....................NATLVGYMNGLLDLPLLRE
Q3I8X2_MONPV/3-635----------------NFNSVKDLILDFLDWIKD.IMTSTR....................TIILVGYMSNLFDIPLLTV
Q8V3R9_SWPV1/2-644----------------NFDSNK.LLSEFFKWLREDIMNNIT....................TIILAGYFSSLFDFELLKA
Q070L3_CPRV/15-686----------------DSSCGKRVTEFLLECLAERFDAEDRRREEDGDDEPETGGAAAGGDTVILAGYHSSFFDAPLLRR
Q08FW7_DPV83/4-651----------------DFDSKK.LISEFLKWVRE.TMNNVS....................TIAMVGYLSSIFDFSLLRA
Q6TUY6_YMTV5/6-640----------------NFDSNK.LIITFLGWITE.NMKDVN....................TIALIGFFSSVFDIPLLKA
Q2F8G6_ORFV/3-635----------------SGDCAKLVVRDFLMWLTTCKE........................NITVYGFYSSLFDT...RQ
Q9Q8S1_MYXVL/3-624----------------SFDPKK.LVMDFLRWIRE.SMVNTS....................TVVIIGYLSSVFDFPLLKS
Q6TVH8_9POXV/3-637----------------RGPSARMVVRELLMWLATCKE........................HMTVYGFYSSFFDS...RQ
Q98188_MCV1/3-654----------------DADSGTGVIADFLHWLLSVFTEQER....................RLYLVGFLSSCYDLPLLRA
A7XCD4_9POXV/6-641----------------NFNSSE.LVSTFLNWIVE.NMKGIN....................TIALVGFFSSVFDIPLLKA

PF00136

DPOD_YEAST/555-991DTD---SVMVKF----GTTDL....................-..KEAMDLGTEAAKYVS.TL........FKHPINLEFE
DPOL_GPCMV/556-1073DTD---SVFVIC----GGVKC....................-..GSVLEHGEAIAGHITRAL........FREPIKLEFE
DPOL2_AERPE/390-793DTD---SLFVKN----D........................-.....PEKVERLIRFVEEEL........G...FDIKVD
O40910_HHV8/533-1006DTD---SLFICC----MGFNM....................-..DSVSDFAEELASITTNTL........FRSPIKLEAE
DPOL1_SULSO/450-869DTD---SLFLLN----P........................-....PKNSLENIIKWVKTT..........FN.LDLEVD
Q89604_9ALPH/639-1203DTD---SVFVKF----AGMPY....................-..DAVCALGDGMARRVSAAL........FRPPIKLECE
Q9YQZ6_9VIRU/602-1028DTD---SVMFDL----P........................-..CDARCYEPDIVPVVESEM.........QP.LFGSYE
Q9WSY3_9ALPH/582-1139DTD---SVFIKF----KGVAI....................-..QGLVANGDDMAKRISSDL........FPKPIKLECE
DPOL_ARCFU/361-774DTD---SIFVTK----AG.......................-.M..TKEDVDRLIDKLHEEL........P...IQIEVD
DPOL_RCMVM/533-1077DTD---SVFVGF----RGIGR....................-..EVLVKVAGKLAAAVTRDL........FRDPVRLEFE
Q9YW56_MSEPV/569-1067DTD---SVFIIV----HFKNKSLN...............DT-YMLRLCKDIGIFISNTISNTG......IFPKLFNLEFG
DPOL_ASFL6/457-978DTD---SLYITC----PDSLYTEVTDAYLNS.QKTTKHYEQ-LCHEKVLLSMKAMSTLCAEVNEYLRQDNGTSYLRMAYE
DPOD1_CAEEL/520-978DTD---SVMVKF----GVETV....................-..AQAMEIGLDAAKEVS.KI........FTPPIKLEFE
DPOL_FOWPN/483-977DTD---SIFSEI----STKDI....................-..EKTAKIAKHLEHIINTKI........LHANFKIEFE
DPOL_HHV21/617-1200DTD---SIFVLC----RGLTG....................-..EALVAMGDKMASHISRAL........FLPPIKLECE
Q9Q6Z6_9GAMA/520-997DTD---SLFINC----PKYNI....................-..DQIVLFGDELAQYITERL........FVSPIKLESE
Q59691_PYROC/388-793DTD---SLFVVY----D........................-.....KEKVEKLIEFVEKEL........G...FEIKID
O36638_9PHYC/422-974DTD---SVMCTF----PAPQTVRGQ.............GKR-ALLGHAYAMGLSAEEKSLSL........FGHPVKLEYE
DPOL_IIV6/578-1226DTD---SNYVTF----DDVVDKNVKV............GTE-EFSREMKKLWNHAIEIAKTIS.....KKFDNPITLEFE
Q69281_9ALPH/606-1168DTD---SVFIKF----KGVDI....................-..HGLVTTGDDMAKRVSSDL........FPKPIKLECE
DPOL_EHV1B/611-1173DTD---SVFIKF----VGLTY....................-..EGVSELGDAMSRQISADL........FRAPIKLECE
DPOL_MUHVS/543-1050DTD---SVFAAF----YGIDK....................-..EALLKAVGALAANVTNAL........FKEPVRLEFE
DPOD1_MESAU/546-1005DTD---SVMCRF----GVSSV....................-..AEAMSLGREAANWVS.SH........FPSPIRLEFE
DPOLA_ORYSJ/834-1303DTD---SIMIHT----GLDDI....................-..SRAKGIAGKVIQEVNKK..........YRCLEIDLD
DPOL_RSIV/397-938DTD---SCYIQL----GHDRA....................-.SLDELWQMAVNASDTVSAF........FERPVRLEFE
DPOL1_SULAC/448-867DTD---SLFLYN----P........................-....TKDKLEELIKFVKQN..........FN.LDLEVD
Q9Y1T1_TOXGO/1006-1612DTD---SIMINT----GLHDDGGE................G-KTYAAAVRLGEQVKA.EINK........SYKKLEIDLE
DPOL1_SULOH/448-867DTD---SMFLWN----P........................-....SKEKLEEIIKFVKGK..........FG.LDLEVD
DPOL_BPT4/383-855DTD---SVYVCV----DK...V...................-IEKVGLDRFKEQNDLVEFMN........QFGKKKMEPM
Q98207_MCV1/494-994DTD---SIFLEL----NLREV....................-..QTTLAVARTLERVLNEHV........LFENFRVEFE
DPOLA_OXYNO/783-1270DTD---SIMINT----GSNQ.....................-..LQQALEMGKRLKG.EVNC........LYKCLEIEID
DPOL_EHV2/530-1004DTD---SLFIHC----RGYRP....................-..EQVTGFCDELAAHMTRTL........FVDPIKLEAE
DPOL_ORFN2/499-998DTD---SVFLEV----GASDI....................-..AFSRRVGRCLERVINEHV........LFANFKVEFE
DPOLA_DROME/805-1258DTD---SLMINT----NITDY....................-..DQVYKIGHNIKQSVN.KL.........YKQLELDID
DPOD1_PLAFK/544-1000DTD---SVMVKF----GTNNI....................-..EEAMTLGKDAAERIS.KE........FLSPIKLEFE
DPOL_VZVD/597-1136DTD---SVFIRF----KGVSV....................-..EGIAKIGEKMAHIISTAL........FCPPIKLECE
O41930_MHV68/528-1001DTD---SLFVET----QGYTL....................-..EEVVEFGEMLADNTTKAL........FVQPIKLEAE
DPOL_TUHV2/556-1135DTD---SVFVRF----GGVRA....................-..GAIVARGEDLAAAVTEAL........FTEPVKLEFE
DPOD1_DROME/534-994DTD---SVMVNF----GVKTL....................-..ERSMELGREAAELVS.SK........FVHPIKLEFE
DPOL_THEGO/348-763DTD---GFFA..----.....TIP...............GA-DAETVKKKAKEFLDYINAKL........PGL.LELEYE
Q9WT26_HHV6H/517-998DTD---SIFMSV----RNMAN....................-..ESLRRIAPMIAKHITDRL........FKSPIKLEFE
DPOL_EBVB9/532-1013DTD---SLFIEC----RGFSE....................-..SETLRFADALAAHTTRSL........FVAPISLEAE
DPOD_CANAX/484-939DTD---SVMVKF----GYQDL....................-..ETCMKLGEEAANYVS.TK........FKNPIKLEFE
DPOLA_TRYBB/684-1157DTD---SVMIQT----GIKDD....................-.IVKVRNLGFEIKGKVNQR..........YQSLELDID
DPOL_BPR69/386-859DTD---SIYVSA----DK...I...................-IDKVGESKFRDTNHWVDFLD........KFARERMEPA
DPOA_YEAST/792-1248DTD---SVMIDT----GCDN.....................-..YADAIKIGLGFKR.LVNE........RYRLLEIDID
DPOL_SFAVA/492-1090DTD---SMYVQL----QDDPAS...................-.NQDPWTYVRELATHITSKL.........REPMVIEAE
DPOL_VACCA/497-995DTD---SVFTEI----DSQDV....................-..DKSIEIAKELERLINNRV........LFNNFKIEFE
O74046_CENSY/420-835DTD---SLFIKN----P........................-....EERQIHDIVEHAKKE..........HG.VELEVD
Q9Q8R2_MYXVL/498-996DTD---SVFLEI----NTNDV....................-..LTSIKIAKELERVINTKV........LFDNFKIEFE
O93043_FHV1/606-1159DTD---SVFIKF----RGFTY....................-..DGVTRLGDLMAKQISQAL........FRAPIKLECE
DPOD_SCHPO/534-990DTD---SVMVKF----GVKTL....................-..PEAMKLGEEAANYVS.DQ........FPNPIKLEFE
DPOLA_OXYTR/809-1299DTD---SIMINT----GTNQ.....................-..LQQSLEMGKRPQGLKLIA........LYKCLEIEID
Q9QEL0_9ALPH/621-1171DTD---SVFVLC----RGLNA....................-..EGLTALGDRMATHVSRAL........FLPPIKLECE
DPOL_METVO/393-818DTD---GFYAKW----DYDKLQKGKKEENDKSDKLSNLPKL-SKEELIILTKKFLKGINEEL........PEG.MELEFE
O92827_9BETA/515-999DTD---SLFVTF----KNVCP....................-..KALKRIAPSIASHITNTL........FKHPIKLEFE
DPOZ_YEAST/919-1384DTD---SLFVYL----PGKTA....................-..IEAFSIGHAMAERVT.QN........NPKPIFLKFE
DPOL1_AERPE/535-951DTD---SLFIWD----P........................-....PKDVLNDLVDYVERT..........YG.LELELD
DPOLA_HUMAN/783-1246DTD---SIMINT----NSTNL....................-..EEVFKLGNKVKSEVN.KL.........YKLLEIDID
Q69390_9ALPH/516-1008DTD---SVFIRF----SGIAY....................-..DDVCELGELMAARITRDL........FRPPIKLECE
DPOL_RHCM6/533-1017DTD---SVFVCY----RGVTA....................-..AALIERGPSLAHYITQCL........FVDPIKLEFE
DPOL_PBCVN/432-881DTD---SVMIRM----KLPDDKI.................H-DMDEQFKMAKWLAGEITKD.........FKAPNDLEFE
DPOL_ALHV1/550-1026DTD---SLFIKC----EGFAM....................-..DTVIKFGDALASHTSSVL........FASPIKLESE
Q59690_PYROC/488-905DTD---SLFIWN----P........................-....DEDKLRELQEYVEKN..........FG.LDLEVD
DPOD1_SOYBN/511-969DTD---SVMVQF----GVSAV....................-..EEAMNLGREAAEHIS.GT........FTKPIKLEFE
DPOL_SHV21/522-994DTD---SLFVEC----VGYSV....................-..DTVVKFGDFLAAFTSEKL........FNAPIKLESE
DPOA_SCHPO/773-1222DTD---SVMLNT----NVTD.....................-..KNHALRIGNEFKE.KVNE........RYSKLEIDID

PF08490

Q7Q7P3_ANOGA/1540-1943DNI...SVVQNR----SGF-------------------------YRSVCVELTVESLAVSAL--------LQASKVQELE
DPOE_CRYNJ/1526-1917DLV...SPHISN----RGC-------------------------YSSTVLEMEVSDLAINAV--------LQSALVNEME
DPOE_DEBHA/1533-1917NLE...FPTINN----PEI-------------------------YETACLEVEIGTLTINTI--------LTSALINEAE
Q7RWE3_NEUCR/1533-1926QVQ...MPSVNN----PGT-------------------------YASVCIDLEVRNLAINTI--------LTSSLINELE
DPOE_ASHGO/1492-1878DLT...SPVINN----PEF-------------------------YDSAVLEIEVNNLLVNTI--------LTSTLINEAE
DPOE_EMENI/1495-1885RVG...MPCVNV----PGS-------------------------YTTVCVELEVRNLAINTI--------LTSSIINEAE
Q6K777_ORYSJ/1562-1941EVI...QPALTY----PGA-------------------------YRRVAVELKIHHLAVNSL--------LKSSQVDEME
DPOE_YEAST/1527-1920DSE...FPKINN----SGV-------------------------YDNVVLDVGVDNLTVNTI--------LTSALINDAE
DPOE1_HUMAN/1525-1925DQA...TVEINS----SGC-------------------------YSTVCVELDLQNLAVNTI--------LQSHHVNDME
DPOE_SCHPO/1497-1886PLE......VNN----PGA-------------------------YSNACVDISLSNLALCSI--------LNSALINDIE
DPOE_KLULA/1497-1883DLV...FPIMNN----PDI-------------------------YDDVIFEISVYNSVVNTV--------LSSTMLNEAE
DPOE_YARLI/1513-1873QAE...VPVANN----PGL-------------------------YTNICFEIKIEHLVLNAL--------LQSAVIQDTE
DPOE_CANGA/1524-1916DLD...FPNINV----PDV-------------------------YDNVVLEVSIENLVVNTI--------LCSTLINEAE
Q95R46_DROME/3-405ESI...SVVQNK----AGF-------------------------YPDVCVELALDSLAVSAL--------LQSTRIQEME
Q59SM7_CANAL/1518-1902SLA...FPTINN----PEI-------------------------YETACLEVEIGTLTINTI--------LTSALINEAE
O62218_CAEEL/1467-1869PLSIDDTVLLNR----ETF-------------------------CETACVELQLSAVAVTAL--------VQRSRVLEAE
Q9ZVC8_ARATH/1484-1864ELQ...ETSLLF----PGA-------------------------YRKVSVELKVHRLAVNAL--------LKSDLVSEME

PF03175

DPOL_ADEB2/267-751GRC---YPTYIG----IME...QPIYV-----------------YDICGMYASALT.HPFPS--------GQPLNPYE.R
DPOL_BPPRD/1-440GRC---QAFEKG----IIE..D.DIKV-----------------YDVNSMYPHAMRNFRHPF--------SDEFYEAN..
Q39432_BETVU/147-571GHA---DAYIPK----GTN.....LYY-----------------YDVNSLYPFIMKEYPMPS--------GKPVWASN.L
DPOL_ADEG1/238-751GRC---YPNVLG----PYL...KPVYV-----------------FDICGMYASALT.HPMPH--------GMPLDPKF.T
DPOM_NEUIN/400-868GIC---ELYKPF----GVN.....IKS-----------------YDVNSLYPFAMKYFKMPS--------GIPKYVKG.T
DPOL_ADE12/306-791GRC---YPTYIG----VLK...EPIYV-----------------YDICGMYASALT.HPMPW--------GPPLNPYE.R
DPOL_BPM2/50-485KYK---.EKEIG----EG......MVF-----------------DVN.SLYPSQMYSRPLPY--------GAPIVFQG.K
O78938_AGRAE/66-524GSV---DMYIPL----IEK..DSKIFI-----------------YDINSLYPFSMKSFKFPI--------GNPTFFKG.D
DPOL_ADE02/300-785GRC---YPTYLG----ILR...EPLYV-----------------YDICGMYASALT.HPMPW--------GPPLNPYE.R
DPOM_CLAPU/431-902GRV---EVFNPI----IMADSTKSYYY-----------------YDVNSLYPFASINDIPGL--------KCTFYEVV.K
Q9XNK1_PLEOS/737-1218GIV---DSWTFY----SEK....PLFK-----------------YDFKSHYPNQMRNNPMPG--------GLPIFST...
O99973_PORPU/80-490GRC---EVYKPT----NDS...NKIFH-----------------YDFNSHYPSSML.NKIPT--------KISGWKS..P
DPOM_NEUCS/366-859GRN---EIFIPI----INN.....IFS-----------------FDFNSLYPTAMM.MPMPV--------GIPVHTF...
Q83895_ADEO7/318-798GRC---YPSFLG----IFE...EAIYV-----------------YDICGMYASALT.HPLPY--------GKTLNAFE.A
DPOL_ADECT/391-876GRC---YPTYIG----VLQ...EPVFV-----------------YDICGMYASALT.HPFPA--------GSPLNPYE.R
DPOL_BPPZA/50-485RFK---.EKEIG----EG......MVF-----------------DVN.SLYPAQMYSRLLPY--------GEPIVFEG.K
DPOM_MAIZE/299-733GHT---DVYKPY----GEN.....LYY-----------------YDVNSLYPSSML.DDMPI--------GKTRWVSD.L
O11414_9ADEN/323-802GRC---YPSYLG----VYE...GPIYV-----------------YDICGMYASALT.HPMPF--------GRTEDPLT.A
DPOM_ASCIM/588-1048GYC---DVFKPE----GKN.....IHS-----------------YDINSLYPSAMAKFDMPT--------GTPLHILG.D
DPOM_PODAS/449-902GVA---EVYRPY----GKN.....LRY-----------------YDVNSLYPFVAK.NTMPG--------HECKYIES.K
Q9WF13_ADE17/335-820GRC---YPTNIG----IFS...EPIYV-----------------YDICGMYASALT.HPMPW--------GPPLNPYE.R
Q9TEH5_9PEZI/309-758GRC---EVSYPC----IKT......KS-----------------YDCNSIYPYCML.KDMPV--------ENLFEVTI.I
DPO2_KLULA/409-873GRV---.ISKNG----IYE...ENIVY-----------------ADVVSLYPSAMKLLKHSY--------GKPKLVD..Y
Q35599_PHYPO/7-446GRN---EIFEHV----AQR.....NYF-----------------YDVNSLYPYIMKKEKMPI--------GIPEYRDK.E
Q9YUR6_9ADEN/338-828GRC---YPTHLG----IFK...EKIFV-----------------YDICGMYASALT.HPMPY--------GFPIGEKE.R
Q09038_LACKL/414-878GRV---.AAKNG----TYN...EEIVY-----------------ADVVSLYPSAMKLLEHSY--------GKPSKVF..S
DPOL_BPCP1/56-488KHR---.GRTLN----QL......IDI-----------------YDINSMYPATMLQNALPI--------GIPKRYKG.K
DPOL_ADE04/437-922GRC---YPTYIG----ILD...EPLYV-----------------YDICGMYASALT.HPMPW--------GTPLSPYE.R
Q9QM79_9ADEN/238-780GRC---YPSVLG----PYR...HPVYV-----------------FDICGMYASALT.HPMPH--------GMPLDPKF.T
DPO1_KLULA/415-878GRC---.ISVNG----IY....KDVLC-----------------LDVKSLYPASMAFYDQPY--------GSFKRVS..S
DPOL_ADE40/433-918GRC---YPTYIG----VLR...EPLYV-----------------YDICGMYASALT.HPMPW--------GFPLNPYE.R
O21376_PICKL/474-939GYN---NVINPM----ADE.....AYY-----------------YDVNSFYPAVAVKYRYPT--------TKGFDMSYPE
Q96206_BPGA1/50-490KYQ---.GETVY----GG......MVF-----------------DVN.SMYPAMMKNKLLPY--------GEPVMFKG.E
DPOL_ADEB3/262-744GRC---YPTYIG----VLT...EAIYV-----------------YDICGMYASALT.HPFPA--------GKPLNPFD.R
O74719_DEBHN/418-882GRC---.ISVNG----IY....ENILC-----------------LDVKSLYPAAMAFYDQPY--------GQFRRVQ..Q

PF03337

Q1HTT9_9POXV/3-657FLPPA.SGWDLC....GATTLLSHDGLRADFVDLSRYALGQPHLRKHCEYWTGAGRDFPPD..LAAESHVKSRIPTLMGA
Q3I8X2_MONPV/3-635YWPNN.CGWKIY.....NNTLISSDGARVIWMDAYKFSCGL.SLQDYCYHWGSKPESRPFD..LIKKSDAKRNTKSLVKE
Q8V3R9_SWPV1/2-644SMSPH.MGWSFI....ENDYMVSQDGLKIILMDFANFSFKL.TLEEYCQYWNKNNAYNIKD..LITKQEAKIKIKLLEKS
Q070L3_CPRV/15-686RASDG..RWVAAVGDDAGPTLIYRGRHRVLVRDLGLFNPSF.SPDAFVRCWARAERGRLDDRYLRTRADLERYRDQILAY
Q08FW7_DPV83/4-651SWPED.SGWTFI....GYNNIVSKDGLKILLLDVANFSCGM.TLKEYCNHWERVIITPPKD..LITKHEAKLKIKLIERC
Q6TUY6_YMTV5/6-640SWNNS.HGWNFV....GDEYIISNNGLKVYLIDALNFSYNC.SVSDYVSSWTTSNVELNKD..FIFEQEARLTIKRLKKV
Q2F8G6_ORFV/3-635VMELAGKGWTRI....SENTLLSRLGNRVAFVDLARFAPAT.LFSEYCEFWGGVCVDVPED..VVSADE...SAAAAEEA
Q9Q8S1_MYXVL/3-624SWPKD.SGWFFV....GNNHIVSSDGMKLVLIDAAKFVRDM.STMDYLQHWKSRAVSIQGD..MITNEEARTKLKVLEKN
Q6TVH8_9POXV/3-637VFALAGKGWTRL....SENTLLSKLGNRVTFVDLARFAPGT.LFSEYCEFWGGACVEVPED..IVPDDE...NPAVAEDA
Q98188_MCV1/3-654YWPRADTGWRLL.....GHALVYRCRYTAVLLDAAPYAHGL.CLREYCEHWAGASPRLPSE..MESRADVLRRASASTEA
A7XCD4_9POXV/6-641SWPNN.SGWNFI....GNEYIVSDNGLKVHLIDALKFSCNN.SVSDYVNNWTSNNITLNKD..FISKQEAKIMSKIFEKN

PF00136

DPOD_YEAST/555-991KAYFPYLLIN.KKRYAGLFWTNPDKF.......DKLDQKGLASVR---RDSCSLVSIVMNKVLKKILIERNVDGA.....
DPOL_GPCMV/556-1073KVFVNLMMIC.KKRYVGRIYG.........Q..TKLSMKGIELVR---KTACEYVKSTVRNVLNMIFFEDDVSAG.....
DPOL2_AERPE/390-793KVYRRVFFTEAKKRYVGLTVD............GKIDVVGFEAVR---GDWSELAKETQFKVAEIVLKTGSVDEA.....
O40910_HHV8/533-1006KIFKCLLLLT.KKRYVGVLS..........D..DKVLMKGVDLIR---KTACRFVQEKSSQVLDLILREPSVKAA.....
DPOL1_SULSO/450-869KTYKFVAFSGLKKNYFGVYQD............GKVDIKGMLVKK---RNTPEFVKKVFNEVKELMISINSPNDV.....
Q89604_9ALPH/639-1203KTFAKLLLIT.KKKYLGLVG..........G..GKMLMKGVDLVR---KNNCRFINAYTRRLVDVLMHDDAVSRA.....
Q9YQZ6_9VIRU/602-1028GGATAEEWLCGAEAHVQDALG................KRATAAVP---GILTRLHTVLLDDFITHLRYVVPENGS.....
Q9WSY3_9ALPH/582-1139KTFDKLLLIT.KKKYMGTIH..........G..GRMLMKGVDIVR---KNNCRFINTYAKKLSDLLFQDDAVAKA.....
DPOL_ARCFU/361-774EYYSAIFFVE.KKRYAGLTEDGRLVV............KGLEVRR---GDWCELAKKVQREVIEVILKEKNPE.......
DPOL_RCMVM/533-1077KMFVSLMMIC.KKRYIGKVYG.........E..NKLCMKGVDLVR---RHACAFVRSIVSEVVDVIFHDEAVSEG.....
Q9YW56_MSEPV/569-1067GVKKWMLFIE.KKKYISYDIINYDTL....E..AKIESKGTSLIK---RDYSNFHKHHYKTIIEIIQKSIENKNN.....
DPOL_ASFL6/457-978EVLFPVCFTG.KKKYYGIAHVNTPNF....N.TKELFIRGIDIIK---QGQTKLTKTIGTRIMEESMKLRRPEDH.....
DPOD1_CAEEL/520-978KVYSPYLLIN.KKRYAGLYFT.KPDV....H..DKMDCKGLETVR---RDNCPLVAKVLGVCLEKLLIERDQQSA.....
DPOL_FOWPN/483-977AIYTQLILQS.KKKYTTIKYLANYKPG..DK..PIRVNKGTSETR---RDVALFHKHMIQRYKDMLMKLLMESKG.....
DPOL_HHV21/617-1200KTFTKLLLIA.KKKYIGVIC..........G..GKMLIKGVDLVR---KNNCAFINRTSRALVDLLFYDDTVSGA.....
Q9Q6Z6_9GAMA/520-997KVFGCLLLLT.KKRYIGTLS..........S..GKILMKGVDLVR---KTACTYVQETCRAVLHLVLNDNTVKEA.....
Q59691_PYROC/388-793KIYKKVFFTEAKKRYVGLLEDGRIDI............VGFEAVR---GDWCELAKEVQEKAAEIVLNTGNVD.......
O36638_9PHYC/422-974KIYFPFLLIS.KKRYACMSYDRPDSE.......PKMSTSGLVTVR---RDNAKVVRDCANGVISILMEGRGQGDVVEYVK
DPOL_IIV6/578-1226NAIYFKFLILTKKRYMYYTCGKDGNILMDANGKPKMGQRGVILSR---RDNCKYMKDVYANVIDKIFDEQSENEILN..G
Q69281_9ALPH/606-1168KTFNKLLLIT.KKKYMGTIH..........G..GRMLMKGVDIVR---KNNCRFINTYAKKLSDLLFLDDTVAKA.....
DPOL_EHV1B/611-1173KTFQRLLLIT.KKKYIGVIN..........G..GKMLMKGVDLVR---KNNCSFINLYARHLVDLLLYDEDVATA.....
DPOL_MUHVS/543-1050KMFVSLMMIC.KKRYIGKVHG.........S..QNLSMKGVDLVR---RTACGFVKAVVSDVLHMVFNDETVSEG.....
DPOD1_MESAU/546-1005KVYFPYLLIS.KKRYAGLLFSSQPDT....H..DRMDCKGLEAVR---RDNCPLVANLVTSSLRRILVDRDPDGA.....
DPOLA_ORYSJ/834-1303GIYKRMLLLK.KKKYAAIKVALDGSL....R..ENIERKGLDMVR---RDWSLLSKEIGDFCLNQILSGGSCDDV.....
DPOL_RSIV/397-938QCIYTKFIIFTKKRYVYRAFTRDGKQ........RTGSKGVMLSR---RDSAMCARNTYAAIMSAILEGSADVPFIAVRM
DPOL1_SULAC/448-867KSYKYVAFSGLKKNYFGVYPD............GKTEIKGMLAKK---RNTPEFIKKEFAEIKNMLASLNSPNDI.....
Q9Y1T1_TOXGO/1006-1612GVFRRLLLLK.KKKYVCCIVVDYAKR....Q..YKLEQKGLDIVR---RDWAKLTKVVGNQLLQIIFRIAQKDAAXAPVS
DPOL1_SULOH/448-867KVYKFVAFSGLKKNYLGVYPDGKTDI............KGMLAKK---RNTPEFIKKEFNEVKQLVTTINSPDDI.....
DPOL_BPT4/383-855IDVAYRELCDYMNNREHLMHMDREAI............SCPPLGS---KGVGGFWKAKKRYALNVYDMEDKRFAE.....
Q98207_MCV1/494-994AIYQNLILQS.KKKYSTTKYAADHRAGD.AP...EHVSKGTSETR---RDVSRFHKLMISRYKAQLVALLAEAR......
DPOLA_OXYNO/783-1270GVFKSLLLLK.KKKYAALKYENFLSPAE.VK..VVQEMKGLDMVR---RDWCPLSKRVGRYVLDQILSGKQREEV.....
DPOL_EHV2/530-1004KTFKCLILLT.KKRYIGMMT..........T..DRLLMKGVDLVR---KTACRFVQETTKAILDLVMGDEAVRAA.....
DPOL_ORFN2/499-998AVYCNLIMQS.KKKYTTIKFAVSDGGG..SE....RVSKGTSETR---RDVAPFHKLMIRKYKDMLCRALAE........
DPOLA_DROME/805-1258GVFGCLLLLK.KKKYAAIKLSKDSKGNL.RR...EQEHKGLDIVR---RDWSQLAVMVGKAVLDEVLSEKPLEEK.....
DPOD1_PLAFK/544-1000KVYCPYLLLN.KKRYAGLLYT.NPNK....H..DKMDCKGIETVR---RDFCILIQQMMETVLNKLLIEKNLNSA.....
DPOL_VZVD/597-1136KTFIKLLLIT.KKKYIGVIY..........G..GKVLMKGVDLVR---KNNCQFINDYARKLVELLLYDDTVSRA.....
O41930_MHV68/528-1001KTFKSLLMIT.KKRYVGTLS..........N..NKLLLKGVDLVR---KTACKFVQSATSNVVSLILNDNDVRAA.....
DPOL_TUHV2/556-1135KLFVALMMIC.KKRYIGRVFG.........S..DALVMKGVDLVR---KTACRFVKTVVRDVVELVFRDAAVAEA.....
DPOD1_DROME/534-994KVYYPYLLIN.KKRYAGLYFT.RPDT....Y..DKMDCKGIETVR---RDNSPLVANLMNSCLQKLLIERDPDGA.....
DPOL_THEGO/348-763GFYKRGFFVT.KKKYAVIDEEDKITT............RGLEIVR---RDWSEIAKETQARVLEAILKHGDVE.......
Q9WT26_HHV6H/517-998KILCPLILIC.KKRYIGRQD..........D..SLLIFKGVDLVR---KTSCDFVKGVVKDIVDLLFFDEEVQTA.....
DPOL_EBVB9/532-1013KTFSCLMLIT.KKRYVGVLT..........D..GKTLMKGVELVR---KTACKFVQTRCRRVLDLVLADARVKEA.....
DPOD_CANAX/484-939KVYFPYLLIN.KKRYAGLYWT.RPEK....F..DKMDTKGIETVR---RDNCRLVQNVITKVLEFILEERDVPKA.....
DPOLA_TRYBB/684-1157GVFRAMLLLR.KKKYAALSVVDWQGEG..KV..YKREVKGLDMVR---RDWCPLSQHVSDAVLKRILNAEGGEDI.....
DPOL_BPR69/386-859IDRGFREMCEYMNNKQHLMFMDREAI............AGPPLGS---KGIGGFWTGKKRYALNVWDMEGTRYAE.....
DPOA_YEAST/792-1248NVFKKLLLHA.KKKYAALTVNLDKNGN..GT..TVLEVKGLDMKR---REFCPLSRDVSIHVLNTILSDKDPEEA.....
DPOL_SFAVA/492-1090DDIHAKVLFLGKKCYIGRKLFRDGSVA...R...DLDWHVVITVR---RDHSEYVKSAYKPPVYKVFADCTHDQFVTSIA
DPOL_VACCA/497-995AVYKNLIMQS.KKKYTTMKYSASSNSKS.VP...ERINKGTSETR---RDVSKFHKNMIKTYKTRLSEMLSEGR......
O74046_CENSY/420-835KEYRYVVLSNRKKNYFGVTKSGKVDV............KGLTGKK---SHTPPFIKELFYSLLDILSAVQTEDEF.....
Q9Q8R2_MYXVL/498-996AVYKNLIMQS.KKKYTTLKYVPSSTQNS.IP...VRINKGTSETR---RDVSKFHKYMIKIYKTRILEMLSDGT......
O93043_FHV1/606-1159KTFCKLILIT.KKKYIGVIN..........G..GKMLMKGVDLVR---KNNCNFINTYARRLVDILLYNDTVSEA.....
DPOD_SCHPO/534-990KVYFPYLLIS.KKRYAGLFWTRTDTY.......DKMDSKGIETVR---RDNCPLVSYVIDTALRKMLIDQDVEGA.....
DPOLA_OXYTR/809-1299GVFKSLLLLK.KKKYAALKYEGFGTPD..AK..VVQEVKGLDMVR---RDWCPLSKNVGNFVLNQILSGKQREDV.....
Q9QEL0_9ALPH/621-1171KTFSKLLMIA.KKKYIGVIC..........G..GGMLIKGVDLAR---KNNCVFINRTSRVLVDLLFNDDHVSRS.....
DPOL_METVO/393-818GHFKRGLFVT.KKKYALIEDDGHIVV............KGLEVVR---RDWSNIAKDTQQAVIRALLEDGDVN.......
O92827_9BETA/515-999KILFPLILIC.KKRYIGKLD..........D..ATLVFKGVELVR---KTSCDFVKVVVKDIIDLLFWDVDVQKS.....
DPOZ_YEAST/919-1384KVYHPSILIS.KKRYVGFSYESPSQT....L..PIFDAKGIETVR---RDGIPAQQKIIEKCIRLLFQTKDLSKI.....
DPOL1_AERPE/535-951KVFRAILFSGLKKNYLGITEEGDIVI............KGMVAKK---SNTPEFIKDEFSKAVKILSKLEKPEDV.....
DPOLA_HUMAN/783-1246GVFKSLLLLK.KKKYAALVVEPTSDGNY.VT...KQELKGLDIVR---RDWCDLAKDTGNFVIGQILSDQSRDTI.....
Q69390_9ALPH/516-1008KTFRRLLLIT.KKKYIGVIN..........G..GKMLMKGVDLVR---KNNCAFINAYARRLVDLLFGDEAVSAA.....
DPOL_RHCM6/533-1017KVFGSLMMIC.KKRYIGKIVG.........E..TELSMKGVDLVR---KTSCEFVKNVTRDIIQLLFDDPEVSRA.....
DPOL_PBCVN/432-881KIYYPYILYS.KKRYAAIKFEDPDEK....G...KVDVKGLALVR---RDFSPITREILKESLDTILFKKDTPTA.....
DPOL_ALHV1/550-1026KVFKCLMLLT.KKRYVGILS..........N..NKILMKGVDLVR---KTACVYVQEVTRAVLELLLRDEEVKVA.....
Q59690_PYROC/488-905KVYKFVTFSGLKKNYIGAYEDGSIDV............KGMVAKK---RNTPEFLKKEFSEMLAVIGSVKSPEDF.....
DPOD1_SOYBN/511-969KVYYPYLLIS.KKRYAGLFWT.KPDN....F..DKMDTKGIETVR---RDNCLLVKNLVNDCLHKILIDRDIPGA.....
DPOL_SHV21/522-994KTFQCLLLLA.KKRYIGILS..........N..DKLLMKGVDLVR---KTACKFVQNTSSKILNLILKDPEVKAA.....
DPOA_SCHPO/773-1222NVYQRMLLHA.KKKYAALQLDSQGKP....N....LDVKGLDMKR---REFCTLAKEASKFCLDQILSGELTETV.....

PF08490

Q7Q7P3_ANOGA/1540-1943GTSSA.ITFD----------VMPQASLEEMITSGPNGQQLSNYDE---TALCSQAFRVMRMMVNTWLREVSINRN-----
DPOE_CRYNJ/1526-1917GSGTGSLAFD----------SASHNLDE...YAKGAVNTSVMLGD---AVLSTQTFGVLKSMLRAWYAD.KARAH-----
DPOE_DEBHA/1533-1917GTDLA..DDA----------VQFDNN...........NGASTIAE---DSFSTPALSILRGMVKDWWDD.ALKNN-----
Q7RWE3_NEUCR/1533-1926GADNI..SFN----------PAADAT.......GSGDGEEFLYSE---NAFANAGVQVLREMVKSWWAE.ACKGS-----
DPOE_ASHGO/1492-1878GGDVAGPESG----------G................REGGGFVE---DAFSTASVNILRSLLKDLWDD.ALQNN-----
DPOE_EMENI/1495-1885GADSLLAPSD----------PSAESS...........GSGVLYSE---KAFASAGAVVLREMVKHWWSE.ACQGN-----
Q6K777_ORYSJ/1562-1941GGPIGSFAND----------MP...........AGPNGTETEFDD---ATLCLPAFQVLKQLIQRCISDAVSSGN-----
DPOE_YEAST/1527-1920GSDLV..NNN----------MGIDDK.......DAVINSPSEFVH---DAFSNDALNVLRGMLKEWWDE.ALKEN-----
DPOE1_HUMAN/1525-1925GADSMGISFD----------VIQQASLEDMITGGQAASAPASYDE---TALCSNTFRILKSMVVGWVKEITQYHN-----
DPOE_SCHPO/1497-1886GIGDMAALND----------NYMTAI.......NDDLEEKLGIHD---NIGLTHSLPVLKALVKTWWNE.AASGN-----
DPOE_KLULA/1497-1883GTDLAQNSTS----------K................EESFGFVE---DSFSSSALSVLRALLKELWDD.ALGDN-----
DPOE_YARLI/1513-1873G.........----------.................DIHNELLS---NAFNPHALKTLKMVVKEWWEH.GDKKR-----
DPOE_CANGA/1524-1916GSDLV..DMN----------T.VDVS.......DKPVGNNQGIVQ---DSFSHDALAVLKSLLKEWWDR.ALEKN-----
Q95R46_DROME/3-405GASSA.ITFD----------VMPQVSLEEMIGTVPA.ATLPSYDE---TALCSAAFRVMRSMVNGWLREVSINRN-----
Q59SM7_CANAL/1518-1902GTDLA..DEN----------MHFDNN...........NGASTFAE---DSFSSPALSILRSMVKDWWDD.ALSNN-----
O62218_CAEEL/1467-1869GADDVVTFDS----------MNTIAQQS...VTGGAVNSIACYDE---GAAVDATIKVLKQMLTECVRHIAHQGN-----
Q9ZVC8_ARATH/1484-1864GGGFLGVNSR----------.............GSSLNDNGSFDE---NNGCAQAFRVLKQLIKRLLHDACNSGN-----

PF03175

DPOL_ADEB2/267-751ALAATEWIRKLENLEQKIDYFDECLLPGI....FTIDADPPDELF.....LDELPPFCSRKGGRLCWANEPLRGE-----
DPOL_BPPRD/1-440..EITEETYFIEW.........EGENNG......AVPVRTKTGLD.....FNQRSGIFH.......TSIHEWRAG-----
Q39432_BETVU/147-571GGMDLDSLYGFIE....AYVECPESIVRP.....FLPYHKVKDPT....LLFPTGEWIG......VYYTEELKYA-----
DPOL_ADEG1/238-751AQHVEELNRLLTNE.SHLSYFDARIKPSI....LKIEAYPPPPEM.....LDPLPPICSRRGGRLVWTNEALYDE-----
DPOM_NEUIN/400-868LQNIVRFTDSICEV..PFGFYNVKVKTPLNLDKPFLPTRLNTPAG.....TRTAFPLGQWE...GWYFSEEILNA-----
DPOL_ADE12/306-791ALAVRQWQVALENYTCKIDYFDKNLCPGI....FTIDADPPDENQ.....LDVLPPFCSRKGGRLAWTNESLRGE-----
DPOL_BPM2/50-485YEKDEQYPLYIQR....IRFEFELKEGYI....PTIQIKKNPFFK.....GNEYLKNSGVEPVELYLTNVDLELI-----
O78938_AGRAE/66-524ITRINKDAFGFFY...CKIITPEYLEHPI....LQTHLKTSDGIR....TLAPLGSWEDMLFSEEMYNAMKYGYK-----
DPOL_ADE02/300-785ALAARAWQQALDLQGCKIDYFDARLLPGV....FTVDADPPDETQ.....LDPLPPFCSRKGGRLCWTNERLRGE-----
DPOM_CLAPU/431-902ANVNIHELFGFFY....CKIKSPDNLYLG.....LLPKRTETSLI.....F.PGGAWEG......WYFSEELKFA-----
Q9XNK1_PLEOS/737-1218.ETNLDLIFGFVR....AEVTAPSEKELRV...AILPIKGPNGEL.....ITFRGTVEG......TWFSEELKNA-----
O99973_PORPU/80-490QIREPIDPFTIYD.....VVVNIGKQYIP.....SIPFRDKDNTL.....KFPSGTFRTN.....V.TGVELKYS-----
DPOM_NEUCS/366-859.CKNLNEIFGFVR....AKIITPAINIP......VLPCRVKVNGVQ..KLIFPIGEWTG......WYFSEELKLA-----
Q83895_ADEO7/318-798NAQIDYFQELLQRK.EKIDYFDNSIKPMI....VVADCEPPSLDY.....LDVLPPLCSKKSGKLCWSNETLINE-----
DPOL_ADECT/391-876ALAIKAYEQKMLNH.KTISYFDKDLLPGI....FTIDADPPAEEF.....LDVLPPFCSRKGGRLCWTNEPLRGE-----
DPOL_BPPZA/50-485YVWDEDYPLHIQH....IRCEFELKEGYI....PTIQIKRSRFYK.....GNEYLKSSGGEIADLWVSNVDLELM-----
DPOM_MAIZE/299-733GSKKSKIVLNDMFGFIRAFIICPKHIKKP.....LLPYKKDDGTI.....IFPTGRFLG......VYFSEELKYA-----
O11414_9ADEN/323-802SISIKTFQDKLDSP.AKLSYFGESIKPMI....VYADCYPPPLEH.....VDVLPPLCSRKSGRLCWTNEPLLGE-----
DPOM_ASCIM/588-1048PYKFTKDPFGFVF....AEVTAPDLKVPI......IQTRVQTSGG.....VRTVAPIGTFK...GWYLLDELINA-----
DPOM_PODAS/449-902KGLKLSELFGFFY.....CKVTTNNQYLG.....LLPVHNQGLIM.......PNGQWYG......WYFSEELKFA-----
Q9WF13_ADE17/335-820AMAAREWQMALDDASSKIDYFDKKLCPGI....FTIDADPPDEHL.....LDVLPPFCSRKGGRLCWTNEPLRGE-----
Q9TEH5_9PEZI/309-758ILIIFRYVYAKIK.....TIGNTKYP........FIPFRSETGLL.....F.PLGSWED......WYFSEELKYA-----
DPO2_KLULA/409-873IDFEKHGIYRVTL....LNKHDQEPKNYL....NFVPRRINRKLT.....WEWFKIHEG......WYHTYDLIIA-----
Q35599_PHYPO/7-446YMKKFEKNIENFFGFIDVLITIEKTNNNI....PVLPYRMGIKNN......VEVGIIYAKGTLRGIYFSEEIKLA-----
Q9YUR6_9ADEN/338-828NNEITKLNEKLKKTKTKLSYFT.DIKPMV....VMIDAIPPPPEH.....LDPLPPLCSRQSGKLCWTNEILKNE-----
Q09038_LACKL/414-878INFNKHGIYDVTL....IHKSNSKPNHYL....EFVPRRIDKKLI.....WSWFKEHRG......TYHTYDLLIA-----
DPOL_BPCP1/56-488PKEIKEDHYYIYH....IKADFDLKRGYL....PTIQIKKKLDALRIGVRTSDYVTTSKNEVIDLYLTNFDLDLF-----
DPOL_ADE04/437-922ALAVREWQASLDDLGTCISYFDPDLLPGI....FTIDADPPDELM.....LDPLPPFCSRKGGRLCWTNEPLRGE-----
Q9QM79_9ADEN/238-780AKHVDELNELMSSE.RPISYFDHRIKPCI....LKVEAYPPPAEH.....LDTLPPICSRRGGRLVWTNEALYDE-----
DPO1_KLULA/415-878RPKDELGIYYVRV....TPNRNNKSN........FFPIRSHNKIT.....YNNFEESTYI....AWYTNVDIDIG-----
DPOL_ADE40/433-918ALAVRDWEHALLQVGTPIDYFNRTLLPGI....FTIDADPPPENL.....LDVLPPLCSRKGGRLCWTNEPLRGE-----
O21376_PICKL/474-939GLDYKDFNYPETTGVLHCEVETPKNLVTG.....VLPVKDINKGV.....MYPLGHFLG......IWTTVELDYA-----
Q96206_BPGA1/50-490YKKNVEYPLYIQQ....VRCFFELKKDKI....PCIQIKGNARFG.....QNEYLSTSGDEYVDLYVTNVDWELI-----
DPOL_ADEB3/262-744ALAIKNWQDRLTQLHRPIDYFDRTLLPAI....FTIDADPPPEAF.....LDVIPPFCSRKGGRLCWTNETLRGE-----
O74719_DEBHN/418-882RMTEELGIYYVRV....IPHTKINSN........FFPVRYNNKIT.....YNNYGSTQYN....AWYTSVDIDIG-----

PF03337

Q1HTT9_9POXV/3-657GREVAQCLFEAAVAQQVTLTRIMPFCAFSSFGCAEDMFLANAAMLGAGP..AGYYVPAHASVAAFVAEAVRPESVQSF..
Q3I8X2_MONPV/3-635SMASLKSLYEAFETQSGALEVLMSPCRMFSFSRIEDMFLTSVINRVSENTGMGMYYPTNDIPSLFIESSICLDYIIVN..
Q8V3R9_SWPV1/2-644SLKFISVLYDSIITQSVALNTLLSPWNVSLFNRIEDIIIVKSNYSAATHIGNSVYYPSGYDAFNFIQQSIQSKYVKTV..
Q070L3_CPRV/15-686LSESCYYLHCAALAQSAALAEAFGRPDPLRCPSLFDAFYEHLIARAAQVPALAPTRCSHPDLADLLERAARRDGARVQ..
Q08FW7_DPV83/4-651ALKTVTTLYNSINNHFTAINVLIQPWFMLSFNKLEDMVITKVLHMAAGKVGNNMYYPTGNDSINFIYQSIRSKYVKTV..
Q6TUY6_YMTV5/6-640SSACTTTLHNAVVNHISYLNSELYPMCFFSFFCLEDMIILKAMYLSAEEDNKQIYVPAGNTTTDIIFQSIRAYSVKTK..
Q2F8G6_ORFV/3-635AAAAAQALSDAALAHQAALARIFPSCDMAAFRGLREMVLANAARGCAAC.......PVHFSALNMVEAALFLEETGASPV
Q9Q8S1_MYXVL/3-624SSRVAESLYNATCTQLITLNDVLSPWNALYFTRLDDAVWTASIYEASK...SNVYYPSGHEAMSFIRQAIRSSYVDTL..
Q6TVH8_9POXV/3-637ASVAAQALMDAARSHQAALARIFPSCDMAAFNGLREMVLGNAARGCGAC.......PMHSSALDMVNAALFIEEAGANPA
Q98188_MCV1/3-654AVHAARLLGTAVCAQQELLRRVMPTCDFAHFPDLSSMAIANAALLGACAHDARLFDPVQPDAVAFVRESMLHEHVGSL..
A7XCD4_9POXV/6-641ACKYTTLLYDAVNNNIAYLDSMLSPVCTMLSFCVEDMILLKAMHLSAEKDNKKFYVP.GNTITDVIFQAIRSTSVKTK..

PF00136

DPOD_YEAST/555-991..LAFVR...........ETINDIL------HN...............................RV..DISKLIISKTLA
DPOL_GPCMV/556-1073..AVELS...........RMTMDDV------KRHGVPSGFY.......RIVEALSNARDELYLNRV..DVKKLVLSASLS
DPOL2_AERPE/390-793.....................VDYV------RN.......................IIEKLRRGQV..DMRKLVIWKTLT
O40910_HHV8/533-1006..AKLIS...........GQATDWV------YREGLPEGFV......KIIQVLNASHRELC.ERSV..PVDKLTFTTELS
DPOL1_SULSO/450-869...KEIK...........RKIVDVV------KG.......................SYEKLKNKGY..NLDELAFKVMLS
Q89604_9ALPH/639-1203..AAEAS...........AVPPSEW------PGRQLPPGFA......RFGAVLAEAHAKIA.DPAL..DIGDFVMTAELS
Q9YQZ6_9VIRU/602-1028....LIP................VV------GS...................................EHETWVRNTFSK
Q9WSY3_9ALPH/582-1139..AALVA...........ERPSSFW------ATAPLPEGLK......PFGDILAEAYGQMTASTLS..DVGDFVMSAELS
DPOL_ARCFU/361-774...................KALSLV------KD.......................VILRIKEGKV..SLEEVVIYKGLT
DPOL_RCMVM/533-1077..AMRLS...........EMSFEEL------RRQGVPVGFF......PVIRRLCDARDDLF.LDRV..PVAQLVLSSVLS
Q9YW56_MSEPV/569-1067...NSKN............VVIKYI------DE.......................LIKNLVDNLDKLNYMDFAVTKRYS
DPOL_ASFL6/457-978.R.P...............PLIEIV------KT.......................VLKDAVVNMKQWNFEDFIQTDAWR
DPOD1_CAEEL/520-978..LDFAK...........RTISDLL------CN...........................K....I..DISLLIISKELT
DPOL_FOWPN/483-977..QQEIT...........RLILQSL------ET......................DMISEFTHNR...EFEKYL....LS
DPOL_HHV21/617-1200..AAALA...........ERPAEEW------LARPLPEGLQ......AFGAVLVDAHRRIT.DPER..DIQDFVLTAELS
Q9Q6Z6_9GAMA/520-997..ANLLS...........KRKISKC------FEEGLPEGFI......KIIDILNAAYKDLS.ANRV..PIQTLVYSTELN
Q59691_PYROC/388-793...................KAISYI------RE.......................VIKQLREGKV..PITKLIIWKTLS
O36638_9PHYC/422-974TVLSKLENSEI...GVEDLTISNEL------KKHPDQYATP......SAHSVLAGKLNARAKNQKLYREIVRPVVEQGGV
DPOL_IIV6/578-1226VVEKMLNLYTRQIEFTSCEKDENYL------KNLIVTKSVGDYGGDKATFEPILGKNEKGEDKWKIGNYVVPLITDEIIK
Q69281_9ALPH/606-1168..AATVA...........EKPPXFW------ATSPLPEGLN......SFGGVLAEAYTRMMINNIT..EVEDFAMSAELS
DPOL_EHV1B/611-1173..AAEVT...........DVPPAEW------VGRPLPSGFD......KFGRVLVEAYNRIT.APNL..DVREFVMTAELS
DPOL_MUHVS/543-1050..TMKLS...........RMTFDDL------KKNGIPCEFG......PVVSRLCRARDDLH.LKKV..PVPELTLSSVLS
DPOD1_MESAU/546-1005..VAHAK...........DVISDLL------CN...........................R....I..DISQLVITKELT
DPOLA_ORYSJ/834-1303..IESIH...............SSL------VQ.......................VQEQMRGGQT..ELEKYIITKSLT
DPOL_RSIV/397-938MHDMMIPG.........ALQDDDFV------LTKSVQD.............IGNGDDNNHGSYKVRNPQKAQAAATQRVA
DPOL1_SULAC/448-867...PEVK...........NKLEIKI------KD.......................IYNKLRNKGY..NLDDLAFRIMLS
Q9Y1T1_TOXGO/1006-1612TPAVTLPRTRRRRATRRNMPSTPWL------KNSTR................NCEKSGSNCGAGGV..PLEFFVITKALT
DPOL1_SULOH/448-867...PKIR...........DQLEYKI------KE.......................IYEKLRHKGY..NLDELAFRVMLS
DPOL_BPT4/383-855...PHLK...........IMGMETQ------QS.......................STPKAVQEAL..EESIRRILQEGE
Q98207_MCV1/494-994..LSSRQ............VCIEML------RS.......................LEVDLFAEFA..ARAQPLEMFLLS
DPOLA_OXYNO/783-1270..VLNLN...............EFL------SN.......................IGNELKEGTI..KLNEFIITKQIT
DPOL_EHV2/530-1004..AERLC...........AMRVEEV------CARGPPVGFL......KVVDILNDSYRKLR.LNRV..PVGQLSFSTELS
DPOL_ORFN2/499-998..EGSGN............VGVEIL------RS.......................LEDELTFEFE..ARSMPLDWFLLS
DPOLA_DROME/805-1258.................LDAVHAQL------EK.......................IKTQIAEGVV..PLPLFVITKQLT
DPOD1_PLAFK/544-1000..IEYTK...........SKIKELL------TN...........................N....I..DMSLLVVTKSLG
DPOL_VZVD/597-1136..AAEAS...........CVSIAEW------NRRAMPSGMA......GFGRIIADAHRQIT.SPKL..DINKFVMTAELS
O41930_MHV68/528-1001..AQTMS...........NWGKLDV------YRRGLPSGFS......KVIDALNHNHLQLI.TNSV..DIDHLTFTTELS
DPOL_TUHV2/556-1135..ATRMS...........ELTLEEM------RRVGVPAGFH......VLLQRLARARDDLF.SGRV..ETAALVLSSVLS
DPOD1_DROME/534-994..VAYVK...........QVIADLL------CN...........................R....I..DISHLVITKEL.
DPOL_THEGO/348-763...................EAVRIV------KE.......................VTEKLSKYEV..PPEKLVIYEQIT
Q9WT26_HHV6H/517-998..AVEFS...........HMTQTQL------RDEGVPVGIH......KILRRLCKAREELF.QNRA..DVRHLMLSSVLS
DPOL_EBVB9/532-1013..ASLLS...........HRPFQES------FTQGLPVGFL......PVIDILNQAYTDLR.EGRV..PMGELCFSTELS
DPOD_CANAX/484-939..QRFVK...........QTIADLL------QN...........................R....I..DLSQLVITKAY.
DPOLA_TRYBB/684-1157.....LD............FVIKYM------KG......................VAQDVRSGNVY..PLEEFVISKSLT
DPOL_BPR69/386-859...PKLK...........IMGLETQ------KS.......................STPKAVQKAL..KECIRRMLQEGE
DPOA_YEAST/792-1248..LQEVY...............DYL------ED.......................IRIKVETNNI..RIDKYKINMKLS
DPOL_SFAVA/492-1090ESCLRLMR.........RTVPCEML------TKTSE.................VRNLGDGCQLVLCKKTMSWMWGDYKVA
DPOL_VACCA/497-995..MNSNQ............VCIDIL------RS.......................LETDLRSEFD..SRSSPLELFMLS
O74046_CENSY/420-835...ESAK...........LKISKAI------AA.......................SGKRLEERGV..PLADLAFNVMIS
Q9Q8R2_MYXVL/498-996..SSSLQ............VCINIL------KS.......................LESDLLIEFE..TRKAPLDLFLLS
O93043_FHV1/606-1159..AAEIA...........SVHPREW------MGRALPANFW......EFGRVLAEAYTHIT.APDL..DVNDFVMTAELS
DPOD_SCHPO/534-990..QLFTK...........KVISDLL------QN...............................KI..DMSQLVITKALS
DPOLA_OXYTR/809-1299..VLNLN...............EYL------SD.......................IGEKMKNNGI..TLDQFIITKQLT
Q9QEL0_9ALPH/621-1171..AAALA...........ERAAEEW------LARPLPDGLA......AFGRVLVDAHRYIS.DPQR..DVRDFVFTAELS
DPOL_METVO/393-818...................LAKKII------KN.......................TIDNLKKGNI..DKNDLLIHTQLT
O92827_9BETA/515-999..AEKLS...........NMTIQEI------YENGVPDGIQ......KIIKKLCDARDALF.LNRV..NIKSLVLSSVLS
DPOZ_YEAST/919-1384..KKYLQ...........NEFFKIQ------IG...............................KV..SAQDFCFAKEVK
DPOL1_AERPE/535-951...EAIL...........AELRDHI------NT.......................VYNNVKKKVY..TLDQFAIKVMLS
DPOLA_HUMAN/783-1246..VENIQ...............KRL------IE.......................IGENVLNGSV..PVSQFEINKALT
Q69390_9ALPH/516-1008..AATIA...........RAPAARW------LERPLPRGFA......AFGRVLAEAHARVAGGAGL..DVADFVMTAELS
DPOL_RHCM6/533-1017..AVQLS...........RLTLDEL------KMQGVPPGFG......RVIQRLSQARDELY.TSRA..RVEELVLSSVLS
DPOL_PBCVN/432-881.....VT............ETVECI------RK...........................VLDNEY..PMEKFTMSKTLK
DPOL_ALHV1/550-1026..AQTLS...........YSPVANC------FKTEPLLGFL......KIIDILNQSYSDLK.SNKV..PVANLTYSTELS
Q59690_PYROC/488-905...IKVR...........RVIRERL------RK.......................VYHGLRDLEF..NLDELAIRMALN
DPOD1_SOYBN/511-969..VQYVK...........NAISDLL------MN...........................R....M..DLSLLVITKGLT
DPOL_SHV21/522-994..AQLLS...........TKDPDYA------FREGLPDGFL......KVIDILNESHKNLR.TGQV..PVEELTFSTELS
DPOA_SCHPO/773-1222..IENIH...............SYL------MD.......................FSEKMRNGKF..PANKFIIFNRLG

PF08490

Q7Q7P3_ANOGA/1540-1943-------------------VFSDFQ......II-----------------------------------HFYRWVRSSRAL
DPOE_CRYNJ/1526-1917-------------------VKGDSLSPAEIVVD-----------------------------------QFWRWISSSTSS
DPOE_DEBHA/1533-1917-------------------DNADSM......MN-----------------------------------NLVTWVQRSDSL
Q7RWE3_NEUCR/1533-1926-------------------TMADVM......VQ-----------------------------------HLVRWVESPASC
DPOE_ASHGO/1492-1878-------------------STADSL......VH-----------------------------------SFIGWVQSVDSK
DPOE_EMENI/1495-1885-------------------NMADIM......VQ-----------------------------------HLIRWVESPASC
Q6K777_ORYSJ/1562-1941-------------------VFADAI......LQ-----------------------------------HLYRWLCSPRSK
DPOE_YEAST/1527-1920-------------------STADLL......VN-----------------------------------SLASWVQNPNAK
DPOE1_HUMAN/1525-1925-------------------IYADNQ......VM-----------------------------------HFYRWLRSPSSL
DPOE_SCHPO/1497-1886-------------------NLADLI......IQ-----------------------------------HLARWISSSKSY
DPOE_KLULA/1497-1883-------------------ITADSL......VH-----------------------------------AFIGWVYNPDAK
DPOE_YARLI/1513-1873-------------------PPQDLL.......D-----------------------------------NFTVWVYAPESR
DPOE_CANGA/1524-1916-------------------ITADLL......VN-----------------------------------SLVSWVYSTDSK
Q95R46_DROME/3-405-------------------IFSDFQ......IV-----------------------------------HFYRWVRSSNAL
Q59SM7_CANAL/1518-1902-------------------INADSI......MN-----------------------------------TLVTWVQRNDSM
O62218_CAEEL/1467-1869-------------------ARADEV......VM-----------------------------------TVSRWLNTRSAL
Q9ZVC8_ARATH/1484-1864-------------------IYADSI......LQ-----------------------------------HLSWWLRSPSSK

PF03175

DPOL_ADEB2/267-751------------------VATSIDLITLHNRGW-----------------------AVRILP.DERTTIFPEWKCVAKEY
DPOL_BPPRD/1-440------------------IDTG......TIKPN-----------------------RIIRTINFTETTTFGAFI...DHF
Q39432_BETVU/147-571------------------KSLG.......YTVI-----------------------PIKGYLFQKRESPFKDYV..GSLF
DPOL_ADEG1/238-751------------------VVTVIDILTLHNRGW-----------------------RVQVLH.DEMNIVFPEWKTLCADY
DPOM_NEUIN/400-868------------------MKHG.......YEFE-----------------------FIEGYL.FEESSMFDEYI...DLL
DPOL_ADE12/306-791------------------VVTSVDLVTLHNRGW-----------------------RLRLLS.DERTTIFPTWKCLAREY
DPOL_BPM2/50-485------------------QEHYE.....LYNVE-----------------------YIDGFKFREKTGLFKDFI...DKW
O78938_AGRAE/66-524------------------FEILWG...YTFESK-----------------------NIFSEIISDLYKMRLEYQKSDPMN
DPOL_ADE02/300-785------------------VATSVDLVTLHNRGW-----------------------RVHLVP.DERTTVFPEWRCVAREY
DPOM_CLAPU/431-902------------------VAHG.......YEVE-----------------------IIKGYNFDRVSNVFNEFV...QEV
Q9XNK1_PLEOS/737-1218------------------ETYG.......YKIK-----------------------VKDCLQFEKVYNLFDDFV..NEFY
O99973_PORPU/80-490------------------IDNKY.....ANIVK-----------------------IYKSLKLKDPNLYLENTYWTCSRK
DPOM_NEUCS/366-859------------------VEYG.......YKIE-----------------------VLESYVFEKRDDPFKEYI...EHF
Q83895_ADEO7/318-798------------------VLTSIDLITLHNRGW-----------------------KCKIIKSSEMYAVWSDWKPLCQKY
DPOL_ADECT/391-876------------------IATSIDVITLHNRGW-----------------------KVTLIP.DTRTTVFPEWKCLAREY
DPOL_BPPZA/50-485------------------KEHYD.....LYNVE-----------------------YISGLKFKATTGLFKDFI...DKW
DPOM_MAIZE/299-733------------------VSLG.......YKVY-----------------------PICGYIFDRKESPFKRFV...YDI
O11414_9ADEN/323-802------------------VVTTIDLITLHNRGW-----------------------KCKILTSEQLYAVWPEWKCITKEY
DPOM_ASCIM/588-1048------------------KKYG.......YTFK-----------------------ISEAYL.FERLNIFKEYI...HRL
DPOM_PODAS/449-902------------------EVNG.......YNIE-----------------------VIKGYQFNKIDNLFSSYV...DDL
Q9WF13_ADE17/335-820------------------VATSVDLVTLHNRGW-----------------------RVRIVP.DERTTVFPEWKCVAREY
Q9TEH5_9PEZI/309-758------------------VKSG......LYQVE-----------------------VIHSYKYEAGVDIFKDYV...EKY
DPO2_KLULA/409-873------------------KSEG.......FDIY-----------------------CHEGFEYPEKDYIFNDFI...DTL
Q35599_PHYPO/7-446------------------LKQG......YKIIE-----------------------IYSAYEYKEKEVVFEEYV...EQM
Q9YUR6_9ADEN/338-828------------------IVTSIDIITLHNRGW-----------------------KVNIIP.HKLNTVFPTWNTCCLEY
Q09038_LACKL/414-878------------------IQEG.......FEII-----------------------CHSGIEYPNKGYIFNNFI...DKL
DPOL_BPCP1/56-488------------------LKHYD......ATIM-----------------------YVETLEFQTESDLFDDYI...TTY
DPOL_ADE04/437-922------------------VATSVDLITLHNRGW-----------------------QVRIVP.DELTTVFPEWKCVAREY
Q9QM79_9ADEN/238-780------------------VITVIDILTLHNRGW-----------------------AVTALH.DDMNIVFPAWKTVCAEY
DPO1_KLULA/415-878------------------LSEGHNIEYIPFDSY-----------------------GNIGYSWSKKGKIFEKYI..KDVL
DPOL_ADE40/433-918------------------VVTSVDLITLHNRGW-----------------------HVRLLP.DERATVFPEWRCVAKEY
O21376_PICKL/474-939------------------LSLG.......YKIT-----------------------VYKGMVFNSMESPYKKYM...DLF
Q96206_BPGA1/50-490------------------KKHYD.....IFEEE-----------------------FIGGFMFKGFIGFFDEYI...DRF
DPOL_ADEB3/262-744------------------VVTCLDAITLHNRGW-----------------------RVQILN.DPRTTVFPQWECLARDY
O74719_DEBHN/418-882------------------ISEGHDIQYIPFDEE-----------------------ENIGYSWINKGKIFQQYI..EDTL

PF03337

Q1HTT9_9POXV/3-657TCKN.RVPLRCLQLRSVARVAMDGLYPVGRPYH-----------------------TLE.CDSSKPYIALCEVKRKSSVR
Q3I8X2_MONPV/3-635NQES.....NKYRIKSVLDIISSKQYPAGRPNY-----------------------VKN.GTKGKLYIALCKVTVPTNDH
Q8V3R9_SWPV1/2-644GVSN.PKSYSVYRLKSIVDIIGNESYPVGLPMY-----------------------VKS.FNEDKLYIALCKITIKNNIK
Q070L3_CPRV/15-686VEGAYTAAERELDLRPAALRVLAREYPVGYPYC-----------------------TAAPDLAGRLSLVRCRVEAKPQNR
Q08FW7_DPV83/4-651NTSQCLKTYSIYRLKSLLKLIEFCKYPIGVPKY-----------------------VKE.GSRDKLYIALCEVTVKRDVR
Q6TUY6_YMTV5/6-640DVSN.KKIFYRYKLKSVLSVIESGLYPVGKPRH-----------------------VKL.STNGKLYIALCKITIDRDIK
Q2F8G6_ORFV/3-635PADA.....RCFRLAYPLREVASQLYPVGKPRM-----------------------VSK.LTRGLLAIALCEVTRSAEVK
Q9Q8S1_MYXVL/3-624YIDV.PKHYSVYALKSVFDVVCEGVYPAGAPTY-----------------------VSGYFDEDKPYIALCEVTVKPDVK
Q6TVH8_9POXV/3-637PADA.....RCFRLSSPLREAASKRYPAGKPHF-----------------------VTE.LTRGLLSIALCEVERSPEVR
Q98188_MCV1/3-654PRDAPGTRLHTMHVRSVIQHLARELYPTGKPYY-----------------------TQT.LNPGRLALALCKVRRRGNLQ
A7XCD4_9POXV/6-641EVTD.KNPFYKYKLKSVLSVIESGSYPVGKPRY-----------------------VKT.LTDGKLYIALCKITVKKDIK

PF00136

DPOD_YEAST/555-991.....PNYTNPQP..........HAVLAERMKRRE...........GVGPNVGDRVDYVIIGG.................
DPOL_GPCMV/556-1073..QEVSAYKQQNLP.........HLRVIQRLAARR...........EELPSVGDRVPYVLIAPP................
DPOL2_AERPE/390-793..RPPSMYEARQP..........HVTAALLMERAGI..........KVEP..GAKIGYVVTKGS................
O40910_HHV8/533-1006..RPLADYKTQNLP.........HLTVYQKLQARQ...........EELPQIHDRIPYVFVDA.................
DPOL1_SULSO/450-869..KPLDAYKKNTPQ.........HVKAALQLRPFGV..........NVLP..RDIIYYVKVRS.................
Q89604_9ALPH/639-1203..RPPEAYANKRIA.........HLTVYYKLLLRS...........EARPNVKDRIPYVIVAPGEGVERD..........
Q9YQZ6_9VIRU/602-1028..ESVTKLCFENMS.........TVTLRLQKKMYVN.........LTHVPLPNDPVGTCKVKA.................
Q9WSY3_9ALPH/582-1139..RPPQAYANKRIA.........HLTVYHKLAMRS...........EQLPMVKDRISYVIAAATPEVLRDAERV...AEA
DPOL_ARCFU/361-774..KKPSKYESMQA..........HVKAALKAREMGI..........IYPV..SSKIGYVIVKGS................
DPOL_RCMVM/533-1077..QDASRYKQKNLP.........HLAVYRSLVERG...........EELPGVGDRIEYVLTCPD................
Q9YW56_MSEPV/569-1067.....GKYVSIDN..........IIELTVNKFNAKY.........PDYKIRKGDRFLYIYGI..................
DPOL_ASFL6/457-978PDKDNKAVQIFMSR........MHARREQLKKHGAAAT......SQFAEPEPGERFSYVIVEKQV...............
DPOD1_CAEEL/520-978..KSGDKYQAKQA..........HVELAARMKKRDA..........GSAPRLGDRVPYVFVAA.................
DPOL_FOWPN/483-977.RKHHNNYKSATHS.........NFELVKRYNLEN...........TEKIEIGERYYYIYICD.................
DPOL_HHV21/617-1200..RHPRAYTNKRLA.........HLTVYYKLMARR...........AQVPSIKDRIPYVIVAQTREVEETVARLAALREL
Q9Q6Z6_9GAMA/520-997..KDFSCYKSYNLP.........HLAVYKKIILRN...........EEPPQVHDRISYVFING.................
Q59691_PYROC/388-793..KRIEEYEHDAP..........HVMAARRMKEAGY..........EVSP..GDKVGYVIVKGS................
O36638_9PHYC/422-974.PSLGTAYGVLEGVRRKF.SFDQRRDVSYEEFLRDLANGRVAEKLKGSAPQVSECESLVGSTEDKLIQEGIRTE...KIL
DPOL_IIV6/578-1226.TCGTNGLPMTQNEIKDWYLERLPCQVQLEVKIKRR..........GHNKEEGQRLSYVVTDI.................
Q69281_9ALPH/606-1168..RPPDAYTNKRIP.........HLTVYYKLAMRS...........EQLPVVKDRISYVIAAATPEVVRDSARV..AEFR
DPOL_EHV1B/611-1173..RSPESYTNKRLP.........HLTVYFKLAMRN...........EELPSVKERIPYVIVAQTEAAEREA.........
DPOL_MUHVS/543-1050..QELSCYKQKNLP.........HLAVIRRLAARK...........EELPAVGDRVEYVLTLPD................
DPOD1_MESAU/546-1005..RAAADYAGKQA..........HVELAERMRKRDP..........GSAPSLGDRVPYVIIGA.................
DPOLA_ORYSJ/834-1303..KAPEDYPDAKNQ........PHVQVALRLKQNG...........YSGCSAGDTVPYIICSQQDS..............
DPOL_RSIV/397-938.PDDAEGYAIALRQEM.....VKQMPAQAQLAERMRL........QGRAVVSGARIEYVVLKHQY...............
DPOL1_SULAC/448-867..KPLDSYTKNTPQ.........HVKAGLQLRAFGV..........NVLP..RDVIMFVKVKS.................
Q9Y1T1_TOXGO/1006-1612..KPPQMYARGAGGAI....MHPHVQVALRMQSRGL..........SVK..PGNEIPYVICSEASVRAFLAAKSE.AEGG
DPOL1_SULOH/448-867..KPLESYTKNTP.........QHVKAALQLRSYGV..........MVLP..RDIIMFVKVKS.................
DPOL_BPT4/383-855..ESVQEYYKNFEKEY.....RQLDYKVIAEVKTAN..........DIAK..YDDKGWPGFKCP................
Q98207_MCV1/494-994.RMHHRNYKAPDNP.........NVELVNRYNREN...........LEPIELGERYYYAYVCA.................
DPOLA_OXYNO/783-1270..KAISDYNDIKG.Q.......PHVAVAKRLRDQGK..........SENQLVNNFIPYVICQQTYG..............
DPOL_EHV2/530-1004..RPISYYKTLTLP.........HLVVYHKIMQRN...........EELPQIHDRIAYVFVQS.................
DPOL_ORFN2/499-998.RTHHKNFKSPDNP.........NVALVTRYNAAN...........AEAIEIGERYFFAYVCE.................
DPOLA_DROME/805-1258..RTPQEYANSASL........PHVQVALRMNRERN.........RRYKK..GDMVDYVICLDGT...............
DPOD1_PLAFK/544-1000....KTDYETRLP..........HVELAKKLKQRDS..........ATAPNVGDRVSYIIVKG.................
DPOL_VZVD/597-1136..RPPSAYINRRLA.........HLTVYYKLVMRQ...........GQIPNVRERIPYVIVAPTDEVEAD..........
O41930_MHV68/528-1001..KPLTEYKTTNLP.........HLAVFKKLVSRQ...........EELPQIHDRIPYVFIDG.................
DPOL_TUHV2/556-1135..QDVSRYKQLNLP.........HLAVIRRLAARS...........EELPSVGDRVSYVLTAGP................
DPOD1_DROME/534-994...AKTDYAAKQA..........HVELAAKMKKRDP..........GTAPKLGDRVPYVICAA.................
DPOL_THEGO/348-763..RDLKDYKATGP..........HVAVAKRLAARGI..........KIRP..GTVISYIVLKGS................
Q9WT26_HHV6H/517-998..KEVAAYKQPNLA.........HLSVIRRLAQRK...........EEIPNVGDRIMYVLIAPS................
DPOL_EBVB9/532-1013..RKLSAYKSTQMP.........HLAVYQKFVERN...........EELPQIHDRIQYVFVEPK................
DPOD_CANAX/484-939...SKHDYSAKQA..........HVELAERMRKRDP..........GSAPTLGDRVAYVIIKT.................
DPOLA_TRYBB/684-1157..KEPESYHGTGYP.........HAVVALRMKQRK............EGVRVGDLIPYVICEGD................
DPOL_BPR69/386-859..ESLQEYFKEFEKEF.....RQLNYISIASVSSAN..........NIAK..YDVGGFPGPKCP................
DPOA_YEAST/792-1248..KDPKAYPGGKN.M.......PAVQVALRMRKAGR..........V.VK.AGSVITFVITKQDEI..............
DPOL_SFAVA/492-1090.RHEQHDRLQRENPKWLRDYYVSKLPAPARLSILLTD........RARPPVEGGRIEFLNVKT.................
DPOL_VACCA/497-995.RMHHSNYKSADNP.........NMYLVTEYNKNN...........PETIELGERYYFAYICP.................
O74046_CENSY/420-835..KAPSEYVKTVP.........QHIRAARLLENA.R..........EVKK..GDIISYVKVMN.................
Q9Q8R2_MYXVL/498-996.RTHHCNYKSIDNP.........NMYLVNEYNKNN...........PERIEIGERYYFAYLCD.................
O93043_FHV1/606-1159..RPPDAYINKRIA.........HLTVYYKLVMRN...........EEVPSVKERIPYVIISPAQVSDSD..........
DPOD_SCHPO/534-990....KTDYAAKMA..........HVELAERMRKRDA..........GSAPAIGDRVAYVIIKG.................
DPOLA_OXYTR/809-1299..KAISEYSDIKG.Q.......PHVAVAQRLKNQGK..........SESDLVNNFIPYVIGAQPFD..............
Q9QEL0_9ALPH/621-1171..RHPDAYANKRIA.........HLTVYYKLLARR...........EQVPSIKDRIPYVIVAQTADAEAS..........
DPOL_METVO/393-818..KNIEEYKSTAP..........HIEVAKKIKQRGD..........SVRV..GDVISYIIVKGS................
O92827_9BETA/515-999..KDISAYKQANLP.........HLAVVKRLAQRK...........EELPNIGDRVMYILIAPT................
DPOZ_YEAST/919-1384...LGAYKSEKTAP........AGAVVVKRRINEDH..........RAEPQYKERIPYLVVKGK................
DPOL1_AERPE/535-951..KNPREYDKNTP.........QHVKAAMLLQRLGL..........TLSR..GDIVYYVKTRD.................
DPOLA_HUMAN/783-1246..KDPQDYPDKKSL........PHVHVALWINSQG...........GRKVKAGDTVSYVICQD.................
Q69390_9ALPH/516-1008..RPPDAYSNTRLP.........HLTVYHKLAMRH...........GEVPSVKERVSYVIIAPTPEA.............
DPOL_RHCM6/533-1017..KDVSLYKQSNLP.........HIAVIKRLAARS...........EELPVVGDRVFYVLTAPV................
DPOL_PBCVN/432-881.....TGYKNECQP.........HLHVSNKIFERTG..........FPVPS.GARVPFVYIEDK................
DPOL_ALHV1/550-1026..KPFTEYKTTNLP.........HLAVYKKLAMRN...........EELPQIHDRISYVFVKS.................
Q59690_PYROC/488-905..KPVEAYTKNTP.........QHVKAARQLIRAGV..........QVLP..GDVISFVKVKG.................
DPOD1_SOYBN/511-969..KTGDDYEVKAA..........HVELAERMRKRDA..........ATAPNVGDRVPYVIIKA.................
DPOL_SHV21/522-994..RPISSYKTENLP.........HLTVYKKIITRH...........EEPPQVHDRIPYVFVGK.................
DPOA_SCHPO/773-1222..KNPEDYPNGKT.M.......PFVQVALKKKARGE..........N.VR.VGDVIPFIIAGSD................

PF08490

Q7Q7P3_ANOGA/1540-1943LYDPALRRALNTI----------MRKLFLQIV--------------AEFRRMKATIIYA---------------------
DPOE_CRYNJ/1526-1917MFEPALHRFLHGL----------MRKTFLQLL--------------AEFKRLGTQVVYA---------------------
DPOE_DEBHA/1533-1917LYDYSLHYHVHNL----------TTKALLQLI--------------GEFKRMNAQVIFA---------------------
Q7RWE3_NEUCR/1533-1926LYDRALHYYVQMM----------SRKALLQLM--------------ADFRRVGSQVIFA---------------------
DPOE_ASHGO/1492-1878LFDYTLRYYVNML----------TKKALFQLI--------------NEFRFMGSQVVFL---------------------
DPOE_EMENI/1495-1885LYDRSLHQYVRML----------SRKSFQQLM--------------AEFRRVGSNVVFA---------------------
Q6K777_ORYSJ/1562-1941LHDPALHHLLHNV----------MKKVFALML--------------AEFRKLGANVIFA---------------------
DPOE_YEAST/1527-1920LFDGLLRYHVHNL----------TKKALLQLV--------------NEFSALGSTIVYA---------------------
DPOE1_HUMAN/1525-1925LHDPALHRTLHNM----------MKKLFLQLI--------------AEFKRLGSSVIYA---------------------
DPOE_SCHPO/1497-1886LYSPLLSSHVEVI----------MRKTFLQLL--------------SEIKRLGAHIIHA---------------------
DPOE_KLULA/1497-1883LFDYALRYHIHTL----------TQKAVLQLI--------------NEFKLAGSSLIFA---------------------
DPOE_YARLI/1513-1873LFSPQLLYHTQNL----------TKKTFLYLA--------------QECRKHQAQLVYA---------------------
DPOE_CANGA/1524-1916LFDGSLRYHIHNL----------TKKSLFQLM--------------NEFNELGSFIVSA---------------------
Q95R46_DROME/3-405LYDPALRRSLNNL----------MRKMFLRII--------------AEFKRLGATIIYA---------------------
Q59SM7_CANAL/1518-1902LYDPSLHYHVHNL----------TSKALLQLI--------------SEFKRMGAQVIFA---------------------
O62218_CAEEL/1467-1869LFDAALTRSVSVL----------ESKLVLLLC--------------AECERIGAKVIHA---------------------
Q9ZVC8_ARATH/1484-1864LHDPALHLMLHKV----------MQKVFALLL--------------TDLRRLGAIIIYA---------------------

PF03175

DPOL_ADEB2/267-751--VQLNIGAKEKADKEKNQTMRSIAKLLSN.ALYGSFATKL....DNKKIVFSDQL........----------------
DPOL_BPPRD/1-440--FSKRDAAKKAGDLFHN....IFYKLILN.SSYGKFAQNPE..NYKEWCITEGGIY....LEG----------------
Q39432_BETVU/147-571--ERRLQAKEDGNEAMS.....LLYKLVMN.SLYGRFGIHPK..STKTDIGGIKEYQYR.MRQE----------------
DPOL_ADEG1/238-751--VTKNILAKEKADREKNEVIRSISKMLSN.ALYGAFATNM....DTTRIIFEQDL........----------------
DPOM_NEUIN/400-868--YNIKKNSPKESPWYY......ISKLLMN.SLYGRFGLNP...EGEEIFITSEEEGDAIIATK----------------
DPOL_ADE12/306-791--VQLNIAAKERADRDKNQTLRSIAKLLSN.ALYGSFATKL....DNKKIVFSDQM........----------------
DPOL_BPM2/50-485--TYVKTHEEGAKKQ.......LAKLMLNS..LYGKFASNPD..VTGKVPYLKDDGS.LGFRVG----------------
O78938_AGRAE/66-524--YIAKILMNSLYGRFGMDDNFTFSDIMDK.DDYFNFEKLD...RNNSILDVTELN........----------------
DPOL_ADE02/300-785--VQLNIAAKERADRDKNQTLRSIAKLLSN.ALYGSFATKL....DNKKIVFSDQM........----------------
DPOM_CLAPU/431-902--YKVKCNPNNVTEKN.......IAKLILN.SLIGRFGMNIN..KIKTSLVPSEKHN...ELLT----------------
Q9XNK1_PLEOS/737-1218--NLKTEAEMNKDDISR.....LIYKLILN.SLSGRWGLRDL..NTEMKVIESKDLN..FLNKT----------------
O99973_PORPU/80-490--DKRLR..CKIDPSE......ILYKLNMN.SLYGRFAMKNE..STENIFVNKSDIESLNKYIE----------------
DPOM_NEUCS/366-859--ASIKDNTKGSKKQ........MAKLLLN.TLYGRTGMNDS..AAEIKMLTTNELDN.IQLTN----------------
Q83895_ADEO7/318-798--VKVNIMAKEKASKSNNKIQRSISKLLSN.ALYGSFATRI....DKKKVVFAENI........----------------
DPOL_ADECT/391-876--VQLNISAKEEADKSKNQTMRSIAKLLSN.ALYGSFATKL....DNKKTVFSDQI........----------------
DPOL_BPPZA/50-485--THIKTTSEGAIKQ.......LAKLMLNS..LYGKFASNPD..VTGKVPYLKENGA.LGFRLG----------------
DPOM_MAIZE/299-733--YSKRLDAKAKGEKALD....FIYKITMN.SLYGRFGISPE..STTTQIVSTEESRKLALYND----------------
O11414_9ADEN/323-802--VSINIAAKEKADKDKNMTQRSISKLLSN.ALYGSFATRL....DNKKVVFANSM........----------------
DPOM_ASCIM/588-1048--YTIKSSYTPDDPMY......FIAKLLMN.SLYGRFGMDP...ITIKYSVLTPEESEEKLKNS----------------
DPOM_PODAS/449-902--YKIKANSEGSEKL........ITKFLLN.SLLGRFGMSIF..KLKTDIVSVEKAK.KLAVTN----------------
Q9WF13_ADE17/335-820--VQLNIAAKERADRDKNQTMRSIAKLLSN.ALYGSFATKL....DNKKIVFSDQM........----------------
Q9TEH5_9PEZI/309-758--YGLNPVLEQVLWEEP......TAKLLLN.GLYGRFGMNPH..TTQATIVASADLP.TFILDN----------------
DPO2_KLULA/409-873--YSMKETHTACSCEEQPCPIRMVAKIALNGGGYGKFVQKP...IDKEIYIVKRDV.....VAG----------------
Q35599_PHYPO/7-446--YNRRLKAKDPALKD.......LYKKLLN.TLYGRFGLVYE..QIDIISPEKELITDNTYISH----------------
Q9YUR6_9ADEN/338-828--VTKNILAKEKATVEKNPVKRAISKLLSN.ALYGSFATRE....SNDITIFENHIQ......E----------------
Q09038_LACKL/414-878--YTLKDIHTNCKCKEQPCPIRMVAKIALNGGGYGKFVQKP...IDKEVYIVKRDV.....VAG----------------
DPOL_BPCP1/56-488--RYKKENAQSPAEKQK......AKIMLNS..LYGKFGAKII..SVKKLAYLDDKGI.LRFKND----------------
DPOL_ADE04/437-922--VQLNIAAKERADKEKNQTMRSIAKLLSN.ALYGSFATKL....DNKKIVFSDQM........----------------
Q9QM79_9ADEN/238-780--VSKNIAAKEKADRDKNEVMRSISKMLSN.ALYGAFATNM....DTTRILFEQDL........----------------
DPO1_KLULA/415-878--YKLKIKYEKQNNKVK....RNVIKIIMN.SLWGKFAQKW...VNFEYFIKSEDD.....IDF----------------
DPOL_ADE40/433-918--VHLNITAKERADREKNQTLRSIAKLLSN.ALYGSFATKL....DNKKIVFSDQM........----------------
O21376_PICKL/474-939--YSRKSNAKGIYRT.......LYKSTLNN..LLGRFSLAPMNYKDAMMDNTTFKMLSLLHNIT----------------
Q96206_BPGA1/50-490--MEIKNSPDSSAEQSL.....QAKLMLNS..LYGKFATNPD..ITGKVPYLDENGV.LKFRKG----------------
DPOL_ADEB3/262-744--VQLNIAAKERADKEKNQTLRSIAKLLSN.ALYGSFATKL....DNRVTVFSDQM........----------------
O74719_DEBHN/418-882--YKLKLKYEEEGNKVK....RNVIKIIMN.SLWGKFAQKW...IDTNYSIKAESD.....VDF----------------

PF03337

Q1HTT9_9POXV/3-657IPAIFAPE.DPEASSFEAVLTSVDIALAAYLGGYKIRILSALQWDFSAQILRTGVMKIADEAARA.ETD-----------
Q3I8X2_MONPV/3-635IPVVYHDD..DNTTTFITVLTSVDIETAIR.AGYSIVELGALQWDDNIPELKDCLLDSIKIIYDL.NAV-----------
Q8V3R9_SWPV1/2-644IPIIFNDDINESSYTFYTPLTSIDIQLARKIGGYKIKEICGLQWEESVRV.KKCIDDTIDNVGNI.YTD-----------
Q070L3_CPRV/15-686FPVLAADG.......GEGVYTSAEVEYAVRVLDCRVEVLEALEWPGRAPIFREALEAFAERVASPAGDR-----------
Q08FW7_DPV83/4-651IPIIFLDDVTEPSYTFYTPLTCVDIELARMIGGYKIRELGALQWESSVHI.SDYLFDTINNIGKLSIED-----------
Q6TUY6_YMTV5/6-640IPIIHLNNIPEYCSTFFASLTSVDISLVKKIGGYIIEEIEAIEWDDYIKI..NKISELISILSKV....-----------
Q2F8G6_ORFV/3-635IPVLFDPA.DEERLRFSAVLTSVDIETALRLKGYEIRVVCALEWGRCDEVLKAGLEAQMTATREL.NIP-----------
Q9Q8S1_MYXVL/3-624IPVLWTN...EDTHTFYTALTSVDIRSANRLGGYKIKQIGALVWNESYSL.RDVAIHRFNGIHRL....-----------
Q6TVH8_9POXV/3-637IPVLFDPD.DEDQLRFSVVLTSVDIETANRLKGYSIRVIAALEWGRSEEVLRTGIEAQMAATREL.NIP-----------
Q98188_MCV1/3-654IPFLFSKR.DPDALAFDAVLTSVDVNNAVRMGGYQIQVQGALEWERSEPVLAQGVQELLAAADA..EGA-----------
A7XCD4_9POXV/6-641IPIIHLEDMSESCCTFFATLTSVDIALARKIGGYIIKEIEVIEWEDSVKV..NKISELITIINKI....-----------

PF00136

DPOD_YEAST/555-991.......................................NDKLYNRAEDPL.FVLENN........IQVDSRYYLTNQLQ
DPOL_GPCMV/556-1073........P..........................GSSKNVPNYEISEDPG.YVIEHK........LPVNGEKYFE.HVV
DPOL2_AERPE/390-793........G..........................PLYTRAKPYFMASKEE.................VDVEYYVDKQVV
O40910_HHV8/533-1006......................................PGSLRSELAEHPE.YVKQHG........LRVAVDLYFD.KLV
DPOL1_SULSO/450-869.....................................KDGVKPVQLAKVTE.................IDAEKYLE.ALR
Q89604_9ALPH/639-1203.AAAVNA.LRGTAPS..............APPGGGARPGRLLISDMAEDPG.YARAHA........VPLNTDYYFS.HLL
Q9YQZ6_9VIRU/602-1028.....................................RGMLANKSSAVGPE.RRIER.........ALVNLIMKGGAIRV
Q9WSY3_9ALPH/582-1139RGERKFR.FSEVSVPEVPG......TFSNSAKTRAVQKPKVLISDMAEDPT.YLIENN........IPLNTDYYLS.HLL
DPOL_ARCFU/361-774........G..........................NIGDRAYPIDLIEDFD.GENLRIKTKSGIEIKKLDKDYYIDNQII
DPOL_RCMVM/533-1077...................................ESKKRAPNYEVAEDPA.HVREAK........IPIHAEKYFD.QIV
Q9YW56_MSEPV/569-1067.......................................YMKPIDKSWNIS.YIK............DISKKMIIIPSNL
DPOL_ASFL6/457-978......Q.F.........................DIQGHRTDTTRKGDKME.YVSEAKA.....KNLPIDILFYINNYVL
DPOD1_CAEEL/520-978.....................................AKNVPAYERAEDPT.FVLQNN........IPLDTKHYLTNQLA
DPOL_FOWPN/483-977.....................................ISLPWQKKLCNILS.YE............VIADSKFYLPKDKR
DPOL_HHV21/617-1200DAAAPGDEPAPPAALPSPAKRPRETPSHADPPGGASKPRKLLVSELAEDPG.YAIARG........VPLNTDYYFS.HLL
Q9Q6Z6_9GAMA/520-997......................................KGSLISDMAEDPA.FVEANR........IPIASDLYFD.KIV
Q59691_PYROC/388-793........G..........................SVSSRAYPYFMVDPST.................IDVNYYIDHQIV
O36638_9PHYC/422-974NDMYREF.SVFDRMYWEA.......QSLGSRVPYVIVRGNGSVNERSEDPR.FVEMAD.......HLRIDTKYYIDQQLK
DPOL_IIV6/578-1226.....................................GCKGKQSEKIESVE.YFKTHSK......VLKLDYGYYIE.RLI
Q69281_9ALPH/606-1168GELDLCH.QNSNTSCPGDS.....VMTNKETYVRHSPRNKLLISDMAEDPK.YLLANN........IPLNTDYYLS.HLL
DPOL_EHV1B/611-1173GVVNSMR.GTAQNPV.............VTKTARPQPKRKLLVSDLAEDPT.YVSEND........VPLNTDYYFS.HLL
DPOL_MUHVS/543-1050...................................GCKKNVPNYEIAEDPR.HVVEAK........LSINAEKYYE.QVV
DPOD1_MESAU/546-1005.....................................AKGVAAYMKSEDPL.FVLEHS........LPIDTQYYLGQQLA
DPOLA_ORYSJ/834-1303.....ES.TH.......................SGGIAQRARHPEELKRNP.....DK........WMIDIDYYLSQQIH
DPOL_RSIV/397-938......G.V.........................PEGALGARLLDFERWRD.MKVA..........YPLDRLYYMKSVVN
DPOL1_SULAC/448-867.....................................KDGVKPIQLAKISE.................IDIEKYVE.TLR
Q9Y1T1_TOXGO/1006-1612KGGEPGA.GQEAGNREADTA....EKAKEGRSGPLSPAERAFHPREVAGN..PL............LKIDAEYYLEQQLL
DPOL1_SULOH/448-867.....................................KDGVKPVQLAKLSE.................IDVDKYIDAVRS
DPOL_BPT4/383-855...................................FHIRGVLTYRRAVSG..................LGVAPILDGNKV
Q98207_MCV1/494-994.....................................SELPWQLAVANVRN.HER............IVDASYVLPERER
DPOLA_OXYNO/783-1270.....DT.TKS......................STALSDKAYHPDEVISSR.GK............VTIDSDWYVSTQLL
DPOL_EHV2/530-1004.....................................PKGKLRSEMAEDPA.YAAQHN........IPPAVDLYFD.KVI
DPOL_ORFN2/499-998......................................EGPWRRRIANVKS.YER............VVDKTFRLDKNER
DPOLA_DROME/805-1258.....TN.AA........................MQRAYHLDELKTSEDKK...............LQLDTNYYLGHQIH
DPOD1_PLAFK/544-1000.....................................VKGQAQYERAEDPL.YVLDNN........LAIDYNHYLD.AIK
DPOL_VZVD/597-1136AKSVALL.RGDPLQN.............TAGKRCGEAKRKLIISDLAEDPI.HVTSHG........LSLNIDYYFS.HLI
O41930_MHV68/528-1001.....................................SEKGLKSDLAEHPA.YVRQQN........LRIAHKVYFD.KLV
DPOL_TUHV2/556-1135........P..........................DGRANAPNYELAEDPD.YVAAHR........VPIHAAKYFE.QVV
DPOD1_DROME/534-994.....................................AKNTPAYQKAEDPL.YVLENS........VPIDATYYLEQQLS
DPOL_THEGO/348-763........G..........................RIGDRAIPFDEFDPAK..............H.KYDAEYYIENQVL
Q9WT26_HHV6H/517-998...................................TGNKQTHNYELAEDPN.YVLEHK........IPIHAEKYFD.QII
DPOL_EBVB9/532-1013...................................GGVKGARKTEMAEDPA.YAERHG........VPVAVDHYFD.KLL
DPOD_CANAX/484-939......................................GGDKNYEKSEDPL.YVLENS........LPIDVKYYLDQQLT
DPOLA_TRYBB/684-1157........E..........................HIDDKAYHIDEVRRSD.G.............LSVDVEWYLSSQLY
DPOL_BPR69/386-859...................................FHIRGILTYNRAIKGN.................IDAPQVVEGEKV
DPOA_YEAST/792-1248....DNA.ADT.....................PALSVAERAHALNEVMIKS.NN............LIPDPQYYLEKQIF
DPOL_SFAVA/492-1090......................................ETKSALAIEEISY.FKDNPG.......CAQVDNMYYIQ.QLV
DPOL_VACCA/497-995.....................................ANVPWTKKLVNIKT.YET............IIDRSFKLGSDQR
O74046_CENSY/420-835.....................................KTGVKPVEMAQAGE.................VDTSKYLEFMES
Q9Q8R2_MYXVL/498-996.....................................AKDAWQKKLVNIKT.YER............IIDKGFTLGSTDR
O93043_FHV1/606-1159.LLGVDG.LRGTII...............NKALNNTKKRKLLVSDLAEDPS.YVIANG........IHLNTEYYFS.HLL
DPOD_SCHPO/534-990.....................................AQGDQFYMRSEDPI.YVLENN........IPIDAKYYLENQLS
DPOLA_OXYTR/809-1299.....PS.KT.......................NPALAGKAYHPEEVVSSK.GK............ILLDIEWYITMQVL
Q9QEL0_9ALPH/621-1171.AAQVSA.LRNAPQD..............KEKEESATRRRLLVSDLAEDPA.YVMANG........IPLNTDYYFS.HLL
DPOL_METVO/393-818........R..........................SISERAELLEYAG...................DYDINYYIDNQVL
O92827_9BETA/515-999........E..........................TVKKTFHNYELAEDPA.YAIENN........LKINADKYFE.QIM
DPOZ_YEAST/919-1384....................................QGQLLRERCVSPEEF.LEGEN.........LELDSEYYINKILI
DPOL1_AERPE/535-951.....................................KLGVKPVQLARLSD.................VDPGKYVEHVKT
DPOLA_HUMAN/783-1246.....................................GSNLTASQRAYAPEQLQKQDN........LTIDTQYYLAQQIH
Q69390_9ALPH/516-1008....ERD.AGAV....................RPGLAPGKLLVSDLAEDPA.YVVAHG........VPLNTEYYFS.HLL
DPOL_RHCM6/533-1017........D..........................GRSSGVRNYEIAEDPT.YVREHG........VPIHADKYFD.QVI
DPOL_PBCVN/432-881....................................KNLDTKQSFRAEDPT.FAQEND........LIVDRLFYIEHQLM
DPOL_ALHV1/550-1026......................................NGHLVSDMAEDPT.YAEQNK........IPIASDWYFD.KII
Q59690_PYROC/488-905.....................................KEGVKPVQLARLPE.................VDVEKYVESMRN
DPOD1_SOYBN/511-969.....................................AKGAKAYERSEDPI.YVLENN........IPIDPHYYLENQIS
DPOL_SHV21/522-994......................................TTSCISNMAEDPT.YTVQNN........IPIAVDLYFD.KLI
DPOA_SCHPO/773-1222......A.D.........................GHPADRAYSPQEIMNTN.ST............LVIDYNYYLSHQIL

PF08490

Q7Q7P3_ANOGA/1540-1943-----------------------------------DFNRIVIDTGKRTVGD---------------AISYTDYIVQNIRN
DPOE_CRYNJ/1526-1917-----------------------------------DFGRVFLLTSKPDAGS---------------AFAFAKYLVAAANS
DPOE_DEBHA/1533-1917-----------------------------------NRNKMLIQTTKVSIEN---------------SYAYGQYILKAARS
Q7RWE3_NEUCR/1533-1926-----------------------------------SSNRLLLQTTKSEVGN---------------AYAYTQYILKSIKG
DPOE_ASHGO/1492-1878-----------------------------------DRNKILLKTSKNTIDN---------------SYAYGQYLIKAIRT
DPOE_EMENI/1495-1885-----------------------------------SPTRLLLQTSKTEVGN---------------AYAYSQYVLKSIRA
Q6K777_ORYSJ/1562-1941-----------------------------------NFSKIIIDTGKVDLLS---------------ARAYCDSLLKTLQT
DPOE_YEAST/1527-1920-----------------------------------DRNQILIKTNKYSPEN---------------CYAYSQYMMKAVRT
DPOE1_HUMAN/1525-1925-----------------------------------NFNRIILCTKKRRVED---------------AIAYVEYITSSIHS
DPOE_SCHPO/1497-1886-----------------------------------SANKILIKTSKLIVQN---------------AVTYSNYLLKSIKT
DPOE_KLULA/1497-1883-----------------------------------DRNKLLIKTQKRSVEN---------------SYAYGQYLMKAIRS
DPOE_YARLI/1513-1873-----------------------------------DQHKLVLQTEKTELQL---------------VYSYSNYIVRQIRT
DPOE_CANGA/1524-1916-----------------------------------DRNRLLIKTNKISPET---------------CYAYSHYMIKSIRS
Q95R46_DROME/3-405-----------------------------------DFNRIILSSGKKTVSD---------------ALGYVDYIVQSLRN
Q59SM7_CANAL/1518-1902-----------------------------------NRNKMLIQTSKISVEN---------------SYAYGQYILKAARS
O62218_CAEEL/1467-1869-----------------------------------TAQKLVLNTGKSTSEE---------------AKGFAEMLIQSLST
Q9ZVC8_ARATH/1484-1864-----------------------------------DFSKVIIDTGKFDLSA---------------AKTYCESLLTVMGS

PF03175

DPOL_ADEB2/267-751-----------------------------------EASASKTIARGNFSIKSSSFIET.......DNFSAEIMPEFVVTY
DPOL_BPPRD/1-440-----------------------------------YDGEGCEVQEHLDYILWGRPAEMF.....NYFNVAVAASITGAAR
Q39432_BETVU/147-571-----------------------------------SWLDGDYLGNDKYVLSYHTNMDN.......TIDRWDPPKNSAIQL
DPOL_ADEG1/238-751-----------------------------------SEADKKNIYEGTEIVKHVTLLND.......DSFNGTEVTLENAPN
DPOM_NEUIN/400-868-----------------------------------EYVTITPLSSGNVLISAKLPEEA.......FGDMNISVPISSAIA
DPOL_ADE12/306-791-----------------------------------EESLMKEIAAGRLNIKSSSFIET.......DTLSTEVMPAFERVY
DPOL_BPM2/50-485-----------------------------------DEEYKDPVYTPMGVFITAWARFTTIT..AAQACYDRIIYCDTDSI
O78938_AGRAE/66-524-----------------------------------NNNFLVTTKNPKVELDTILDNGS........EKHDINIAIASAIT
DPOL_ADE02/300-785-----------------------------------DAATLKGITAGQVNIKSSSFLET.......DNLSAEVMPAFEREY
DPOM_CLAPU/431-902-----------------------------------TRVVKSTTDLGSGMFMDIYVPGIDKNICEDFNLDYIEVLNSTNTD
Q9XNK1_PLEOS/737-1218-----------------------------------ENVDTLFESNRLSLIKSHGPLDP........EVVDLFSKENLIEN
O99973_PORPU/80-490-----------------------------------SEEFRNFRDFGEKYLVEISKTAKG......VKLPELASYVPTYVT
DPOM_NEUCS/366-859-----------------------------------NVIHEFEVDDDKHYVRYDKKPCPVLCAQSEKNYELLSYLDGEKDD
Q83895_ADEO7/318-798-----------------------------------EEKDKKRLENGSAEITSYTTVIS.......KSLPKR.SFEWNQYF
DPOL_ADECT/391-876-----------------------------------ESNIAKEIASGAYVVKSSSYIET.......DNLCAEIMPEFVVAY
DPOL_BPPZA/50-485-----------------------------------EEETKDPVYTPMGVFITAWARYTTIT..AAQACFDRIIYCDTDSI
DPOM_MAIZE/299-733-----------------------------------GFVQSYELSSDKCLVTCKNVRSLD.....LLKLSSDRPTYAAVQI
O11414_9ADEN/323-802-----------------------------------EKGDMERIANGKATITAQTTVIN.......TCLPKKDTTSWERFF
DPOM_ASCIM/588-1048-----------------------------------SCIEATTLPSGNVLFKENKPLGE.......FSNLNTSVPISAAIA
DPOM_PODAS/449-902-----------------------------------YINSVKAISDTDVLISYNKEISRKLVEEHGLNYIEILNSNSKLDL
Q9WF13_ADE17/335-820-----------------------------------DESLLKSIAAGQANIKSSSFLET.......DNLSAEVMPALEREY
Q9TEH5_9PEZI/309-758-----------------------------------DVIDYFTIFVGYEWVTYTPKKFAS.....DNIVRKENSPLTNFHA
DPO2_KLULA/409-873-----------------------------------ECDKLQENENGEICIGKRLVKRPLFYNLDSENYDKMIIEKEDEPI
Q35599_PHYPO/7-446-----------------------------------DTTEFIDITANTCYNNIAITSAIT.......SYARIFMYNTILNY
Q9YUR6_9ADEN/338-828-----------------------------------NPKIRNQLLNKQLTIDSITTLPT.......YNLPYVSIENLTFTL
Q09038_LACKL/414-878-----------------------------------ECENLSQNENGEICIGKRIVKKPKFFNLDGEDYDKMIIERDDDPI
DPOL_BPCP1/56-488-----------------------------------DEEEVQPVYAPVALFVTSIARHFIIS..NAQENYDNFLYADTDSL
DPOL_ADE04/437-922-----------------------------------DEGLLKGISAGTVNIKSSSFLET.......DNLSAEVMPAFEREY
Q9QM79_9ADEN/238-780-----------------------------------TEDDRRGIYEGTQIVRHVTLLNH.......DSLAGTVVCPESTPD
DPO1_KLULA/415-878-----------------------------------ESEEAYKIWDTDFMLIKKIKEST.........YSSKPIQNGVFTL
DPOL_ADE40/433-918-----------------------------------DSATIKSIAAGQINIKSTSFVET.......DTLSAEVMPTFQRAY
O21376_PICKL/474-939-----------------------------------NMLEMKDFDVKMCHVEKEIKYTP......DNMPEYVNKVRNSEFY
Q96206_BPGA1/50-490-----------------------------------ELKERDPVYTPMGCFITAYARENILS..NAQKLYPRFIYADTDSI
DPOL_ADEB3/262-744-----------------------------------EDKYVRGISDGTYDIKSTAFVET.......DNLSSSVMAELKITY
O74719_DEBHN/418-882-----------------------------------DEEEAYKIWDTEYMLIKQHKESE.........YSSKPIQNGVFTL

PF03337

Q1HTT9_9POXV/3-657-----------------------------------QTSRFMMWMAT...TSKLLRGSEAGACAFEALV..VAAFAASHCR
Q3I8X2_MONPV/3-635-----------------------------------TTNNLLEQLIE............NINFNNSSIISLFYTFAISYCR
Q8V3R9_SWPV1/2-644-----------------------------------KSDYVHNYLTQ...KTDLIAHNDIYHMNTL.....FAAFAVSYCR
Q070L3_CPRV/15-686-----------------------------------AAHEFLFREVVANDSGALLGAPFGCRRQRGPRLGHYAAFARGYAR
Q08FW7_DPV83/4-651-----------------------------------IEDNLIDKIMN...ISELFPHKEEDYFPNYLLP..FAAFSASYCR
Q6TUY6_YMTV5/6-640-----------------------------------NTDLLINKFER....GKIFPKVNECQFNNLLP...FYAFAASYCR
Q2F8G6_ORFV/3-635-----------------------------------QTSNLMSRIAS....MPLALETDDSPSGRCSAV..VRAFAASYAR
Q9Q8S1_MYXVL/3-624-----------------------------------.NDKKTDYVDY...CDRLFPCTDDT.....MLI..FYAFCASYCR
Q6TVH8_9POXV/3-637-----------------------------------QTSNLMSRIAS....MPLPLDPDSSPSGRSSAV..VRAFAASYCR
Q98188_MCV1/3-654-----------------------------------AAADLVAWVAR...TPHLLQAHLAEYGPASGLL..LAAFAVSYCR
A7XCD4_9POXV/6-641-----------------------------------NTESLINRFEK....GKIFPKINENRCSDLLL...FYAFAASYCR

PF00136

DPOD_YEAST/555-991NPIISIVAPIIGD..................KQANGMFVVKSIKIN---
DPOL_GPCMV/556-1073KTVTNVLGPIIPK.................DCARKEKFLSYVLPQR---
DPOL2_AERPE/390-793PAALRILQY..FG...................VTEKRLK.GGGRQS---
O40910_HHV8/533-1006HAVANIIQCLFQN.................NTSATVAMLYNFLDIP---
DPOL1_SULSO/450-869STFEQILRA..FG...................VSWD...EIAATMS---
Q89604_9ALPH/639-1203GTVGATFKALFGN.................DTRTTENLLKRFIPET---
Q9YQZ6_9VIRU/602-1028CENFERLEAVTWN.................SVVPGDLVVCTPGKHV---
Q9WSY3_9ALPH/582-1139GTLCVIFKALFGN.................DTKTTDTVLKRFIPET---
DPOL_ARCFU/361-774PSVLRILER..FG...................YTEASLKGSSQ..M---
DPOL_RCMVM/533-1077KAVTNVLLPVFPK.................DMPRRERFFAYVLPIR---
Q9YW56_MSEPV/569-1067NNFNISEIRICIE................SYVIKLITDVSQLLDDK---
DPOL_ASFL6/457-978GLCARFINENEEFQ..............PPGNVSNKDEYAQRRAKS---
DPOD1_CAEEL/520-978KPLARIFEPILGDRAEKILVE.GEHTRVRTVVQSKVGGLAAFTTKS---
DPOL_FOWPN/483-977IFYEIYFKRIASE................VVNLLTDKTQCMLFFSR---
DPOL_HHV21/617-1200GAACVTFKALFGN.................NAKITESLLKRFIPET---
Q9Q6Z6_9GAMA/520-997HGVANILQCLFEN.................NTAATVNLLYNFVTTR---
Q59691_PYROC/388-793PAALRILSY..FG...................VTEKQLKAAATVQR---
O36638_9PHYC/422-974NPILGIVEAFPDG..................RASLERVFREFSRRA---
DPOL_IIV6/578-1226EPLDQVFQAVFKN..................CQEKETIYSDNFRKT---
Q69281_9ALPH/606-1168GTLCVTFKALFGN.................DVKITETVLRRFIPET---
DPOL_EHV1B/611-1173GTISVTFKALFGN.................DVRTTENLLKRFIPET---
DPOL_MUHVS/543-1050KAVTNTLMPVFPR.................DMPKREKFFSLVVPQR---
DPOD1_MESAU/546-1005KPLLRIFEPILGEGRAESVLLRGDHTRCKTVLTSKVGGLLAFTKRR---
DPOLA_ORYSJ/834-1303PVVSRLCASIQGT.................SPARLAECLGLDSSKF---
DPOL_RSIV/397-938ACDQLLVTAGYGPV...............CSKVYAAHLQLAYVHKQ---
DPOL1_SULAC/448-867TTFEQILKA..FG...................ISWD...EIVSTIS---
Q9Y1T1_TOXGO/1006-1612PPIQRMCAFVE.G................TSASRLAECLGLDGSKH---
DPOL1_SULOH/448-867.TFEQILKA..FG...................LIGA...NLLQLLS---
DPOL_BPT4/383-855.MVLPLREGNPFG................DKCIAWPSGTELPKEIR---
Q98207_MCV1/494-994VFYEIYFRRLATE................LVNLLDNKPLCAEFFTR---
DPOLA_OXYNO/783-1270PPITRLIEHIE.G................IEVEFVAQCLGLDPKKY---
DPOL_EHV2/530-1004HGAANILQCLFEN.................DSDKAARVLYNFADLP---
DPOL_ORFN2/499-998IMYEVYFKRLCTE................IVNLLDNKAMCTLFFER---
DPOLA_DROME/805-1258PVVTRMVEVLEGT.................DASRIAECLGMDPTKF---
DPOD1_PLAFK/544-1000SPLSRIFEVIMQNSDSLFSG...DHTRHKTILTSSQTALSKFLKKS---
DPOL_VZVD/597-1136GTASVTFKALFGN.................DTKLTERLLKRFIPET---
O41930_MHV68/528-1001HSVANIIQCLFDN.................DTDYTVKIIYNFLNIQ---
DPOL_TUHV2/556-1135KAVTNTLYPVFPR.................GVVRRDRFLADLVPKR---
DPOD1_DROME/534-994KPLLRIFEPILGDNAESILLK.GEHTRTRTVVTSKVGGLAGFMTKK---
DPOL_THEGO/348-763PAVERILRA..FG...................YRKEDLRYQKTRQV---
Q9WT26_HHV6H/517-998KAVTNAISPIFPK.................TDIKKEKLLLYLLPMK---
DPOL_EBVB9/532-1013QGAANILQCLFDN.................NSGAALSVLQNFTARP---
DPOD_CANAX/484-939KPLERIFIPILGETKTKELLT.GSHTRTIKVAAPKTGGLLRFAKKS---
DPOLA_TRYBB/684-1157PPVMRLCEHIQGFVPEQLSEAMCIASHMRTERDVKEEDTANDFSHC---
DPOL_BPR69/386-859.YVLPLREGNPFG................DKCIAWPSGTEITDLIK---
DPOA_YEAST/792-1248APVERLLERID.S................FNVVRLSEALGLDSKKY---
DPOL_SFAVA/492-1090NPLTKVSEAVWRR..................SNSVNIAIAPFIYYN---
DPOL_VACCA/497-995IFYEVYFKRLTSE................IVNLLDNKVLCISFFER---
O74046_CENSY/420-835.TLDQLTSS..MG...................LDFD...EMLGKPK---
Q9Q8R2_MYXVL/498-996IFYEVYFKRLATE................VVNLLDNKVLSTSFFEK---
O93043_FHV1/606-1159STISVTFKALFGN.................DVKTTEILLKRFIPET---
DPOD_SCHPO/534-990KPLLRIFEPILGEKASSLLH..GDHTRTISMAAPSVGGIMKFAVKV---
DPOLA_OXYTR/809-1299PPITRLIEHID.G................IDVEFVAQCLGVDPKKY---
Q9QEL0_9ALPH/621-1171RAASTTFKALFGN.................NTRVTESLLKRFIPEV---
DPOL_METVO/393-818PPVIRIMES..LG...................ISEDELK.NSGKQF---
O92827_9BETA/515-999KAVTNAISPIFPK.................TGIKKEKFLLSILPLK---
DPOZ_YEAST/919-1384PPLDRLFNLIGINV..............GNWAQEIVKSKRASTTTT---
DPOL1_AERPE/535-951.AFEQMLMA..FG...................ISWD...DISGVRK---
DPOLA_HUMAN/783-1246PVVARICEPID.G................IDAVLIATWLGLDPTQF---
Q69390_9ALPH/516-1008STLSVTFKALFGN.................DTKITERLLKRFIPET---
DPOL_RHCM6/533-1017KSVTNVLSPVFPP.................QTLRKDKFLLGILPHR---
DPOL_PBCVN/432-881KPICSLFEPLLDDP...............ETEIFGHPLIKGKIDEL---
DPOL_ALHV1/550-1026HGVANILQCVFNN.................NTSATVEVLYNFVRNP---
Q59690_PYROC/488-905.VFEQLLLA..IS...................MSWD...EIIGSSR---
DPOD1_SOYBN/511-969KPILRIFEPILKNASKELLH..GSHTRSISISTPSNSGILRFAKKQ---
DPOL_SHV21/522-994HGVANIIQCLFK..................DSSKTVSVLYNFVSTP---
DPOA_SCHPO/773-1222PPIERVIAPIE.G................TNRARLAECLGLDARKY---

PF08490

Q7Q7P3_ANOGA/1540-1943RELFHSVSLSFQQ--------------------AWEFLLWNDPTNYGGV
DPOE_CRYNJ/1526-1917QELFRHLIIDVAQ--------------------FWNYLAWMDVANFGGV
DPOE_DEBHA/1533-1917KPLFNFLDLRIVK--------------------YWDLLVWMDEYNFGGR
Q7RWE3_NEUCR/1533-1926KPLFHFIDLEIKE--------------------YWDYLVWYDEFNYGGK
DPOE_ASHGO/1492-1878RPLFSYLDLKIVR--------------------YWDILLWMDQYNHGGC
DPOE_EMENI/1495-1885NPSFHFIDLDIKE--------------------YWDYLVWYDEYNYGGK
Q6K777_ORYSJ/1562-1941RDIFEWVELEPLH--------------------YWHSLLFMDQYNYGGI
DPOE_YEAST/1527-1920NPMFSYLDLNIKR--------------------YWDLLIWMDKFNFSGL
DPOE1_HUMAN/1525-1925KETFHSLTISFSR--------------------CWEFLLWMDPSNYGGI
DPOE_SCHPO/1497-1886LPLFHFLDLNVTE--------------------YWDYLLWMDSVNYGGK
DPOE_KLULA/1497-1883KPMFAYLDLKIDR--------------------YWDVLIWMDKYNYGGR
DPOE_YARLI/1513-1873HPILKYVSVDITR--------------------YWDTFLWMDKWNYGGY
DPOE_CANGA/1524-1916NPMFTYLDLNIER--------------------YWDLLIWMDKYNFSGL
Q95R46_DROME/3-405KEMFHSIQLSFEQ--------------------CWNFMLWMDQANFSGI
Q59SM7_CANAL/1518-1902KPLFNFLDLRIVK--------------------YWDILIWMDEFNYGGR
O62218_CAEEL/1467-1869NVVFAALHITPVK--------------------FFDAMLWMDAHNHTGI
Q9ZVC8_ARATH/1484-1864RDIFKLILLEPVH--------------------YWHSLLFMDQHNYAGI

PF03175

DPOL_ADEB2/267-751PPAPS..AELDES-----------------DENE.EHTLFIPKDSH---
DPOL_BPPRD/1-440SVLLRALAQAERP-----------------LYCDTDSIICRDLKNV---
Q39432_BETVU/147-571AAAITACARIYMY-----------------KYTSREDCYYTDSVVL---
DPOL_ADEG1/238-751PFSEESLRQQFRY-----------------ADDP.EQEEPEAEEDG---
DPOM_NEUIN/400-868AYSR...IHMSHF-----------------LTKYSNNIYYIDTDGI---
DPOL_ADE12/306-791SPNQL.ALVNSEA-----------------EESD.EDQGPAPFYSP---
DPOL_BPM2/50-485HLTGTEVPEIIKD-----------------IVDP.KKLGYWAHEST---
O78938_AGRAE/66-524AYSR...IQMSKF-----------------KNNPNFKLFYSDTDSV---
DPOL_ADE02/300-785SPQQL.ALADSDA-----------------EESE.DERAPTPFYSP---
DPOM_CLAPU/431-902EKGTMPDNNVSIT-----------------TAAAVLSYARIHMAQI---
Q9XNK1_PLEOS/737-1218KKINPFIEDKDKP-----------------WGKNKSAVQLSAAISA---
O99973_PORPU/80-490SYARIVLHEAMMG-----------------VLDRGGNVYYRDTDSI---
DPOM_NEUCS/366-859GFIINSTSIAAAT-----------------ASWSRILMYKHIINSA---
Q83895_ADEO7/318-798SNLPE.MPPKDSK-----------------DTNE.NFNFPLFIGNQ---
DPOL_ADECT/391-876PPVNSDVRQLAPP-----------------SCSE.EDPTKDPLAEA---
DPOL_BPPZA/50-485HLTGTEIPDVIKD-----------------IVDP.KKLGYWAHEST---
DPOM_MAIZE/299-733SAAVTGYARIRMH-----------------PFISRDDCYYTDTDSV---
O11414_9ADEN/323-802SNLPQ.TTALPVA-----------------PSTE.NEGNDINPKSF---
DPOM_ASCIM/588-1048AYSR...MIMSEY-----------------LIKYADNLYAVDTDGI---
DPOM_PODAS/449-902EKNNS.FKDVAVS-----------------ISAAVTAYARIFMAQT---
Q9WF13_ADE17/335-820LPQQL.ALVDSDA-----------------EESE.DEHRPAPFYTP---
Q9TEH5_9PEZI/309-758ELEQSVQISIRIT-----------------AYARICMAETIKHVTQ---
DPO2_KLULA/409-873YSTQCGISILSAS-----------------RYRLYKLCKQFENIDI---
Q35599_PHYPO/7-446NLHVIYIDTDGLF-----------------LKNPIPDIALTTSKEM---
Q9YUR6_9ADEN/338-828KN.....RTDSAE-----------------RNLELDDELTSPFNSL---
Q09038_LACKL/414-878YSTQCGVSILSAS-----------------RYRLYNLCKKFEGLEI---
DPOL_BPCP1/56-488HLFHS...DSLVL-----------------DIDP.SEFGKWAHEGR---
DPOL_ADE04/437-922LPQHV.ALLDSDP-----------------EDSE.DEQRPAPFYTP---
Q9QM79_9ADEN/238-780AFRHHQLRQYFDR-----------------KPPT.RTAEEENEEQE---
DPO1_KLULA/415-878SWARYHMKSIWDA-----------------GAKEGAECIYSDTDSI---
DPOL_ADE40/433-918SPEQL.AVVHSDA-----------------EESD.EEPGHAPFYTP---
O21376_PICKL/474-939TNALKSMNNFVQN-----------------TNTLDSSVIMTTFVNA---
Q96206_BPGA1/50-490HVEGLGEVDAIKD-----------------VIDP.KKLGYWDHEAT---
DPOL_ADEB3/262-744SP....VKQQTDA-----------------TRKH.RQCTPTSNSSS---
O74719_DEBHN/418-882SWARHHMKLLWDA-----------------STRPDTECIYSDTDSI---

PF03337

Q1HTT9_9POXV/3-657FHLHKIVCDIDSHFVGDVVERHSFCKVWLREPAGAIADCLSKQLEA---
Q3I8X2_MONPV/3-635AFIYSIMETIDPVYISQF....SYKELYVSSSYKDINESMSQMVKL---
Q8V3R9_SWPV1/2-644KKLHTLIENIDSHFLGDYVIKHNYRELWISNTLTLDTHFLCDTIKM---
Q070L3_CPRV/15-686VAAHELMRRLDNEYCPRVVSSYTSSRVFVRPSCFGAAS..RKALEI---
Q08FW7_DPV83/4-651MKLHSIIKRVDSHFLGEYVFRHNYKEVWINDSFKKDQLFLSEMIKV---
Q6TUY6_YMTV5/6-640ERVHNLIKKIDSHFLGNVVIKHNTVNIHTTCKVN.NEGFLSETYKI---
Q2F8G6_ORFV/3-635RAVHGFIERVDCHATAAFVLRHGYDRFWVRERAARCLAGVSGIQEV---
Q9Q8S1_MYXVL/3-624RKLHNLIRTIDSHYLGEYVIKHNYKEIWTRDVVKLSDEFLSNVVKL---
Q6TVH8_9POXV/3-637STIHSLIERVDSHFSGNFVVRHGYDRFWVRDRVAKHLTGVSGIQEV---
Q98188_MCV1/3-654AQVHKVIAEVDNHYYSSHVRAHSYNCICVPPALSSVLPELDWGSAL---
A7XCD4_9POXV/6-641ERVHNLIKEIDSHYLGNVVLKHNTIKIYTDSEVT.NKNFLSETCKL---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window