Sequence alignment for CL0194

PF00136

Q9Q8R2_MYXVL/483-985--GAFTYILPQSMVFEYRASTLIKGPLLKLLLEKKIIMTR........................................
DPOD_SCHPO/519-956--MARVTGVPFNFLLARGQQIKVISQLFRKALQHDLVVPNIR......................................
DPOL_MUHVS/528-1031--IARLARIPLRKVIFDGQQIRIYTCLLEECSGRDMILPNMPSLGHGAAAAIEEAAAGGEGDETSEGEN...........
DPOD1_DROME/519-959--MARVTGVPLESLLTRGQQIKVLSQLLRKAKTKGFIMPSYT......................................
DPOD_YEAST/540-973--MARVTGVPFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQ......................................
DPOL_GAHVM/591-1150--IAKLAGILLSKAIFDGQQIRVYTCLLRLARSHGFILPEKNKKF....................AETVSLTCEEDQTEI
DPOA_YEAST/777-1229--LTNLAGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGNRS.............RAQKQRQNEENADA.......
DPOL_ALHV1/535-1007--IAKIANIPTRRVLSDGQQIRVFTCLLAAAQERDYILPM........................................
DPOL_HHV2H/602-1181--VARLAGINITRTIYDGQQIRVFTCLLRLAGQKGFILPDTQGRFRGLDKEAPKRPAVPRGEGERPGDGNGDEDKDDDED
Q98207_MCV1/479-983--AAATYLLPQCLALEYRASTLIKGPLLRLMLRERVVYVR........................................
DPOLA_ORYSJ/819-1284--LTNISGNLWGKTLQGSRAQRVEYLLLHAFHARKFIVPDKFARSKEFNSTKRKMNPDTEAARPDEADPSIDDEGHHVDQ
DPOD1_SOYBN/496-935--MARVTGVPISFLLSRGQSIKVLSQLLRRARQKNLVIPNAK......................................
Q57UW4_TRYB2/670-1122--LTLLAGNLWSRTLYGARSERIEYLLLHAFHNLKFVTPDKKKRDL................KRGREDDD..........
DPOL_ASFB7/442-955--ILSYTSLYDCIYYAGGHKVCNMLIAYAIHDEYGRIACSTI......................................
DPOL_HHV6Z/502-979--VARLAHVTARCVVFEGQQKKIFPCILTEAKRRNMILPSMVS.....................................
DPOD1_CAEEL/505-943--MARVTGVPMNFLLTKGQQIKILSMMLRRCKQNNFFLPVIE......................................
DPOL_EBVB9/517-994--IAKIAHIPCRRVLDDGQQIRVFSCLLAAAQKENFILPM........................................
G8BKE7_CANPC/511-946--MARVTGVPFSYLLSRGQQIKVVSQLFRKCLQEDIVIPNMK......................................
DPOL_VACCW/482-984--GASTYVLPQSMVFEYRASTVIKGPLLKLLLETKTILVR........................................
DPOA_SCHPO/758-1203--LTNIAGNSWARTLTGTRAERNEYILLHEFKKNGYIVPDKQQSIR.............RHAEAFGAEDGLQEE......
DPOLA_HUMAN/768-1227--ITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRK.............PQQKLGDEDEEIDGDTNKY..
Q6TVU5_ORFSA/488-991--AASTYLLPQSVVFEYRASTCIKGPLMKLLLENRTVMVR........................................
DPOZ_YEAST/904-1362--QARLIGIDFHSVYYRGSQFKVESFLIRICKSESFILL.........................................
DPOL_VZVD/582-1117--VARLARITLTKAIYDGQQVRIYTCLLGLASSRGFILPD............GGYPATFEYKDVIPDVGDVEEEMDEDES
DPOL_HHV8P/518-987--IAKLAKIPTRRVLTDGQQIRVFSCLLEAAATEGYILPV........................................
DPOL_SHV21/507-976--IAKLAKIPTRRVLTDGQQIRVFSCLLAAARAENYILPV........................................
DPOL_EHV2/515-985--IAKIAKIPTRRVLTDGQQIRVFSCLLDVAGREGYILPV........................................
DPOL_FOWPN/468-966--ASSTYLLPQSLALEYRASTLIKGPLLKLLLEERVIYTR........................................
DPOLA_DROME/790-1239--ITNICGNTMTRTLQGGRSERNEFLLLHAFHEKNYIVPDKKPVSK..............RSGAGDTDATLSGADAT...

PF03175

DPOL_ADEG1/239-749--CDRSFMPRVGRLLFNDIIFRMPNPNYVKKDASR..........-----------------------------------
Q9QM79_9ADEN/239-780--CDRFFMPRVGRLLFNDVLFHLPNPNYDKKDPTR..........-----------------------------------
Q9YUR6_9ADEN/339-828--VERNFMPRQGRILFNDITIKFPNPDYYVAKEEK.KN.......-----------------------------------
DPOL_ADEB3/263-744--VSRNFMPRCGKILFNDLTFALPNPTHAARKDFK..........-----------------------------------
DPOL_ADECT/392-875--ICRNFMPRAGRLLFNDITYSLPNPSYVPAKSYE..........-----------------------------------
DPOL_ADEB2/268-751--INRNFMPRNGKILFNDISFCLPNPKYEKRKDFA..........-----------------------------------
DPOL_ADE40/434-918--ITRNFMPRAGKILFNDITFALPNPSSKKRTDYR..........-----------------------------------
DPOL_ADE12/307-791--ISRNFIPRAGKILFNDITFALPNPHYKKRTNFL..........-----------------------------------
DPOL_ADE02/443-927--ITRNFMPRAGKILFNDVTFALPNPRSKKRTDFL..........-----------------------------------
Q9WF13_ADE17/336-820--ITRNFMPRAGKILFNDVTFALPNPLSKKRTDFE..........-----------------------------------
DPOL_ADE04/438-922--ITRNFMPRAGKILFNDVTFALPNPAYKKRTDFQ..........-----------------------------------
Q83895_ADEO7/319-798--LTRSFMPRAGKLLFNDITLSLPNPCFKKPSHTT..........-----------------------------------
O11414_9ADEN/324-802--ITRNFLPRAGKLLFNDITFSLPNPQYKKPSRGT..........-----------------------------------
DPO2_KLULA/409-871--......SYNVDIILYAWYGSGYDYQHVLPYMKS.KC.......-----------------------------------
Q09038_LACKL/414-876--......NLKKNVILYAWFGSGYDYQHVLPYFKK.KC.......-----------------------------------
DPO1_KLULA/416-866--ICGELNISSVELIAHNGGG..YDFHYILSSMYN.PA.......-----------------------------------
O74719_DEBHN/419-870--ICSELKNKNIELIAHNGGA..YDFHYILSSMYK.SS.......-----------------------------------
DPOL_BPCP1/57-480--TYTETGEDEFIIFFHNLK...FDGSFLLSFFLNNDI.......-----------------------------------
Q96206_BPGA1/50-479--......NSNSDIYFHNLK...FDGSFILPWWLR.NG.......-----------------------------------
DPOL_BPM2/50-474--......EIQADLYFHNLK...FDGAFIVNWLEQ.HG.......-----------------------------------
DPOL_BPPZA/50-474--......KVQADLYFHNLK...FDGAFIINWLER.NG.......-----------------------------------
DPOL_BPPRD/2-433--PRRSRKKVEYKIAAFDFETDPFKHDRIPKPFSWGFY.......-----------------------------------
O21376_PICKL/474-939--KDMCVKANNYTFYCHNLSG..FDSVYIMSALIK..YTRVKGSE-----------------------------------
Q35599_PHYPO/8-446--LNTLYILKYKDIIKNQIPFNLFPVINNVDNLNIFSL.......-----------------------------------
O99973_PORPU/80-478--.......ARNIAYFHNLSG..FDGIYLIPLLIT..........-----------------------------------
Q9XNK1_PLEOS/738-1218--DLMVIENDNRFYYAHNLSD..FDGMFVLKSLIN.TS....KSH-----------------------------------
E6ZE21_BETVM/147-562--...KMNPEIQTVYFHNFSR..FDGILILRHLVL.HN.......-----------------------------------
DPOM_MAIZE/299-724--....RRGSSMVVYFHNLSQ..FDGIMILSFLTK.SY.......-----------------------------------
Q9TEH5_9PEZI/309-758--....IINLPGYIYVHNLTK..FDAYFILKIIYD.NF.......-----------------------------------
DPOM_NEUCS/366-859--.KDMLKYDKHTVYCHNFSK..FDINFIIKILVQ.EF.......-----------------------------------
O78938_AGRAE/67-512--DICIRKYKNYKVYLHNFAK..FDGYFLVKYLSK.LG.......-----------------------------------
DPOM_NEUIN/401-859--SIMLRKYDGYKVYTHNFSY..FDGIFIIDILSR.LG.......-----------------------------------
DPOM_ASCIM/589-1039--TLLKSTNHGKKFYVHNLAH..FDSVFILDTLSK.LG.......-----------------------------------
DPOM_CLAPU/432-888--EMMRYKYRNVLFYAHNLGK..FDAVFLLKELLRFNLTTEGLNN-----------------------------------
DPOM_PODAS/450-889--INTIVEDDKKIKVKKKKPISDVNKKSQNKDHYE.IS.......-----------------------------------

PF08490

D8PW53_SCHCM/1455-1844--...TYAQLKDK....RASILSGCKAYDYPAACDFTT------------------------------------------
K1Q2Z7_CRAGI/498-892--....FNAERNSKLSKVDEED......LPPANHTFDY------------------------------------------
K5UTI1_PHACS/1501-1886--....YLDLLNK....RPNQ.GSNISFTYPDSLDFTT------------------------------------------
T1J6P1_STRMM/1470-1868--MNSLYSAERNAKLATDSDTN......IPEDGYRFDI------------------------------------------
E0VSJ8_PEDHC/1513-1911--LKNVYNKERNNRISNGSNEL.....ELPPDDFTFEV------------------------------------------
G8BQ26_TETPH/1521-1912--IEQLYKTAYNK...KKDDHYNHYRSINLTKDLNFEQ------------------------------------------
G0T1H4_RHOG2/1536-1927--.ERLKKDKSAK.........REVGAFEYADRMTMIV------------------------------------------
J0M8E9_LOALO/1625-2027--LSNMYASEKAN.....LSADVIVSFLSRKADMNFTV------------------------------------------
B0WNF0_CULQU/1523-1926--LKNLYTSERLALLKGESENF..TEDSLPPADMTFES------------------------------------------
M5E7V9_MALS4/1436-1836--LEPMYQERLQA.LRNAGRIHDGEGAFEYPATFSPQV------------------------------------------
E3S8N6_PYRTT/1524-1919--VDRIYRDALQR.RLEDNNGEPWQAMIEYQDDIHFKT------------------------------------------
W1Q6U0_OGAPD/1501-1875--VDSLYEEIFAS...KKDTLP..SDLINYQDQMKFET------------------------------------------
I1G2M3_AMPQE/1495-1895--LSNLYRSERNSRISE.....FGPGYPLPPEDFTFDV------------------------------------------
Q9VCN1_DROME/1529-1930--MRQLYTAERLALLKNLTAEE...QDKIPVEDYTFEV------------------------------------------
DPOE_CANGA/1526-1915--.IGIFKEQYHK...RKDRITKFNKYINLSDNVDMNS------------------------------------------
E2B8B2_HARSA/1525-1925--LNTLYTQERNAMLAQEDESK....ISKLPKTMQFVV------------------------------------------
J7RME7_KAZNA/1518-1909--ITKIYSDLFEK...RMDKLREFSRFIDFKETVAFNL------------------------------------------
F4S3B6_MELLP/1559-1958--MQTYYETSFQA...RVEDIKLNPGVFQYEPNLQIEA------------------------------------------
DPOE_ASHGO/1493-1878--LEAAYEQQYLK...KVKNFEKFRHYFMPAESAKFEL------------------------------------------
B6K1H9_SCHJY/1420-1808--LKKLYEEALPS.....YKQSEAPSCIKYGDTIEAGV------------------------------------------
A0BZJ9_PARTE/1454-1836--FEFKRKQLNKN............FEMPIPEKNKITV------------------------------------------
C5DK88_LACTC/1505-1895--VQSLFKELRAQ...KSDKLDSHYDILRYPDSIDVQS------------------------------------------
H2YP37_CIOSA/1434-1828--LQNLFKNERAKLVSENVDEE.....VLPNAGYLFEV------------------------------------------
M2NL61_BAUCO/1525-1921--VDRIYEEIIAR.KLQEAGGEPWQKVVEYQDFLHFKT------------------------------------------
U1M0G7_ASCSU/1468-1870--VNAIYANEKAR.....LGGTAAASLLERKPMLNFST------------------------------------------
B0DWP2_LACBS/1522-1912--LNSVYTEILEK....RRQMYGPSVSITYPTAPKFNT------------------------------------------
R4X9Y3_TAPDE/1534-1914--.ERIYRETRAR....MDSTTSGSALFEYPTELECST------------------------------------------
R1GQ63_BOTPV/1519-1912--LDKIYKEHFAA.RLQESEGQPWQETFEYQAAIHFKT------------------------------------------
K1VVE5_TRIAC/1494-1883--..KWYADRIDK........VAAGGAFKYPEELNSTV------------------------------------------
B3S6C7_TRIAD/1510-1905--LSNIYQSEWGAKYVFSNYVT......LPPEKYSFQL------------------------------------------
N1JGF4_BLUG1/1511-1904--VGKIYDDLRVR.REQEANDQPLQTCFEYQKKMEFKT------------------------------------------
W4ZAF4_STRPU/37-438--LNSMYQHERQAKSERSSENE.....LLPREDHTFEI------------------------------------------
M5BQD5_THACB/1537-1929--MQEQYSVLNSA.....RKATGRTSLYEYPEEIETQY------------------------------------------
M3ALS7_PSEFD/1503-1901--VDRVYEELLNA.KLEETGGQPWQPTFDYQESIHFKT------------------------------------------
I2GW49_TETBL/1546-1937--LQQVFKNYFQK...KYENNEKDIKLVKLSEDMIFEL------------------------------------------
F6GW32_VITVI/1705-2088--.EKQFREACEA.........LSIEPPQPRNGISFKV------------------------------------------
S7ZMV2_PENO1/1499-1887--VDKIYSELLSR.KLQDASTEESQNAFEYQDKIHFKT------------------------------------------
DPOE_SCHPO/1498-1886--ISKIYEELRSK.....FDNLIKESSIEYPDTLSCNV------------------------------------------
H9J5N5_BOMMO/1546-1951--MSTLYAAERTAKINQGTDEN.....TLPGPELSWEV------------------------------------------
H2AUI7_KAZAF/1512-1900--IRQTFEQFYEK...NNKITNKNTRWVELKETTQFHF------------------------------------------
I1BIP1_RHIO9/1528-1924--VARIYKEAYHA....MNRERTMDDAVQAPNTMDFET------------------------------------------
DPOE_CRYNJ/1529-1917--..KFYTDRVER.........AERGVFSYPDMLDFTT------------------------------------------
F8QB37_SERL3/1530-1921--LQELYEDLLRK....RQASYGGSTCIDYPKTREFTT------------------------------------------
G7E3T0_MIXOS/1542-1933--.KRVYSGLTQA......AQKAARGAFDYPEDLTFDT------------------------------------------
R9P7N8_PSEHS/1532-1932--VETMYADRVAH.MRKRGKLEEGSGVFEYSDTMRVDV------------------------------------------
C1FJ68_MICSR/1644-2054--.DRAWRAARAE...VSSADGDDAATQSADGAIDWTV------------------------------------------
A5DEB2_PICGU/1518-1900--MQRIYEDLFHS...KKTKLEATSSILDYSSTMEFDT------------------------------------------
L8G4R0_PSED2/1520-1914--IAKIYTDALAK.RFSEAEGKSWQDCFDYQDKIQFTT------------------------------------------
C4QV66_PICPG/1520-1895--MESVYQDYYRS...KKERLS..HTIIQYDEQLSFDV------------------------------------------
K1XY13_MARBU/1520-1913--IGKIYSEMLLR.REQEAEGQEWQNCFKYQAKLQFKT------------------------------------------
A7TF62_VANPO/1518-1909--IESMFKETYAM...KEDKLDKLSHIIDFSEGVKFEV------------------------------------------
A5E0L0_LODEL/484-866--FHKIYQELYAG...KSEKLKKSQRIIEYPPKITFEA------------------------------------------
Q7Q7P3_ANOGA/1541-1943--VKNLYTSERIALLTTSDEHG...EDMLPPSDMTFEV------------------------------------------
G8BGB3_CANPC/1514-1896--ISKIYGEVFEN...KREKLKKMSRVIDYPDEMAFDV------------------------------------------
A0A088AM07_APIME/1527-1928--MNTLYTQERDIVISMNGADK....VKFLPESMQFTL------------------------------------------
T1HUW2_RHOPR/1490-1890--LNNMYNSERKLKLSKTEAKE...EHLLPPAGVSFDV------------------------------------------
V5I1Z1_BYSSN/1523-1915--MDKIYAEDLLR.KLQGSSGEKVQEAFSYQEKLHFKS------------------------------------------
A7SIT9_NEMVE/1502-1904--...MFNTERSARKKKADEDD..ESFSLPPENHTFEI------------------------------------------
DPOE_YARLI/1514-1873--ISKEYARLRRG..ERYKQNMDDCTVFSFPDTMQYEV------------------------------------------
R9AMW8_WALI9/1475-1880--LDKVYGQSYES..YLSRKSEENDEAFEYSSEMSFEV------------------------------------------
D8SJG5_SELML/1443-1816--.ERQFRDSLRT.....QESSVMEEFNMDTSDVNFEI------------------------------------------
S8FUF8_FOMPI/1617-2006--.AEVYRDQFVK....RQQTVGNSVAYSYPDACDFTS------------------------------------------
G1X6W6_ARTOA/1520-1907--IDKMYAEQILR.RNQESHG...QGPFEYLDTVHFKT------------------------------------------
Q17H50_AEDAE/1518-1917--LKNLYLAERTAMLSTGKSSN....DNLPPEDLTFSI------------------------------------------
G1RBL5_NOMLE/1514-1911--..ALYSAEHSLLLEKVGPEL......LPPPKHTFEV------------------------------------------
D5GGS6_TUBMM/1460-1851--MDKIYAEQFTR.RMETANG.PGDSMIEYPATLHFQT------------------------------------------
H2UTB8_TAKRU/1527-1926--LSNLYTAERTALLDKTTEEL......LPPEKHNFEV------------------------------------------
G8ZQL0_TORDC/1514-1906--LKQIYKEAFEQ...KKEFHSKFSRFFPLNEDMDFEL------------------------------------------
S3BV94_OPHP1/1618-2007--AA..........QQAATAATNWRDCFPYQDALTVKV------------------------------------------
G0V590_NAUCC/1533-1922--MDQVYSELYKS...RGDKIRKFTHLADVKEDASFEF------------------------------------------
K5XRW0_AGABU/1528-1917--LQEQYSSQLRQ....FREQYDAPKSYNYVETLDIST------------------------------------------
E9H7I0_DAPPU/1517-1917--LVNLYNEERLKKLSQADVVE....SSVPARDYSFSI------------------------------------------
G3B805_CANTC/1530-1912--MDKIYRDLFLA...KEDKLGKMYNIIEYPNEMKFNV------------------------------------------
D6WSX8_TRICA/1501-1896--LNKLYQAERMAKKEKGTEDD.....SLPPASVTFEI------------------------------------------
A8NMZ4_COPC7/1518-1909--LDTSYRDLFAK....QQQMFGKSNTFPYPTSLSFET------------------------------------------
G0WD71_NAUDC/1559-1949--LEQTYRESYHK...RSNKIKKFTHLVDVKEDVEFNF------------------------------------------
S2J5L9_MUCC1/1535-1930--ISRLYSERY.......SRGKPTSDTVEILESAEFET------------------------------------------
C5GX57_AJEDR/1519-1912--VDKIYREALEK.KIEEHAGESWQQIFDYQDNIHFKI------------------------------------------
E9D9U9_COCPS/1514-1907--VDKIYANSLRR.RIEEGNNENWQQVFEYQHALHFRT------------------------------------------
K7J3X8_NASVI/1487-1888--MNTLYSTEKIKAIEMNEIER....VDSIPESMTFHV------------------------------------------
O62218_CAEEL/1468-1869--MDSLYTSAYTK.....MMSTERGQLCHTSESMPFTV------------------------------------------
V2XXQ2_MONRO/1528-1918--.AETYVDLRQK....RLQNYGKSRSLAYPESREFNT------------------------------------------
R7YYU2_CONA1/1520-1913--VDKTYRDQFTR.RLQEAGGEQWQSTIQYQDNIHFKT------------------------------------------
B6QRD6_PENMQ/1519-1904--IDKMYVELLGR.KIAAES.EASTGAFDYQEKVHFKT------------------------------------------
G6CJ62_DANPL/1482-1880--MNTLYNAERTAKINLGTDEK.....SLPNADLSWEV------------------------------------------
G8YP31_PICSO/1529-1911--MEKIYHEIYEQ...KKDKLGKLYNIIDYPSEMVFET------------------------------------------
S9XA99_SCHCR/1491-1879--IEDLYHELRQK.....YNDMLKMSVIDYPESITFSV------------------------------------------
N1PFE7_DOTSN/1521-1915--VDRIYEDLLNR.KLEEAGGQPWQTIVEYQDAIHFKS------------------------------------------
J4I9U6_FIBRA/1520-1910--LSELYTELLNK....RRQSARSNVSYTYPSTCDFTS------------------------------------------
M7NNI3_PNEMU/1489-1876--FEKLYTELLSN...WKSQDLFNDSAFEFSDSITFKI------------------------------------------
DPOE_YEAST/1528-1919--LGQIYKQMFEK...KKGKIETYSYLVDIKEDINFEF------------------------------------------
M2QWE4_CERS8/1506-1894--..ETYADLWGK....QQQSAGPNISYIYPAQCEFTS------------------------------------------
G2X166_VERDV/1512-1902--VSRIYTDTLKQ.RDQEAEGTNWQECFPYQEKLNFKI------------------------------------------
U4LW68_PYROM/1510-1903--MDKLYAEQFLA.RQTKEPDGLWKKPFEYQEKIHFKV------------------------------------------
Q7RWE3_NEUCR/1534-1926--INKLYADMLAR.RNQEAAGAEWQECFPYQEKLNIKI------------------------------------------
G4TAK9_PIRID/1551-1940--..EAYMFMLEQ.....HRQRSQPSVIDYTDTMEFTV------------------------------------------
H6BPG7_EXODN/1517-1908--VDKIYTEQYRH.KAEE..DVLIQDIFQYQSNLSFKV------------------------------------------
C4XXS2_CLAL4/253-635--ISKIYKEVYEA...KKSKLSKLYNFIDYMPEMTFDT------------------------------------------
DPOE_KLULA/1498-1882--IESLYNEIYEK...KFEKLDKYYDLIKINKNVSFNV------------------------------------------
G8JME6_ERECY/1494-1883--LESTYVNQFES...KKADLDRFYDYLKPKSRLSFDV------------------------------------------
E3L3C9_PUCGT/1547-1947--IQKYYKNVLNS...RLAIMEKEPGVFEYDPNMLVEV------------------------------------------
DPOE_EMENI/1496-1885--VDKIYSELLAR.KLQ.GQGDQAEGAFQYQEKIHFRT------------------------------------------
DPOE_DEBHA/1534-1916--MDKIYREIFEA...KKDRLGKMYSIIEYPDEMKFET------------------------------------------
F4NWW9_BATDJ/1562-1979--VQRMYSSMLAN......SAADTRGSINYPEQLEITT------------------------------------------
E5RYM0_TRISP/1442-1827--VSALYSQERKAKLEVNSKRM......FPEEDYTFKV------------------------------------------
F4PWS2_DICFS/1559-1964--...PYTSHNIS.......DKLLNSLSEKHPNVKFSL------------------------------------------
K0KG22_WICCF/1507-1890--LEKIYRDLYEA...KREKIAPLYGIIDYQEELEFET------------------------------------------
J5JYN7_BEAB2/1524-1910--ITRMYSEMLAK.RAEEAAGTNWQDCFTYQEQVNFKI------------------------------------------
U1GF87_ENDPU/1518-1911--VDKIYSEQLLR.KTEEGDDPTWQATFQYQDKVHFKT------------------------------------------
C5DYX0_ZYGRC/1500-1892--LEQLYKDAYLK...KISKLQGYSRFFDLKDHMKFEL------------------------------------------
F2PJ05_TRIEC/1466-1860--VDKIFTEALQR.KVDEQNNEAWQQVFQYQDKIHFKT------------------------------------------
F6WUQ7_CIOIN/1486-1883--LQALFKNKRTKLLSQDDVNE....DVLPHPDYQFEA------------------------------------------
J9M470_ACYPI/1505-1904--LNTLYTKERNTKISRGHNES.....NIPPSDITFEV------------------------------------------
Q59SM7_CANAL/1519-1901--IHKIYREIFES...KREKLDKVSNVVNYPAEMSFDV------------------------------------------

PF03337

Q98188_MCV1/6-651GISCMTARASDTDEVRATLQKQ.PCSEVYARLPCGRGV------------------------------------------
Q9Q8S1_MYXVL/6-624GLLHDTKKE....VVVHTLKEH.PRAVVLTKTRHGKGV------------------------------------------
Q070L3_CPRVZ/15-682CLLDAEPGGGDSLESVTSMIRVNGDLVVSIKTRHGP.F------------------------------------------
Q6TUY6_YMTV5/10-640.......NKKSTDDVSSFLNRY.KYSIILARNNDGKGV------------------------------------------
Q08FW7_DPV83/7-651KSLSDDNNDDENNHIITALEEY.KFSIVLARTKCGKGI------------------------------------------
Q6TVW0_ORFSA/6-637GKVCGGVPGRQAWDEPPPTDLV.PGEYALAKARDGKTM------------------------------------------
F12_VACCW/6-635QILMKTANNYETIEI...LRNYLRLYIILARNEEGRGI------------------------------------------
Q8V3R9_SWPV1/5-644KSLKSYNNN..NLTISSALNEY.KFCIILARTNYGKGI------------------------------------------

PF00136

Q9Q8R2_MYXVL/483-985....................SEKKNK.YPYEGG.....KVFAPKQK-M.F-----------INNVLIFDYNSLYP-NVCL
DPOD_SCHPO/519-956....................VNGTDE..QYEGA.....TVIEPIKG-Y.Y-----------DTPIATLDFSSLYP-SIMQ
DPOL_MUHVS/528-1031....................SNNSRT.VGYQGA.....TVLEPECG-F.H-----------HVPVCVFDFASLYP-SIIM
DPOD1_DROME/519-959....................SQGSDE..QYEGA.....TVIEPKRG-Y.Y-----------ADPISTLDFASLYP-SIMM
DPOD_YEAST/540-973....................SQASDD..QYEGA.....TVIEPIRG-Y.Y-----------DVPIATLDFNSLYP-SIMM
DPOL_GAHVM/591-1150CEHDSPQEPIHNIKQSSLCHSNSGRT.IGYQGA.....KVLDPISG-F.H-----------VDPVMVFDFASLYP-SIIQ
DPOA_YEAST/777-1229....................PVNSKK.AKYQGG.....LVFEPEKG-L.H-----------KNYVLVMDFNSLYP-SIIQ
DPOL_ALHV1/535-1007....................PVTGSQ.EGYQGA.....TVINPISG-F.Y-----------NTPVLVVDFASLYP-SIIQ
DPOL_HHV2H/602-1181GDEDGDE.......REEVARETGGRH.VGYQGA.....RVLDPTSG-F.H-----------VDPVVVFDFASLYP-SIIQ
Q98207_MCV1/479-983....................TQEPAR.YTYGGG.....KVFLPRQK-L.F-----------DTNVMVFDYNSLYP-NVCI
DPOLA_ORYSJ/819-1284....................GKTKKG.PSYAGG.....LVLEPKKG-L.Y-----------DKYVLLLDFNSLYP-SIIQ
DPOD1_SOYBN/496-935....................QAGSEQ.GTFEGA.....TVLEARAG-F.Y-----------EKPIATLDFASLYP-SIMM
Q57UW4_TRYB2/670-1122....................DEGKRK.TKYQGG.....MVLEPKSG-L.Y-----------SEYILLLDFNSLYP-SLIQ
DPOL_ASFB7/442-955....................ARGKREHGKYPGA.....FVIDPVKG-LEQ-----------DKPTTGLDFASLYP-SLIM
DPOL_HHV6Z/502-979....................SHNRQG.IGYKGA.....TVLEPKTG-Y.Y-----------AVPTVVFDFQSLYP-SIMM
DPOD1_CAEEL/505-943....................ANSGDG.EGYEGA.....TVIDPIRG-F.Y-----------NEPIATLDFASLYP-SIMI
DPOL_EBVB9/517-994....................PSASDR.DGYQGA.....TVIQPLSG-F.Y-----------NSPVLVVDFASLYP-SIIQ
G8BKE7_CANPC/511-946....................SEGSSE..EFEGA.....TVIEPERG-Y.Y-----------DVPIATLDFSSLYP-SIMM
DPOL_VACCW/482-984....................SETKQK.FPYEGG.....KVFAPKQK-M.F-----------SNNVLIFDYNSLYP-NVCI
DPOA_SCHPO/758-1203....................SLGKKK.DKYKGG.....LVFEPQKG-L.Y-----------ETCILVMDFNSLYP-SIIQ
DPOLA_HUMAN/768-1227....................KKGRKK.AAYAGG.....LVLDPKVG-F.Y-----------DKFILLLDFNSLYP-SIIQ
Q6TVU5_ORFSA/488-991....................ADTKSK.FFYEGG.....RVMVPKQK-M.H-----------DKHVLIFDYNSLYP-NVCI
DPOZ_YEAST/904-1362....................SPGKKD.VRKQKALECVPLVMEPESA-F.Y-----------KSPLIVLDFQSLYP-SIMI
DPOL_VZVD/582-1117VSPTG...............TSSGRN.VGYKGA.....RVFDPDTG-F.Y-----------IDPVVVLDFASLYP-SIIQ
DPOL_HHV8P/518-987....................PKGDAV.SGYQGA.....TVISPSPG-F.Y-----------DDPVLVVDFASLYP-SIIQ
DPOL_SHV21/507-976....................SNDVNA.DGFQGA.....TVINPIPG-F.Y-----------NNAVLVVDFASLYP-SIIQ
DPOL_EHV2/515-985....................DRHADA.EGYQGA.....TVIDPSPG-F.Y-----------NTPVLVVDFASLYP-TIIQ
DPOL_FOWPN/468-966....................KITKVR.YPYIGG.....KVFLPSQK-T.F-----------ENNVMIFDYNSLYP-NVCI
DPOLA_DROME/790-1239....................MQTKKK.AAYAGG.....LVLEPMRG-L.Y-----------EKYVLLMDFNSLYP-SIIQ

PF03175

DPOL_ADEG1/239-749--------------------.....V-ERWSRG-----IVSHQDAR-S-V...........FVRFMVRDTLQLTSGAKLS
Q9QM79_9ADEN/239-780--------------------.....L-HRWARG-----VVAPSDSR-T-V...........FVRFMVRDTLQFTSGAKLS
Q9YUR6_9ADEN/339-828--------------------NKSEIL-SQIKEG-----IPHPESIK-N-L...........YIKSMVRDTFQITH.TSLK
DPOL_ADEB3/263-744--------------------......-.DWEEG-----TPTSADYK-F-Q...........FVKFMVRDTFALTH.TSLR
DPOL_ADECT/392-875--------------------......-.HWEQG-----QVLASDLK-S-Q...........YIKFMVRDTFSLTH.TSLK
DPOL_ADEB2/268-751--------------------......-.DWECG-----KLTAADHK-Y-Q...........FVKFMVRDTFALTH.TSLR
DPOL_ADE40/434-918--------------------......-.LWEQG-----ACDDSDFK-Y-Q...........FLKVMVRDTFALTH.TSLR
DPOL_ADE12/307-791--------------------......-.LWEHG-----GCDDQDFK-Y-Q...........YLKVMVRDTFALTH.TSLR
DPOL_ADE02/443-927--------------------......-.LWEQG-----GCDDTDFK-Y-Q...........YLKVMVRDTFALTH.TSLR
Q9WF13_ADE17/336-820--------------------......-.LWEHG-----GCDDSDFK-Y-Q...........FLKVMVRDTFALTH.TSLR
DPOL_ADE04/438-922--------------------......-.LWEQG-----GCDDIDFK-H-Q...........FLKVMVRDTFALTH.TSLR
Q83895_ADEO7/319-798--------------------.....Y-ERWKNG-----IINFEDMK-W-Q...........GIKFMVRDTFLLTH.SSLR
O11414_9ADEN/324-802--------------------.....F-DRWQNG-----MLDKQDLK-W-Q...........GVKFMVRDTYLLTH.TSLR
DPO2_KLULA/409-871--------------------..IKDK-YIIKNN-----MITYGELY-Y-E...........NAIIYLKDPYLFIL.TSLD
Q09038_LACKL/414-876--------------------..IKDK-YIIKNN-----MITYSELY-F-K...........HSKIILKDPFLFIL.TSLD
DPO1_KLULA/416-866--------------------..AIKN-ILIRNN-----SFISFNFA-H-D...........GVKFSVKDSYSFLL.CSLA
O74719_DEBHN/419-870--------------------..DIKN-ILIRNN-----NFISFSFV-H-D...........DITFNIKDSYSFLL.CSLA
DPOL_BPCP1/57-480--------------------..ECTY-FINDMG-----VWYSITLE-F-P...........DFTLTFRDSLKILN.FSIA
Q96206_BPGA1/50-479--------------------......-YVHTEE-----DRTNTPKE-F-T..........................TTIS
DPOL_BPM2/50-474--------------------......-FKWSNE-----GLPNT...-Y-N..........................TIIS
DPOL_BPPZA/50-474--------------------......-FKWSAD-----GLPNT...-Y-N..........................TIIS
DPOL_BPPRD/2-433--------------------NGEIYK-DYWGDD-----CIEQFIYW-L-D...............TIEEPHVIYA.HNGG
O21376_PICKL/474-939--------------------SDITFK-IIRREA-----KVLKMTVR-Y-M......DESGKESQMVMLDSLTVLN.ASLR
Q35599_PHYPO/8-446--------------------....FD-FLLKEK-----NANNYWYL-Y-S..............YEITQLFNLL..KSLQ
O99973_PORPU/80-478--------------------....IK-TIWEGA-----KYIKLIYT-I-L..........TTHILSLRDSLNLLP.MSLN
Q9XNK1_PLEOS/738-1218--------------------DLKIKV-LSKNDG-----TIISLEIK-K-I......LINKKIIKITLLDSLHLLP.FSLR
E6ZE21_BETVM/147-562--------------------DEYEIR-PLMRNG-----RLYEVVVY-F-K..........KRMLFRFRDSLNLLP.GSLD
DPOM_MAIZE/299-724--------------------KNCHIE-PIMRND-----CIYSIKLY-K-V.....SKNGDKRLVLTFMDSYLLLK.VKLA
Q9TEH5_9PEZI/309-758--------------------...VVK-PLYKDR-----TILQLDMT-L-K.TFETNTKKCKNKRMVLKDSYLLLP.ESLK
DPOM_NEUCS/366-859--------------------..VVEK-IISKDL-----DILSIKIS-Y-KFEPKKKGGKAERHTITIADSCRLLP.GSLD
O78938_AGRAE/67-512--------------------..FIDN-IIINKG-----RIITLKFI-Y-N...........KYSITFKDSYLLLP.SSLR
DPOM_NEUIN/401-859--------------------...EVK-PFMRNG-----KILKLTFN-F-T.....LPNSKRKYTLYFMDSLLILP.DSLD
DPOM_ASCIM/589-1039--------------------...KID-IIMRDD-----KIMKLKIT-F-K.....IPGKNTEYSISFLDSLLMLP.NSLD
DPOM_CLAPU/432-888--------------------PYEFPA-PLTRNS-----DILKLTIK-R-T.......VDGKTRKVTIMDSFALLP.RSLR
DPOM_PODAS/450-889--------------------......-TILRDD-----RILKCVIK-V-K.......TPSGYNKITFIDSYNILP.DKLD

PF08490

D8PW53_SCHCM/1455-1844---------------------------TFHGND-----ATALKAVS-R-E-------------LGLIENRG....-YTVV
K1Q2Z7_CRAGI/498-892---------------------------KLEKDV-----RQVYRSIQ-R-S-------------LSAYKDEK.RGP-TYIA
K5UTI1_PHACS/1501-1886---------------------------TYHAND-----FIAMKAIS-R-E-------------LGLAENQG....-LTVV
T1J6P1_STRMM/1470-1868---------------------------RTDSNK-----SNVHRAIQ-R-L-------------LMAYKNEK.RGP-TMLV
E0VSJ8_PEDHC/1513-1911---------------------------HAETES-----KNIYKSIH-N-V-------------LNSYKKEG.QGA-TVIL
G8BQ26_TETPH/1521-1912---------------------------FSYTDI-----TKVYKKLS-Q-I-------------LSDIKDEK.GLQ-FLML
G0T1H4_RHOG2/1536-1927---------------------------AYASNE-----DVALRHLS-R-D-------------LDALSKQK.SMA-SLLV
J0M8E9_LOALO/1625-2027---------------------------SQCSAV-----QRADRIIQ-R-Y-------------IRSLLHVD.SYP-TVIA
B0WNF0_CULQU/1523-1926---------------------------FMEIDQ-----KQVYQKLS-R-L-------------LSAYKDEK.RGP-TILC
M5E7V9_MALS4/1436-1836---------------------------HIHTNE-----IKAFRALM-K-D-------------VREARSGK.QGA-PLLA
E3S8N6_PYRTT/1524-1919---------------------------TMVTTK-----RKALLEIG-D-V-------------IKRMKADE.SGP-VIVV
W1Q6U0_OGAPD/1501-1875---------------------------QYFTDA-----VKLYKKLN-S-K-------------LLTLDEHS.ASK-SLLV
I1G2M3_AMPQE/1495-1895---------------------------SIDTEA-----RRALRSIQ-R-L-------------LVDYKESH.HGP-TVIL
Q9VCN1_DROME/1529-1930---------------------------LIEVDV-----KQIYRHIQ-R-A-------------LTTYKQEH.QGP-TILC
DPOE_CANGA/1526-1915---------------------------NHYTDK-----KKLFKAIN-Q-E-------------FAMIKEQK.GQQ-VLLL
E2B8B2_HARSA/1525-1925---------------------------QGETNF-----QQVCRTLQ-A-A-------------LTAYKNEG.HGA-TIII
J7RME7_KAZNA/1518-1909---------------------------HSFTDL-----NKLTRHLT-V-S-------------IGKMKEEK.GQQ-FLML
F4S3B6_MELLP/1559-1958---------------------------INVATE-----ALGLKALN-R-D-------------LSTLKGKRIASD-YVVM
DPOE_ASHGO/1493-1878---------------------------HHFTDK-----SVLLRSLS-K-V-------------VSSWSELK.GSQ-LLLL
B6K1H9_SCHJY/1420-1808---------------------------SFCNSP-----KQMYKSLT-D-K-------------LSKFVSSK.LGV-CTLI
A0BZJ9_PARTE/1454-1836---------------------------QSMKDD-----KLAIDYIS-N-N-------------FETRGQSM....-KLCI
C5DK88_LACTC/1505-1895---------------------------HSFTDL-----RALYKKLS-K-S-------------ISQMNEEK.GAQ-CLML
H2YP37_CIOSA/1434-1828---------------------------RVEVEV-----KQMYRNMQ-R-Y-------------LTTYKNER.RGP-TVVI
M2NL61_BAUCO/1525-1921---------------------------VQVTTQ-----RRALQELG-D-A-------------IKKIQKED.SGP-TVLV
U1M0G7_ASCSU/1468-1870---------------------------FQCSTN-----KEAERIVH-K-Y-------------VRGIRELD.TQP-MFMT
B0DWP2_LACBS/1522-1912---------------------------AYHSND-----TTALKAVS-R-E-------------LGLFEDKS....-FIVV
R4X9Y3_TAPDE/1534-1914---------------------------VTVNTE-----TRFYKAVN-E-A-------------IRNMKADR.SGP-LAII
R1GQ63_BOTPV/1519-1912---------------------------VQVTTK-----RKAHLEVA-D-A-------------IKKMRNDE.SKP-IVLV
K1VVE5_TRIAC/1494-1883---------------------------NYYPTE-----AGAMRQLA-K-D-------------LQSVR....SGL-NVIA
B3S6C7_TRIAD/1510-1905---------------------------HIETDM-----RRVYRTLI-R-S-------------LISYKEMR.YGP-TILL
N1JGF4_BLUG1/1511-1904---------------------------KQVTTR-----RKALLELG-N-L-------------IKKIKSDE.SKP-LILV
W4ZAF4_STRPU/37-438---------------------------VVEKDM-----KKAYRTIH-R-L-------------LLAYKDEK.RGP-TFIS
M5BQD5_THACB/1537-1929---------------------------MFHKDE-----QKLMASLS-A-E-------------LSVVSDKY....-YSII
M3ALS7_PSEFD/1503-1901---------------------------VQVTTQ-----RRALQELG-D-A-------------IKKIQKEE.TLP-IMLV
I2GW49_TETBL/1546-1937---------------------------DSFTDI-----SQLYRKLN-K-S-------------ITKVKEEK.GIQ-LILF
F6GW32_VITVI/1705-2088---------------------------DYVGYV-----KDAEKFLQ-R-T-------------INDHRHQH.HGP-EVAV
S7ZMV2_PENO1/1499-1887---------------------------TQVMTR-----RKAHLEVG-D-L-------------IRKLRNDE.TQP-AIMV
DPOE_SCHPO/1498-1886---------------------------IFSGNE-----RKAYKLID-E-K-------------LLQYFSTK.TKN-SLLI
H9J5N5_BOMMO/1546-1951---------------------------VVESST-----RALCRGLQ-A-A-------------LGRGRTER.AGP-ALLA
H2AUI7_KAZAF/1512-1900---------------------------TYFTVL-----NKLNKSLA-S-E-------------ISGMKEEK.GQQ-FILF
I1BIP1_RHIO9/1528-1924---------------------------SYHSNE-----REALKAIN-K-A-------------LLKYQDAK.KGK-TILA
DPOE_CRYNJ/1529-1917---------------------------SYHSSE-----SSAFKALG-K-D-------------LQAIN....HGL-NVIA
F8QB37_SERL3/1530-1921---------------------------TYHNND-----ITALKAIS-R-E-------------LGLLENMS....-YSIV
G7E3T0_MIXOS/1542-1933---------------------------SVYDRE-----DVAFRAVS-R-E-------------LTGLHARK.EGP-TVLI
R9P7N8_PSEHS/1532-1932---------------------------RVHTST-----ARAFKAIT-K-D-------------LATLKSVK.QGS-AMLA
C1FJ68_MICSR/1644-2054---------------------------EYVKDD-----ESAGAAVS-R-H-------------LQAYLEDP.KGP-AVCV
A5DEB2_PICGU/1518-1900---------------------------VYYNDR-----GKLFKRID-K-D-------------LRKLEETR.STK-ALLA
L8G4R0_PSED2/1520-1914---------------------------KVVSTK-----RKALLEVG-D-L-------------VKKIKSDE.TKP-LILV
C4QV66_PICPG/1520-1895---------------------------VDFTDK-----NKLLRNLN-I-K-------------CGEANEEK.SSK-SLMV
K1XY13_MARBU/1520-1913---------------------------SQVTTR-----RKALLEVG-D-I-------------VKKMKNDE.SKP-LMLV
A7TF62_VANPO/1518-1909---------------------------QNFRDI-----TKLYRKLS-N-S-------------ITKMKDEK.GLQ-FIML
A5E0L0_LODEL/484-866---------------------------LYYHDK-----LKLFKKLN-Q-A-------------IGKLHESR.SAK-ALFA
Q7Q7P3_ANOGA/1541-1943---------------------------FMEIDA-----KQVYQRVT-R-A-------------LSAYRDEK.RGP-TLLC
G8BGB3_CANPC/1514-1896---------------------------SYFHDK-----LKLLKKVN-Q-A-------------IGKIHESR.SNK-ALLA
A0A088AM07_APIME/1527-1928---------------------------KFETNF-----QQVCRIIQ-A-A-------------ITAYKNEG.YSI-PIFI
T1HUW2_RHOPR/1490-1890---------------------------KIETDP-----KQAYRHIV-A-A-------------LQVYRDEK.KGP-TLIA
V5I1Z1_BYSSN/1523-1915---------------------------TQVTTR-----RKAHLEIG-D-L-------------VKKFRSEE.SQP-VMLV
A7SIT9_NEMVE/1502-1904---------------------------RVDTNA-----RQAWRAVQ-R-L-------------LMGYKEEK.RGP-TMVL
DPOE_YARLI/1514-1873---------------------------EYCSNH-----RRMLQKVS-K-A-------------CDSLSGSR.NGQ-LVFA
R9AMW8_WALI9/1475-1880---------------------------TFHGGE-----QSAVKNMF-R-Y-------------LNTLGGQR.QGP-TIVV
D8SJG5_SELML/1443-1816---------------------------EYLATY-----AEAGRRLQ-R-T-------------LHDYLDQF.RRP-AVAI
S8FUF8_FOMPI/1617-2006---------------------------TYHGTD-----VAALKAIS-R-E-------------LGTMENQS....-YTVV
G1X6W6_ARTOA/1520-1907---------------------------TYINKP-----RLLYRNID-D-A-------------IKKLKSEE.QKA-FVLV
Q17H50_AEDAE/1518-1917---------------------------YNEIDI-----NQVYKRLG-S-T-------------LASYKAEK.RGP-TILC
G1RBL5_NOMLE/1514-1911---------------------------RAETDL-----KTICRAIQ-R-F-------------LLAYKEER.RGP-TLIA
D5GGS6_TUBMM/1460-1851---------------------------TYVNTK-----KKLEKELT-D-L-------------LKGIRNEE.SKP-TTLV
H2UTB8_TAKRU/1527-1926---------------------------RAESDI-----KAIYRALQ-R-I-------------LLNYKEER.RGP-TLIA
G8ZQL0_TORDC/1514-1906---------------------------QAFADR-----SKLYRKLS-L-Q-------------INKLKEEK.GLQ-FLLL
S3BV94_OPHP1/1618-2007---------------------------TQVTTR-----RKAFLEIG-D-I-------------VKKMRKEEIGRP-QMLV
G0V590_NAUCC/1533-1922---------------------------SYFDDI-----AKLYRRLS-Q-D-------------ISKIKEEK.GQQ-FLFL
K5XRW0_AGABU/1528-1917---------------------------TYHSND-----VTALKAIS-R-E-------------LGLLEDKS....-FTVV
E9H7I0_DAPPU/1517-1917---------------------------QVETDI-----RQVYRQMN-R-L-------------LQTYKDEK.RGP-TFVA
G3B805_CANTC/1530-1912---------------------------TYFNDN-----SKLFKKLD-K-T-------------IAKINESK.SNK-ALLT
D6WSX8_TRICA/1501-1896---------------------------RVESDL-----GQVYKTLQ-K-A-------------LQFYKDEK.KGP-TLLA
A8NMZ4_COPC7/1518-1909---------------------------VHHSND-----VTALKAIS-R-E-------------LGLLTDSS....-LMVV
G0WD71_NAUDC/1559-1949---------------------------EYFTDI-----SKLYRKIS-I-N-------------MNKLKEEK.GQQ-FLLL
S2J5L9_MUCC1/1535-1930---------------------------SYFPNE-----REALKAIN-K-S-------------LSKYLDNK.RGK-SILA
C5GX57_AJEDR/1519-1912---------------------------TQVTTR-----RKALLEVG-D-L-------------IKKFRNES.NQA-IMLV
E9D9U9_COCPS/1514-1907---------------------------MQVTAK-----RKAHLEVG-D-L-------------LRKFRNES.SYP-TLIV
K7J3X8_NASVI/1487-1888---------------------------KVETDV-----KVIYTQLQ-N-A-------------LKNYKNEA.RGG-TILI
O62218_CAEEL/1468-1869---------------------------KRFSSN-----TECERQLG-R-A-------------LRVYREVS.SKT-AIVL
V2XXQ2_MONRO/1528-1918---------------------------TYHSTD-----LTALKAIS-R-E-------------LGLHENKS....-YTVV
R7YYU2_CONA1/1520-1913---------------------------VQVTTK-----RKALLEVE-D-A-------------IKKMRRDE.NGA-TVLA
B6QRD6_PENMQ/1519-1904---------------------------TQVTTL-----RKAILEVG-D-L-------------VKKLRNEE.SQP-VVFV
G6CJ62_DANPL/1482-1880---------------------------VVETEP-----RAVYRGVQ-R-A-------------LQRYRDER.CGP-TMVA
G8YP31_PICSO/1529-1911---------------------------SYFQDM-----PKLLKKLD-S-A-------------ISKIDESR.SNK-AILA
S9XA99_SCHCR/1491-1879---------------------------SYSKNE-----KKAYKLID-E-R-------------ILQYLSAK.TKN-SLLV
N1PFE7_DOTSN/1521-1915---------------------------VQVTTQ-----RRALQEIG-D-A-------------VKKIQKEE.SQP-IMLV
J4I9U6_FIBRA/1520-1910---------------------------TYHGSD-----LMALKAIS-R-E-------------LGLLESQA....-YMLV
M7NNI3_PNEMU/1489-1876---------------------------LILKNE-----KKLYKSFS-T-C-------------LREYQTER.HGP-TIVV
DPOE_YEAST/1528-1919---------------------------VYFTDI-----SKLYRRLS-Q-E-------------TTKLKEER.GLQ-FLLL
M2QWE4_CERS8/1506-1894---------------------------TYHGTD-----STALKAIS-R-E-------------LGLMENQS....-YTVV
G2X166_VERDV/1512-1902---------------------------TQVTTR-----RKLHLELG-D-I-------------VKKLRKDE.VKP-LMLV
U4LW68_PYROM/1510-1903---------------------------STTDKR-----NKLSKVLS-N-I-------------IKNM.NDD.TKP-VMVV
Q7RWE3_NEUCR/1534-1926---------------------------TQVTTR-----RKAFLEVG-D-I-------------VKKLRKEE.SGP-TMVV
G4TAK9_PIRID/1551-1940---------------------------SYHSND-----TTAMKALN-R-E-------------LGLAEYKA....-KILT
H6BPG7_EXODN/1517-1908---------------------------SQVTTK-----RKANLAIA-D-V-------------LQKWRSDE.SQP-TILL
C4XXS2_CLAL4/253-635---------------------------SYFNNP-----STLYKKLN-S-V-------------FRKFHESR.SNK-ALLS
DPOE_KLULA/1498-1882---------------------------NDYTEL-----KRLLKDLS-K-M-------------LQNIKEEK.GSH-TMVI
G8JME6_ERECY/1494-1883---------------------------QSFTEI-----SKLYRSLS-K-H-------------LENLSEEK.GFQ-SILL
E3L3C9_PUCGT/1547-1947---------------------------TNVATE-----TLALKAIS-R-E-------------LALLKGQKTGPG-YVLM
DPOE_EMENI/1496-1885---------------------------TQITTR-----RKAYLEVS-D-L-------------IKKLRNDE.SLP-AIMI
DPOE_DEBHA/1534-1916---------------------------TYFHDT-----AKIFKKMD-N-C-------------ISKIYESR.SNR-ALLA
F4NWW9_BATDJ/1562-1979---------------------------TIYQTE-----ARAFAAVN-T-H-------------LNNYFDQR.RGA-TALA
E5RYM0_TRISP/1442-1827---------------------------TMETNV-----RQVYRSMQ-R-A-------------LRSYHDGK.HGP-TMVA
F4PWS2_DICFS/1559-1964---------------------------EIGKSI-----DGAKKLVN-A-Q-------------LQVYIGAR.RGA-TIVI
K0KG22_WICCF/1507-1890---------------------------VYFEEL-----PKLHRKLN-S-F-------------INKINEES.PTK-PLFV
J5JYN7_BEAB2/1524-1910---------------------------TQVTTR-----RKAHLEIG-D-V-------------IKQMRKDE.HRP-QMMI
U1GF87_ENDPU/1518-1911---------------------------SQVTTK-----RKTHLEVG-D-L-------------VKKWRNEE.TKP-MLLV
C5DYX0_ZYGRC/1500-1892---------------------------HGFVDI-----AKLYRKIT-S-Q-------------INQQKEDK.GFQ-FLLM
F2PJ05_TRIEC/1466-1860---------------------------TQVTTK-----RKAHLEVG-D-I-------------IKKFRNEN.TMP-LMVV
F6WUQ7_CIOIN/1486-1883---------------------------RVDVDV-----KQLYRNMQ-R-Y-------------LSTYKDER.RGP-TMII
J9M470_ACYPI/1505-1904---------------------------RVETEE-----RQVYRQIQ-R-T-------------LQSYRDEK.RGP-TMLV
Q59SM7_CANAL/1519-1901---------------------------KYYHES-----AKLFKKLN-Q-V-------------IGKIHESR.SNK-AFLA

PF03337

Q98188_MCV1/6-651---------------------------VVNADT-----FQSTARLC.ALQSARV...LAACPVREMPSPPAPA....LVM
Q9Q8S1_MYXVL/6-624---------------------------VVYAGN-----LEDVKSMV.SVSELDV.VGVTPH.AEPVSLPASPINS..LCI
Q070L3_CPRVZ/15-682---------------------------CLSAEN-----LERYQRLY.GDCSVRV........VDAVQRPP.PSERDLRTM
Q6TUY6_YMTV5/10-640---------------------------IVHANN-----ASHAKCML.NLSLLEI.VGITKY.VEPSPLPDKPISN..LHI
Q08FW7_DPV83/7-651---------------------------IVYSSN-----LSMVKSMI.DLTTLEI.AGITKY.VEPCPPPMGPISK..LFI
Q6TVW0_ORFSA/6-637---------------------------IFDAEG-----ARAAAVVLPSLKSVRISCTFIDARTDALAPPPAPATQRFAIV
F12_VACCW/6-635---------------------------LIYDDN-----IDSIMSMM.NITRLEV.IGLTTHCTKLRSSPPIPMSR..LFM
Q8V3R9_SWPV1/5-644---------------------------IVYSGN-----LVYVQSMV.DISDLEI.IGITKY.VEPYPKPIKPIGN..LFI

PF00136

Q9Q8R2_MYXVL/483-985FGNLSPETLV..CVFVA-----NNK-LEAEINKQEIQKMYPGPRYISVQCEPR....SEDLVSEIAVFDRS...VEGIIP
DPOD_SCHPO/519-956AHNLCYTTLLDSNTAEL-----L.K-LK...Q............DVDYSVTPN....GD.....YFVKPHV...RKGLLP
DPOL_MUHVS/528-1031SNNLCYSTLLVEGS...-----.PE-VPEK.D............VLRVEIGDQ....CH.....RFVRENV...HRSLLA
DPOD1_DROME/519-959AHNLCYTTLVLGGTREK-----L.R-QQENLQ............DDQVERTPA....NN.....YFVKSEV...RRGLLP
DPOD_YEAST/540-973AHNLCYTTLCNKATVER-----L.N-LK...I............DEDYVITPN....GD.....YFVTTKR...RRGILP
DPOL_GAHVM/591-1150AHNLCFTTLVHDDT..N-----LSN-LRPQDD............YLEINVQGK....LL.....RFVKPHI...RESLLA
DPOA_YEAST/777-1229EFNICFTTV........-----...-.....DRNKEDID.........ELP.............SVPPSEV...DQGVLP
DPOL_ALHV1/535-1007AHNLCYSTLIKQQDLPK-----FTN-LTAN.D............YETFMISGG....PV.....HFVKKHK...TESLLA
DPOL_HHV2H/602-1181AHNLCFSTLSLRPE..A-----VAH-LEADRD............YLEIEVGGR....RL.....FFVKAHV...RESLLS
Q98207_MCV1/479-983FGNLSPETLV..GVVAN-----AHR-LDAEINMQELRRRFPEPAFLHVLCEAR....ARDGYSEIAVFDRR...RQGIIP
DPOLA_ORYSJ/819-1284EYNICFTTV........-----...-.....DR...........SADGNVP.............NLPASKT....TGVLP
DPOD1_SOYBN/496-935AYNLCYCTLVIPEDARK-----L.N-IP...P............E.SVNRTPS....GE.....TFVKSNL...QKGILP
Q57UW4_TRYB2/670-1122EFNVCYTTI........-----...-.....DR........DENTVSAEVPPPESLICLSCRAAGLPSPCL...HKCILP
DPOL_ASFB7/442-955AYNFSPEKFVASRD...-----...-.....EAKSLMAKGESLHYVSFHFNNR....LVEG...WFVRHNNVPDKMGLYP
DPOL_HHV6Z/502-979AHNLCYSTLVLDER..Q-----IAG-LSES.D............ILTVKLGDE....TH.....RFVKPCV...RESVLG
DPOD1_CAEEL/505-943AHNLCYTTLL.......-----..K-SPQGVE............NEDYIRTPS....GQ.....YFATKSK...RRGLLP
DPOL_EBVB9/517-994AHNLCYSTMITPGEEHR-----LAG-LRPGED............YESFRLTGG....VY.....HFVKKHV...HESFLA
G8BKE7_CANPC/511-946AHNLCYTTLLNRNSIKA-----F.D-LK................EEDYTKTPN....GD.....YFVHADK...KKGILP
DPOL_VACCW/482-984FGNLSPETLV..GVVVS-----TNR-LEEEINNQLLLQKYPPPRYITVHCEPR....LPNLISEIAIFDRS...IEGTIP
DPOA_SCHPO/758-1203EYNICFTTV........-----...-.....DRSPSNSDSDD......QIP.............DTPSASA...NQGIFP
DPOLA_HUMAN/768-1227EFNICFTTV........-----...-.....QRVASEAQKVTEDGEQEQIP.............ELPDPSL...EMGILP
Q6TVU5_ORFSA/488-991YANLSPETLV..GVVVS-----DNR-LDAEVAAVDVRRMFPAPRYIAVPCEPR....SPELVAEVAIFDRE...AKGIIP
DPOZ_YEAST/904-1362GYNYCYSTMIGRVREIN-----LTE-NNLGVSKFSLPRNILALLKNDVTIAPN....GV.....VYAKTSV...RKSTLS
DPOL_VZVD/582-1117AHNLCFTTLTLNFE..T-----VKR-LNPS.D............YATFTVGGK....RL.....FFVRSNV...RESLLG
DPOL_HHV8P/518-987AHNLCYSTLIPGDSLHL-----HPH-LSPD.D............YETFVLSGG....PV.....HFVKKHK...RESLLA
DPOL_SHV21/507-976AHNLCYSTLIPHHALHN-----YPH-LKSS.D............YETFMLSSG....PI.....HFVKKHI...QASLLS
DPOL_EHV2/515-985AHNLCYSTMIPGDRLCL-----HPH-LGPG.D............YETFELASG....PV.....HFVKKHK...AVSLLA
DPOL_FOWPN/468-966YGNLSPEKLV..CILLN-----SNK-LESEINMRTIKSKYPYPEYVCVSCESR....LSDYYSEIIVYDRR...EKGIIP
DPOLA_DROME/790-1239EYNICFTTV........-----...-...............QQPVDADELP.............TLPDSKT...EPGILP

PF03175

DPOL_ADEG1/239-749KAAAAYAL.........-----.DL.CKGHCPYEAIN...EFISTGRFHADAD-----------GFPVERYWEDPSVIAE
Q9QM79_9ADEN/239-780KAAAAYAL.........-----.EL.SKGQCPYEAVN...EHVSIGGYEQDSD-----------GFPVARYWEDPSVIAE
Q9YUR6_9ADEN/339-828EAAKAYNL.........-----.KI.HKGCCPFKAIN...EYMSTNSLSTDSD-----------SFPSEKYWSSKEEYNE
DPOL_ADEB3/263-744NAAAAYAL.........-----.PV.EKGCCPYKAVN...EFYMLGTYRTDAD-----------SFPQRDYWSSDEEYLL
DPOL_ADECT/392-875NAAKAYSL.........-----.TV.SKGCCPYQAVN...EFYMLGSYQQDAD-----------GFPDLKYWKDQEEYSF
DPOL_ADEB2/268-751NAAGAYEL.........-----.PV.EKGSCPYEAVN...EFYRIGSYQQDED-----------GFPSLRYWKSSEEYQL
DPOL_ADE40/434-918KAAQAYTL.........-----.PV.EKGCCPYKAVN...EFYMLGSYRADER-----------GFPAEDYWKDREEYLL
DPOL_ADE12/307-791KAAQAYAL.........-----.PV.EKGCCPYKAVN...QFYMLGSYRADAN-----------GFPLEEYWKDKEEYLL
DPOL_ADE02/443-927KAAQAYAL.........-----.PV.EKGCCAYQAVN...QFYMLGSYRSEAD-----------GFPIQEYWKDREEFVL
Q9WF13_ADE17/336-820KAAQAYAL.........-----.PV.EKGCCPYKAVN...HFYMLGSYRADDR-----------GFPLREYWKDDEEYAL
DPOL_ADE04/438-922KAAQAYAL.........-----.PV.EKGCCAYKAVN...QFYMLGSYRADQD-----------GFPLEEYWKDREEFLL
Q83895_ADEO7/319-798DAATAYQL.........-----.SV.SKGYCPYRAIN...DFFMLGEYEKENN-----------GYPVQKYWNSFEEYLQ
O11414_9ADEN/324-802NAATAYQL.........-----.PI.SKGCCPYEAVN...EYLMTGNYEQETN-----------GYPTLKYWNNADEYHQ
DPO2_KLULA/409-871KASKAFNV.........-----..I.NKGEFPHSIIHSWEDLNKILPNWVKIQ-----------KRMIEYKDDNKLNIYY
Q09038_LACKL/414-876KAAKAFNV.........-----..I.NKGSFPHSLIKDWPDLQKIYPHWIKTQ-----------RKIIEFKHDNKLNIKI
DPO1_KLULA/416-866NASKAFLN.........-----EETFKKTDFPHHDLKTADDLYKVYKEWSSVN-----------TEINHVVEKEKLLITS
O74719_DEBHN/419-870NAAKAFLS.......GN-----HDF.GKTDFPHHDVRSKADLEKVYRKWRSID-----------NIIDIEIEKEKLLISS
DPOL_BPCP1/57-480TMAGLFKM.........-----.PI.AKGTTPLLKHK................-----------................
Q96206_BPGA1/50-479GMGQWYAV.........-----.DV....CINTRGKN...KNHVVFYDSLKKL-----------PFKVEQIAKGFGLPVL
DPOL_BPM2/50-474KMGQWYMI.........-----.DI....CFGYKGKR...KLHTVIYDSLKKL-----------PFPVKKIAKDFQLPLL
DPOL_BPPZA/50-474RMGQWYMI.........-----.DI....CLGYKGKR...KIHTVIYDSLKKL-----------PFPVKKIAKDFKLTVL
DPOL_BPPRD/2-433KFDFLFLM.........-----.KY.FRGKLKIVNGRILEVEHGIHKFRDSYA-----------ILPVPLAASDEKIEID
O21376_PICKL/474-939KTSQLFEL.........-----.EH.QKGYLPYDWVS......TNTNYMGPIP-----------QSFNDDVKAYLLELFP
Q35599_PHYPO/8-446D.SSFYTF.........-----......KQFTYQNIM........YSLEISCF-----------LYPKKKILIKD.....
O99973_PORPU/80-478DLGKSFIN.........-----........................RSKLDIN-----------PIFTLERISKEKNFII
Q9XNK1_PLEOS/738-1218DLGKVFSLKKNSFYNET-----KNIIGKGNFPHDFIQ.KLGIDKALEYKGLVP-----------DIKYFDNLSEEDYITE
E6ZE21_BETVM/147-562YLSSNLCP.........-----.ELGNKGSFDHSSMN................-----------................
DPOM_MAIZE/299-724DLADSFCP.........-----.ELGGKGSFDHQNVT..............VD-----------KLP.............
Q9TEH5_9PEZI/309-758RLGTNFNT.........-----.NI.QKGYFPYDFVN...ENRLEY.....IG-----------EIPNYQYFKNQLTQTE
DPOM_NEUCS/366-859KLAKDHNI.........-----..ITKKGKFPYKFVN...KDNLEYVGLLPDY-----------EYYIDPKKGEMITLFE
O78938_AGRAE/67-512KLCKSFNT.........-----.QT.QKDIFPYLLDD......INYIGEVPDY-----------KYFCNLEMEEYNNYKS
DPOM_NEUIN/401-859KLSNFFNN.........-----.KV.KKLFFPHSFLD...DNTIPINYVGKCP-----------DYKYFPKAYTEDFTIE
DPOM_ASCIM/589-1039NLSKAFNI.........-----.EN.KKSVFPLKFTN...GAVTPFNYIGAVP-----------GYEYFYNTPNKKFTKD
DPOM_CLAPU/432-888DLCKDYNI.........-----.DN.PKSYFPYLFSV...DSHLFYTGATPNI-----------NYYLDIPKAEYLKLVK
DPOM_PODAS/450-889NLAKSFGT.........-----.EI.QKGLFPYEFVK...SNTLNYVGITPSI-----------EYYKIN......NEVI

PF08490

D8PW53_SCHCM/1455-1844ISSSKD...........-----.....QSYFDRS.VQKLT.KFPILSMTKIRQ-----------.AHTLDV.FPWQLHVA
K1Q2Z7_CRAGI/498-892IQSPQD...........-----.....FQHLTSS.MPGLN.DFPLVPIHITDS-----------.DRLYSV.LDWQRVGC
K5UTI1_PHACS/1501-1886ISSLKE...........-----.....QTYFDAY.IPKLA.KFPVLSMSKAKA-----------.LHSLDV.LPWQPAAA
T1J6P1_STRMM/1470-1868VQSSKT...........-----.....FQDWINV.MPALV.EFPFVPIYKNDS-----------.DAIFNV.MDWQRVGA
E0VSJ8_PEDHC/1513-1911LQSYLD...........-----.....FNILSAS.IPSLL.EFPVITFHTKDP-----------.DNLYAT.LEWQKLGT
G8BQ26_TETPH/1521-1912IQSPYI...........-----......MKLLNF.VKYLN.QVPLIELASN..-----------.ELSLPQ.LNWQTILS
G0T1H4_RHOG2/1536-1927VHSPKP...........-----.....RSYFDEK.VRGAA.NFPLIAIQSSKA-----------.ENTFPTALAWQAPAC
J0M8E9_LOALO/1625-2027VQSRQQ...........-----.....LSALVKR.LPALD.SYPLVRIHASEP-----------.SGLFNV.LDWQRIVL
B0WNF0_CULQU/1523-1926VQTALG...........-----.....LQKLNQL.IPVCL.EFPETQIHIADD-----------.ASLLSG.LEWQRHGA
M5E7V9_MALS4/1436-1836LCSSRP...........-----.....LSYYDSR.MGLSS.EMPVLMVPAARA-----------.EDSLPA.LGWQPYAA
E3S8N6_PYRTT/1524-1919MQSPNH...........-----......ALLSHD.VPILK.DLPILPLHPDES-----------.DKQLPP.LGWQAFIA
W1Q6U0_OGAPD/1501-1875VQSPYS...........-----......SKIARH.LAATA.QFPCVRMGAG..-----------.QIHINS.LSWHSLIM
I1G2M3_AMPQE/1495-1895IQTHTG...........-----.....IAELRNA.VPALD.QFPHVLIPFIES-----------.DNHYLL.LDWQRSAS
Q9VCN1_DROME/1529-1930LQTALS...........-----.....ARKLSLA.MPILL.EFPQAEIHISDD-----------.ASLLSG.LDWQRQGS
DPOE_CANGA/1526-1915MQSPFP...........-----......SLIKKN.IRYST.QIPIIELSMN..-----------.ILALPQ.LNWQNVMI
E2B8B2_HARSA/1525-1925NQTAMD...........-----.....KVMLTAE.MPLLN.DFPIVSTHVQDV-----------.ENLYNM.LEWQKIGA
J7RME7_KAZNA/1518-1909LKSPSN...........-----......KKLTSK.IKNLR.TLPVLELATT..-----------.PLTLPQ.LNWQSNLC
F4S3B6_MELLP/1559-1958IHSDKD...........-----.....YAYYDDG.ITSMS.RFPTLMIHSNKA-----------.DNKFEA.FGWQRYAA
DPOE_ASHGO/1493-1878LQSPTP...........-----......SRLLKS.IRILN.QLPVVQLSTC..-----------.ELAFPT.LNWQDQLI
B6K1H9_SCHJY/1420-1808LETSEA...........-----......FILKKN.LKILD.DIPFAVIERH..-----------.DTANMS.FSWKSTYA
A0BZJ9_PARTE/1454-1836LQSNKE...........-----.....LTYLQSQGLQFLCLKIPTFCIPNLHR-----------.ESRKE..FQWDINTV
C5DK88_LACTC/1505-1895LQSPYT...........-----......QKLRQT.IKPFR.QMPLVEISSA..-----------.ELALPH.LKWQHIVT
H2YP37_CIOSA/1434-1828YQSSML...........-----.....LDGMKSK.LPILN.DFPVITAPCKAS-----------.MEYNDE.LTWQKEAA
M2NL61_BAUCO/1525-1921LQSGSA...........-----......QMLAND.LPVLQ.SYPLLQLQPEEN-----------.DKALPP.LGWQSFVA
U1M0G7_ASCSU/1468-1870VQTNET...........-----.....SAELIRR.IPALG.DLPLVRIHSAEP-----------.TNLLDV.LDWQRVVI
B0DWP2_LACBS/1522-1912ISSSKD...........-----.....QSYFDRL.VPKLA.KFPVLCMSQAKG-----------.PHTLDI.FPWHSHLA
R4X9Y3_TAPDE/1534-1914LSSPGV...........-----......NELQKR.LPICG.EHPIMCMPTA..-----------.DTLSNS.LNWQSIVM
R1GQ63_BOTPV/1519-1912VRAENQ...........-----......KLLAHD.IPILK.DMPVLPLQADEA-----------.DKQLPP.LGWQSFVA
K1VVE5_TRIAC/1494-1883LCSPFE...........-----.....HAYYQAR.AAVFS.EFPVITIKPLRE-----------EEPS....LMWLVNTA
B3S6C7_TRIAD/1510-1905IQSPTD...........-----.....YIKLATY.IPAIN.DFPVASVSSNDS-----------.DNRYPI.LDWQRHAV
N1JGF4_BLUG1/1511-1904IQSPQC...........-----......RSLLHD.VPVLN.EFPVLSLKNEIS-----------.DASLPL.LAWQLFIA
W4ZAF4_STRPU/37-438VQSTLS...........-----.....NRELARS.IPAME.DFPLVKLHIAES-----------.DNIYSV.LDWQRQGS
M5BQD5_THACB/1537-1929LSSSRD...........-----.....PEYFDLR.VKNMH.KFPVIPMLTDRA-----------.AHVVTAPLQWQSETV
M3ALS7_PSEFD/1503-1901LQSHSA...........-----......TMLVHD.LPMLQ.NLPSLRLKANET-----------.DKQLPP.LGWQSIVA
I2GW49_TETBL/1546-1937LQSPYI...........-----......QKLTRF.LKPLN.QVPIVKVSMS..-----------.EVTLPP.LNWQGTMT
F6GW32_VITVI/1705-2088IECPNV...........-----.......HLLKSGIRALD.DLPCVNIPSNAR-----------.DSHYQA.LGWQIVAA
S7ZMV2_PENO1/1499-1887IQSQQK...........-----......DRLCHD.IPVLK.DYPTLAVKPEVS-----------.DMDLPP.LGWQAFIA
DPOE_SCHPO/1498-1886IESSLP...........-----......HILKAN.VKQIE.ELPYIMIPRL..-----------.ESNIQS.LSWKQHIA
H9J5N5_BOMMO/1546-1951VQAALS...........-----.....LPALTAL.MPGLV.DYPIVPLHVRDV-----------.ETLYNT.LEWQRIGA
H2AUI7_KAZAF/1512-1900LQSPYT...........-----......KNILKS.IKHFK.TLPVIEWTMN..-----------.ELQLPQ.LNWQTGLV
I1BIP1_RHIO9/1528-1924INSPRS...........-----.....SVHLIQY.ARMLS.EFPYIRVPTAQQ-----------.DKKFDA.LNWVQPML
DPOE_CRYNJ/1529-1917LCSPFE...........-----.....HSYYQAK.APVYS.NFPFITYRLGKE-----------EDPG....LMWLLQTS
F8QB37_SERL3/1530-1921VSSTKE...........-----.....QTYFDTW.VPKMS.KFPVLSMSKTKA-----------.AHTLDV.FPWQTHVA
G7E3T0_MIXOS/1542-1933AYTPKD...........-----.....RPFLEEH.LPAAA.NFPLVMIRANKA-----------.DNVLPA.LAWQEPAS
R9P7N8_PSEHS/1532-1932LCTSKD...........-----.....QSYYESR.IPSVA.EFPVIRIAAAAL-----------.EDDLPA.LGWQLYSA
C1FJ68_MICSR/1644-2054VEAPGDSGVDVVDGSSI-----RREGVAGRLGAI.IPALA.RLPVVHVPANAA-----------DTASMPA.IGWQVNAA
A5DEB2_PICGU/1518-1900IQSPYA...........-----......NALLSQ.LKSVQ.DYPTIRMGMR..-----------.ELKLPA.IGWQSLIS
L8G4R0_PSED2/1520-1914IQSPQK...........-----......RMLLHD.MPVLA.DFPVLTLPHDKK-----------.DISFPP.LGWQAFIA
C4QV66_PICPG/1520-1895IQSNQC...........-----......TKLVRA.LKNLN.EQPVISMNLR..-----------.ELNLSP.LSWKSSVI
K1XY13_MARBU/1520-1913VQSPQR...........-----......RMLIHD.VPILA.DFPVLPLKYEIS-----------.DSNLPP.LQWQAFIA
A7TF62_VANPO/1518-1909IQSPFI...........-----......NKIMNT.VRVIN.QIPTIHLGMK..-----------.ELSLPQ.LNWQSVLA
A5E0L0_LODEL/484-866IQSPYA...........-----......DRVLNG.LSSTF.DFPTVKMAVN..-----------.ELSLPA.VGWQVLIS
Q7Q7P3_ANOGA/1541-1943LQTALG...........-----.....LHKLNQH.LPICL.EFPEVSIHIADD-----------.AALLSG.LDWQRHGA
G8BGB3_CANPC/1514-1896IQSPYI...........-----......SKIVPL.LTSVA.EFPTIKMAIS..-----------.ELTLPA.IGWQVLIS
A0A088AM07_APIME/1527-1928TQTALD...........-----.....KTALIAQ.MPLLN.DFPLISTHVQDI-----------.ENLYNT.LEWQKVGA
T1HUW2_RHOPR/1490-1890VQSNRD...........-----.....IQETTML.LPIIN.EWPFMSIYVQES-----------.EPIYST.LDWQRLGS
V5I1Z1_BYSSN/1523-1915IQSQQR...........-----......ERLCHD.IPILK.EYPLLTVKPEAA-----------.DMEFPP.LGWQSFVA
A7SIT9_NEMVE/1502-1904VQSAWD...........-----.....LSHLTSS.VPVLG.DFPLVPLPYSDS-----------.DAQYNV.LDWQRHAS
DPOE_YARLI/1514-1873LHSPD............-----......RNVDEK.VAALA.RIPCIRLRPV..-----------.PPSTAA.VGWQRDLV
R9AMW8_WALI9/1475-1880LNSPQS...........-----.....QSYFSQF.GDGLN.NYPVIAVPTSRK-----------.DLSIDESLMWLPKIS
D8SJG5_SELML/1443-1816VECPSM...........-----......ENIVAH.VPAIL.EVPRVQVPWNSR-----------.HSDYKL.LGWQPVAA
S8FUF8_FOMPI/1617-2006ISSSKE...........-----.....QPYFDAH.VPKLG.KFPVLSMPKTKV-----------.AHTLDV.FPWQTNVA
G1X6W6_ARTOA/1520-1907IQSPYK...........-----......STLCKE.IRSLN.EFPMLSLQIDQT-----------.DSSLPP.LGWQNFVA
Q17H50_AEDAE/1518-1917AQTGFS...........-----.....LQKLNQL.VPACL.DFPETQIHIMDD-----------.ASLLFG.LEWQRNGV
G1RBL5_NOMLE/1514-1911VQSTWE...........-----.....LKRLASE.IPVLE.EFPLVPICVAD.-----------.KINYGV.LDWQRHGA
D5GGS6_TUBMM/1460-1851IQSPQQ...........-----......RTLVDA.VSILS.EFPILTLRSDPA-----------.DNSLP..LGWQTFVA
H2UTB8_TAKRU/1527-1926MQSNWE...........-----.....LKRLASG.MPVLE.EFPVVPVHVVD.-----------.EISYNV.LDWQRLGA
G8ZQL0_TORDC/1514-1906LQSPFP...........-----......TNLTKR.IKVLG.QVPVVEITMN..-----------.ELDLPQ.LQWEVVLS
S3BV94_OPHP1/1618-2007IQSSQR...........-----......NMLVHD.VPVLS.EFPVLPLKYDPL-----------.DSSLPP.LGWQSVVA
G0V590_NAUCC/1533-1922LQSPYP...........-----......KKIMKS.VKYLN.QIPVVELASN..-----------.ELALPQ.LNWQGVLI
K5XRW0_AGABU/1528-1917ISSSKD...........-----.....DAYFEQQ.LPKLA.KFPTLSMPKAKA-----------.PHTLDV.FPWQTHVA
E9H7I0_DAPPU/1517-1917IQSPQD...........-----.....LHATASQ.IQTLN.EFPLVPIHSTDP-----------.DGLYNV.LDWQRVGS
G3B805_CANTC/1530-1912IQSPYT...........-----......DRLLSI.LGSTA.NFPTVKMNVN..-----------.SLSLPA.VGWHSLVT
D6WSX8_TRICA/1501-1896VQSALE...........-----.....PATLRSR.IPLFS.DFPQVQIHITDE-----------.EELYNV.MDWQKIGG
A8NMZ4_COPC7/1518-1909ISSNKD...........-----.....VSYFDRL.VPRLS.KFPVVAMSSARN-----------.AHLLNS.LPWQSTAG
G0WD71_NAUDC/1559-1949LQSPYS...........-----......KKMMKS.IQFLN.QVPVVKLALN..-----------.ELNLPQ.LNWQNGLI
S2J5L9_MUCC1/1535-1930INSPRS...........-----.....STYLTSN.ARMLN.SIPFVRIPSLQE-----------.DNRFDA.LNWVTSIV
C5GX57_AJEDR/1519-1912VQSPQR...........-----......RQLMQE.IPIIK.EHPVLPLRSEAS-----------.DNDLPP.LGWQSFVA
E9D9U9_COCPS/1514-1907LQSPHK...........-----......QQLLHE.VSAFK.DFPVLSLRSDPS-----------.DNELPR.LGWQPFVA
K7J3X8_NASVI/1487-1888LQTPIA...........-----.....TSTLINK.MPYLN.EFPLIKAHIQDL-----------.DNLYDT.LDWQRTGS
O62218_CAEEL/1468-1869LLSDTD...........-----.....PFRLARK.LPNLG.LFPNVQLHITEP-----------.SSLLNQ.IDWQKVVA
V2XXQ2_MONRO/1528-1918LSSSKD...........-----.....DDYFIHH.LPKLV.NFPVLSMSKAKS-----------.AHTLDV.FPWQSHVA
R7YYU2_CONA1/1520-1913IQSQQH...........-----......RMLTHD.IPSLR.DYPILPLRVDEA-----------.DKKLPP.IGWQSVIA
B6QRD6_PENMQ/1519-1904IQSQQK...........-----......RKLCHD.IPILK.DYPMLSVKPEVS-----------.DTDMPP.LGWQSFIA
G6CJ62_DANPL/1482-1880LQTTLS...........-----.....SHALLAL.MPGLS.EFPLVPLHVRDV-----------.ETLYNT.LEWQRIGA
G8YP31_PICSO/1529-1911VQSPYT...........-----......SRILEV.LKSSS.EYPVIRMNIS..-----------.ELTLPA.IGWQSLII
S9XA99_SCHCR/1491-1879IESTSP...........-----......ERLKAN.LKQLE.ELPYTIISRR..-----------.EAAIQS.LSWKQYVS
N1PFE7_DOTSN/1521-1915LQSHGA...........-----......QMLMHD.LPILQ.TFPVLKLHADED-----------.DKHLPP.LGWQSFVA
J4I9U6_FIBRA/1520-1910ISSSKE...........-----.....QTYFDTH.IPRLS.KFPVLSMPKAKV-----------.PHTLDV.FPWQTGVA
M7NNI3_PNEMU/1489-1876HTLKY............-----......DQLSQS.FPILL.DFPLMKFPQD..-----------.DNNVPS.LGWQTYLG
DPOE_YEAST/1528-1919LQSPFI...........-----......TKLLGT.IRLLN.QMPIVKLSLN..-----------.EVLLPQ.LNWQPTLL
M2QWE4_CERS8/1506-1894ISSTKE...........-----.....PAYFDTN.VEKLA.KFPVLSMPKAKV-----------.AHTLDV.FPWQSSVG
G2X166_VERDV/1512-1902IQSSQR...........-----......NHLISE.VPVLS.EFPVLALKYDTT-----------.DSSLPP.LGWQTVAA
U4LW68_PYROM/1510-1903VQSAKR...........-----......QLLLDT.VPALS.EFPILPLKPDPS-----------.DSNLPP.LGWQTFVA
Q7RWE3_NEUCR/1534-1926IQSSQR...........-----......NLLVHE.IPILG.EFPVMPLRYDQG-----------.DSSLPP.LGWQSVVA
G4TAK9_PIRID/1551-1940LASRKD...........-----.....LGYYETG.IAAIS.NLPVLRMASNR.-----------.NTSLDR.LDWQRVAI
H6BPG7_EXODN/1517-1908LQTNSH...........-----......RQLVHD.IRIMK.EYPILCLPTDQA-----------.DTDLPS.LGWQGFAF
C4XXS2_CLAL4/253-635IQSPYC...........-----......NKVLDL.LEAAS.DFPTIKLSVG..-----------.EISLPA.VGWQSLIA
DPOE_KLULA/1498-1882LQSPYT...........-----......HRVAKL.LQPLN.AFPVVEIATA..-----------.ETHLPA.LNWQGQLM
G8JME6_ERECY/1494-1883LQSPFT...........-----......KKLQKT.IRVLS.QIPTVEISMG..-----------.ELILPN.LNWQTLLI
E3L3C9_PUCGT/1547-1947IHSMKD...........-----.....LSYYQEK.VLSVS.KYPVVMVHSSQA-----------.DNKFEA.FGWQRFAA
DPOE_EMENI/1496-1885IQSQQR...........-----......SRLCHD.IPILK.EYPILSVKPEVS-----------.DMNLPP.LGWQSFIA
DPOE_DEBHA/1534-1916VQSPYT...........-----......TKVLNL.LKSTS.SFPTIKMNVS..-----------.ELSLPA.VGWQSLII
F4NWW9_BATDJ/1562-1979IQSASS...........-----.....RKYFENAGITAIR.SVPIITVPSHKN-----------.DVQFPP.IGWQQHGL
E5RYM0_TRISP/1442-1827YISSHE...........-----.....CDQLMSL.ISSLS.YFPVVKLRIVDG-----------C.......LDWQRVGC
F4PWS2_DICFS/1559-1964TQ...............-----.....CSEFMKRDIPALR.EFPKVAMPYHDQ-----------.DSNYSP.FNWEVHCI
K0KG22_WICCF/1507-1890LQSPTA...........-----......NNLSKS.FKTLS.DFPVIHMNVG..-----------.EINVPA.IGWQGIVL
J5JYN7_BEAB2/1524-1910IQSSQR...........-----......NLLVHD.VPVLG.EFPILPLRYDVA-----------.DSSLPP.LGWQAVVA
U1GF87_ENDPU/1518-1911IQSPQQ...........-----......RQLVHD.ITILK.EYPVLALRSETS-----------.DSDLPP.LGWQAYAA
C5DYX0_ZYGRC/1500-1892LQSPYS...........-----......SKLLNA.LRVLN.QVPIIEIAMT..-----------.ELILPR.LNWQGALN
F2PJ05_TRIEC/1466-1860VQSPKS...........-----......RQLPRL.ISSLK.DYPMVSLRSNAS-----------.DNELPP.LGWQPYAA
F6WUQ7_CIOIN/1486-1883YQSTSS...........-----.....VKKIKSK.LPILH.DFPIIHIHNNNA-----------.DQFNDE.LTWQKDAS
J9M470_ACYPI/1505-1904IQSPID...........-----.....IQVMLSN.IPIMN.EFPVVTLHVQDS-----------TASMYAQ.MEWQRLGC
Q59SM7_CANAL/1519-1901IQSPYS...........-----......SRILNV.LNTTD.DFPTIKMNIS..-----------.ELSLPA.VGWQSLIS

PF03337

Q98188_MCV1/6-651AALETDSFFSPQSSATP.....LAKILFHRASGEDNEDLLRALLQPGEP.PGL-----------SLTDINWWLQTRGLGR
Q9Q8S1_MYXVL/6-624HETDTDVYYFPKTCKSP.....LLDILKKRF..KHDPLIRTLQER......DY-----------TVSEINYWLYCNGLEA
Q070L3_CPRVZ/15-682RLRGEDV...PRRHFAPSHGDCLAKILARRASEQGLAELAAALAEPRAPDALA-----------GAAAANQWLARHGLER
Q6TUY6_YMTV5/10-640QSVDTETYYSPETSTSP.....LIDILRLKS..KQYHDLNEFVLKLSKQ.GNV-----------SISEINNCMCLNGMSK
Q08FW7_DPV83/7-651DESESDNYYSPATARSP.....LIDILIKRA..SSEKEIENNIKKLDIK.GNV-----------TVSEINYWMCCNGLAK
Q6TVW0_ORFSA/6-637SRHDPDCYI.PDSS.SP.....FLDILRQRA..ETEPELRAAFEDSPPPRDAL-----------SMDELNQWLSDVGLYD
F12_VACCW/6-635DEIDHESYYSPKTSDYP.....LIDIIRKRS..HEQGDIALALEQYGIE.NTD-----------SISEINEWLSSKGLAC
Q8V3R9_SWPV1/5-644DELDTELFYSPKTSISP.....LIDILKKRF..CNDDNIKTIIGSMTIC.GNV-----------SVSEINYWMYRNGLYK

PF00136

Q9Q8R2_MYXVL/483-985KLLKTFLTERLKYKKMIKETNDVVE...............KAIYDS-MQ------------YTYKIIANSVYGLM-----
DPOD_SCHPO/519-956IILADLLNARKKAKADLKKETDPFK...............KAVLDG-RQ------------LALKVSANSVYGFT-----
DPOL_MUHVS/528-1031ELLVRWLTQRKLVREAMKQCTNEMQ...............RMIMDK-QQ------------LALKVTCNAFYGFT-----
DPOD1_DROME/519-959EILESLLAARKRAKNDLKVETDPFK...............RKVLDG-RQ------------LALKISANSVYGFT-----
DPOD_YEAST/540-973IILDELISARKRAKKDLRDEKDPFK...............RDVLNG-RQ------------LALKISANSVYGFT-----
DPOL_GAHVM/591-1150ILLKDWLAMRKAIRAKIPESCD.EI...............AVLLDK-QQ------------AAIKVVCNSVYGFC-----
DPOA_YEAST/777-1229RLLANLVDRRREVKKVMKTETDPHK...............RVQCDI-RQ------------QALKLTANSMYGCL-----
DPOL_ALHV1/535-1007SLLKTWLAKRKSIKKELEQCQDAKM...............KTILDK-QQ------------LAIKVTCNSVYGFT-----
DPOL_HHV2H/602-1181ILLRDWLAMRKQIRSRIPQSTP.EE...............AVLLDK-QQ------------AAIKVVCNSVYGFT-----
Q98207_MCV1/479-983KLLGTFMEQRARYKALMRAASSGLE...............RTLYDS-MQ------------YVYKVVANSVYGLM-----
DPOLA_ORYSJ/819-1284ELLKSLVERRRMVKSWLKTASGLK................RQQFDI-QQ------------QALKLTANSMYGCL-----
DPOD1_SOYBN/496-935EILEELLTARKRAKADLKEAKDPLE...............KAVLDG-RQ------------LALKISANSVYGFT-----
Q57UW4_TRYB2/670-1122KVIRGLVDSRREIKRMMKSERDPGN...............LAMLEI-RQ------------LALKLTANSMYGCL-----
DPOL_ASFB7/442-955KVLIDLLNKRTALKQELKKLGEKKECIHESHPGFKELQFRHAMVDA-KQ------------KALKIFMNTFYGEA-----
DPOL_HHV6Z/502-979SLLKDWLAKRREVKAEMQNCSDPMM...............KLLLDK-KQ------------LALKTTCNSVYGVT-----
DPOD1_CAEEL/505-943EILEDILAARKRAKNDMKNEKDEFK...............RMVYNG-RQ------------LALKISANSVYGFT-----
DPOL_EBVB9/517-994SLLTSWLAKRKAIKKLLAACEDPRQ...............RTILDK-QQ------------LAIKCTCNAVYGFT-----
G8BKE7_CANPC/511-946TILNELLTARKKAKTDLKNEKDPFK...............KDVLNG-RQ------------LALKISANSVYGFT-----
DPOL_VACCW/482-984RLLRTFLAERARYKKMLKQATSSTE...............KAIYDS-MQ------------YTYKIVANSVYGLM-----
DPOA_SCHPO/758-1203RLIANLVERRRQIKGLLKDNSATPTQ..............RLQWDI-QQ------------QALKLTANSMYGCL-----
DPOLA_HUMAN/768-1227REIRKLVERRKQVKQLMKQQDLNPDL..............ILQYDI-RQ------------KALKLTANSMYGCL-----
Q6TVU5_ORFSA/488-991MLLRSFLDARAKYKKLMKAAETAVD...............REIYNS-MQ------------YTYKITANSVYGLM-----
DPOZ_YEAST/904-1362KMLTDILDVRVMIKKTMNEIGDDNTTL.............KRLLNN-KQ------------LALKLLANVTYGYT-----
DPOL_VZVD/582-1117VLLKDWLAMRKAIRARIPGSSS.DE...............AVLLDK-QQ------------AAIKVVCNSVYGFT-----
DPOL_HHV8P/518-987KLLTVWLAKRKEIRKTLASCTDPAL...............KTILDK-QQ------------LAIKVTCNAVYGFT-----
DPOL_SHV21/507-976RLLTVWLSKRKAIRQKLAECEDLDT...............KTILDK-QQ------------LAIKVTCNAVYGFT-----
DPOL_EHV2/515-985TLLNVWLAKRKAIRRELATVSDEAV...............RTILDK-QQ------------LAIKVTCNAVYGFT-----
DPOL_FOWPN/468-966KLLEMFIGKRKEYKNLLKTASTTIE...............STLYDS-LQ------------YIYKIIANSVYGLM-----
DPOLA_DROME/790-1239LQLKRLVESRKEVKKLMAAPDLSPEL..............QMQYHI-RQ------------MALKLTANSMYGCL-----

PF03175

DPOL_ADEG1/239-749QKNLWQKEHPGQQYDIVQACLEYCM---------------QDVRVT-QK------------.LAHTLHDSYDAYFQREL-
Q9QM79_9ADEN/239-780QKALWRQEHPGRPYDIVQACLEYCM---------------QDVRVT-QK------------.LALTLYDSYDKYFKDEL-
Q9YUR6_9ADEN/339-828QKEIWLEKKEV.KYDIVKELIDYCI---------------KDVKIT-EE------------.LTKTLLNTFDTFIKEEL-
DPOL_ADEB3/263-744NKSLWLQENSG.AYDIVQRTLDYCA---------------MDVLVT-AE------------.LVKKLQASYLDFVHTSV-
DPOL_ADECT/392-875NKDLWIKEKKG.AYDIIQQTLDYCA---------------LDVQVT-AQ------------.LVNKLIESYQIFIKNSV-
DPOL_ADEB2/268-751NKALWREKNVG.AYDIIQQTLHYCV---------------QDVLVT-SA------------.LVNKLQESYKNFIASQV-
DPOL_ADE40/434-918NRELWEKKQCP.HYDLVRETLDYCA---------------LDVLVT-AA------------.LVQKLRESYAQFIRDAV-
DPOL_ADE12/307-791NQELWKKKGEK.NYNLIGETLNYCA---------------LDVLVT-AS------------.LVEKLRSSYAQFVTDAV-
DPOL_ADE02/443-927NRELWKKKGQD.KYDIIKETLDYCA---------------LDVQVT-AE------------.LVNKLRDSYASFVRDAV-
Q9WF13_ADE17/336-820NRELWEKKGEA.GYDIIRETLDYCA---------------MDVLVT-AE------------.FVAKLQDSYAHFIRDSV-
DPOL_ADE04/438-922NRELWKQKGQL.KYDIIQETLDYCA---------------LDVLVT-AE------------.LVAKLQDSYAHFIRDSV-
Q83895_ADEO7/319-798NKPKHNQ.....KYNLLEEAKEYCI---------------DDVIVT-AQ------------.LVEKLIEGYQEFCTTSL-
O11414_9ADEN/324-802NKIKG.......PYDILKEALIYCI---------------ADVKVT-SQ------------.LTRKLIEGYQSFCNDQI-
DPO2_KLULA/409-871KNIEIFENDRN.YNTILENAIEYCK---------------VDVLAM-EK------------.VWIKFKKLLEKNL....-
Q09038_LACKL/414-876NTTLEEDNITN.NSTIIEKAIEYCS---------------IDVIAM-KQ------------.VWQKFKKLVKENL....-
DPO1_KLULA/416-866EHIVNFTKNDK.SKTLIEWSKDYCR---------------NDVLVL-SK------------.VWLEFKNAVEDIF....-
O74719_DEBHN/419-870HNIINYETDGK.SKKLLDWSREYCC---------------NDVIVL-AK------------.VWLEFKIAVYEIF....-
DPOL_BPCP1/57-480............PEVIKPEWIDYIH---------------VDVAIL-AR------------GIFAMYYE..........-
Q96206_BPGA1/50-479KGDIDYKKYRPVGYVMDDNEIEYLK---------------HDLLI.-..------------.VALALRSMFD.......-
DPOL_BPM2/50-474KGDIDYHTERPVGHEITPEEYEYIK---------------NDIEII-AR------------ALDIQFKQGLD.......-
DPOL_BPPZA/50-474KGDIDYHKERPVGYEITPDEYAYIK---------------NDIQII-AE------------ALLIQFKQGLD.......-
DPOL_BPPRD/2-433YGKMERETREQHKAEILE....YLK---------------GDCVTL-HK------------.MVSLFIAEFG.......-
O21376_PICKL/474-939NGMM........NTKMATKT..YTD---------------TDVRLL-TM------------.IMDKFKNIMYS......-
Q35599_PHYPO/8-446............LYNFFSENIIY..---------------NDVVKD-YK------------.LLAILYNEIQTAY....-
O99973_PORPU/80-478K.....................YLT---------------NDIEML-RD------------.IIISFENMVNESY....-
Q9XNK1_PLEOS/738-1218IVNRIKNEENG.VWDCEKELLKYLN---------------GDIDTL-YS------------.VMYTFGEFIFDKF....-
E6ZE21_BETVM/147-562.....LENVKK.KRDVVIE...YMK---------------QDIRLL-GG------------.VMQKAQDIYWNLF....-
DPOM_MAIZE/299-724..............SIREDSLTYLK---------------QDILIT-AA------------.VMQRAKAIIWEEY....-
Q9TEH5_9PEZI/309-758YDEIKNSPDSS.KRDLKKETIKYLE---------------QDIKTL-CE------------.VLIKFSDEIW.......-
DPOM_NEUCS/366-859WAAMYTN.....KWSMRKETIIYLE---------------KDIKAL-YQ------------.LMMEMSNNTYSTF....-
O78938_AGRAE/67-512NFK.........VWNFREEAIKYCN---------------LDCISL-YE------------.ILYKFNTLVFNKF....-
DPOM_NEUIN/401-859QYQEYANKFKNNNWDLKKELIKYCE---------------IDTIAL-YQ------------.VLVSFQRKIYEKF....-
DPOM_ASCIM/589-1039DYKKYCKDFNN.NWDFNKELKNYCE---------------IDCLAL-HD------------.ILTLFAKMIHNEF....-
DPOM_CLAPU/432-888D...........DWDFKDETLEYLN---------------LDLISL-HQ------------.VLVKVNKAINFLF....-
DPOM_PODAS/450-889SQELYNELIVP.QWDLRKQTLHYLE---------------RDLLSL-LE------------.IINTYNHYVYKRY....-

PF08490

D8PW53_SCHCM/1455-1844HKMNARYLAMGPWLDRLIATAQYFD---------------VPIGHL.DG............DQPLVVSDISFARR-----
K1Q2Z7_CRAGI/498-892RRMIQHYLNVKIILQSMTEQCRYLH---------------IPLGNL.PK............DITMFGCDLFFARH-----
K5UTI1_PHACS/1501-1886QKMIRRYLTMGAWLDRTIALADYYD---------------VPVGHI.DG............DQPLLLADIEFARR-----
T1J6P1_STRMM/1470-1868KLIIQHFLKAETILQVLIEHCRYLH---------------IPVGNL.PH............DATLFAADLFFARY-----
E0VSJ8_PEDHC/1513-1911RIMIHHFLNSITTLNSVLYQSKFFH---------------APPGNI.PA............DATLFGTDLFYARH-----
G8BQ26_TETPH/1521-1912KIIVSNLVSSGSSLHTLITLSHYSN---------------IPICNL.KL............HEMNFIIDVLYARK-----
G0T1H4_RHOG2/1536-1927RRMIQHYLRAAVWIRERIELADRFD---------------VPVCNL.EK............DVPLFLADIDFARR-----
J0M8E9_LOALO/1625-2027RRIIKHYFNMFLYLHQYVEVSRYLH---------------IPIGNI.PE............DFSTFGPDVLFARS-----
B0WNF0_CULQU/1523-1926RSMVRHFLNLNHVVEMMLDQCRYFQ---------------LPIGNM.PA............DTVLFGADLFYARH-----
M5E7V9_MALS4/1436-1836RRMVNCYLRTSLWLVRWIELAAHLD---------------IPLGNM.PR............DFAMFGSDLDLARR-----
E3S8N6_PYRTT/1524-1919RRLVGHYLDLGSWVAHLLELARYGD---------------IPLCNL.ES............NDPRFLIDVAYARR-----
W1Q6U0_OGAPD/1501-1875KRIINHYLSVAGWLQKIISLARYSN---------------IPLCNL.EI............DNLGYMIDIEYARK-----
I1G2M3_AMPQE/1495-1895KKMIAQLLNAPTWLHNRLEYARYAH---------------IPVGNF.CP............DAVVYAADVFYSRH-----
Q9VCN1_DROME/1529-1930RAVIRHFLNLNNVLDLMLDQCRYFH---------------VPIGNM.PP............DTVLFGADLFFARL-----
DPOE_CANGA/1526-1915NKLCSYIISTSYWVSHLVSLSQHSN---------------VPICNI.NL............EKMDFVIDVIYARR-----
E2B8B2_HARSA/1525-1925KMMVRHYLKSQQIIELMAEQCRFFH---------------APIGNI.PA............DPTLFGADLFYARH-----
J7RME7_KAZNA/1518-1909SKIINQIFSCSSWVAHMVKVARYSN---------------IPVCNL.QL............DNMGYVIDVLYARK-----
F4S3B6_MELLP/1559-1958ERMVQHFLRASSFIQERILQAEQFD---------------VPVCNF.ES............DAASFLMDLEFCKK-----
DPOE_ASHGO/1493-1878KKTVSHILQLGSWLSNLTILSNYTR---------------IPICNL.NL............TNLGYVIDIMYARR-----
B6K1H9_SCHJY/1420-1808KMMIRHYLGIGPWITHQRQLAAYAS---------------IPFCNF.EK............DNMQYLLDIEYARR-----
A0BZJ9_PARTE/1454-1836KQQLESYCKLRETIAQHIKYCKYVK---------------VPLCNLTASNLGKTDVFKTDIEMLNYTTDIFFQRV-----
C5DK88_LACTC/1505-1895KKITNHILSLGKWLQNLMNLSRYSN---------------IPICNI.RL............EKMSFVIDVMYARR-----
H2YP37_CIOSA/1434-1828SEMIEHFLESEMVFPRLLSYSKYFH---------------IPVGNL.PN............QPATFVTDLLCARH-----
M2NL61_BAUCO/1525-1921KRLVSHYLDLGTWISHLVEFARYGN---------------VPLCNL.EK............DDPRFLIDITYARR-----
U1M0G7_ASCSU/1468-1870RRIIKHYFNSFIYLHDYVEVSRYLR---------------IPLGNV.PA............DLSLFAADLFYARN-----
B0DWP2_LACBS/1522-1912QKMLNRYLSLGLWLDRMIDLAEYYD---------------VPVGHI.EG............DQPLMLSDISFARR-----
R4X9Y3_TAPDE/1534-1914KTLVAKFLTIRSWLEYRIMLSRYGQ---------------VPICNL.GD............DEAKTVIDLTMARR-----
R1GQ63_BOTPV/1519-1912RRLVDHYLDLGTWIAHLIGLARYGD---------------IPLCNL.ER............DDPRFLIDISYARR-----
K1VVE5_TRIAC/1494-1883RRMIAQYMKLSAWIAGQLEIAAHYD---------------VPVGNL.GP............DPPMLLSDLEFARR-----
B3S6C7_TRIAD/1510-1905RRMIQHHLNIEIWLENRLDHARYAH---------------IPLGNM.PA............DVPLFVNDLFFARY-----
N1JGF4_BLUG1/1511-1904KRLINNYLSLGSWILHFIELAKYGD---------------IPLCNL.ER............DDPKYLIDIAYARR-----
W4ZAF4_STRPU/37-438RRLLQHYLNADYLLLSYLEQSRYFH---------------IPVGNL.PE............DSGIAGADLFFARH-----
M5BQD5_THACB/1537-1929EKLMTQYLSFDSWLQTAVEQSTYFD---------------VPLGNI.GA............DAPLFFADVDFARR-----
M3ALS7_PSEFD/1503-1901RRLVSHYLDLGLWISHLLEFARYGN---------------VPLGNL.EV............DDPRFLIDIAYARR-----
I2GW49_TETBL/1546-1937KRISQYLVSLGSWYAHLLALSKYSN---------------IPLCNL.QL............DNMGYVIDVIYARK-----
F6GW32_VITVI/1705-2088KIGMQRCAAATQWLNERISLARYAH---------------VPLGNF.EP............DWLIFTADLFFSRA-----
S7ZMV2_PENO1/1499-1887RRIVTHYLYLAAWIQHLALLARYGD---------------VPLCNL.ET............DDPRFLIDVAYARR-----
DPOE_SCHPO/1498-1886TKMIQHFLAIGSWLFHRIQLSRFSD---------------IPLCNF.ES............DDIQYSIDVVYSRK-----
H9J5N5_BOMMO/1546-1951RAIVRHYLNLESVLALTIEQCRYFH---------------VPLGNM.PA............DPTLFGADLFYARH-----
H2AUI7_KAZAF/1512-1900SKLVKHLFSSGYGISHMINIAKYSN---------------IPIGNL.QL............NNMGYVIDILYARR-----
I1BIP1_RHIO9/1528-1924KRVFKYYMELGSLVDERLSQARYAN---------------VPFCNI.PE............DPYVFMSDVIFART-----
DPOE_CRYNJ/1529-1917RRMIGLYLRLSSWLKEQIQIASHFD---------------VPIGNL.GA............DIAVFLADIEFARR-----
F8QB37_SERL3/1530-1921QKLLYRYLSVGGWLDRLVVLADYYD---------------VPIGHI.EG............DQPLLLSDITFARR-----
G7E3T0_MIXOS/1542-1933KRMLQHYLRVSHWLKDRIALAEEFD---------------IPLCNL.EG............DVPIMVADIEYARR-----
R9P7N8_PSEHS/1532-1932RRMLQCYLRASNWIRGWIELASHFD---------------LPVCNM.EK............DFTIFGADIDFARR-----
C1FJ68_MICSR/1644-2054KTACTRLAAHGDWLAERVAISRYAH---------------IPVGNL.GQ............DWCLHTADTFFARA-----
A5DEB2_PICGU/1518-1900KRIVNHYFVLGAWIKNLISISKYGN---------------IPLCNL.EI............DNLGYLIDVEYARR-----
L8G4R0_PSED2/1520-1914KRIINNYLNLGSWISELTNLARYGD---------------VPLCNL.ER............DDPRFLIDIAYARR-----
C4QV66_PICPG/1520-1895NKIINHYLSLGAGLKDLISMARYGN---------------IPLCNL.NV............EDKSYLIDIQYARK-----
K1XY13_MARBU/1520-1913KRLVNHYLSLGSWILHLTELARYGD---------------VPLCNL.ER............DDPRFLIDIAYARR-----
A7TF62_VANPO/1518-1909RKICSHILLCGQWLSHLVELSRYSN---------------IPIGNL.QL............NNIGYIIDILYARK-----
A5E0L0_LODEL/484-866KRVINHYFVLGSWLQNLIALSRYGG---------------VPLCNL.QI............ENMSYLIDVEYARR-----
Q7Q7P3_ANOGA/1541-1943RSMIRHFLNLGRVLQMMLEQCLYFQ---------------LPLGNM.PP............DTVLFGADLFFARL-----
G8BGB3_CANPC/1514-1896KRVMNHYFALASWIKNLIALSKYGR---------------VPLCNL.QI............ENVGYLIDVEYARR-----
A0A088AM07_APIME/1527-1928KIMIRHYFKSQQILELMSEQCRFFH---------------APIGNI.PA............DPVIFGADLFFARH-----
T1HUW2_RHOPR/1490-1890KLMVKHYLNSEKAIALQAELCRYFH---------------VPIGNI.PQ............DTTMFGADLFFARH-----
V5I1Z1_BYSSN/1523-1915KRLVRRYMYLGTWIQNLTLLARYGD---------------VPVGNL.ES............EDPRYLIDVSYARR-----
A7SIT9_NEMVE/1502-1904RRMIRHYLEVDIYVQAQLEHARYFH---------------VPIGNV.ST............DPTLFAADLFFARH-----
DPOE_YARLI/1514-1873RRLIASFLSHGANISYLVEMARYAK---------------MPLCHV...............QDTRDVIDVSYARR-----
R9AMW8_WALI9/1475-1880KRMIGMYFRMSAWIHERIGLAKHYD---------------VPVGNI.ER............DAPIQLSDISFARR-----
D8SJG5_SELML/1443-1816KLAMQRCAASPSWLSERIALCRYAH---------------VPLGNL.DS............DWILFTADAFYARV-----
S8FUF8_FOMPI/1617-2006QKMVNRYLAMGTWLDRTIALASYYN---------------MPIGHI.DG............DQPLLLADVDFARR-----
G1X6W6_ARTOA/1520-1907KRIVIRYLSLGSWLSHLIELARYGN---------------VPLCNL.VN............HDPRFLVDIAYARR-----
Q17H50_AEDAE/1518-1917RTMIRHYLRLNPVIDMMLDQCRYFQ---------------IPLGNM.PF............DTVLFGADLFYARH-----
G1RBL5_NOMLE/1514-1911RRMIRHYLNLDTCLSQAFEMSRYFH---------------IPIGNL.PE............DISTFGSDLFFARH-----
D5GGS6_TUBMM/1460-1851KRIVTHYLALGAWILHLVELARYGR---------------IPLCNL.ER............DDPTFLIDIDYARR-----
H2UTB8_TAKRU/1527-1926RRMIRHYLNLDSCLSQAFDMARYYH---------------LPVGNL.PQ............DVSIFGSDLFLARH-----
G8ZQL0_TORDC/1514-1906KKMISHFLSCGSWLSHLVTISQSSS---------------IPICNL.KL............DNAGFVIDVLYSRQ-----
S3BV94_OPHP1/1618-2007RRLVSHYLALGSWVLHLVGLARYGD---------------VPVCNL.ER............DDPRFLIDVAYARR-----
G0V590_NAUCC/1533-1922KKIVNHLLSCGSWVSHLITLSQYSN---------------IPIGNL.NL............DNMSYVIDMIYVRR-----
K5XRW0_AGABU/1528-1917AKLMTRYLTMGSWIDRLVTLADYYD---------------IPMGHI.EG............DQPLHCIDVNFARK-----
E9H7I0_DAPPU/1517-1917KVCLRHFLRLRTVLDANLEQCRYFH---------------IPIGNL.PS............DANLFGADLFFARH-----
G3B805_CANTC/1530-1912KRVVNHFFVLASWMKNLISLSKYGN---------------IPICNL.QA............ENISYLIDIEYARR-----
D6WSX8_TRICA/1501-1896RALVRHYLNSEKVLDLMIEQSRYFH---------------LPVGNM.PP............DPALFGSDLFYARH-----
A8NMZ4_COPC7/1518-1909VKILKRYLALGPWLDRMIALADYYD---------------VPIGHI.EG............DTPLLLSDITYARR-----
G0WD71_NAUDC/1559-1949KKLVSHLLSCGSWVSHLIELAKYSN---------------IPIGNL.NL............DTMNFIIDVLYARK-----
S2J5L9_MUCC1/1535-1930NRMIKHYMELGTWIDEKISQARYSN---------------IPFCNI.PD............DPYLFISDVLFARK-----
C5GX57_AJEDR/1519-1912KQIVMHYLALDSWLFHLGELARYGD---------------VPICNL.EK............DDPKYLIDIAYARR-----
E9D9U9_COCPS/1514-1907KQIVMHYLALDSWISHLIEFARYGD---------------IPLCNL.ER............DDPKFLIDIAYARR-----
K7J3X8_NASVI/1487-1888KMLLRHYFKSEDVLKQLVEQARYFY---------------APVGNL.PP............DVVIFGADLFYARH-----
O62218_CAEEL/1468-1869RRVLQHYFNSFFFLADYLEWARYLR---------------VPIGNL.PA............DHALFGLDLLFARN-----
V2XXQ2_MONRO/1528-1918QKMLNRYLSLASWLDRLVVLADYYD---------------IPIGHI.EG............DQPLFTADVTFARR-----
R7YYU2_CONA1/1520-1913KRLVHNYLDLGQWISHLTELARYGD---------------IPLCNL.ER............DDPRFLIDVAYARR-----
B6QRD6_PENMQ/1519-1904KRLLTHYLYLGSWIQHLKMLARYGD---------------VPVCNL.ES............DDPRYLIDVSYARR-----
G6CJ62_DANPL/1482-1880RAIVRHYLNLDSVLELTIEQCRYFH---------------LPLGNT.SS............DPTQFGADVFFARH-----
G8YP31_PICSO/1529-1911RRAVNHYFVLATWLRKLISLSRYSN---------------VPLCNL.QI............ENMGYLIDMEYARR-----
S9XA99_SCHCR/1491-1879KKMIQHFLAVGAWINHRIQLSRYAD---------------IPLCNF.ES............DELQYVIDLLYARK-----
N1PFE7_DOTSN/1521-1915KRFVSHYLDLGSWIAHLLAFSQYGN---------------VPLCNL.EV............DDPRFLIDIAYARR-----
J4I9U6_FIBRA/1520-1910QKLVGRYLTMGTWLDRSISLANYYD---------------VPLGHI.DG............DQPLLLSDIEFARK-----
M7NNI3_PNEMU/1489-1876KSLITSFLHLSVFILYRIKLSRYSN---------------IPLCEM.SE............DDPKFVIDVTFARC-----
DPOE_YEAST/1528-1919KKLVNHVLSSGSWISHLIKLSQYSN---------------IPICNL.RL............DSMDYIIDVLYARK-----
M2QWE4_CERS8/1506-1894HKMLTRYLYMGTWLDRTIALADYYD---------------VPIGHI.EG............DQPLLLSDIEFARR-----
G2X166_VERDV/1512-1902RRLVGHYLGLGSWVMHLMSLARYGD---------------VPLCNL.ER............DDPRFLIDIAYARR-----
U4LW68_PYROM/1510-1903KRIVTHYLALGSWISHLTDLARYGD---------------VPICNL.EK............DDPKFLIDIAYARR-----
Q7RWE3_NEUCR/1534-1926RRLVNHYLSLGSWITHMTALARYGD---------------VPLCNL.ER............DDPRFLIDIAYARR-----
G4TAK9_PIRID/1551-1940QGFLSHYFAFGEWLRDSIDNSVYYD---------------VPIGNT.PT............DQSLFFMDVAFARK-----
H6BPG7_EXODN/1517-1908KQLISHYFNVGGWLSHLIELARYGD---------------VPLCNL.EK............DDPRFLIDLAYARR-----
C4XXS2_CLAL4/253-635KRIVNHYFSLASWLKNMTSLSSYGK---------------VPLCNL.QI............ETPGYLIDIEYSRR-----
DPOE_KLULA/1498-1882RKAVNHILSLGSWISNLITLSKYSN---------------IPICNL.KV............DNLGYIIDLMYARQ-----
G8JME6_ERECY/1494-1883KKIVNYILSLGSWVSNLVSLSKYTN---------------IPICNL.KL............ENLGYVIDILYSRK-----
E3L3C9_PUCGT/1547-1947ERMVQHYVRASSFLRERVAQAEQFD---------------VPVANF.EM............DAPRSLMDLEFARR-----
DPOE_EMENI/1496-1885KRLVTHYLYLSSWVQHLTMLARYGD---------------VPLCNL.ES............DDPRFLIDISYARR-----
DPOE_DEBHA/1534-1916KRVVNHYFVLASWIKKLISLAKYGN---------------VPLCNL.QI............ENMGYLIDIEYARR-----
F4NWW9_BATDJ/1562-1979RRMFGHFLNLDDFITDRIKLARYAD---------------IPLCNI.ES............DYTMFLSDVFMARR-----
E5RYM0_TRISP/1442-1827KKVVTHFLNVNSYLTTFKDLCRYMR---------------IPLGNV.PT............NPTQYGSDLSYARH-----
F4PWS2_DICFS/1559-1964KPIATRYEEVDKWWMHYVGMARYSN---------------IPIGNLVGG............DYAQMVTDTEFSRL-----
K0KG22_WICCF/1507-1890KRVCNHYLALASWIKHLLALAKYGN---------------IPLCNL.RA............DNIGYLIDIEYARR-----
J5JYN7_BEAB2/1524-1910RRLVGHYLGLGSWVLHLTALARYGE---------------VPLCNL.ER............DDPRYLIDIAYARR-----
U1GF87_ENDPU/1518-1911RRSVSHYLTLSSWISHLVELARYGD---------------VPLCNL.AC............DDPRFLVDIAYARR-----
C5DYX0_ZYGRC/1500-1892KKLISNILSCGPRLSHLVTLSQFSN---------------IPLCNL.KV............DTMGYIIDILYARR-----
F2PJ05_TRIEC/1466-1860RQIVMHYLALDSWINHLLGFARYGS---------------VPIGNL.EK............DDPKHLIDILYARQ-----
F6WUQ7_CIOIN/1486-1883NIMVDHFLESKLIFPRLLSFSKYFH---------------IPVANF.PS............PLGTFVTDLLCARH-----
J9M470_ACYPI/1505-1904SLIVNHYLNSPENINIMLEQCRYLQ---------------IPLGNL.PA............DVTLFASDIFFARH-----
Q59SM7_CANAL/1519-1901KRVINHYFVLGSWIKNLVAFAKYAN---------------VPLCNL.QI............ENIGFLVDIEYARR-----

PF03337

Q98188_MCV1/6-651YCFMTLSTFRA.RELPRGSLTLIDD---------------MVVGCL-GY------------HAIWVKDPERYTRPEIDI.
Q9Q8S1_MYXVL/6-624YRFVNYKDEKA....NDSQYTLIDD---------------MIISYI-GN------------HYIWVKKKEAYQRPEIDV.
Q070L3_CPRVZ/15-682FRVVNYKDAAA..LAARPQATVVDD---------------MRIRNL-GY------------YAIWVRDVRVYARPEMDID
Q6TUY6_YMTV5/10-640YRFFNYKDERF.IEKEKNLYTFLDE---------------MNISYI-GH------------HYIWVKDK.NYVRPDLDI.
Q08FW7_DPV83/7-651YRFMNYRDDKI....KETSYTLIDE---------------MIITYI-GN------------HYIWVKDKLSYTRPELDI.
Q6TVW0_ORFSA/6-637LRMVSHDAVRR.LGTPLRRQTLLDL---------------MNVCCV-GS------------YAIWIKDPSAYSRPDTEV.
F12_VACCW/6-635YRFVKFNDYRKQMYRKFSRCTIVDS---------------MIIGHI-GH------------HYIWIKNLETYTRPEIDV.
Q8V3R9_SWPV1/5-644YRFMNYRDSKI...TKDCEYTMIDE---------------MVITYI-GN------------HYIWVKNK.AYNRPELDI.

PF00136

Q9Q8R2_MYXVL/483-985---GFK.NSAL-YSYA----------SAKSCTAIGRQMI-----------------------------------------
DPOD_SCHPO/519-956---GAT.NGRL-PCLA----------ISSSVTSYGRQMI-----------------------------------------
DPOL_MUHVS/528-1031---GVA.AGML-PCLP----------IAASITKIGRDML-----------------------------------------
DPOD1_DROME/519-959---GAQ.VGKL-PCLE----------ISGSVTAYGRTMI-----------------------------------------
DPOD_YEAST/540-973---GAT.VGKL-PCLA----------ISSSVTAYGRTMI-----------------------------------------
DPOL_GAHVM/591-1150---GVS.NGLL-PCID----------VAATVTTIGRNML-----------------------------------------
DPOA_YEAST/777-1229---GYV.NSRF-YAKP----------LAMLVTNKGREIL-----------------------------------------
DPOL_ALHV1/535-1007---GVA.SGML-PCLM----------IAETVTLQGRTML-----------------------------------------
DPOL_HHV2H/602-1181---GVQ.HGLL-PCLH----------VAATVTTIGREML-----------------------------------------
Q98207_MCV1/479-983---GFY.NSSL-YSYS----------SAKCCTTIGRVMI-----------------------------------------
DPOLA_ORYSJ/819-1284---GFS.NSRF-YAKP----------LAELITLQGREIL-----------------------------------------
DPOD1_SOYBN/496-935---GAT.IGQL-PCLE----------ISSSVTSYGRQMI-----------------------------------------
Q57UW4_TRYB2/670-1122---GFE.YSRF-YAQP----------LAELVTRQGRLAL-----------------------------------------
DPOL_ASFB7/442-955---GNN.LSPF-FLLP----------LAGGVTSSGQYNL-----------------------------------------
DPOL_HHV6Z/502-979---GAA.HGLL-PCVA----------IAASVTCLGREML-----------------------------------------
DPOD1_CAEEL/505-943---GAT.VGKL-PCLE----------ISQSVTAFGRKMI-----------------------------------------
DPOL_EBVB9/517-994---GVA.NGLF-PCLS----------IAETVTLQGRTML-----------------------------------------
G8BKE7_CANPC/511-946---GAT.VGKL-PCLA----------ISSSVTAFGREMI-----------------------------------------
DPOL_VACCW/482-984---GFR.NSAL-YSYA----------SAKSCTSIGRRMI-----------------------------------------
DPOA_SCHPO/758-1203---GYT.KSRF-YARP----------LAVLITYKGREAL-----------------------------------------
DPOLA_HUMAN/768-1227---GFS.YSRF-YAKP----------LAALVTYKGREIL-----------------------------------------
Q6TVU5_ORFSA/488-991---GFR.NSAL-FSYA----------SAKSCTAIGRTMI-----------------------------------------
DPOZ_YEAST/904-1362---SASFSGRM-PCSD----------LADSIVQTGRETL-----------------------------------------
DPOL_VZVD/582-1117---GVA.QGFL-PCLY----------VAATVTTIGRQML-----------------------------------------
DPOL_HHV8P/518-987---GVA.SGIL-PCLN----------IAETVTLQGRKML-----------------------------------------
DPOL_SHV21/507-976---GVA.SGLL-PCIS----------IAETVTLQGRTML-----------------------------------------
DPOL_EHV2/515-985---GVA.SGIL-PCLK----------IAETVTFQGRRML-----------------------------------------
DPOL_FOWPN/468-966---GFS.NSTL-YSYS----------SAKTCTTIGRNMI-----------------------------------------
DPOLA_DROME/790-1239---GFA.HSRF-FAQH----------LAALVTHKGREIL-----------------------------------------

PF03175

DPOL_ADEG1/239-749GM.EGH-FNIF-VRPT----------IPSNTHAFWKQLT...FSNYVREQRATCPPSVPEPP..................
Q9QM79_9ADEN/239-780GM.HGD-FNIF-LRPT----------IPSNTHAFWKQLT...FTAYVEEQERAS..TVERPPSKYKRKVALKKNDIKGNP
Q9YUR6_9ADEN/339-828NL.KCN-FNIF-KRPT----------ISSNSHAIFRQLH...F.....................................
DPOL_ADEB3/263-744GLPHCN-FNVL-QRPT----------ISSNSHAIFRQVV...Y.....................................
DPOL_ADECT/392-875NLPETS-FNVF-QRPT----------ISSNSHAIFKQIL...Y.....................................
DPOL_ADEB2/268-751NLPDAS-FNIF-QRPT----------ISSNSHAIFKQIL...Y.....................................
DPOL_ADE40/434-918GLPEAS-FNVF-QRPT----------ISSNSHAIFRQIL...Y.....................................
DPOL_ADE12/307-791GLDAAH-FNVF-QRPT----------ISSNSHAIFRQIL...Y.....................................
DPOL_ADE02/443-927GLTDAS-FNVF-QRPT----------ISSNSHAIFRQIV...F.....................................
Q9WF13_ADE17/336-820RLPHAH-FNIF-QRPT----------ISSNSHAIFRQIV...F.....................................
DPOL_ADE04/438-922GLPHAH-FNIF-QRPT----------ISSNSHAIFRQIV...Y.....................................
Q83895_ADEO7/319-798KL.ECS-FNIF-QRPT----------ISSNTQALFKQIF...Y.....................................
O11414_9ADEN/324-802KL.TCQ-FHIF-QRPT----------ISSNTHALFKQIL...Y.....................................
DPO2_KLULA/409-871...NIT-VSV.-KTFT----------LSQLSMKIMESKL.........................................
Q09038_LACKL/414-876...QIS-ISE.-KTFT----------LSQLSMKIMEASL...D.....................................
DPO1_KLULA/416-866...NCE-LVD.-QTMT----------LAGLSYKLFQANM.........................................
O74719_DEBHN/419-870...SAK-VVD.-QSYT----------LAGMSFKLFESNL...D.....................................
DPOL_BPCP1/57-480......-.ENF-TKYT----------SASEALTEFKRIF.........................................
Q96206_BPGA1/50-479......-.NDF-TSMT----------VGSDALNTYKEML.........................................
DPOL_BPM2/50-474......-....-.RMT----------AGSDSLKGFKDIL..ST.....................................
DPOL_BPPZA/50-474......-....-.RMT----------AGSDDLKGFKDII...TT....................................
DPOL_BPPRD/2-433......-....-MRLT----------IGGTAMNELKQFH.........................................
O21376_PICKL/474-939...TAR-VDLT-KCMT----------ISKLALSMYSNMC.........................................
Q35599_PHYPO/8-446...NIN-INRK-YILS----------TASLSLRIFKKSF.........................................
O99973_PORPU/80-478.....N-MICH-NNLT----------STSLSYKIFKKYY.........................................
Q9XNK1_PLEOS/738-1218.....N-INIT-RIRT----------YSGLAFLIYTSRY...Y.....................................
E6ZE21_BETVM/147-562.....E-VDLV-DWIT----------VASQALGIFRMNF...F.....................................
DPOM_MAIZE/299-724.....G-IDIL-KVLT----------ISALALKIFRRVY...Y.....................................
Q9TEH5_9PEZI/309-758...EER-ENIT-KCSS----------LSGLAYLIFKTNY.........................................
DPOM_NEUCS/366-859.....R-INIT-RVKT----------ASALAFLVYRTIFLPNEVEEENETNSPNNILSLF....................
O78938_AGRAE/67-512.....E-LNIN-KYPT----------LPSLSFALFKTKY.........................................
DPOM_NEUIN/401-859.....M-IDCT-KYPT----------IPSLAFAIFRKKY.........................................
DPOM_ASCIM/589-1039.....S-VDIT-RYVS----------LSSITFAIFRTNF.........................................
DPOM_CLAPU/432-888.....D-IEFT-SCAT----------VSSLANKIFLSKF...Y.....................................
DPOM_PODAS/450-889.....N-VQLT-ESLT----------IARLALNIYLKRY.........................................

PF08490

D8PW53_SCHCM/1455-1844---LVQQDMVL.WWSP----------.GENPDLGGIE-------------------------------------------
K1Q2Z7_CRAGI/498-892---LQKNNHVL.WCSP----------.TERPDLGGKE-------------------------------------------
K5UTI1_PHACS/1501-1886---LTAQDILL.WWSP----------.TDRPDLGGIE-------------------------------------------
T1J6P1_STRMM/1470-1868---LMQNNCVL.WCSS----------.SDRPDLGGKE-------------------------------------------
E0VSJ8_PEDHC/1513-1911---LLKNNFVL.WCSD----------.NELPDFGGTE-------------------------------------------
G8BQ26_TETPH/1521-1912---LKNEGIVL.WWND----------KTPLPDYGGTQ-------------------------------------------
G0T1H4_RHOG2/1536-1927---LSKADCVL.WWSP----------.AARPDLGGRE-------------------------------------------
J0M8E9_LOALO/1625-2027---LINQGYVL.WASP----------.LSRPDLGGKE-------------------------------------------
B0WNF0_CULQU/1523-1926---LLKSNFIL.WWSP----------.SSRPDLGGRE-------------------------------------------
M5E7V9_MALS4/1436-1836---LQQSDMVL.WWSE----------.GPRPDLGGRE-------------------------------------------
E3S8N6_PYRTT/1524-1919---LQKDRVIL.WWSG----------.QAKPDHAGYE-------------------------------------------
W1Q6U0_OGAPD/1501-1875---LSQANIVL.WWSP----------.TPNPDLGGVE-------------------------------------------
I1G2M3_AMPQE/1495-1895---LARHNHVI.WATP----------.TDQPDLGGHE-------------------------------------------
Q9VCN1_DROME/1529-1930---LQRHNFVL.WWSA----------.STRPDLGGRE-------------------------------------------
DPOE_CANGA/1526-1915---LKLDNIIL.WWNE----------QSPLPDHGGME-------------------------------------------
E2B8B2_HARSA/1525-1925---LHRNNFVL.WCSP----------.TEKPDLGGSE-------------------------------------------
J7RME7_KAZNA/1518-1909---LRHENIVL.WWNE----------NGPLPDLAGIE-------------------------------------------
F4S3B6_MELLP/1559-1958---LTRSDHIL.WWSS----------.SPKPDLGGRE-------------------------------------------
DPOE_ASHGO/1493-1878---LKLENIVL.WWNQ----------KQPLPDRGGIQ-------------------------------------------
B6K1H9_SCHJY/1420-1808---LTEKQIIL.WWNK----------.NPLPDLGGLE-------------------------------------------
A0BZJ9_PARTE/1454-1836---LRQKTSCLSWYGS----------........GLG-------------------------------------------
C5DK88_LACTC/1505-1895---LKKDNIVL.WWND----------VYPLPDHGGSE-------------------------------------------
H2YP37_CIOSA/1434-1828---LRKHNHLL.WCSP----------.SDQPDLGGVE-------------------------------------------
M2NL61_BAUCO/1525-1921---LQKERVVL.WWSQ----------.GARPDHAGHE-------------------------------------------
U1M0G7_ASCSU/1468-1870---LCRYGYVL.WASP----------.TRRPDLGGKE-------------------------------------------
B0DWP2_LACBS/1522-1912---LVQQDIVL.WWSP----------.GDQPDLGGIE-------------------------------------------
R4X9Y3_TAPDE/1534-1914---LRSEDVVL.WWSG----------.APQPDQGGRE-------------------------------------------
R1GQ63_BOTPV/1519-1912---LQKEKVVL.WWSE----------.GPKPDHAGYE-------------------------------------------
K1VVE5_TRIAC/1494-1883---LQAADMVL.WWSP----------.SPRPDLGGSE-------------------------------------------
B3S6C7_TRIAD/1510-1905---LAKNNHLI.WASR----------.TPRPDLGGKE-------------------------------------------
N1JGF4_BLUG1/1511-1904---LQRNNVVL.WWSA----------.GPRPDHAGYE-------------------------------------------
W4ZAF4_STRPU/37-438---LNKHGHVM.WASP----------.TNRPDLGGKE-------------------------------------------
M5BQD5_THACB/1537-1929---LWQNDSLL.WWSP----------.GLRPDLGGME-------------------------------------------
M3ALS7_PSEFD/1503-1901---LQKEKVVL.WWSQ----------.DARPDHAGHE-------------------------------------------
I2GW49_TETBL/1546-1937---LKREGIII.WWNE----------NGPLPDLGGKQ-------------------------------------------
F6GW32_VITVI/1705-2088---LRDQQQVL.WISD----------.NGIPDLGGLN-------------------------------------------
S7ZMV2_PENO1/1499-1887---LQQSNVVL.WWSN----------.GPRPDHAGFE-------------------------------------------
DPOE_SCHPO/1498-1886---LKEHNIIL.WWNK----------.GPTPDLGGIE-------------------------------------------
H9J5N5_BOMMO/1546-1951---LVKHNFVL.WCSN----------.LERPDLGGRE-------------------------------------------
H2AUI7_KAZAF/1512-1900---LKHESVVL.WWNE----------DSPLPDHAGVE-------------------------------------------
I1BIP1_RHIO9/1528-1924---MIQNDMII.WWST----------.TKLPDLGGRE-------------------------------------------
DPOE_CRYNJ/1529-1917---LKQQDMLI.WWSS----------.TPRPDLGGSE-------------------------------------------
F8QB37_SERL3/1530-1921---LIQQDTVL.WWSP----------.SERPDLGGLE-------------------------------------------
G7E3T0_MIXOS/1542-1933---LISADLLL.WWSP----------.RAKPDLGGRD-------------------------------------------
R9P7N8_PSEHS/1532-1932---LVKQDMVL.WWSP----------.HPQPDLGGRE-------------------------------------------
C1FJ68_MICSR/1644-2054---LRDSSQLL.WTGP----------.GGVPDLGGGS-------------------------------------------
A5DEB2_PICGU/1518-1900---LSMNNVVL.WWSP----------.KALPDHGGFE-------------------------------------------
L8G4R0_PSED2/1520-1914---LEKNNVVL.WWSS----------.GPRPDHAGYE-------------------------------------------
C4QV66_PICPG/1520-1895---LIELGIVL.WWSP----------.NPLPDHGGFE-------------------------------------------
K1XY13_MARBU/1520-1913---LQKNNVVL.WWSG----------.GPRPDHAGYE-------------------------------------------
A7TF62_VANPO/1518-1909---LKSESIVL.WWNE----------NSPLADIGGIQ-------------------------------------------
A5E0L0_LODEL/484-866---LIENNIVL.WWSP----------.NPLPDHGGFE-------------------------------------------
Q7Q7P3_ANOGA/1541-1943---LHRHNFVL.WFSG----------.GARPDLGGRE-------------------------------------------
G8BGB3_CANPC/1514-1896---LTENNIVL.WWSP----------.NPLPDHGGFE-------------------------------------------
A0A088AM07_APIME/1527-1928---LQKNNFVL.WCSP----------.TEKPDLGGSE-------------------------------------------
T1HUW2_RHOPR/1490-1890---LLKNNFVL.WCSE----------.SDRPDLGGRE-------------------------------------------
V5I1Z1_BYSSN/1523-1915---LQQSNVVL.WWSS----------.GPRPDHAGYE-------------------------------------------
A7SIT9_NEMVE/1502-1904---LQKHNHIL.WMSP----------.TDRPDLGGKE-------------------------------------------
DPOE_YARLI/1514-1873---LIQNSVVL.WWSA----------.A..LSTGGAL-------------------------------------------
R9AMW8_WALI9/1475-1880---LIKSDILL.WWSH----------.SSKPDLGGRE-------------------------------------------
D8SJG5_SELML/1443-1816---LKDNQHVL.WISD----------.DGLPDLGGVP-------------------------------------------
S8FUF8_FOMPI/1617-2006---LMEHDFVL.WWSP----------.GNRPDLGGIE-------------------------------------------
G1X6W6_ARTOA/1520-1907---LQASNVVL.WWSS----------.TPIPDHAGHQ-------------------------------------------
Q17H50_AEDAE/1518-1917---LQKHNFVL.WCSP----------.NSRPDLGGRE-------------------------------------------
G1RBL5_NOMLE/1514-1911---LQRHNHLL.WLSP----------.TARPDLGGKE-------------------------------------------
D5GGS6_TUBMM/1460-1851---LQKNNVVL.WWSP----------.SPKPDHGGYE-------------------------------------------
H2UTB8_TAKRU/1527-1926---LRKHNHLL.WLSP----------.TSRPDLGGKE-------------------------------------------
G8ZQL0_TORDC/1514-1906---LKNDGYVL.WWND----------NSPLPDHGGAQ-------------------------------------------
S3BV94_OPHP1/1618-2007---LQANNVVL.WWSG----------.SPRPDHAGYE-------------------------------------------
G0V590_NAUCC/1533-1922---LKNEGIVL.WWNE----------NIPLPDHGGVQ-------------------------------------------
K5XRW0_AGABU/1528-1917---LIQQDIVL.WWSS----------.GERPDLGGIE-------------------------------------------
E9H7I0_DAPPU/1517-1917---LIRNNCIL.WCSP----------.TERPDLGGKE-------------------------------------------
G3B805_CANTC/1530-1912---LSNSNMVL.WWSD----------.TPLADHGGFE-------------------------------------------
D6WSX8_TRICA/1501-1896---LTKHNHVL.WCSP----------.TDKPDLGGVE-------------------------------------------
A8NMZ4_COPC7/1518-1909---LIHQDTVL.WWSP----------.SDLPDLGGIE-------------------------------------------
G0WD71_NAUDC/1559-1949---LKQEGIIM.WWNE----------NVPLPDHGGTE-------------------------------------------
S2J5L9_MUCC1/1535-1930---LIQNDMVI.WWSA----------.SPMPDLGGRE-------------------------------------------
C5GX57_AJEDR/1519-1912---LEQNKIVL.WWSP----------.SPLPDHAGYE-------------------------------------------
E9D9U9_COCPS/1514-1907---LEQNNVVL.WWSP----------.NPLPDHAGYE-------------------------------------------
K7J3X8_NASVI/1487-1888---LQKANFVL.WWSP----------.TEKPDFGGSE-------------------------------------------
O62218_CAEEL/1468-1869---LQKSGHAL.WATR----------.ASRPDLGGKE-------------------------------------------
V2XXQ2_MONRO/1528-1918---LVQQDIVL.WWSP----------.SDKPDLGGIE-------------------------------------------
R7YYU2_CONA1/1520-1913---LMKENVVL.WWSD----------.GPKPDHAGYE-------------------------------------------
B6QRD6_PENMQ/1519-1904---LEKSNVVL.WWSA----------.GPRPDHAGYE-------------------------------------------
G6CJ62_DANPL/1482-1880---LLKHNFVL.WCSG----------.SERPDLGGRE-------------------------------------------
G8YP31_PICSO/1529-1911---LSENNIVL.WLSS----------.KPLPDHGGFE-------------------------------------------
S9XA99_SCHCR/1491-1879---LKEQNIIL.WWNK----------.GPMPDLGGLE-------------------------------------------
N1PFE7_DOTSN/1521-1915---LQKEKVVL.WWSQ----------.DARPDHAGHE-------------------------------------------
J4I9U6_FIBRA/1520-1910---LAEHDIVL.WWSP----------.GDRPDLGGME-------------------------------------------
M7NNI3_PNEMU/1489-1876---LIKNNYLL.WWSK----------.SSVPDYGGYE-------------------------------------------
DPOE_YEAST/1528-1919---LKKENIVL.WWNE----------KAPLPDHGGIQ-------------------------------------------
M2QWE4_CERS8/1506-1894---LVGQDIIL.WWSP----------.GDRPDLGGIE-------------------------------------------
G2X166_VERDV/1512-1902---LQNNNVVL.WWSA----------.SPRPDHAGYE-------------------------------------------
U4LW68_PYROM/1510-1903---LQSNNVVL.WWSS----------.SAKPDHGGYE-------------------------------------------
Q7RWE3_NEUCR/1534-1926---LMANNVVL.WWSP----------.SPRPDHAGYE-------------------------------------------
G4TAK9_PIRID/1551-1940---LMKQDMVL.WWSP----------.GMKPDLGGRE-------------------------------------------
H6BPG7_EXODN/1517-1908---LKRSNVVL.WWSD----------.QPRPDHAGYE-------------------------------------------
C4XXS2_CLAL4/253-635---LTQNNVVL.WWSN----------.KPYPDHGGFQ-------------------------------------------
DPOE_KLULA/1498-1882---LKKNNIVL.WWND----------KSPLPDHGGVE-------------------------------------------
G8JME6_ERECY/1494-1883---LKESNVVL.WWND----------KQPLPDYGGIQ-------------------------------------------
E3L3C9_PUCGT/1547-1947---LTKADHLI.WWSA----------.SRKPDLGGKE-------------------------------------------
DPOE_EMENI/1496-1885---LQQNNVVL.WWSS----------.TAKPDHAGYE-------------------------------------------
DPOE_DEBHA/1534-1916---LSQSNIVL.WLSS----------.RPLPDHGGFE-------------------------------------------
F4NWW9_BATDJ/1562-1979---LTKADALL.WFSL----------.SGKPDLGGAE-------------------------------------------
E5RYM0_TRISP/1442-1827---LCKSGHVL.WCSN----------.SDVPDFGGKE-------------------------------------------
F4PWS2_DICFS/1559-1964---LTDSSHLL.WMSY----------.SNSPDLGGTE-------------------------------------------
K0KG22_WICCF/1507-1890---LKKSDIVL.WWSP----------.RPTPDYGGLE-------------------------------------------
J5JYN7_BEAB2/1524-1910---LQANNIVL.WWSP----------.GPRPDHAGHE-------------------------------------------
U1GF87_ENDPU/1518-1911---LQRSNVVL.WWSD----------.KPIPDQAGHE-------------------------------------------
C5DYX0_ZYGRC/1500-1892---LKKEGMVM.WWNE----------NSPLADHGGVQ-------------------------------------------
F2PJ05_TRIEC/1466-1860---LEQNNVVL.WWSA----------.SPLPDHGGYE-------------------------------------------
F6WUQ7_CIOIN/1486-1883---LRKHNHVL.WCST----------.GDQPDVGGME-------------------------------------------
J9M470_ACYPI/1505-1904---LMKHNFVL.WISE----------.TDKPDLGGRE-------------------------------------------
Q59SM7_CANAL/1519-1901---LSENNIVL.WWSP----------.NPLPDLGGFE-------------------------------------------

PF03337

Q98188_MCV1/6-651HRYDVQAVAAPENWAP..........LRARTARAPMRAMLLYARAST---------------------------------
Q9Q8S1_MYXVL/6-624YPYDLERLSSPSNWTE..........LRP..NKQYLKFITILVNATI---------------------------------
Q070L3_CPRVZ/15-682YGVSLADLCDLRHWGP..........V..DLEEPRARAVPVVCFQTM---------------------------------
Q6TUY6_YMTV5/10-640LPYNIKSINFNAEWKK..........L.PMFNEQFLNFFTFSINSII---------------------------------
Q08FW7_DPV83/7-651LPYDIQSISQKNMWSK..........IYP.YNRHFLKIFSIYVNAII---------------------------------
Q6TVW0_ORFSA/6-637LSHDVHTAASADSWAQPHVHAPSGNSVAAWFVYRFSSDGTVRLNSIA---------------------------------
F12_VACCW/6-635LPFDIKYISRDELWAR..........ISSSLDQTHIKTIAVSVYGAI---------------------------------
Q8V3R9_SWPV1/5-644LPYNVENISLKNNWSK..........IFP.YNRDLIKIIAISINAVI---------------------------------

PF00136

Q9Q8R2_MYXVL/483-985-------------------HYLNS--------VLNGCKLS--SGKFQLAAYPINPFFQD....DRSVDLYASTNLPTEYN
DPOD_SCHPO/519-956-------------------EKTKD--------VVEKRYR.--...........IE...NGYSHD................
DPOL_MUHVS/528-1031-------------------LATAG--------HIEDRCNR--PDFLRTVLGL.PPEAIDPEALR................
DPOD1_DROME/519-959-------------------EMTKN--------EVESHYT.--...........QA...NGYENN................
DPOD_YEAST/540-973-------------------LKTKT--------AVQEKYC.--...........IK...NGYKHD................
DPOL_GAHVM/591-1150-------------------LTVRD--------YIHKQWGT--RDALLREFPN.LSNFMRPEDYS................
DPOA_YEAST/777-1229-------------------MNTRQ--------LAESMN..--......................................
DPOL_ALHV1/535-1007-------------------EKTKQ--------FVENVTVE--YLQKICNFEV.QCLPQHPNP.K................
DPOL_HHV2H/602-1181-------------------LATRA--------YVHARWAE--FDQLLADFPE.AAGMRAPGPYS................
Q98207_MCV1/479-983-------------------TYLDR--------VVDGATLC--AGVLRLAAEPRNPLLASAPPRARDVD..VSAALGHELE
DPOLA_ORYSJ/819-1284-------------------QNTVD--------LVQNNLN.--......................................
DPOD1_SOYBN/496-935-------------------EHTKK--------LVEDKFT.--...........TL...NGYEHN................
Q57UW4_TRYB2/670-1122-------------------QNTVE--------LIPQISPS--......................................
DPOL_ASFB7/442-955-------------------KLVYN--------FVINKG..--......................................
DPOL_HHV6Z/502-979-------------------CSTVD--------YVNSKMQS--EQFFCEELGL.TASDFTGD.LK................
DPOD1_CAEEL/505-943-------------------DMTKL--------EVERIYK.--...........KGALDGKCPAD................
DPOL_EBVB9/517-994-------------------ERAKA--------FVEALSPA--NLQALAPSPD.AWAPLNPEG.Q................
G8BKE7_CANPC/511-946-------------------EKTKN--------EVQERYS.--...........KK...NGYPYD................
DPOL_VACCW/482-984-------------------LYLES--------VLNGAELS--NGMLRFANPLSNPFYMD....DRDINPIVKTSLPIDYR
DPOA_SCHPO/758-1203-------------------MNTKE--------LADQMG..--......................................
DPOLA_HUMAN/768-1227-------------------MHTKE--------MVQKMN..--......................................
Q6TVU5_ORFSA/488-991-------------------AYLER--------TLDGASVC--GTRLSLAAAPDNPLLRDEAFAGRAAELEIDAAVAGERT
DPOZ_YEAST/904-1362-------------------EKAID--------IIEKDETW--N.....................................
DPOL_VZVD/582-1117-------------------LSTRD--------YIHNNWAA--FERFITAFPDIESSVLSQKAYE................
DPOL_HHV8P/518-987-------------------ERSQA--------FVEAISPE--RLAGLLRRPV.DV...SPDA.R................
DPOL_SHV21/507-976-------------------EKSKI--------FIEAMTPD--TLQEIVPHIV.KH...EPDA.K................
DPOL_EHV2/515-985-------------------ENSKR--------YIEGVTPE--GLADILGRRV.EC...APDA.S................
DPOL_FOWPN/468-966-------------------TYLDS--------IMNGAVWE--NDKLILADFPRNIFSGETMFNKELEVPNMNESFK....
DPOLA_DROME/790-1239-------------------TNTQQ--------LVQKMN..--......................................

PF03175

DPOL_ADEG1/239-749.............KKKGRTKKKKQPSPDYVAEVYAPHRPM--FKYIRQALRGGRC...YPNVLGPYL-------------
Q9QM79_9ADEN/239-780HDADVHDVERASANKNTKKRKKRLPSPEYVAEIYAPHRPM--FKYIRQALRGGRC...YPSVLGPYR-------------
Q9YUR6_9ADEN/339-828...................KQNGTKASTL.PDIVAPSDEM--YSFIRQSVRGGRC...YPTHLGIFK-------------
DPOL_ADEB3/263-744...................RSQRPNRSSLGNFLLAPSNEM--YDYVRESIRGGRC...YPTYIGVLT-------------
DPOL_ADECT/392-875...................KAEKPNTHHLSTILMAPSNEM--YEYVRLSIRGGRC...YPTYIGVLQ-------------
DPOL_ADEB2/268-751...................REVRPNKANLDNVLLAPSHEM--YDYVRQSIRGGRC...YPTYIGIME-------------
DPOL_ADE40/434-918...................RTVKPQRSDLGGSLLAPSHEM--YDYVRASIRGGRC...YPTYIGVLR-------------
DPOL_ADE12/307-791...................RAEKPQRTHLGPNILAPSHEL--YDYVRASIRGGRC...YPTYIGVLK-------------
DPOL_ADE02/443-927...................RAEQPARSNLGPDLLAPSHEL--YDYVRASIRGGRC...YPTYLGILR-------------
Q9WF13_ADE17/336-820...................RAEQPQRTNFGPGLLGPSHEL--YEYVRASIRGGRC...YPTNIGIFS-------------
DPOL_ADE04/438-922...................RAEKPSRANLGAGLLAPSHEL--YDYVRATIRGGRC...YPTYIGILD-------------
Q83895_ADEO7/319-798...................NEEDHPSEFL.RNLEAPSEKM--YDFVRMSLRGGRC...YPSFLGIFE-------------
O11414_9ADEN/324-802...................RAEKGQTEHL.PGLQAPSEKM--YDHIRKSVRGGRC...YPSYLGVYE-------------
DPO2_KLULA/409-871...................PKYVK........LYVPTLEE--YSKIRNAIYGGRV....ISKNGIYE-------------
Q09038_LACKL/414-876...................RNIEL.........YVPTSEE--YQFIRNSIYGGRV....AAKNGTYN-------------
DPO1_KLULA/416-866....................PFDV.......ELRHPNKED--YFNMREALIGGRC....ISVNGIY.-------------
O74719_DEBHN/419-870...................PNIDL.........RHPKKED--YMNMKDSLIGGRC....ISVNGIY.-------------
DPOL_BPCP1/57-480...................RKSKR...KFRDFFPILDEKV--DDFCRKHIVGAGRLPTLKHRGRTLN-------------
Q96206_BPGA1/50-479.................GVKQWEK.......YFPVLSLKV--NSEIRKAYKGGFTWV.NPKYQGETV-------------
DPOL_BPM2/50-474...................KKFNK.......VFPKLSLPM--DKEIRKAYRGGFTWL.NDKYKEKEI-------------
DPOL_BPPZA/50-474...................KKFKK.......VFPTLSLGL--DKEVRYAYRGGFTWL.NDRFKEKEI-------------
DPOL_BPPRD/2-433....................PYDP...........VRKGF--DEAMRPFYFGGRC...QAFEKGIIE-------------
O21376_PICKL/474-939...................HDETK......KMPLMSSTMD--DTFMRKALFGGYNNVINPM.....A-------------
Q35599_PHYPO/8-446...................PEKYR.......LIPHLTRDE--DNYIRKSYIGGRNEIFEHV.....A-------------
O99973_PORPU/80-478...................LKTHK........IEVPKTYY--DKFIRKAYYGGRCEVYKPTND...S-------------
Q9XNK1_PLEOS/738-1218...................DSIKK.......PIFLTTGKI--DNYIRNAYYGGIV....DSWTFYSE-------------
E6ZE21_BETVM/147-562...................NDMDF.......HIHIPNRNE--DTFIRRGYYGGHADAYIPK.....G-------------
DPOM_MAIZE/299-724...................KDDDD......NWIYIPDDNE--AQFIREGYYGGHTDVYKPY.....G-------------
Q9TEH5_9PEZI/309-758...................IKDSK.........LSMVKGV--AHEIWEAYYGGRCEVSYPC......-------------
DPOM_NEUCS/366-859...................DKKEEKKLTPKYFLPKLKGRL--ERAVRAAYFGGRNEIFIPI.....I-------------
O78938_AGRAE/67-512...................LKENE........VHMLSGSI--ATNIRKSYTGGSVDMYIPLIEK..D-------------
DPOM_NEUIN/401-859...................LVEDM........IPNIKSKL--HNIIKLSYFGGICELYKPF.....G-------------
DPOM_ASCIM/589-1039...................LPENK.......IPNITCTKL--HYILKQAYTGGYCDVFKPE.....G-------------
DPOM_CLAPU/432-888...................DDKNK......AIPLVKDIDL--FNDIHEAYYGGRVEVFNPIIMADST-------------
DPOM_PODAS/450-889...................LGDNL.......IPVVLNNSL--FTSIKAAYYGGVAEVYRPY.....G-------------

PF08490

D8PW53_SCHCM/1455-1844-------------------CD............RRPT.DD..FPRTEFMSPGAYP-------------------------
K1Q2Z7_CRAGI/498-892-------------------ADDNRLCMEL.........EE..STSVEVNNPGTFP-------------------------
K5UTI1_PHACS/1501-1886-------------------DD............RRPT.EE..LPKTEFMSPGCYS-------------------------
T1J6P1_STRMM/1470-1868-------------------VDDNRLLIDQ.........EE..YSSIEINNPGSYG-------------------------
E0VSJ8_PEDHC/1513-1911-------------------ADDSRLLGEF.........DE..LSTTVINKEGCYT-------------------------
G8BQ26_TETPH/1521-1912-------------------KE.......FDLNTSWIM.ND..LKFLEINNPDVYD-------------------------
G0T1H4_RHOG2/1536-1927-------------------AD.........ANASQLG.DE..LINPELGKPGCYS-------------------------
J0M8E9_LOALO/1625-2027-------------------LDDTRLNAVWSSLSI....NK..QSVCVVNESSFET-------------------------
B0WNF0_CULQU/1523-1926-------------------ADDSRLLAEF.........ED..NISVVQNRSGFYG-------------------------
M5E7V9_MALS4/1436-1836-------------------DD..........MNPGTV.DE..LDMLEITNPGAYS-------------------------
E3S8N6_PYRTT/1524-1919-------------------KD..........DVLAPL.ET..VEMPSINNPGTYS-------------------------
W1Q6U0_OGAPD/1501-1875-------------------KD............TFAVDES..FEFPVINQSEVYE-------------------------
I1G2M3_AMPQE/1495-1895-------------------SDDYRLMMET.........DD..GRSLELNNPGLYP-------------------------
Q9VCN1_DROME/1529-1930-------------------ADDSRLLAEF.........EE..SISVVQNKAGFYP-------------------------
DPOE_CANGA/1526-1915-------------------ND.......FDQNTSWIM.ND..LDFPNINVPDVYD-------------------------
E2B8B2_HARSA/1525-1925-------------------NDDNRLLTDF.........EE..SSSCAANNPGTYS-------------------------
J7RME7_KAZNA/1518-1909-------------------KE.......YDPNISGIM.QE..LSFPDVNTPDIYD-------------------------
F4S3B6_MELLP/1559-1958-------------------ND.........INAQQVL.ET..LSSPEISVMGAYS-------------------------
DPOE_ASHGO/1493-1878-------------------NE.......YNPHTLSLA.TD..LTSPVINNPEFYD-------------------------
B6K1H9_SCHJY/1420-1808-------------------HD..........DILHLT.SP..SDNFELNYSGAYA-------------------------
A0BZJ9_PARTE/1454-1836-------------------RDNRDLVP...........TE..FTKTYFDNPGIYI-------------------------
C5DK88_LACTC/1505-1895-------------------KD.......FNPSMASLM.SD..LDISITNSPSVYD-------------------------
H2YP37_CIOSA/1434-1828-------------------VGDKRLGLND.........HA..NTCIEINNSAFHQ-------------------------
M2NL61_BAUCO/1525-1921-------------------KD..........DILSSM.EV..VDTPAVNNPGTYS-------------------------
U1M0G7_ASCSU/1468-1870-------------------LDDCRIGVDWNSLCV....SE..QPAAIVNHSRLCT-------------------------
B0DWP2_LACBS/1522-1912-------------------HD............RRPT.ED..LPKTDFLSAGVYS-------------------------
R4X9Y3_TAPDE/1534-1914-------------------QD..........DLVKAL.ET..VEPVKMNNPGAYN-------------------------
R1GQ63_BOTPV/1519-1912-------------------KD..........DILGPL.ET..VEMPSINNPGTYS-------------------------
K1VVE5_TRIAC/1494-1883-------------------ED............ANGG.EE..PTPPQISTKGVYS-------------------------
B3S6C7_TRIAD/1510-1905-------------------DDDSSIVS...........EE..LPSIELNNPGCYP-------------------------
N1JGF4_BLUG1/1511-1904-------------------KD..........NVFGTL.EP..IKMPSTNNPGTYS-------------------------
W4ZAF4_STRPU/37-438-------------------ADDNRLVTEF.........DE..SGGVELNHSGCYQ-------------------------
M5BQD5_THACB/1537-1929-------------------HD..........INAPTE.DP..NSSVDLANPGCYT-------------------------
M3ALS7_PSEFD/1503-1901-------------------RD..........DVLSGM.EV..VEMPAINTPGTYS-------------------------
I2GW49_TETBL/1546-1937-------------------KD.......FDINTSWTM.NN..LQFPRINVPDVYD-------------------------
F6GW32_VITVI/1705-2088-------------------EEDTCFA............DE..VHQPVLTYPGAYR-------------------------
S7ZMV2_PENO1/1499-1887-------------------KD..........DIVGPL.EK..VNMPSVNTPGAYS-------------------------
DPOE_SCHPO/1498-1886-------------------KD..........SILQIA.SP..KDPLEVNNPGAYS-------------------------
H9J5N5_BOMMO/1546-1951-------------------IDDNRLASEA.........EE..AGAWSGGAVGAHG-------------------------
H2AUI7_KAZAF/1512-1900-------------------KD.......FDPNADWII.NG..SNFSEINTPDIYD-------------------------
I1BIP1_RHIO9/1528-1924-------------------ED..........ETISIT.GG..LVNPELNFQGAYE-------------------------
DPOE_CRYNJ/1529-1917-------------------ED............ANSS.ED..LVSPHISNRGCYS-------------------------
F8QB37_SERL3/1530-1921-------------------DD............FRPV.EE..LQNTEFMSPGCYS-------------------------
G7E3T0_MIXOS/1542-1933-------------------ED...........TFVSA.SE..TSEPEISRPGCYT-------------------------
R9P7N8_PSEHS/1532-1932-------------------QD.........IHAQSRW.DE..QESLEISHAGAYS-------------------------
C1FJ68_MICSR/1644-2054-------------------GDGALSGLD..........DTLQTTRAEVNNPGAYR-------------------------
A5DEB2_PICGU/1518-1900-------------------ND...........SAQDY.EN..FDFPQFNNPEVYD-------------------------
L8G4R0_PSED2/1520-1914-------------------KD..........DVLGPL.ET..VQMPTVNNPGTYS-------------------------
C4QV66_PICPG/1520-1895-------------------LD..........QSMANIEKS..LEFPTINKPEIYE-------------------------
K1XY13_MARBU/1520-1913-------------------QD..........DVLGPL.ET..VQMPSVNNPGTYP-------------------------
A7TF62_VANPO/1518-1909-------------------KE.......FDLNSSWIM.NN..LDFPEINNPDVYD-------------------------
A5E0L0_LODEL/484-866-------------------ND...........KPINS.ES..LKFPVINNPEVYE-------------------------
Q7Q7P3_ANOGA/1541-1943-------------------ADDSRLLAEF.........ED..NISVVQNRSGFYR-------------------------
G8BGB3_CANPC/1514-1896-------------------MD...........RVLNL.ES..LEFPTINNSEVYE-------------------------
A0A088AM07_APIME/1527-1928-------------------HDDNRLLTDF.........EE..SSQCAANNFGTYS-------------------------
T1HUW2_RHOPR/1490-1890-------------------ADDNRLLSDF.........EE..NTNVISNNLGCYS-------------------------
V5I1Z1_BYSSN/1523-1915-------------------KD..........DVVGPL.ER..VDMPSINVPGAYS-------------------------
A7SIT9_NEMVE/1502-1904-------------------DDDNRLGLMT.........DE..VESVEFNSSGCYP-------------------------
DPOE_YARLI/1514-1873-------------------TD..................Q..AEVPVANNPGLYT-------------------------
R9AMW8_WALI9/1475-1880-------------------QD........VPPQQFAD.EG..GGPEEFSNPGTFS-------------------------
D8SJG5_SELML/1443-1816-------------------QDEPSFT............DV..VQQPSLCYPGAYR-------------------------
S8FUF8_FOMPI/1617-2006-------------------ED............ARPT.EE..LPKTDFMSPGCYS-------------------------
G1X6W6_ARTOA/1520-1907-------------------KD..........SIVRSL.EH..VNMPDINNRGSYS-------------------------
Q17H50_AEDAE/1518-1917-------------------ADDSRLLAEF.........ED..NISVVQNRQGFYG-------------------------
G1RBL5_NOMLE/1514-1911-------------------ADDNCLVMEF.........DD..QATVEINSSGCYS-------------------------
D5GGS6_TUBMM/1460-1851-------------------KD..........DILGSM.ET..VDMPAINNPGSYS-------------------------
H2UTB8_TAKRU/1527-1926-------------------ADDSRLVMDS.........DD..KGSVEINAQGCYS-------------------------
G8ZQL0_TORDC/1514-1906-------------------RD.......FDLNTSWLM.ND..LAFPEVNNPAVYD-------------------------
S3BV94_OPHP1/1618-2007-------------------KD..........DVAGPL.ET..VSLPKINNPGTFA-------------------------
G0V590_NAUCC/1533-1922-------------------ND.......FDLNTSDMM.ND..LSFPELNQPNIYD-------------------------
K5XRW0_AGABU/1528-1917-------------------ND............THLS.ED..FPETEFSSPGVYS-------------------------
E9H7I0_DAPPU/1517-1917-------------------ADDNRLVTEI.........ED.ATTTLVVNNPGVYT-------------------------
G3B805_CANTC/1530-1912-------------------MD...........KAPDY.EN..LDFPVINNPEIYE-------------------------
D6WSX8_TRICA/1501-1896-------------------ENDSRLLAEN.........QE..GSSEVCNVPGWYS-------------------------
A8NMZ4_COPC7/1518-1909-------------------AD............IQAL.ED..WPRTDFLSPGVYS-------------------------
G0WD71_NAUDC/1559-1949-------------------KE.......FDLNTSWLM.ND..SSYIEMNNPNVYD-------------------------
S2J5L9_MUCC1/1535-1930-------------------ED..........ESLAMT.SE..IVNTELSFPGAYE-------------------------
C5GX57_AJEDR/1519-1912-------------------KD..........DILGPM.QK..VDMPSRNTPGAYS-------------------------
E9D9U9_COCPS/1514-1907-------------------KD..........NINSLI.QK..VDMPTINNPGAYS-------------------------
K7J3X8_NASVI/1487-1888-------------------NDDSRLLTDF.........EE..SSGCLKNNPGVYS-------------------------
O62218_CAEEL/1468-1869-------------------MDDVRLSVDWNPLSI....DD....TVLLNRETFCE-------------------------
V2XXQ2_MONRO/1528-1918-------------------ND............KRPT.DE..LPNTEFLVSGIYP-------------------------
R7YYU2_CONA1/1520-1913-------------------KD..........DVLGPL.EI..VEMPSINNPGTYS-------------------------
B6QRD6_PENMQ/1519-1904-------------------KD..........DILGSL.DT..VEMPSVNVPGTYT-------------------------
G6CJ62_DANPL/1482-1880-------------------IDDNRLVSES.........DE..WSSCRVCSRGSYG-------------------------
G8YP31_PICSO/1529-1911-------------------ND...........RQSSF.HS..IDFPTINNPEIYE-------------------------
S9XA99_SCHCR/1491-1879-------------------KD..........DVLHVA.SP..NDSLEINRSGAYS-------------------------
N1PFE7_DOTSN/1521-1915-------------------KD..........DILGSM.ET..VEMPAVNNPGTYS-------------------------
J4I9U6_FIBRA/1520-1910-------------------ND............ARPS.EE..LSKTEFCSPGCYS-------------------------
M7NNI3_PNEMU/1489-1876-------------------KD..........WMPYIQ.EG..LDIPLVNNPGSYE-------------------------
DPOE_YEAST/1528-1919-------------------ND.......FDLNTSWIM.ND..SEFPKINNSGVYD-------------------------
M2QWE4_CERS8/1506-1894-------------------DD............RRPS.DE..LPKTEFQSSGCFS-------------------------
G2X166_VERDV/1512-1902-------------------KD..........DVTGPL.ET..VSMPNVNKPGTFA-------------------------
U4LW68_PYROM/1510-1903-------------------KD..........DIVGSM.ET..VEMPIINNPGSYS-------------------------
Q7RWE3_NEUCR/1534-1926-------------------KD..........DVVGPL.DQ..VQMPSVNNPGTYA-------------------------
G4TAK9_PIRID/1551-1940-------------------TD.........GSAGGLS.ED..VTSPETSRPGCYT-------------------------
H6BPG7_EXODN/1517-1908-------------------RD..........DILGPLTEV..VDMPSINNPGAYT-------------------------
C4XXS2_CLAL4/253-635-------------------ND...........HVQDF.DN..FDFITINSPEIYE-------------------------
DPOE_KLULA/1498-1882-------------------RD.......FDPRKAELM.TD..LVFPIMNNPDIYD-------------------------
G8JME6_ERECY/1494-1883-------------------NQ.......HDPHKMHLS.MS..LDSPVINNPEIYD-------------------------
E3L3C9_PUCGT/1547-1947-------------------AD.........LNTELVM.DV..LSNPEISVMGAYS-------------------------
DPOE_EMENI/1496-1885-------------------KD..........DITGPL.ER..VGMPCVNVPGSYT-------------------------
DPOE_DEBHA/1534-1916-------------------MD...........KAQDF.EN..LEFPTINNPEIYE-------------------------
F4NWW9_BATDJ/1562-1979-------------------NEDTHFAYAV.............PTNPEINKPGSFS-------------------------
E5RYM0_TRISP/1442-1827-------------------TDDHRLNVDS.........DD..AVDSQINRAGFYK-------------------------
F4PWS2_DICFS/1559-1964-------------------EDDAKFH............EE..LPKIEINQPDSYS-------------------------
K0KG22_WICCF/1507-1890-------------------KD..........SILMDN.EN..YEFPIINNPEIYE-------------------------
J5JYN7_BEAB2/1524-1910-------------------KD..........DLVGPL.DV..VKMPNVNKPGTYS-------------------------
U1GF87_ENDPU/1518-1911-------------------KD..........DIRGPLTDM..VEMPNINNAGAYS-------------------------
C5DYX0_ZYGRC/1500-1892-------------------KD.......YDPNTAWLQ.ND..LEFPVINNVGVYD-------------------------
F2PJ05_TRIEC/1466-1860-------------------KD..........NILGPL.NS..VEMTSVNIAGAYS-------------------------
F6WUQ7_CIOIN/1486-1883-------------------TEDKRIVLGM.........NQRRNASIEINNSGFYQ-------------------------
J9M470_ACYPI/1505-1904-------------------SDDNRMLMDS.........EE..SSSMLVNNEGCYT-------------------------
Q59SM7_CANAL/1519-1901-------------------MD...........RMIDF.DS..LAFPTINNPEIYE-------------------------

PF03337

Q98188_MCV1/6-651-------------------GCTPPEPYMISVYPEGRVFFDADSGTGVIADFLHWLLSVFTEQER................
Q9Q8S1_MYXVL/6-624-------------------TPNGASVYMITTH.PGRCFTSFDPKK.LVMDFLRWIRE.SMVNTS................
Q070L3_CPRVZ/15-682-------------------V.HGREPVAVATYPGGRAYFDSSCGKRVTEFLLECLAERFDAEDRRREEDGDDEPETGGAA
Q6TUY6_YMTV5/10-640-------------------TSTGPSIYMISTY.PGKCFVNFDSNK.LIITFLGWITE.NMKDVN................
Q08FW7_DPV83/7-651-------------------TPTGPSIYMISVY.PGKCFIDFDSKK.LISEFLKWVRE.TMNNVS................
Q6TVW0_ORFSA/6-637-------------------TNAGP.............VFSGDCAKLVVRDFLMWLTT.......................
F12_VACCW/6-635-------------------TDNGPMPYMISTY.PGNTFVNFNSVKNLILNFLDWIKD.IMTSTR................
Q8V3R9_SWPV1/5-644-------------------TPTGPSIYMITTYPPGKTFINFDSNK.LLSEFFKWLREDIMNNIT................

PF00136

Q9Q8R2_MYXVL/483-985YD..FKGVYGDTDSVFLEI............................NT.NDVL----------------TSIK--IAKE
DPOD_SCHPO/519-956....AVVIYGDTDSVMVKF............................GV.KTLP----------------EAMK--LGEE
DPOL_MUHVS/528-1031....VKIIYGDTDSVFAAF............................YG.IDKE----------------ALLK--AVGA
DPOD1_DROME/519-959....AVVIYGDTDSVMVNF............................GV.KTLE----------------RSME--LGRE
DPOD_YEAST/540-973....AVVVYGDTDSVMVKF............................GT.TDLK----------------EAMD--LGTE
DPOL_GAHVM/591-1150....VSVIYGDTDSVFIKF............................KG.VDIH----------------GLVT--TGDD
DPOA_YEAST/777-1229....LLVVYGDTDSVMIDT............................GC.DNYA----------------DAIK--IGLG
DPOL_ALHV1/535-1007....FRVVYGDTDSLFIKC............................EG.FAMD----------------TVIK--FGDA
DPOL_HHV2H/602-1181....MRIIYGDTDSIFVLC............................RG.LTAA----------------GLVA--MGDK
Q98207_MCV1/479-983LR..FRSVYGDTDSIFLEL............................NL.REVQ----------------TTLA--VART
DPOLA_ORYSJ/819-1284....LEVIYGDTDSIMIHT............................GL.DDIS----------------RAKG--IAGK
DPOD1_SOYBN/496-935....AEVIYGDTDSVMVQF............................GV.SAVE----------------EAMN--LGRE
Q57UW4_TRYB2/670-1122....IRVIYGDTDSVMIQT............................GIKDDIG----------------KVRN--LGFE
DPOL_ASFB7/442-955....YGIKYGDTDSLYITCPDSLYTEVTDAYLNSQKTIKHYEQLCHEKVLLSMK----------------AMST--LCAE
DPOL_HHV6Z/502-979....VEVIYGDTDSIFMSV............................RN.MANE----------------SLRR--IAPM
DPOD1_CAEEL/505-943....AKVIYGDTDSVMVKF............................GV.ETVA----------------QAME--IGLD
DPOL_EBVB9/517-994....LRVIYGDTDSLFIEC............................RG.FSES----------------ETLR--FADA
G8BKE7_CANPC/511-946....AHVIYGDTDSVMVKF............................GY.QDLK----------------TCMK--LGEE
DPOL_VACCW/482-984FR..FRSVYGDTDSVFTEI............................DS.QDVD----------------KSIE--IAKE
DPOA_SCHPO/758-1203....LQVIYGDTDSVMLNT............................NV.TDKN----------------HALR--IGNE
DPOLA_HUMAN/768-1227....LEVIYGDTDSIMINT............................NS.TNLE----------------EVFK--LGNK
Q6TVU5_ORFSA/488-991ERVGFRSVYGDTDSVFLEV............................GA.SDIA----------------FSRR--VGRC
DPOZ_YEAST/904-1362....AKVVYGDTDSLFVYL............................PG.KTAI----------------EAFS--IGHA
DPOL_VZVD/582-1117....VKVIYGDTDSVFIRF............................KG.VSVE----------------GIAK--IGEK
DPOL_HHV8P/518-987....FKVIYGDTDSLFICC............................MG.FNMD----------------SVSD--FAEE
DPOL_SHV21/507-976....FRVIYGDTDSLFVEC............................VG.YSVD----------------TVVK--FGDF
DPOL_EHV2/515-985....FKVIYGDTDSLFIHC............................RG.YRPE----------------QVTG--FCDE
DPOL_FOWPN/468-966....FRSVYGDTDSIFSEI............................ST.KDIE----------------KTAK--IAKH
DPOLA_DROME/790-1239....YDVVYGDTDSLMINT............................NI.TDYD----------------QVYK--IGHN

PF03175

DPOL_ADEG1/239-749----KPVYVFDICGMYASA----------------------------LTH.PMP----------------HGMP--LD.P
Q9QM79_9ADEN/239-780----HPVYVFDICGMYASA----------------------------LTH.PMP----------------HGMP--LD.P
Q9YUR6_9ADEN/339-828----EKIFVYDICGMYASA----------------------------LTH.PMP----------------YGFP--IG.E
DPOL_ADEB3/263-744----EAIYVYDICGMYASA----------------------------LTH.PFP----------------AGKP--LN.P
DPOL_ADECT/392-875----EPVFVYDICGMYASA----------------------------LTH.PFP----------------AGSP--LN.P
DPOL_ADEB2/268-751----QPIYVYDICGMYASA----------------------------LTH.PFP----------------SGQP--LN.P
DPOL_ADE40/434-918----EPLYVYDICGMYASA----------------------------LTH.PMP----------------WGFP--LN.P
DPOL_ADE12/307-791----EPIYVYDICGMYASA----------------------------LTH.PMP----------------WGPP--LN.P
DPOL_ADE02/443-927----EPLYVYDICGMYASA----------------------------LTH.PMP----------------WGPP--LN.P
Q9WF13_ADE17/336-820----EPIYVYDICGMYASA----------------------------LTH.PMP----------------WGPP--LN.P
DPOL_ADE04/438-922----EPLYVYDICGMYASA----------------------------LTH.PMP----------------WGTP--LS.P
Q83895_ADEO7/319-798----EAIYVYDICGMYASA----------------------------LTH.PLP----------------YGKT--LN.A
O11414_9ADEN/324-802----GPIYVYDICGMYASA----------------------------LTH.PMP----------------FGRT--ED.P
DPO2_KLULA/409-871----ENIVYADVVSLYPSA----------------------------MKLLKHS----------------YGKP--....
Q09038_LACKL/414-876----EEIVYADVVSLYPSA----------------------------MKLLEHS----------------YGKP--....
DPO1_KLULA/416-866----KDVLCLDVKSLYPAS----------------------------MAFYDQP----------------YGSF--....
O74719_DEBHN/419-870----ENILCLDVKSLYPAA----------------------------MAFYDQP----------------YGQF--....
DPOL_BPCP1/57-480----QLIDIYDINSMYPAT----------------------------MLQNALP----------------IGIP--...K
Q96206_BPGA1/50-479----YGGMVFDVNSMYPAM----------------------------MKNKLLP----------------YGEP--...V
DPOL_BPM2/50-474----GEGMVFDVNSLYPSQ----------------------------MYSRPLP----------------YGAP--...I
DPOL_BPPZA/50-474----GEGMVFDVNSLYPAQ----------------------------MYSRLLP----------------YGEP--...I
DPOL_BPPRD/2-433----DDIKVYDVNSMYPHA----------------------------MRNFRHP----------------FSD.--...E
O21376_PICKL/474-939----DEAYYYDVNSFYPAV----------------------------AVKYRYP----------------TTKG--FDMS
Q35599_PHYPO/8-446----QRNYFYDVNSLYPYI----------------------------MKKEKMP----------------IGIP--...E
O99973_PORPU/80-478----NKIFHYDFNSHYPSS----------------------------MLN.KIP----------------TKIS--...G
Q9XNK1_PLEOS/738-1218----KPLFKYDFKSHYPNQ----------------------------MRNNPMP----------------GGLP--...I
E6ZE21_BETVM/147-562----TNLYYYDVNSLYPFI----------------------------MKEYPMP----------------SGKP--...V
DPOM_MAIZE/299-724----ENLYYYDVNSLYPSS----------------------------MLD.DMP----------------IGKT--...R
Q9TEH5_9PEZI/309-758----IKTKSYDCNSIYPYC----------------------------MLK.DMP----------------VEN.--...L
DPOM_NEUCS/366-859----NNIFSFDFNSLYPTA----------------------------MMM.PMP----------------VGIP--....
O78938_AGRAE/67-512----SKIFIYDINSLYPFS----------------------------MKSFKFP----------------IGNP--...T
DPOM_NEUIN/401-859----VNIKSYDVNSLYPFA----------------------------MKYFKMP----------------SGIP--...K
DPOM_ASCIM/589-1039----KNIHSYDINSLYPSA----------------------------MAKFDMP----------------TGTP--...L
DPOM_CLAPU/432-888----KSYYYYDVNSLYPFA----------------------------SIN.DIP----------------GLKC--...T
DPOM_PODAS/450-889----KNLRYYDVNSLYPFV----------------------------AKN.TMP----------------GHEC--...K

PF08490

D8PW53_SCHCM/1455-1844----NVCLEITIRNLAVNS----------------------------VLHSVLV----------------NELE..GSG.
K1Q2Z7_CRAGI/498-892----TVCVELGISSLAVNT----------------------------IIESAHV----------------NDQE..GAS.
K5UTI1_PHACS/1501-1886----NVCLEITVRNLAVDA----------------------------VLHSMIV----------------NELE..GSG.
T1J6P1_STRMM/1470-1868----SVCLELEIDHLAVNT----------------------------LLQSNHI----------------QEME..GTSS
E0VSJ8_PEDHC/1513-1911----SISVEMDIDALAVNT----------------------------LLQLNRM----------------NEAE..GISS
G8BQ26_TETPH/1521-1912----NVTLELSINNLTVNT----------------------------VLTSAVI----------------SSID..GSDL
G0T1H4_RHOG2/1536-1927----NACLEVEVRNLAVDA----------------------------VLQSALV----------------YELE..GGEG
J0M8E9_LOALO/1625-2027----DVCIELELGAVDVTA----------------------------IVQSASI----------------ADAE..GGAD
B0WNF0_CULQU/1523-1926----TVCVELSIESLAVSA----------------------------LLQAGKV----------------QEME..GASS
M5E7V9_MALS4/1436-1836----SICLEVQVADLALNC----------------------------VLQNANV----------------HAME..GIGA
E3S8N6_PYRTT/1524-1919----SVCIDINVRNLAINT----------------------------ILSSSLV----------------NELE..GA.D
W1Q6U0_OGAPD/1501-1875----SVCLELELKNLTINT----------------------------VLTSSLI----------------NEAE..GV..
I1G2M3_AMPQE/1495-1895----STCIELSIEGLAVTA----------------------------VLQASHI----------------NDYE..GASS
Q9VCN1_DROME/1529-1930----DVCVELALDSLAVSA----------------------------LLQSTRI----------------QEME..GASS
DPOE_CANGA/1526-1915----NVVLEVSIENLVVNT----------------------------ILCSTLI----------------NEAE..GSDL
E2B8B2_HARSA/1525-1925----SVCVQLDVESLAVNA----------------------------LLQYHHI----------------HDID..GTST
J7RME7_KAZNA/1518-1909----KTVLEIQIRNLTINT----------------------------VLASTLI----------------NEAE..GSDL
F4S3B6_MELLP/1559-1958----NASIELSIVDLAIDA----------------------------VLQSATV----------------YE....GDKG
DPOE_ASHGO/1493-1878----SAVLEIEVNNLLVNT----------------------------ILTSTLI----------------NEAE..GGDV
B6K1H9_SCHJY/1420-1808----NASVDIHISNLAMCS----------------------------ILNSAIV----------------NDAE..GVED
A0BZJ9_PARTE/1454-1836----GYTCEIDILHFSINT----------------------------IAQSEEI----------------KNLD......
C5DK88_LACTC/1505-1895----TVVLEIEMSNLTINT----------------------------VLTSAVI----------------NEAE..GSDL
H2YP37_CIOSA/1434-1828----TVCVQVDISSLAINT----------------------------ILQSHHV----------------NDVE..GASS
M2NL61_BAUCO/1525-1921----SVCIDLSIKNLAINT----------------------------ILSAAVL----------------NDVE..DS.D
U1M0G7_ASCSU/1468-1870----EVCVELELGALAVSA----------------------------LVHGARI----------------AEAE..GGSG
B0DWP2_LACBS/1522-1912----NVCLEITVRNLAVNS----------------------------ILQSVMV----------------NELE..GSG.
R4X9Y3_TAPDE/1534-1914----TVCIELEVRNIIIST----------------------------ILNSALI----------------NELE..GSAA
R1GQ63_BOTPV/1519-1912----SVCIDLEIKNLAIST----------------------------VLSSSII----------------NEAE..GS.D
K1VVE5_TRIAC/1494-1883----TVVLEMEIADMAINA----------------------------VLQSALV----------------NEME..GSGS
B3S6C7_TRIAD/1510-1905----SVSAEISMHGLAVSS----------------------------VLQSLRL----------------GDFE..T...
N1JGF4_BLUG1/1511-1904----SVCVELDVRNLVINT----------------------------ILTSSLI----------------KELE..GS.D
W4ZAF4_STRPU/37-438----TVCVDLDMANLAVNT----------------------------LLQSHQV----------------SELE..GAAG
M5BQD5_THACB/1537-1929----NVCLAINIRNLALNS----------------------------VLQSGIV----------------NELE..GTA.
M3ALS7_PSEFD/1503-1901----SVCIDLSVKNLAINT----------------------------ILSSAVL----------------NDAEGAGA.D
I2GW49_TETBL/1546-1937----NVILEIDIKNLVVNT----------------------------VLGITLF----------------NDAE..GSDM
F6GW32_VITVI/1705-2088----KVSVELKIHHLAVNA----------------------------LLKSNQV----------------NEME..GGAL
S7ZMV2_PENO1/1499-1887----TVCIELDIRNLAINT----------------------------ILTSSIV----------------HDMD..GG.D
DPOE_SCHPO/1498-1886----NACVDISLSNLALCS----------------------------ILNSALI----------------NDIE..GIGD
H9J5N5_BOMMO/1546-1951----GVCVELGLDALSVCA----------------------------LLQAHLV----------------LQAE..GTSA
H2AUI7_KAZAF/1512-1900----NVVLDISVGNLTVNT----------------------------ILGSTLI----------------NEAE..GSDL
I1BIP1_RHIO9/1528-1924----TVCADFDLSRLCLNT----------------------------LLVSPVI----------------NELE..GTA.
DPOE_CRYNJ/1529-1917----STVLEMEVSDLAINA----------------------------VLQSALV----------------NEME..GSGT
F8QB37_SERL3/1530-1921----NVCLDVAVRNLAVNS----------------------------VLHSVVV----------------NELE..GSG.
G7E3T0_MIXOS/1542-1933----NAVVDLDLRDLAVNA----------------------------VMQAAFV----------------YELE..GAEG
R9P7N8_PSEHS/1532-1932----TVCLEVGLVDLAVDS----------------------------VLQSGSV----------------NEME..GST.
C1FJ68_MICSR/1644-2054----CVCVELKAHHLAVCA----------------------------IANAHLL----------------NDLE......
A5DEB2_PICGU/1518-1900----TTSLEIELGTLTINT----------------------------ILTSALI----------------NGAE..GTDL
L8G4R0_PSED2/1520-1914----SVCIEIDVRNLAINT----------------------------ILTSSLI----------------NDLE..GSMD
C4QV66_PICPG/1520-1895----TVCLELNLSNLTINT----------------------------ILTSALI----------------NEAE..G...
K1XY13_MARBU/1520-1913----SVCIEIDVRNLAINT----------------------------ILTSSLI----------------NELE..GS.D
A7TF62_VANPO/1518-1909----NVTLEVSINNLTVNT----------------------------VLTSALI----------------NDAE..GSDL
A5E0L0_LODEL/484-866----TACLEVEIGTLTINT----------------------------ILTSSII----------------NEAE..GTDL
Q7Q7P3_ANOGA/1541-1943----SVCVELTVESLAVSA----------------------------LLQASKV----------------QELE..GTSS
G8BGB3_CANPC/1514-1896----TTCLEVEIGTLTINT----------------------------ILTSSLI----------------NEAE..GTDL
A0A088AM07_APIME/1527-1928----SVCIELEIENLAVNT----------------------------LLQYHHI----------------HDID..GTSN
T1HUW2_RHOPR/1490-1890----TICVELDIDSLAVNT----------------------------LLQSHHV----------------HDIE..GTSS
V5I1Z1_BYSSN/1523-1915----TVCIELDIRNLAFNT----------------------------ILTSSLI----------------NELE..GS.D
A7SIT9_NEMVE/1502-1904----TVCVELSIDGLAVNT----------------------------ILQSAHI----------------NDFE..GGAG
DPOE_YARLI/1514-1873----NICFEIKIEHLVLNA----------------------------LLQSAVI----------------QDTE..GDIH
R9AMW8_WALI9/1475-1880----NVVLEVELRDIAVNS----------------------------ILQSSLV----------------NEME..GAGS
D8SJG5_SELML/1443-1816----SVTIELKINHLAVNA----------------------------LLKSTQV----------------NELE..GGAL
S8FUF8_FOMPI/1617-2006----NVCLEITVRNLAVNS----------------------------VLHSLMV----------------NELE..GAG.
G1X6W6_ARTOA/1520-1907----SVCIELDVRNLAINT----------------------------LLTSSLI----------------NELE..GA.D
Q17H50_AEDAE/1518-1917----DVCVELTIDSLAVSA----------------------------LLQASRV----------------QEME..GAAS
G1RBL5_NOMLE/1514-1911----TVCVELDLQNLAVNT----------------------------ILQSHHV----------------NDME..GADS
D5GGS6_TUBMM/1460-1851----SVCIEIEVRNLAINT----------------------------ILTSSLI----------------NELE..GS.D
H2UTB8_TAKRU/1527-1926----TACVELDLQSLAVNT----------------------------ILQSQHV----------------NDME..GGAS
G8ZQL0_TORDC/1514-1906----QVVLEIGVGNLTINA----------------------------VLGSALI----------------NEAE..GGDP
S3BV94_OPHP1/1618-2007----SVCIDIDVRNLAINT----------------------------ILTSSLI----------------NELE..GA.D
G0V590_NAUCC/1533-1922----NAVLEIEIGNLTVNT----------------------------VLGSTLI----------------NEAE..GSDL
K5XRW0_AGABU/1528-1917----NVCLEITLRNLAVNS----------------------------VLQSQLV----------------NELE..GSG.
E9H7I0_DAPPU/1517-1917----NVCVEMDVDALAVTT----------------------------LLQSHQV----------------LDVE..GTSS
G3B805_CANTC/1530-1912----TACLEIDIGTLSINT----------------------------ILTSSII----------------NEAE..GADL
D6WSX8_TRICA/1501-1896----SVCIELDVDCLAINT----------------------------LLQSHHV----------------TDIE..GTSS
A8NMZ4_COPC7/1518-1909----NVCLEVTVRNLAVNS----------------------------VLQSVVI----------------NELE..GSG.
G0WD71_NAUDC/1559-1949----NAVLEIEISNLTVNT----------------------------VLGSALI----------------NDAE..GSDL
S2J5L9_MUCC1/1535-1930----TVCVEIDVVRLCLNT----------------------------IIEANVI----------------NELE..GATG
C5GX57_AJEDR/1519-1912----SVCIELEIRNLAINT----------------------------ILTSSLI----------------NELE..GS.E
E9D9U9_COCPS/1514-1907----SVCIDLDVRNLAINT----------------------------ILTSSLI----------------NDLE..GS.E
K7J3X8_NASVI/1487-1888----NVCFELDVISLAVTA----------------------------LVQANHI----------------NDID..GTSS
O62218_CAEEL/1468-1869----TACVELQLSAVAVTA----------------------------LVQRSRV----------------LEAE..GADD
V2XXQ2_MONRO/1528-1918----NVCLELTVRNLAVNS----------------------------VIHSVVV----------------NELE..GSG.
R7YYU2_CONA1/1520-1913----SVCIDLEVRNLAINT----------------------------VLSSSLI----------------NEVE..GS.D
B6QRD6_PENMQ/1519-1904----TVSIELEVRNLAINT----------------------------ILTSSII----------------NDLE..GS.D
G6CJ62_DANPL/1482-1880----GVCVALTGDALAVSA----------------------------LLQAHTI----------------LQTE..GTSV
G8YP31_PICSO/1529-1911----TTCLEIEIGTLTINT----------------------------ILTSSLI----------------NEME..GTDL
S9XA99_SCHCR/1491-1879----NACVDVSFSNLAVCS----------------------------ILNSALI----------------NEIE..GASD
N1PFE7_DOTSN/1521-1915----SVCIDLSVRNLAINT----------------------------ILSAAML----------------NEAE..GS.D
J4I9U6_FIBRA/1520-1910----NVCLEITVRNLAVNA----------------------------VLHSVIV----------------NELE..GSG.
M7NNI3_PNEMU/1489-1876----NVCIELDVKSLTISA----------------------------ILNFALV----------------NAFD..S...
DPOE_YEAST/1528-1919----NVVLDVGVDNLTVNT----------------------------ILTSALI----------------NDAE..GSDL
M2QWE4_CERS8/1506-1894----NVCLELTVRNLAVNS----------------------------VLHSVIV----------------NELE..GSG.
G2X166_VERDV/1512-1902----SVCIDLEVRNLAINT----------------------------ILTSSLI----------------NDLE..GA.D
U4LW68_PYROM/1510-1903----SVCIEIDVRNLAINT----------------------------ILTSSLI----------------NELE..GS.D
Q7RWE3_NEUCR/1534-1926----SVCIDLEVRNLAINT----------------------------ILTSSLI----------------NELE..GA.D
G4TAK9_PIRID/1551-1940----NVCLLIEMRNLAVDA----------------------------VLQSSLV----------------NELE..GSG.
H6BPG7_EXODN/1517-1908----TVCVDVAVQNLTINT----------------------------ILTSSII----------------NDLE..GSAE
C4XXS2_CLAL4/253-635----TACLEVEIGNLTINT----------------------------ILTSSLI----------------NEAE..GTDL
DPOE_KLULA/1498-1882----DVIFEISVYNSVVNT----------------------------VLSSTML----------------NEAE..GTDL
G8JME6_ERECY/1494-1883----SAVLELEINNLTVNT----------------------------VLTSTLI----------------NEAE..GSDF
E3L3C9_PUCGT/1547-1947----DASVELTIQHLAMNS----------------------------VLQSSWV----------------YEIS..GGTG
DPOE_EMENI/1496-1885----TVCVELEVRNLAINT----------------------------ILTSSII----------------NEAE..GA.D
DPOE_DEBHA/1534-1916----TACLEVEIGTLTINT----------------------------ILTSALI----------------NEAE..GTDL
F4NWW9_BATDJ/1562-1979----SMCIEMDIWDLALNT----------------------------ILQTDLL----------------HDME..NPIS
E5RYM0_TRISP/1442-1827----NITFELNIVSLPIAA----------------------------VLSTSRI----------------LDFD..NSEA
F4PWS2_DICFS/1559-1964----TVCFELDLANLAVNT----------------------------ILESAHL----------------ADIE..GIIG
K0KG22_WICCF/1507-1890----TVALEVDVSNLTINT----------------------------VLTSALI----------------NEAE..GTDL
J5JYN7_BEAB2/1524-1910----SVCIDLDVRNLAINT----------------------------ILTSSLV----------------NELE..GA.D
U1GF87_ENDPU/1518-1911----SVCVDLEVRNLAINT----------------------------ILTSSLI----------------NELE..GSNG
C5DYX0_ZYGRC/1500-1892----KAVLEIEMSNLTVNT----------------------------VLGSALI----------------TEAE..GCDL
F2PJ05_TRIEC/1466-1860----TVCIELEVRNLAINT----------------------------VLTSSLI----------------SDLE..NN.E
F6WUQ7_CIOIN/1486-1883----TVCIQLDISSLAVNT----------------------------VLQSHNI----------------NDTE..GASS
J9M470_ACYPI/1505-1904----SYCIELEIDALPVTT----------------------------LLQSHHI----------------HDFE..GTSA
Q59SM7_CANAL/1519-1901----TACLEVEIGTLTINT----------------------------ILTSALI----------------NEAE..GTDL

PF03337

Q98188_MCV1/6-651....RLYLVGFLSSCYDLP----------------------------LLRAYWPRADTGWRLLGH.....ALVY--RCRY
Q9Q8S1_MYXVL/6-624....TVVIIGYLSSVFDFP----------------------------LLKSSWP.KDSGWFFVGNN....HIVS--SDGM
Q070L3_CPRVZ/15-682AGGDTVILAGYHSSFFDAP----------------------------LLRRRA..SDGRWVAAVGDDAGPTLIY--RGRH
Q6TUY6_YMTV5/10-640....TIALIGFFSSVFDIP----------------------------LLKASWN.NSHGWNFVGDE....YIIS--NNGL
Q08FW7_DPV83/7-651....TIAMVGYLSSIFDFS----------------------------LLRASWP.EDSGWTFIGYN....NIVS--KDGL
Q6TVW0_ORFSA/6-637.CKENITVYGFYSSFFDT.----------------------------..RQVMELAGKGWTRISEN....TLLS--RLGN
F12_VACCW/6-635....TIILVGYMSNLFDIP----------------------------LLTVYWP.NNCGWKIYNN.....TLIS--SDGA
Q8V3R9_SWPV1/5-644....TIILAGYFSSLFDFE----------------------------LLKASMS.PHMGWSFIEND....YMVS--QDGL

PF00136

Q9Q8R2_MYXVL/483-985LERVINTKVLFDNFKIE--FEAVYKNLIMQ-----SKKKYTTLKYVPSSTQNSIPVR..INKGTSETRRDVSKFHKYMIK
DPOD_SCHPO/519-956AANYVSD.QFPNPIKLE--FEKVYFPYLLI-----SKKRYAGLFWTRTDTYD....K.MDSKGIETVRRDNCPLVSYVI.
DPOL_MUHVS/528-1031LAANVTNALFKEPVRLE--FEKMFVSLMMI-----CKKRYIGKVHG.....S....QNLSMKGVDLVRRTACGFVKAVV.
DPOD1_DROME/519-959AAELVSS.KFVHPIKLE--FEKVYYPYLLI-----NKKRYAGLYFTRPDTYD....K.MDCKGIETVRRDNSPLVANLM.
DPOD_YEAST/540-973AAKYVST.LFKHPINLE--FEKAYFPYLLI-----NKKRYAGLFWTNPDKFD....K.LDQKGLASVRRDSCSLVSIVM.
DPOL_GAHVM/591-1150MAKRVSSDLFPKPIKLE--CEKTFNKLLLI-----TKKKYMGTIHG.....G....R.MLMKGVDIVRKNNCRFINTYA.
DPOA_YEAST/777-1229FKRLVNE..RYRLLEID--IDNVFKKLLLH-----AKKKYAALTVNLDKNGNGTTVL..EVKGLDMKRREFCPLSRDVS.
DPOL_ALHV1/535-1007LASHTSSVLFASPIKLE--SEKVFKCLMLL-----TKKRYVGILSN.....N....K.ILMKGVDLVRKTACVYVQEVT.
DPOL_HHV2H/602-1181MASHISRALFLPPIKLE--CEKTFTKLLLI-----AKKKYIGVICG.....G....K.MLIKGVDLVRKNNCAFINRTS.
Q98207_MCV1/479-983LERVLNEHVLFENFRVE--FEAIYQNLILQ-----SKKKYSTTKYAADHRAGDAPEH..VSKGTSETRRDVSRFHKLMIS
DPOLA_ORYSJ/819-1284VIQEVNK..KYRCLEID--LDGIYKRMLLL-----KKKKYAAIKVALDGSLR....ENIERKGLDMVRRDWSLLSKEIG.
DPOD1_SOYBN/496-935AAEHISG.TFTKPIKLE--FEKVYYPYLLI-----SKKRYAGLFWTKPDNFD....K.MDTKGIETVRRDNCLLVKNLV.
Q57UW4_TRYB2/670-1122IKGKVNQ..RYQSLELD--IDGVFRAMLLL-----RKKKYAALSVVDWQGEGKVYKR..EVKGLDMVRRDWCPLSQHVS.
DPOL_ASFB7/442-955VNEYLRQDNGTSYLRMA--YEEVLFPVCFT-----GKKKYYGIAHVNTPNFNT...KELFIRGIDIIKQGQTKLTKTIG.
DPOL_HHV6Z/502-979IAKHITDRLFKSPIKLE--FEKILCPLILI-----CKKRYIGRQDD.....S....L.LIFKGVDLVRKTSCDFVKGVV.
DPOD1_CAEEL/505-943AAKEVSK.IFTPPIKLE--FEKVYSPYLLI-----NKKRYAGLYFTKPDVHD....K.MDCKGLETVRRDNCPLVAKVL.
DPOL_EBVB9/517-994LAAHTTRSLFVAPISLE--AEKTFSCLMLI-----TKKRYVGVLTD.....G....K.TLMKGVELVRKTACKFVQTRC.
G8BKE7_CANPC/511-946AANYVST.KFQNPIKLE--FEKVYFPYLLI-----NKKRYAGLYWTRPDKFD....K.MDTKGIETVRRDNCRLVQNVI.
DPOL_VACCW/482-984LERLINNRVLFNNFKIE--FEAVYKNLIMQ-----SKKKYTTMKYSASSNSKSVPER..INKGTSETRRDVSKFHKNMIK
DPOA_SCHPO/758-1203FKEKVNE..RYSKLEID--IDNVYQRMLLH-----AKKKYAALQLDSQGKPN......LDVKGLDMKRREFCTLAKEAS.
DPOLA_HUMAN/768-1227VKSEVNK..LYKLLEID--IDGVFKSLLLL-----KKKKYAALVVEPTSDGNYVTKQ..ELKGLDIVRRDWCDLAKDTG.
Q6TVU5_ORFSA/488-991LERVINEHVLFANFKVE--FEAVYCNLIMQ-----SKKKYTTIKFAVSDGGGS..ER..VSKGTSETRRDVAPFHKLMIR
DPOZ_YEAST/904-1362MAERVTQ.NNPKPIFLK--FEKVYHPSILI-----SKKRYVGFSYESPSQTL....PIFDAKGIETVRRDGIPAQQKII.
DPOL_VZVD/582-1117MAHIISTALFCPPIKLE--CEKTFIKLLLI-----TKKKYIGVIYG.....G....K.VLMKGVDLVRKNNCQFINDYA.
DPOL_HHV8P/518-987LASITTNTLFRSPIKLE--AEKIFKCLLLL-----TKKRYVGVLSD.....D....K.VLMKGVDLIRKTACRFVQEKS.
DPOL_SHV21/507-976LAAFTSEKLFNAPIKLE--SEKTFQCLLLL-----AKKRYIGILSN.....D....K.LLMKGVDLVRKTACKFVQNTS.
DPOL_EHV2/515-985LAAHMTRTLFVDPIKLE--AEKTFKCLILL-----TKKRYIGMMTT.....D....R.LLMKGVDLVRKTACRFVQETT.
DPOL_FOWPN/468-966LEHIINTKILHANFKIE--FEAIYTQLILQ-----SKKKYTTIKYLANYKPGDKPIR..VNKGTSETRRDVALFHKHMIQ
DPOLA_DROME/790-1239IKQSVNK..LYKQLELD--IDGVFGCLLLL-----KKKKYAAIKLSKDSKGNLRREQ..EHKGLDIVRRDWSQLAVMVG.

PF03175

DPOL_ADEG1/239-749KFTAQHVEELNRLLTNES.HLSYFDARIKP-----SILKIE..AYPPPPEMLDP.LPPICSRRGGRLVWTNEALYDEVVT
Q9QM79_9ADEN/239-780KFTAKHVDELNELMSSER.PISYFDHRIKP-----CILKVE..AYPPPAEHLDT.LPPICSRRGGRLVWTNEALYDEVIT
Q9YUR6_9ADEN/339-828KERNNEITKLNEKLKKTKTKLSYF.TDIKP-----MVVMID..AIPPPPEHLDP.LPPLCSRQSGKLCWTNEILKNEIVT
DPOL_ADEB3/263-744FDRALAIKNWQDRLTQLHRPIDYFDRTLLP-----AIFTID..ADPPPEAFLDV.IPPFCSRKGGRLCWTNETLRGEVVT
DPOL_ADECT/392-875YERALAIKAYEQKMLNHK.TISYFDKDLLP-----GIFTID..ADPPAEEFLDV.LPPFCSRKGGRLCWTNEPLRGEIAT
DPOL_ADEB2/268-751YERALAATEWIRKLENLEQKIDYFDECLLP-----GIFTID..ADPPDELFLDE.LPPFCSRKGGRLCWANEPLRGEVAT
DPOL_ADE40/434-918YERALAVRDWEHALLQVGTPIDYFNRTLLP-----GIFTID..ADPPPENLLDV.LPPLCSRKGGRLCWTNEPLRGEVVT
DPOL_ADE12/307-791YERALAVRQWQVALENYTCKIDYFDKNLCP-----GIFTID..ADPPDENQLDV.LPPFCSRKGGRLAWTNESLRGEVVT
DPOL_ADE02/443-927YERALAARAWQQALDLQGCKIDYFDARLLP-----GVFTVD..ADPPDETQLDP.LPPFCSRKGGRLCWTNERLRGEVAT
Q9WF13_ADE17/336-820YERAMAAREWQMALDDASSKIDYFDKKLCP-----GIFTID..ADPPDEHLLDV.LPPFCSRKGGRLCWTNEPLRGEVAT
DPOL_ADE04/438-922YERALAVREWQASLDDLGTCISYFDPDLLP-----GIFTID..ADPPDELMLDP.LPPFCSRKGGRLCWTNEPLRGEVAT
Q83895_ADEO7/319-798FEANAQIDYFQELLQRKE.KIDYFDNSIKP-----MIVVAD..CEPPSLDYLDV.LPPLCSKKSGKLCWSNETLINEVLT
O11414_9ADEN/324-802LTASISIKTFQDKLDSPA.KLSYFGESIKP-----MIVYAD..CYPPPLEHVDV.LPPLCSRKSGRLCWTNEPLLGEVVT
DPO2_KLULA/409-871..KLVDYIDFE........KHGIYRVTLLN-----KHDQEPKNYLNFVPRRIN...........RKLTWEWFKIHEGWYH
Q09038_LACKL/414-876......SKVFSINFN....KHGIYDVTLIH-----KSNSKPNHYLEFVPRRID...........KKLIWSWFKEHRGTYH
DPO1_KLULA/416-866......KRVSSRPKD....ELGIYYVRVTP-----N..RNN..KSNFFPIR.........SHNKITYNNFEESTYIAWYT
O74719_DEBHN/419-870.......RRVQQRMTE...ELGIYYVRVIP-----H..TKI..NSNFFPVR.........YNNKITYNNYGSTQYNAWYT
DPOL_BPCP1/57-480RYKGKPKEI..........KEDHYYIYHIK-----ADFDLKRGYLPTIQIKKKLDALRIGVRTSDYVTTSKNEVIDLYLT
Q96206_BPGA1/50-479MFKGEYKKNVEYPL.....YIQQVRCFFEL-----...KKD..KIPCIQIKGN.....ARFGQNEYLSTSGDEYVDLYVT
DPOL_BPM2/50-474VFQGKYEKDEQYPL.....YIQRIRFEFEL-----...KEG..YIPTIQIKKN.....PFFKGNEYLKNSGVEPVELYLT
DPOL_BPPZA/50-474VFEGKYVWDEDYPL.....HIQHIRCEFEL-----...KEG..YIPTIQIKRS.....RFYKGNEYLKSSGGEIADLWVS
DPOL_BPPRD/2-433FYEANEITEETYFIEWEGENNGAVPVRTKT-----GLDFNQ.....................RSGIFHTSIHEWRAGIDT
O21376_PICKL/474-939YPEGLDYKDFNYPE.....TTGVLHCEVET-----PKNLVT....GVLPVK..........DINKGVMYPLGHFLGIWTT
Q35599_PHYPO/8-446YRDKEYMKKFEKNIEN...FFGFIDVLITI-----EK.TNN..NIPVLPYRMG.....IKNNVEVGIIYAKGTLRG.IYF
O99973_PORPU/80-478WKS....PQIREPID....PFTIYDVVVNI-----...GKQ..YIPSIPFR.......DKDNT...LKFPSGTFRT.NVT
Q9XNK1_PLEOS/738-1218FSTETNLDL..........IFGFVRAEVTA-----PSEKEL..RVAILPIK..........GPNGELITFRGTVEGTWFS
E6ZE21_BETVM/147-562WASNLGGMDLDS.......LYGFIEAYVEC-----PESIVR....PFLPYH.........KVKDPTLLFPTGEWIGVYYT
DPOM_MAIZE/299-724WVSDLGSKKSKIVLND...MFGFIRAFIIC-----PKHIKK....PLLPYK..........KDDGTIIFPTGRFLG.VYF
Q9TEH5_9PEZI/309-758FEVTIIILI..........IFRYVYAKIK.-----...TIGNTKYPFIPFR...........SETGLLFPLGSWED.WYF
DPOM_NEUCS/366-859......VHTFCKNLNE...IFGFVRAKIIT-----PAI.....NIPVLPCR.......VKVNGVQKLIFPIGEWTG.WYF
O78938_AGRAE/67-512FFKGDITRINKD.......AFGFFYCKIIT-----PEYLEH....PILQTH.......LKTSDGIRTLAPLGSWEDMLFS
DPOM_NEUIN/401-859YVKGTLQNIVRFTDSICEVPFGFYNVKVKT-----PLNLDK....PFLPTRLN.......TPAGTRTAFPLGQWEG.WYF
DPOM_ASCIM/589-1039HILG...DPYKFTKD....PFGFVFAEVTA-----P...DL..KVPIIQTR.......VQTSGGVRTVAPIGTFKG.WYL
DPOM_CLAPU/432-888FYEVVKANVNIHEL......FGFFYCKIKS-----P..DNL..YLGLLPKR...........TETSLIFPGGAWEG.WYF
DPOM_PODAS/450-889YIESKKGLKLSE.......LFGFFYCKVTT-----...NNQ..YLGLLPVH............NQGLIMPNGQWYG.WYF

PF08490

D8PW53_SCHCM/1455-1844.GATAFD...AVSHTIDEYRKGENQRDVTF.....GE..............SNV.....SPHMFSILRNMLKGWLLDRI.
K1Q2Z7_CRAGI/498-892.AVSFDTLPQSSLEEMVQGQ.GAATYLASY.....DE..............TAL.....CSTSFRILKTMVHGWVRDVTL
K5UTI1_PHACS/1501-1886.GATAFD...A.TKNLDQYTGDDTQKDLTL.....GE..............SSV.....SPITFSILRGMVKTWLLDKI.
T1J6P1_STRMM/1470-1868.SIAFDAMPLSSFEEMISGN..LTSSLSSY.....DE..............TAL.....CAGAFRILRTMVSDWLRSVTK
E0VSJ8_PEDHC/1513-1911.SLAFDSAPQVVMEDLLSGS...NNHCVTY.....DE..............SAV.....CSSAFRILRILAGILIREVSL
G8BQ26_TETPH/1521-1912..........AEVNSLMINNNNENGTGSSF.....VQ..............DSF.....STGSLSVLRSVLKSWWDQAL.
G0T1H4_RHOG2/1536-1927GGID......EAAHNLDDYAKGTAHAPHVL.....GD..............AIL.....PTSTFNMVRAMVKAWSVEAA.
J0M8E9_LOALO/1625-2027.SVGFLTGSVLSADALL....GYVRSIAQY.....DE..............GAA.....VAGPLKVLRLLLHDCIKDIHL
B0WNF0_CULQU/1523-1926.AITFDVIPQASLDDMISNQ.GGVQTLPSY.....DE..............TAL.....CSQAFRVMRSMVNGWLREVSI
M5E7V9_MALS4/1436-1836.ASMAFD...SASHSLEEYAHGRVPATADL.....GD..............AVL.....TSQTFATVRSMVKAWHVEKT.
E3S8N6_PYRTT/1524-1919.SVSFNP....AP.SYDSTND...GSNVIY.....SD..............NAF.....ASAGITVLREMVKDWWVEAV.
W1Q6U0_OGAPD/1501-1875..................FSSTDAAAEGAF.....AE..............DSF.....SGPALVVLRSLVRTWWDDAI.
I1G2M3_AMPQE/1495-1895TSISFDYAPQASLEDLMDGT..AAASLSIY.....DE..............AAL.....CSNAFKILRGLVHTWLHEVST
Q9VCN1_DROME/1529-1930.AITFDVMPQVSLEEMIGTV..PAATLPSY.....DE..............TAL.....CSAAFRVMRSMVNGWLREVSI
DPOE_CANGA/1526-1915..........VDMN.TVDVSDKPVGNNQGI.....VQ..............DSF.....SHDALAVLKSLLKEWWDRAL.
E2B8B2_HARSA/1525-1925.FVAFHNQQRPSVQDIVTGD..AATIIPSY.....DE..............ITL.....CNPAFKTLRSMVNAWLLEVSV
J7RME7_KAZNA/1518-1909..........TNVE.SSAMNSASSEKNSVF.....VE..............DAF.....NAESLTVLKNLLKDWWEEAL.
F4S3B6_MELLP/1559-1958ESTIGFQ...NASHNLDDYSKGSANSHHIL.....GD..............SDL.....TTQTFALFRSMVRVWMAESV.
DPOE_ASHGO/1493-1878.................AGPESGGREGGGF.....VE..............DAF.....STASVNILRSLLKDLWDDAL.
B6K1H9_SCHJY/1420-1808.FSALDD.......SYLASDSGNLEARFGA.....SE..............NFG.....LTYSLPILKDLVKELWLEAG.
A0BZJ9_PARTE/1454-1836...................................KEASQLVGQNGKSDMLDNLDELGGAKIAFRLLQMLVSSWLDDIYA
C5DK88_LACTC/1505-1895..........AESN.FSIGGEGEYIGGGAL.....VE..............DSF.....SGVSLSVLRALLKSLWDDAL.
H2YP37_CIOSA/1434-1828.GVCFEG.......DLMSNSNSAMVCLVNY.....DD..............SAP.....CSSTFRILKSMVLSWLRDVSV
M2NL61_BAUCO/1525-1921.PIGISG...ASA.KEDTLED...ATQVVA.....SE..............NAF.....ASAGINALREMLRVWWQEAC.
U1M0G7_ASCSU/1468-1870.SVGFLSSASLSADALF....GRVRTIAHY.....DE..............AAA.....VSGALKVLRLMLQDCVKDIHA
B0DWP2_LACBS/1522-1912.GATAFD...SVSHTLDEYASGETQRDLTL.....GE..............SQV.....SAQTFGIMKNMLKSWLVDKI.
R4X9Y3_TAPDE/1534-1914..........ADSFTTGAADEGDM...........QD..............KEF.....LSPSISSFKSLVKAWWHEAS.
R1GQ63_BOTPV/1519-1912.SVSFNP...AAP.TEDQPSD...GSNVIY.....SD..............NAF.....ASAGILVLREMVKAWWAEAE.
K1VVE5_TRIAC/1494-1883.GSMAFG...SASHTLDEYAQGTANASVML.....GD..............ATL.....SIQTFTVLKSMVHSWFVDKA.
B3S6C7_TRIAD/1510-1905.DLTFDAAPQASLDDIVITNGNPGTELSSY.....DE..............MTL.....CSSTFRIMKIMVHSWLHEVSS
N1JGF4_BLUG1/1511-1904.SSCLNP...ANP.TDNVPSD...GTGVLY.....SD..............DAF.....STAGVIVLREMVKSWWAEAC.
W4ZAF4_STRPU/37-438.SIAFDAIQQTSLEDMVSGQPGAAASLASY.....DE..............TAL.....CTVAFRIMKTMVHGWLRDVTT
M5BQD5_THACB/1537-1929.GATAFD...STSHTLNDYASGEARVSITL.....GD..............SVL.....SPQTFGILKSMAKAWLLDKV.
M3ALS7_PSEFD/1503-1901.PLGISG...AGA.KEDALDE...TAQTIQ.....SE..............NAF.....AAAGISALREMVRAWWQEAC.
I2GW49_TETBL/1546-1937..........ANAS.LNNTEDSVNGQSSTF.....IQ..............DAF.....SGPSLLVLRNMLKDWWDDAM.
F6GW32_VITVI/1705-2088..........FGFEQDMNMGAHGFNEQCGF.....DE..............ATL.....CAPTFRVLKQLIQRCLADAVS
S7ZMV2_PENO1/1499-1887.TL.LAP...S...ANG..TD...ESGILY.....SE..............KAF.....ASAGALVLREMVKNWWTEAC.
DPOE_SCHPO/1498-1886.MAALND.......NYMTAINDDLEEKLGI.....HD..............NIG.....LTHSLPVLKALVKTWWNEAA.
H9J5N5_BOMMO/1546-1951.ATAFGHAP.TSLQHLLDNT..GPNASLNY.....DE..............AAQ.....CSAAFKILRTMVASWLRDVTQ
H2AUI7_KAZAF/1512-1900..........AN...GGYDTFQGAGSSTEF.....VQ..............DAF.....SEQGLSVLKNMLKDWWDEAL.
I1BIP1_RHIO9/1528-1924.GNNSFD...NASHTLDEYTKGTVVAASSF.....GG..............GMV.....SSKTLYILRSTVHRWMDNSIS
DPOE_CRYNJ/1529-1917.GSLAFD...SASHNLDEYAKGAVNTSVML.....GD..............AVL.....STQTFGVLKSMLRAWYADKA.
F8QB37_SERL3/1530-1921.GTTAFD...SVSRTLDEYSTGDAQRDITL.....GE..............SSL.....SPQTFGILRTMVKGWLLDRI.
G7E3T0_MIXOS/1542-1933.TSMGFG...EASHNLDEYAKGSAHEAVNL.....GD..............VVL.....SPQTFAILRSMVRQWLVSSG.
R9P7N8_PSEHS/1532-1932.SGLAFE...GASHNLDEYSRGTVESSTIL.....GD..............SVL.....TSAVFAAVKGMVKTWYTTKR.
C1FJ68_MICSR/1644-2054............QGALLGYEQNTVGSGKDN.....GD..............SGVRGGHEAAAAFRTLRTLVNNWLVDATE
A5DEB2_PICGU/1518-1900..............ADEVVEFDNNNGAGSI.....AS..............DSF.....SAPAMQILRSMVKNWWDDAL.
L8G4R0_PSED2/1520-1914.SVTFNP...AAP.QDDAPTD...GANALY.....SD..............NAF.....AGAGVAVLREMVKAWWTEAC.
C4QV66_PICPG/1520-1895..................LEIGDNENTTSF.....AE..............DIF.....STPALQALRFLLKSWWDDAL.
K1XY13_MARBU/1520-1913.SISFNP...AAP.QDDSPSD...GTNVLY.....SD..............NAF.....ATAGVTVLREMVKAWWTEAC.
A7TF62_VANPO/1518-1909..........ADVG.FSNNTESGETSSSLF.....IQ..............DSF.....SSTSLIVLRNLLKTWWDHAL.
A5E0L0_LODEL/484-866..............ADDSVQYDNNNGAGSF.....AV..............DSF.....STPALLILRAMVKDWWDDAL.
Q7Q7P3_ANOGA/1541-1943.AITFDVMPQASLEEMITSG.PNGQQLSNY.....DE..............TAL.....CSQAFRVMRMMVNTWLREVSI
G8BGB3_CANPC/1514-1896..............AEDGVQFDNNHGASTF.....AE..............DSF.....SSPALSLLRSMVKDWWDDAL.
A0A088AM07_APIME/1527-1928.FVAFHNQQQTSVQDMAMGD.SMTNTIPSY.....DE..............IVL.....CSPAFRSLRSMVNAWLLDVSV
T1HUW2_RHOPR/1490-1890.SVGFDTMPQLSIGEQVSGQ...VPVLPIY.....DE..............GAL.....CSGAFKVMRFMVNAWLRDVTI
V5I1Z1_BYSSN/1523-1915.AL.LAP...SAP.AADGPSD...GTGVLY.....SE..............KAF.....ASAGVFVLREMVKQWWTEVC.
A7SIT9_NEMVE/1502-1904TGISFDNLPQASLEELVQGGSNTATSLTTY.....DE..............AAL.....CSTAFRILKGMVHSWLHEVSA
DPOE_YARLI/1514-1873...................................NELLS...........NAF.....NPHALKTLKMVVKEWWE....
R9AMW8_WALI9/1475-1880.AATVFD...STSHTIDEYTKGQAKASVTL.....GE..............AVV.....SSQVFSILKSMVKSWYLDKA.
D8SJG5_SELML/1443-1816LGF...........ELDATGSNLRQVGGSW.....DE..............TNS.....CAPAFGLLKQMVL........
S8FUF8_FOMPI/1617-2006.GATAFD...S.TRNLDEYTAADTQRDLTL.....GD..............SNV.....SPQMFSVLKNMVKTWLLDKI.
G1X6W6_ARTOA/1520-1907.AMGFNP.......AGKSNGE...EQQSLY.....TE..............NTF.....ASASITVLRDLVKSWWGDAT.
Q17H50_AEDAE/1518-1917.AITFDVIPQASLDDMIANQ...GQTLPSY.....DE..............TAL.....CSQAFRVMRSMVNGWLRDVSL
G1RBL5_NOMLE/1514-1911MGISFDVIQQASLEDMITGG.QAASAPASY.....DE..............TAL.....CSNTFRILKSMVVGWVKEITQ
D5GGS6_TUBMM/1460-1851.SVAMNP...AAP.QGDDPTD...GTNIIF.....AN..............NAF.....TTAGVAVLREMVKAWSALAT.
H2UTB8_TAKRU/1527-1926VGVSFDVIQQASLEDMMMGN.QGASAVASY.....DE..............TAL.....CSNTFRILKSMVVGWVREITQ
G8ZQL0_TORDC/1514-1906..........MGMDVSNSLNSGDHNSGDNL.....VN..............DAF.....SGGSLLVLRNLLKEWWDSAL.
S3BV94_OPHP1/1618-2007AAVSFNP...AAD.IGGGGDDGAGGSSTLY.....SE..............NAF.....SNASILVLREMVKGWWTEAC.
G0V590_NAUCC/1533-1922..........AN...NGSSGFDDNKNSNAF.....VE..............DAF.....SGAALSVLRNMLKEWWDQAL.
K5XRW0_AGABU/1528-1917.GSTAFD...SISHTLNEYSKADGQRELTL.....AE..............SQI.....SSQTFGIIRSLVKAWLLDKV.
E9H7I0_DAPPU/1517-1917.STAFD.VPQVSLKDMLNDN..HTAELSSY.....SE..............SAM.....CVTVFRVLKSVVASWLRDISV
G3B805_CANTC/1530-1912..............VDEGTVFDNNNGASTL.....ME..............DSF.....GNAQLNVLRSMVKNWWDDAL.
D6WSX8_TRICA/1501-1896.ATAFDGVGATSLDDLVGDN......PTVY.....DE..............TAR.....CAEAFKILRTMASIWMRDISL
A8NMZ4_COPC7/1518-1909.GTTAFD...SVSHTLDDYKSGDSQRDITL.....GG..............SRV.....STHAFSILKNMLKGWLLDKI.
G0WD71_NAUDC/1559-1949..........ADINVLD..GNTNNGGSSAF.....VE..............DSF.....SGAALTVLRNMLKEWWDLAL.
S2J5L9_MUCC1/1535-1930.GLGGFD...TSNYTLDDFAHGNVSNAAAF.....GE..............NMI.....SGKTFGMLRSVVQLWFHQAIT
C5GX57_AJEDR/1519-1912.STLLNP...VTP.NEAGASD...GTGVLY.....SD..............TAF.....ASAGILVLRDLVKSWWAEAC.
E9D9U9_COCPS/1514-1907.SVLLNP...SAP.TGQEVSD...GTGVLY.....SD..............TAF.....SSAGIVVLRDMVKAWWAEAC.
K7J3X8_NASVI/1487-1888.YVAFHNAQQTSLQDMVTND.GSAPSIPSY.....DE..............TAL.....CGPAFRILRLMVATWLKEVSN
O62218_CAEEL/1468-1869.VVTFDS...MNTIAQQSVTGGAVNSIACY.....DE..............GAA.....VDATIKVLKQMLTECVRHIAH
V2XXQ2_MONRO/1528-1918.GTTAFD...SVSKTLDEYAEGTGSRDLTL.....GE..............SNV.....SSHTFSILKNMVRGWLLDRI.
R7YYU2_CONA1/1520-1913.SASFNP...AAP.ADGGAAD...GMNVMY.....SD..............NAF.....ASAGITVLREMVKAWWTEAE.
B6QRD6_PENMQ/1519-1904.TL.LAS...TKE.SAD.........GVLY.....SE..............KAF.....ASAGVFVLREMVKQWWSEAC.
G6CJ62_DANPL/1482-1880.ATSFG.AQHANIQDVMAST..GSNATETY.....DE..............TAQ.....CSAAFKILRTMVASWLRDVTH
G8YP31_PICSO/1529-1911..............ADDVIEFDKNNGASTM.....AE..............DSF.....SAPALSILRAMVKDWWEDAL.
S9XA99_SCHCR/1491-1879.LAALND.......GFTANVTDDLEARLGM.....YD..............SVG.....LAHSLPVLKELIKNWWQEAA.
N1PFE7_DOTSN/1521-1915.PMGISG...AGA.QEDALDE...TTQTIQ.....SE..............NAF.....ASAGIGALREMVRGWWQEAC.
J4I9U6_FIBRA/1520-1910.GATAFD...S.SHTLDEYAGGDSPRDLTF.....GD..............ASV.....SPQTFSILKSMVKTWLLDKI.
M7NNI3_PNEMU/1489-1876..........VSEQAFDEFSILDNGIHNDF.....................ENFVDSNSSSSVMVVLKSLVKHWWSEAS.
DPOE_YEAST/1528-1919..........VNNNMGIDDKDAVINSPSEF.....VH..............DAF.....SNDALNVLRGMLKEWWDEAL.
M2QWE4_CERS8/1506-1894.GATAFD...S.SHTLDEYAGADSKWDLTL.....GE..............SNV.....STQTFAIIKAMVKMWLLDKI.
G2X166_VERDV/1512-1902.SVSFNP...AA..EAGANAD.....EVIS.....FD..............NAF.....ANAGVLVLREMVKAWWVEAC.
U4LW68_PYROM/1510-1903.SVTLNP...AAP.TEDGQGD..TGANVIF.....AD..............NAF.....ATAGVMVLRDMVKAWWQEAC.
Q7RWE3_NEUCR/1534-1926.NISFNP...AA..DATGSGD...GEEFLY.....SE..............NAF.....ANAGVQVLREMVKSWWAEAC.
G4TAK9_PIRID/1551-1940.GTTSFE...AITHTLEDYANGEPHSSVTL.....GD..............SVL.....SPQVFFILKNLVKGWMLDKA.
H6BPG7_EXODN/1517-1908.SVAFNP...AG..DEATSGD....GNTVN.....ST..............GGF.....AQAALDVLREMVKSWWAEAC.
C4XXS2_CLAL4/253-635..............SDDPLLGDANNGASTL.....AL..............DTF.....SPVALGILRSMVKDWWDDAV.
DPOE_KLULA/1498-1882.................AQNSTSKEESFGF.....VE..............DSF.....SSSALSVLRALLKELWDDAL.
G8JME6_ERECY/1494-1883..........GN...LDIDGNAQEKNAVRF.....VE..............DAF.....SNLSLNVLRSLLKDWWDDAL.
E3L3C9_PUCGT/1547-1947.GSLGFQ...DASHNLDDYSKGSVAS.SLL.....GD..............SDL.....PVQTFTLFRTMVRAWIAESA.
DPOE_EMENI/1496-1885.SL.LAP...SDP.SAE..SS...GSGVLY.....SE..............KAF.....ASAGAVVLREMVKHWWSEAC.
DPOE_DEBHA/1534-1916..............ADDAVQFDNNNGASTI.....AE..............DSF.....STPALSILRGMVKDWWDDAL.
F4NWW9_BATDJ/1562-1979.STSYNQHQVVTSMQLDHSEKLGDTSAKMIKEDSYDEQGTLTLSMLDDADRDTI.....SRPVYNVFRGMIKGWMDEVR.
E5RYM0_TRISP/1442-1827FFKASSTTKKTGVATLHSLNSYNN...........DE..............SIL.....LSSAFKVMKQMVHGWLKEVTL
F4PWS2_DICFS/1559-1964GELNNGDPTIFTQASQLQHQQQQQQQTPTQAPSRLNN..............KQMTHLNSCDKEFNILRKLVTKWSLDLV.
K0KG22_WICCF/1507-1890..............AEVELIHDENSGTSTF.....AE..............DSF.....SGPGLSVLRTMVKDWWDDAV.
J5JYN7_BEAB2/1524-1910.SVSFNP...SA........D...GSDSLA.....SE..............NAF.....SNAGVQVLREMVKAWWTEAC.
U1GF87_ENDPU/1518-1911.SISFNP...AAD...ENNND...ENGTIA.....SA..............SAF.....ANAPLLVLREMVKAWWAEAC.
C5DYX0_ZYGRC/1500-1892..........AEADAENDAALRATSSMGAF.....VQ..............DAF.....SSGSLAVLRNMLKDWWDSAL.
F2PJ05_TRIEC/1466-1860.PALLNP...TAPGDQQTISD...GSGVLY.....SD..............TAF.....SAAGILVLRDMVKSWWNEAC.
F6WUQ7_CIOIN/1486-1883.GVCFEG.......DLVSSSNSAMVCLANY.....DE..............TVL.....CSSTFRILKSMILGWLRDVSV
J9M470_ACYPI/1505-1904.GVAFDQIPQASLEEIMDGG...TFVTPTY.....DE..............IAL.....CSAAFRVLRSMVNVWFRDVVL
Q59SM7_CANAL/1519-1901..............ADENMHFDNNNGASTF.....AE..............DSF.....SSPALSILRSMVKDWWDDAL.

PF03337

Q98188_MCV1/6-651TAVLLDAAPYAHGLCLREYCEHWAGASPRLPSE..MESRADVLRRASASTEAAVHAARLLGTAVCAQQELLRRVMPTCDF
Q9Q8S1_MYXVL/6-624KLVLIDAAKFVRDMSTMDYLQHWKSRAVSIQGD..MITNEEARTKLKVLEKNSSRVAESLYNATCTQLITLNDVLSPWNA
Q070L3_CPRVZ/15-682RVLVRDLGLFNPSFSPDAFVRCWARAERGRLDDRYLRTRADLERYRDQILAYLSESCYYLHCAALAQSAALAEAFGRPDP
Q6TUY6_YMTV5/10-640KVYLIDALNFSYNCSVSDYVSSWTTSNVELNKD..FIFEQEARLTIKRLKKVSSACTTTLHNAVVNHISYLNSELYPMCF
Q08FW7_DPV83/7-651KILLLDVANFSCGMTLKEYCNHWERVIITPPKD..LITKHEAKLKIKLIERCALKTVTTLYNSINNHFTAINVLIQPWFM
Q6TVW0_ORFSA/6-637RVAFVDLARFAPATLFSEYCEFWGGVCVDVPED..VVSADES...AAAAEEAAAAAAQALSDAALAHQAALARIFPSCDM
F12_VACCW/6-635RVIWMDAYKFSCGLSLQDYCYHWGSKPESRPFD..LIKKSDAKRNSKSLVKESMASLKSLYEAFETQSGALEVLMSPCRM
Q8V3R9_SWPV1/5-644KIILMDFANFSFKLTLEEYCQYWNKNNAYNIKD..LITKQEAKIKIKLLEKSSLKFISVLYDSIITQSVALNTLLSPWNV

PF00136

Q9Q8R2_MYXVL/483-985IYKTR------ILEMLSDG----------------TSSSLQVCINILKSL-ESDLL....................IEFE
DPOD_SCHPO/519-956..DTA------LRKMLIDQ----------------..DVEGAQLFTKKVI-.........................SDLL
DPOL_MUHVS/528-1031..SDV------LHMVFNDE----------------..TVSEGTMKLSRMT-FDDLKKNGIPCEFGPVVSRLCRAR.DDLH
DPOD1_DROME/519-959..NSC------LQKLLIER----------------..DPDGAVAYVKQVI-.........................ADLL
DPOD_YEAST/540-973..NKV------LKKILIER----------------..NVDGALAFVRETI-.........................NDIL
DPOL_GAHVM/591-1150..KKL------SDLLFLDD----------------..TVAKAAATVAEKP-PSFWATSPLPEGLNSFGGVLAEAYTRMMI
DPOA_YEAST/777-1229..IHV------LNTILSDK----------------..DPEEALQEVYDYL-EDIR.....................IKVE
DPOL_ALHV1/535-1007..RAV------LELLLRDE----------------..EVKVAAQTLSYSP-VANCFKTEPLLGFLKIIDILNQSY.SDLK
DPOL_HHV2H/602-1181..RAL------VDLLFYDD----------------..TVSGAAAALAERP-AEEWLARPLPEGLQAFGAVLVDAH.RRIT
Q98207_MCV1/479-983RYKAQ------LVALLAEA----------------RLSSRQVCIEMLRSL-EVDLF....................AEFA
DPOLA_ORYSJ/819-1284..DFC------LNQILSGG----------------..SCDDVIESIHSSL-VQVQ.....................EQMR
DPOD1_SOYBN/496-935..NDC------LHKILIDR----------------..DIPGAVQYVKNAI-.........................SDLL
Q57UW4_TRYB2/670-1122..DAV------LKRILNAE----------------..GGEDILDFVIKYM-KGVA.....................QDVR
DPOL_ASFB7/442-955..TRI------MEESMKLR----------------..RPEDHRPPLIEIV-KTVLK....................DAVV
DPOL_HHV6Z/502-979..KDI------VDLLFFDE----------------..EVQTAAVEFSHMT-QTQLREQGVPVGIHKILRRLCKAR.EELF
DPOD1_CAEEL/505-943..GVC------LEKLLIER----------------..DQQSALDFAKRTI-.........................SDLL
DPOL_EBVB9/517-994..RRV------LDLVLADA----------------..RVKEAASLLSHRP-FQESFTQGLPVGFLPVIDILNQAY.TDLR
G8BKE7_CANPC/511-946..TKV------LEFILEER----------------..NVDKAQRFVKQTI-.........................ADLL
DPOL_VACCW/482-984TYKTR------LSEMLSEG----------------RMNSNQVCIDILRSL-ETDLR....................SEFD
DPOA_SCHPO/758-1203..KFC------LDQILSGE----------------..LTETVIENIHSYL-MDFS.....................EKMR
DPOLA_HUMAN/768-1227..NFV------IGQILSDQ----------------..SRDTIVENIQKRL-IEIG.....................ENVL
Q6TVU5_ORFSA/488-991KYKDM------LCRALAEE----------------..GSGNVGVEILRSL-EDELT....................FEFE
DPOZ_YEAST/904-1362..EKC------IRLLFQTK----------------..DLSKIKKYLQNEF-.........................FKIQ
DPOL_VZVD/582-1117..RKL------VELLLYDD----------------..TVSRAAAEASCVS-IAEWNRRAMPSGMAGFGRIIADAH.RQIT
DPOL_HHV8P/518-987..SQV------LDLILREP----------------..SVKAAAKLISGQA-TDWVYREGLPEGFVKIIQVLNASH.RELC
DPOL_SHV21/507-976..SKI------LNLILKDP----------------..EVKAAAQLLSTKD-PDYAFREGLPDGFLKVIDILNESH.KNLR
DPOL_EHV2/515-985..KAI------LDLVMGDE----------------..AVRAAAERLCAMR-VEEVCARGPPVGFLKVVDILNDSY.RKLR
DPOL_FOWPN/468-966RYKDM------LMKLLMES----------------K.GQQEITRLILQSL-ETDMI....................SEFT
DPOLA_DROME/790-1239..KAV------LDEVLSEK----------------..PLEEKLDAVHAQL-EKIK.....................TQIA

PF03175

DPOL_ADEG1/239-749VI..D------ILTLHNRG.WR.VQVL.HDEM...NIVFPEWKTLCADYV.TKNILAKEKADRE...KNE.VIRSISKML
Q9QM79_9ADEN/239-780VI..D------ILTLHNRG.WA.VTAL.HDDM...NIVFPAWKTVCAEYV.SKNIAAKEKADRD...KNE.VMRSISKML
Q9YUR6_9ADEN/339-828SI..D------IITLHNRG.WK.VNII.PHKL...NTVFPTWNTCCLEYV.TKNILAKEKATVE...KNP.VKRAISKLL
DPOL_ADEB3/263-744CL..D------AITLHNRG.WR.VQIL.NDPR...TTVFPQWECLARDYV.QLNIAAKERADKE...KNQ.TLRSIAKLL
DPOL_ADECT/392-875SI..D------VITLHNRG.WK.VTLI.PDTR...TTVFPEWKCLAREYV.QLNISAKEEADKS...KNQ.TMRSIAKLL
DPOL_ADEB2/268-751SI..D------LITLHNRG.WA.VRIL.PDER...TTIFPEWKCVAKEYV.QLNIGAKEKADKE...KNQ.TMRSIAKLL
DPOL_ADE40/434-918SV..D------LITLHNRG.WH.VRLL.PDER...ATVFPEWRCVAKEYV.HLNITAKERADRE...KNQ.TLRSIAKLL
DPOL_ADE12/307-791SV..D------LVTLHNRG.WR.LRLL.SDER...TTIFPTWKCLAREYV.QLNIAAKERADRD...KNQ.TLRSIAKLL
DPOL_ADE02/443-927SV..D------LVTLHNRG.WR.VHLV.PDER...TTVFPEWRCVAREYV.QLNIAAKERADRD...KNQ.TLRSIAKLL
Q9WF13_ADE17/336-820SV..D------LVTLHNRG.WR.VRIV.PDER...TTVFPEWKCVAREYV.QLNIAAKERADRD...KNQ.TMRSIAKLL
DPOL_ADE04/438-922SV..D------LITLHNRG.WQ.VRIV.PDEL...TTVFPEWKCVAREYV.QLNIAAKERADKE...KNQ.TMRSIAKLL
Q83895_ADEO7/319-798SI..D------LITLHNRG.WK.CKIIKSSEM...YAVWSDWKPLCQKYV.KVNIMAKEKASKS...NNK.IQRSISKLL
O11414_9ADEN/324-802TI..D------LITLHNRG.WK.CKILTSEQL...YAVWPEWKCITKEYV.SINIAAKEKADKD...KNM.TQRSISKLL
DPO2_KLULA/409-871TY..D------LIIAKSEG.FD.IYCH....E...GFEYPEKDYIFNDFI.DTLYSMKETHTACSCEEQPCPIRMVAKIA
Q09038_LACKL/414-876TY..D------LLIAIQEG.FE.IICH....S...GIEYPNKGYIFNNFI.DKLYTLKDIHTNCKCKEQPCPIRMVAKIA
DPO1_KLULA/416-866NV..D------IDIGLSEG.HN.IEYIPFDSYGNIGYSWSKKGKIFEKYIKDVLYKLKIKYEKQ...NNK.VKRNVIKII
O74719_DEBHN/419-870SV..D------IDIGISEG.HD.IQYIPFDEEENIGYSWINKGKIFQQYIEDTLYKLKLKYEEE...GNK.VKRNVIKII
DPOL_BPCP1/57-480NFDLD------LFLKHYDA..T.IMYV....E...TLEFQTESDLFDDYI.TTYRYKKENAQSP.......AEKQKAKIM
Q96206_BPGA1/50-479NVDWE------LIKKHYDI.FE.EEFI....G...GFMFKGFIGFFDEYI.DRFMEIKNSPDSS.....A.EQSLQAKLM
DPOL_BPM2/50-474NVDLE------LIQEHYEL.YN.VEYI....D...GFKFREKTGLFKDFI.DKWTYVKTHEEGA........KKQLAKLM
DPOL_BPPZA/50-474NVDLE------LMKEHYDL.YN.VEYI....S...GLKFKATTGLFKDFI.DKWTHIKTTSEGA........IKQLAKLM
DPOL_BPPRD/2-433GT...------.........IKPNRII....R...TINFTE.TTTFGAFI.DHFFSKRDAAKKA...GDL.FHNIFYKLI
O21376_PICKL/474-939V...E------LDYALSLG.YK.ITVY....K...GMVFNSMESPYKKYM.DLFYSRKSNAKGI........YRTLYKST
Q35599_PHYPO/8-446SE..E------IKLALKQG.YKIIEIY....S...AYEYKEKEVVFEEYV.EQMYNRRLKAKDP.......ALKDLYKKL
O99973_PORPU/80-478GV..E------LKYSIDNK.YA..NIV....K...IYKSLKLKDP.NLYL.ENTYWTCSRKDKRLRCKID.PSEILYKLN
Q9XNK1_PLEOS/738-1218E...E------LKNAETYG.YK.IKVK....D...CLQFEKVYNLFDDFV.NEFYNLKTEAEMN...KDD.ISRLIYKLI
E6ZE21_BETVM/147-562E...E------LKYAKSLG.YTVIPIK........GYLFQKRESPFKDYV.GSLFERRLQAKED...GNE.AMSLLYKLV
DPOM_MAIZE/299-724SE..E------LKYAVSLG.YK.VYPI....C...GYIFDRKESPFKRFV.YDIYSKRLDAKAK...GEK.ALDFIYKIT
Q9TEH5_9PEZI/309-758SE..E------LKYAVKSGLYQ.VEVI....H...SYKYEAGVDIFKDYV.EKYYGLNPVLEQV.....L.WEEPTAKLL
DPOM_NEUCS/366-859SE..E------LKLAVEYG.YK.IEVL....E...SYVFEKRDDPFKEYI.EHFASIKDNTKGS........KKQMAKLL
O78938_AGRAE/67-512E...E------MYNAMKYG.YK.FEIL....W...GYTFES.KNIFSEII.SDLYKMRLEYQKS.....D.PMNYIAKIL
DPOM_NEUIN/401-859SE..E------ILNAMKHG.YE.FEFI....E...GYLFEE.SSMFDEYI.DLLYNIKKNSPKE.....S.PWYYISKLL
DPOM_ASCIM/589-1039LD..E------LINAKKYG.YT.FKIS....E...AYLFER.LNIFKEYI.HRLYTIKSSYTPD.....D.PMYFIAKLL
DPOM_CLAPU/432-888SE..E------LKFAVAHG.YE.VEII....K...GYNFDRVSNVFNEFV.QEVYKVKCNPNNV.......TEKNIAKLI
DPOM_PODAS/450-889SE..E------LKFAEVNG.YN.IEVI....K...GYQFNKIDNLFSSYV.DDLYKIKANSEGS........EKLITKFL

PF08490

D8PW53_SCHCM/1455-1844.VDET...AGGPASMGIDH-------------------FWRWISSSNATMYDPSLHRF-------------VHGLMRKTF
K1Q2Z7_CRAGI/498-892.YNNI......FADNQIIH-------------------FYRWLRSSNALLYDPALRRT-------------LHNMMKKVF
K5UTI1_PHACS/1501-1886.RGNF....ESPASLAIDH-------------------FWRWISSNSSHLYEPSLHRF-------------VHGLMRKTF
T1J6P1_STRMM/1470-1868.HGNL......YADMQLVH-------------------FYRWLRSPKSLLHDPALHKI-------------LNNLMKKLF
E0VSJ8_PEDHC/1513-1911.FKNI......LADYQISH-------------------FYRWLRSSNALLYDPSMRKI-------------IHNLMKKFL
G8BQ26_TETPH/1521-1912.KGDV......SADLLVNS-------------------FVSWVQNPDSKLFDGTLRYH-------------VNNLTKKSL
G0T1H4_RHOG2/1536-1927.KPDG.....AHWRLMLDH-------------------FWRWTSSPAAKLYDPALYRF-------------VHGLMRKTF
J0M8E9_LOALO/1625-2027.YGSK......IADQVIIS-------------------LDRWLRTQHSLMYDPAIVRV-------------VDILITKLI
B0WNF0_CULQU/1523-1926.NRNI......FSDFQIIH-------------------FYRWVRSSKALLYDPALRRA-------------LNTLMRKLF
M5E7V9_MALS4/1436-1836.RGLS.....TCASLLADN-------------------FWRWACSSKAALFEPALQRF-------------LQRLMRKTL
E3S8N6_PYRTT/1524-1919.QANH...GFSMADVMVQH-------------------LVRWVSSPGSFLYDRSLHYY-------------VQMMSKKTL
W1Q6U0_OGAPD/1501-1875.KNNS......EADSMVHG-------------------FVSWCQNPASFLYDSSLHYH-------------VHNLTKKSF
I1G2M3_AMPQE/1495-1895.RQTT......YADFQLQH-------------------FYRWISSPNSLLYEPALCRM-------------IHKLMSKLF
Q9VCN1_DROME/1529-1930.NRNI......FSDFQIVH-------------------FYRWVRSSNALLYDPALRRS-------------LNNLMRKMF
DPOE_CANGA/1526-1915.EKNI......TADLLVNS-------------------LVSWVYSTDSKLFDGSLRYH-------------IHNLTKKSL
E2B8B2_HARSA/1525-1925.YKNV......FADYQLIH-------------------FYRWLRSSNALLYDPALRRT-------------LHTYMKKLY
J7RME7_KAZNA/1518-1909.NEDF......TADLLVNA-------------------FISWVQNPESCLFDILLRYH-------------VHNLTRKSL
F4S3B6_MELLP/1559-1958.KSNG.....HHYRGLIRH-------------------FWRWISSASSKMFDPALYHF-------------VHGLMKKVF
DPOE_ASHGO/1493-1878.QNNS......TADSLVHS-------------------FIGWVQSVDSKLFDYTLRYY-------------VNMLTKKAL
B6K1H9_SCHJY/1420-1808.KGDL......IADLIIQH-------------------LVRWVQQTDAHMYDPVLVTH-------------VRLLMRKTF
A0BZJ9_PARTE/1454-1836.KGEK......VSDDHILN-------------------INIWIYSGLSPLYDPYLGKL-------------LNRLNFKFF
C5DK88_LACTC/1505-1895.DENE......TADSLVHA-------------------FIHWVQSADSKLFDYALKYH-------------VHNLTKKAI
H2YP37_CIOSA/1434-1828.HRNQ......LADH