Sequence alignment for CL0194

PF03175

DPOL_ADEG1/239-749CDRSFMPRVGRLLFNDIIFRMPNPNYVKKDASR.----------------------------------------------
Q9QM79_9ADEN/239-780CDRFFMPRVGRLLFNDVLFHLPNPNYDKKDPTR.----------------------------------------------
Q9YUR6_9ADEN/339-828VERNFMPRQGRILFNDITIKFPNPDYYVAKEEK.----------------------------------------------
DPOL_ADEB3/263-744VSRNFMPRCGKILFNDLTFALPNPTHAARKDFK.----------------------------------------------
DPOL_ADECT/392-875ICRNFMPRAGRLLFNDITYSLPNPSYVPAKSYE.----------------------------------------------
DPOL_ADEB2/268-751INRNFMPRNGKILFNDISFCLPNPKYEKRKDFA.----------------------------------------------
DPOL_ADE40/434-918ITRNFMPRAGKILFNDITFALPNPSSKKRTDYR.----------------------------------------------
DPOL_ADE12/307-791ISRNFIPRAGKILFNDITFALPNPHYKKRTNFL.----------------------------------------------
DPOL_ADE02/443-927ITRNFMPRAGKILFNDVTFALPNPRSKKRTDFL.----------------------------------------------
Q9WF13_ADE17/336-820ITRNFMPRAGKILFNDVTFALPNPLSKKRTDFE.----------------------------------------------
DPOL_ADE04/438-922ITRNFMPRAGKILFNDVTFALPNPAYKKRTDFQ.----------------------------------------------
Q83895_ADEO7/319-798LTRSFMPRAGKLLFNDITLSLPNPCFKKPSHTT.----------------------------------------------
O11414_9ADEN/324-802ITRNFLPRAGKLLFNDITFSLPNPQYKKPSRGT.----------------------------------------------
DPO2_KLULA/409-871......SYNVDIILYAWYGSGYDYQHVLPYMKS.----------------------------------------------
Q09038_LACKL/414-876......NLKKNVILYAWFGSGYDYQHVLPYFKK.----------------------------------------------
DPO1_KLULA/416-866ICGELNISSVELIAHNGGG..YDFHYILSSMYN.----------------------------------------------
O74719_DEBHN/419-870ICSELKNKNIELIAHNGGA..YDFHYILSSMYK.----------------------------------------------
DPOL_BPCP1/57-480TYTETGEDEFIIFFHNLK...FDGSFLLSFFLNN----------------------------------------------
Q96206_BPGA1/50-479......NSNSDIYFHNLK...FDGSFILPWWLR.----------------------------------------------
DPOL_BPM2/50-474......EIQADLYFHNLK...FDGAFIVNWLEQ.----------------------------------------------
DPOL_BPPZA/50-474......KVQADLYFHNLK...FDGAFIINWLER.----------------------------------------------
DPOL_BPPRD/2-433PRRSRKKVEYKIAAFDFETDPFKHDRIPKPFSWG----------------------------------------------
O21376_PICKL/474-939KDMCVKANNYTFYCHNLSG..FDSVYIMSALIK.----------------------------------------------
Q35599_PHYPO/8-446LNTLYILKYKDIIKNQIPFNLFPVINNVDNLNIF----------------------------------------------
O99973_PORPU/80-478.......ARNIAYFHNLSG..FDGIYLIPLLIT.----------------------------------------------
Q9XNK1_PLEOS/738-1218DLMVIENDNRFYYAHNLSD..FDGMFVLKSLIN.----------------------------------------------
E6ZE21_BETVM/147-562...KMNPEIQTVYFHNFSR..FDGILILRHLVL.----------------------------------------------
DPOM_MAIZE/299-724....RRGSSMVVYFHNLSQ..FDGIMILSFLTK.----------------------------------------------
Q9TEH5_9PEZI/309-758....IINLPGYIYVHNLTK..FDAYFILKIIYD.----------------------------------------------
DPOM_NEUCS/366-859.KDMLKYDKHTVYCHNFSK..FDINFIIKILVQ.----------------------------------------------
O78938_AGRAE/67-512DICIRKYKNYKVYLHNFAK..FDGYFLVKYLSK.----------------------------------------------
DPOM_NEUIN/401-859SIMLRKYDGYKVYTHNFSY..FDGIFIIDILSR.----------------------------------------------
DPOM_ASCIM/589-1039TLLKSTNHGKKFYVHNLAH..FDSVFILDTLSK.----------------------------------------------
DPOM_CLAPU/432-888EMMRYKYRNVLFYAHNLGK..FDAVFLLKELLRF----------------------------------------------
DPOM_PODAS/450-889INTIVEDDKKIKVKKKKPISDVNKKSQNKDHYE.----------------------------------------------

PF03337

Q98188_MCV1/6-651GISCMTARASDTDEVRATLQKQ.PCSEVYARLPC----------------------------------------------
Q9Q8S1_MYXVL/6-624GLLHDTKKE....VVVHTLKEH.PRAVVLTKTRH----------------------------------------------
Q070L3_CPRVZ/15-682CLLDAEPGGGDSLESVTSMIRVNGDLVVSIKTRH----------------------------------------------
Q6TUY6_YMTV5/10-640.......NKKSTDDVSSFLNRY.KYSIILARNND----------------------------------------------
Q08FW7_DPV83/7-651KSLSDDNNDDENNHIITALEEY.KFSIVLARTKC----------------------------------------------
Q6TVW0_ORFSA/6-637GKVCGGVPGRQAWDEPPPTDLV.PGEYALAKARD----------------------------------------------
F12_VACCW/6-635QILMKTANNYETIEI...LRNYLRLYIILARNEE----------------------------------------------
Q8V3R9_SWPV1/5-644KSLKSYNNN..NLTISSALNEY.KFCIILARTNY----------------------------------------------

PF00136

DPOD_YEAST/555-991-------GQQIKVVSQLFRKCLEIDTVIPNMQSQ..............................................
DPOD1_CAEEL/520-978-------GQQIKILSMMLRRCKQNNFFLPVIEAN..............................................
DPOL_FOWPN/483-977-------RASTLIKGPLLKLLLEERVIYTRKITK..............................................
DPOL_IIV6/578-1226-------GQQVKFFNQVYKYCYDHKTVTDKETYK..............................................
DPOL_MUHVS/543-1050-------GQQIRIYTCLLEECSGRDMILPNMPSLGHGAAAAIEEAAA.................................
DPOLA_ORYSJ/834-1303-------SRAQRVEYLLLHAFHARKFIVPDKFARSKEFNSTKRKMNPDTEAA............................
DPOL_BPT4/383-855-------HVKQSFPGAFVFEPKPIARRYIMSFDLTSLYP.........................................
Q98207_MCV1/494-994-------RASTLIKGPLLRLMLRERVVYVRTQEP..............................................
DPOL_EHV2/530-1004-------GQQIRVFSCLLDVAGREGYILPVDRHA..............................................
DPOLA_DROME/805-1258-------GRSERNEFLLLHAFHEKNYIVPDKKPVSKRSGAGDTD....................................
DPOL_VZVD/597-1136-------GQQVRIYTCLLGLASSRGFILPDGGYPATFEYKDVIPDVGDV...............................
DPOD1_DROME/534-994-------GQQIKVLSQLLRKAKTKGFIMPSYTSQ..............................................
DPOL_EBVB9/532-1013-------GQQIRVFSCLLAAAQKENFILPMPSAS..............................................
DPOA_YEAST/792-1248-------TRAGRNEYILLHEFSRNGFIVPDKEGNRSRAQKQR......................................
DPOL_SFAVA/492-1090-------KQQRRMFHLMFSECMRENVAMQDDFGLANAAP.........................................
Q9Q8R2_MYXVL/498-996-------RASTLIKGPLLKLLLEKKIIMTRSEKK..............................................
DPOD_SCHPO/534-990-------GQQIKVISQLFRKALQHDLVVPNIRVN..............................................
DPOZ_YEAST/919-1384-------GSQFKVESFLIRICKSESFILLSPGKKD.............................................
DPOLA_HUMAN/783-1246-------GRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDED...................................
DPOL_ALHV1/550-1026-------GQQIRVFTCLLAAAQERDYILPMPVTG..............................................
DPOD1_SOYBN/511-969-------GQSIKVLSQLLRRARQKNLVIPNAKQA..............................................
DPOL_SHV21/522-994-------GQQIRVFSCLLAAARAENYILPVSNDV..............................................
DPOA_SCHPO/773-1222-------TRAERNEYILLHEFKKNGYIVPDKQQSIRRHAEAFG.....................................
B6KU35_TOXGO/1007-1611-------.RAERNAFLLLHEFHREKFICPDKDDPYARGAPVRRPHAGPGRGGPRRGPSASGARDEDPWEVEGGGQEVGVA
G8BKE7_CANPC/526-956-------GQQIKVVSQLFRKCLQEDIVIPNMKSE..............................................
DPOL_VACCW/499-994-------..STVIKGPLLKLLLETKTILVRSETK..............................................
DPOL_ASFB7/457-973-------GHKVCNMLIAYAIHDEYGRIACSTIAR..............................................
DPOL_HHV2H/617-1200-------GQQIRVFTCLLRLAGQKGFILPDTQGRFRGLDKEAPKRPAVPRGEGERPGDG.................NGDE
DPOL_HHV8P/533-1003-------GQQIRVFSCLLEAAATEGYILPVPKGD..............................................
Q57UW4_TRYB2/686-1135-------.RSERIEYLLLHAFHNLKFVTPDKKKRDLKRG.........................................
Q6TVU5_ORFSA/504-1000-------.ASTCIKGPLMKLLLENRTVMVRADTK..............................................
DPOL_GAHVM/606-1169-------GQQIRVYTCLLRLARSHGFILPEKNKKFAETVSLTCEEDQTEICE............................
DPOL_HHV6Z/517-994-------GQQKKIFPCILTEAKRRNMILPSMVSS..............................................

PF08490

D8PW53_SCHCM/1455-1844-------------...TYAQLKDK....RASILS----------------------------------------------
K1Q2Z7_CRAGI/498-892-------------....FNAERNSKLSKVDEED.----------------------------------------------
K5UTI1_PHACS/1501-1886-------------....YLDLLNK....RPNQ.G----------------------------------------------
T1J6P1_STRMM/1470-1868-------------MNSLYSAERNAKLATDSDTN.----------------------------------------------
E0VSJ8_PEDHC/1513-1911-------------LKNVYNKERNNRISNGSNEL.----------------------------------------------
G8BQ26_TETPH/1521-1912-------------IEQLYKTAYNK...KKDDHYN----------------------------------------------
G0T1H4_RHOG2/1536-1927-------------.ERLKKDKSAK.........R----------------------------------------------
J0M8E9_LOALO/1625-2027-------------LSNMYASEKAN.....LSADV----------------------------------------------
B0WNF0_CULQU/1523-1926-------------LKNLYTSERLALLKGESENF.----------------------------------------------
M5E7V9_MALS4/1436-1836-------------LEPMYQERLQA.LRNAGRIHD----------------------------------------------
E3S8N6_PYRTT/1524-1919-------------VDRIYRDALQR.RLEDNNGEP----------------------------------------------
W1Q6U0_OGAPD/1501-1875-------------VDSLYEEIFAS...KKDTLP.----------------------------------------------
I1G2M3_AMPQE/1495-1895-------------LSNLYRSERNSRISE.....F----------------------------------------------
Q9VCN1_DROME/1529-1930-------------MRQLYTAERLALLKNLTAEE.----------------------------------------------
DPOE_CANGA/1526-1915-------------.IGIFKEQYHK...RKDRITK----------------------------------------------
E2B8B2_HARSA/1525-1925-------------LNTLYTQERNAMLAQEDESK.----------------------------------------------
J7RME7_KAZNA/1518-1909-------------ITKIYSDLFEK...RMDKLRE----------------------------------------------
F4S3B6_MELLP/1559-1958-------------MQTYYETSFQA...RVEDIKL----------------------------------------------
DPOE_ASHGO/1493-1878-------------LEAAYEQQYLK...KVKNFEK----------------------------------------------
B6K1H9_SCHJY/1420-1808-------------LKKLYEEALPS.....YKQSE----------------------------------------------
A0BZJ9_PARTE/1454-1836-------------FEFKRKQLNKN..........----------------------------------------------
C5DK88_LACTC/1505-1895-------------VQSLFKELRAQ...KSDKLDS----------------------------------------------
H2YP37_CIOSA/1434-1828-------------LQNLFKNERAKLVSENVDEE.----------------------------------------------
M2NL61_BAUCO/1525-1921-------------VDRIYEEIIAR.KLQEAGGEP----------------------------------------------
U1M0G7_ASCSU/1468-1870-------------VNAIYANEKAR.....LGGTA----------------------------------------------
B0DWP2_LACBS/1522-1912-------------LNSVYTEILEK....RRQMYG----------------------------------------------
R4X9Y3_TAPDE/1534-1914-------------.ERIYRETRAR....MDSTTS----------------------------------------------
R1GQ63_BOTPV/1519-1912-------------LDKIYKEHFAA.RLQESEGQP----------------------------------------------
K1VVE5_TRIAC/1494-1883-------------..KWYADRIDK........VA----------------------------------------------
B3S6C7_TRIAD/1510-1905-------------LSNIYQSEWGAKYVFSNYVT.----------------------------------------------
N1JGF4_BLUG1/1511-1904-------------VGKIYDDLRVR.REQEANDQP----------------------------------------------
W4ZAF4_STRPU/37-438-------------LNSMYQHERQAKSERSSENE.----------------------------------------------
M5BQD5_THACB/1537-1929-------------MQEQYSVLNSA.....RKATG----------------------------------------------
M3ALS7_MYCFI/1503-1901-------------VDRVYEELLNA.KLEETGGQP----------------------------------------------
I2GW49_TETBL/1546-1937-------------LQQVFKNYFQK...KYENNEK----------------------------------------------
F6GW32_VITVI/1705-2088-------------.EKQFREACEA.........L----------------------------------------------
S7ZMV2_PENO1/1499-1887-------------VDKIYSELLSR.KLQDASTEE----------------------------------------------
DPOE_SCHPO/1498-1886-------------ISKIYEELRSK.....FDNLI----------------------------------------------
H9J5N5_BOMMO/1546-1951-------------MSTLYAAERTAKINQGTDEN.----------------------------------------------
H2AUI7_KAZAF/1512-1900-------------IRQTFEQFYEK...NNKITNK----------------------------------------------
I1BIP1_RHIO9/1528-1924-------------VARIYKEAYHA....MNRERT----------------------------------------------
DPOE_CRYNJ/1529-1917-------------..KFYTDRVER.........A----------------------------------------------
F8QB37_SERL3/1530-1921-------------LQELYEDLLRK....RQASYG----------------------------------------------
G7E3T0_MIXOS/1542-1933-------------.KRVYSGLTQA......AQKA----------------------------------------------
R9P7N8_PSEHS/1532-1932-------------VETMYADRVAH.MRKRGKLEE----------------------------------------------
C1FJ68_MICSR/1644-2054-------------.DRAWRAARAE...VSSADGD----------------------------------------------
A5DEB2_PICGU/1518-1900-------------MQRIYEDLFHS...KKTKLEA----------------------------------------------
L8G4R0_PSED2/1520-1914-------------IAKIYTDALAK.RFSEAEGKS----------------------------------------------
C4QV66_PICPG/1520-1895-------------MESVYQDYYRS...KKERLS.----------------------------------------------
K1XY13_MARBU/1520-1913-------------IGKIYSEMLLR.REQEAEGQE----------------------------------------------
A7TF62_VANPO/1518-1909-------------IESMFKETYAM...KEDKLDK----------------------------------------------
A5E0L0_LODEL/484-866-------------FHKIYQELYAG...KSEKLKK----------------------------------------------
Q7Q7P3_ANOGA/1541-1943-------------VKNLYTSERIALLTTSDEHG.----------------------------------------------
G8BGB3_CANPC/1514-1896-------------ISKIYGEVFEN...KREKLKK----------------------------------------------
H9K9J3_APIME/1527-1928-------------MNTLYTQERDIVISMNGADK.----------------------------------------------
T1HUW2_RHOPR/1490-1890-------------LNNMYNSERKLKLSKTEAKE.----------------------------------------------
V5I1Z1_BYSSN/1523-1915-------------MDKIYAEDLLR.KLQGSSGEK----------------------------------------------
A7SIT9_NEMVE/1502-1904-------------...MFNTERSARKKKADEDD.----------------------------------------------
DPOE_YARLI/1514-1873-------------ISKEYARLRRG..ERYKQNMD----------------------------------------------
R9AMW8_WALI9/1475-1880-------------LDKVYGQSYES..YLSRKSEE----------------------------------------------
D8SJG5_SELML/1443-1816-------------.ERQFRDSLRT.....QESSV----------------------------------------------
S8FUF8_FOMPI/1617-2006-------------.AEVYRDQFVK....RQQTVG----------------------------------------------
G1X6W6_ARTOA/1520-1907-------------IDKMYAEQILR.RNQESHG..----------------------------------------------
Q17H50_AEDAE/1518-1917-------------LKNLYLAERTAMLSTGKSSN.----------------------------------------------
G1RBL5_NOMLE/1514-1911-------------..ALYSAEHSLLLEKVGPEL.----------------------------------------------
D5GGS6_TUBMM/1460-1851-------------MDKIYAEQFTR.RMETANG.P----------------------------------------------
H2UTB8_TAKRU/1527-1926-------------LSNLYTAERTALLDKTTEEL.----------------------------------------------
G8ZQL0_TORDC/1514-1906-------------LKQIYKEAFEQ...KKEFHSK----------------------------------------------
S3BV94_OPHP1/1618-2007-------------AA..........QQAATAATN----------------------------------------------
G0V590_NAUCC/1533-1922-------------MDQVYSELYKS...RGDKIRK----------------------------------------------
K5XRW0_AGABU/1528-1917-------------LQEQYSSQLRQ....FREQYD----------------------------------------------
E9H7I0_DAPPU/1517-1917-------------LVNLYNEERLKKLSQADVVE.----------------------------------------------
G3B805_CANTC/1530-1912-------------MDKIYRDLFLA...KEDKLGK----------------------------------------------
D6WSX8_TRICA/1501-1896-------------LNKLYQAERMAKKEKGTEDD.----------------------------------------------
A8NMZ4_COPC7/1518-1909-------------LDTSYRDLFAK....QQQMFG----------------------------------------------
G0WD71_NAUDC/1559-1949-------------LEQTYRESYHK...RSNKIKK----------------------------------------------
S2J5L9_MUCC1/1535-1930-------------ISRLYSERY.......SRGKP----------------------------------------------
C5GX57_AJEDR/1519-1912-------------VDKIYREALEK.KIEEHAGES----------------------------------------------
E9D9U9_COCPS/1514-1907-------------VDKIYANSLRR.RIEEGNNEN----------------------------------------------
K7J3X8_NASVI/1487-1888-------------MNTLYSTEKIKAIEMNEIER.----------------------------------------------
O62218_CAEEL/1468-1869-------------MDSLYTSAYTK.....MMSTE----------------------------------------------
V2XXQ2_MONRO/1528-1918-------------.AETYVDLRQK....RLQNYG----------------------------------------------
R7YYU2_CONA1/1520-1913-------------VDKTYRDQFTR.RLQEAGGEQ----------------------------------------------
B6QRD6_PENMQ/1519-1904-------------IDKMYVELLGR.KIAAES.EA----------------------------------------------
G6CJ62_DANPL/1482-1880-------------MNTLYNAERTAKINLGTDEK.----------------------------------------------
G8YP31_PICSO/1529-1911-------------MEKIYHEIYEQ...KKDKLGK----------------------------------------------
S9XA99_SCHCR/1491-1879-------------IEDLYHELRQK.....YNDML----------------------------------------------
N1PFE7_MYCP1/1521-1915-------------VDRIYEDLLNR.KLEEAGGQP----------------------------------------------
J4I9U6_FIBRA/1520-1910-------------LSELYTELLNK....RRQSAR----------------------------------------------
M7NNI3_PNEMU/1489-1876-------------FEKLYTELLSN...WKSQDLF----------------------------------------------
DPOE_YEAST/1528-1919-------------LGQIYKQMFEK...KKGKIET----------------------------------------------
M2QWE4_CERS8/1506-1894-------------..ETYADLWGK....QQQSAG----------------------------------------------
G2X166_VERDV/1512-1902-------------VSRIYTDTLKQ.RDQEAEGTN----------------------------------------------
U4LW68_PYROM/1510-1903-------------MDKLYAEQFLA.RQTKEPDGL----------------------------------------------
Q7RWE3_NEUCR/1534-1926-------------INKLYADMLAR.RNQEAAGAE----------------------------------------------
G4TAK9_PIRID/1551-1940-------------..EAYMFMLEQ.....HRQRS----------------------------------------------
H6BPG7_EXODN/1517-1908-------------VDKIYTEQYRH.KAEE..DVL----------------------------------------------
C4XXS2_CLAL4/253-635-------------ISKIYKEVYEA...KKSKLSK----------------------------------------------
DPOE_KLULA/1498-1882-------------IESLYNEIYEK...KFEKLDK----------------------------------------------
G8JME6_ERECY/1494-1883-------------LESTYVNQFES...KKADLDR----------------------------------------------
E3L3C9_PUCGT/1547-1947-------------IQKYYKNVLNS...RLAIMEK----------------------------------------------
DPOE_EMENI/1496-1885-------------VDKIYSELLAR.KLQ.GQGDQ----------------------------------------------
DPOE_DEBHA/1534-1916-------------MDKIYREIFEA...KKDRLGK----------------------------------------------
F4NWW9_BATDJ/1562-1979-------------VQRMYSSMLAN......SAAD----------------------------------------------
E5RYM0_TRISP/1442-1827-------------VSALYSQERKAKLEVNSKRM.----------------------------------------------
F4PWS2_DICFS/1559-1964-------------...PYTSHNIS.......DKL----------------------------------------------
K0KG22_WICCF/1507-1890-------------LEKIYRDLYEA...KREKIAP----------------------------------------------
J5JYN7_BEAB2/1524-1910-------------ITRMYSEMLAK.RAEEAAGTN----------------------------------------------
U1GF87_ENDPU/1518-1911-------------VDKIYSEQLLR.KTEEGDDPT----------------------------------------------
C5DYX0_ZYGRC/1500-1892-------------LEQLYKDAYLK...KISKLQG----------------------------------------------
F2PJ05_TRIEC/1466-1860-------------VDKIFTEALQR.KVDEQNNEA----------------------------------------------
F6WUQ7_CIOIN/1486-1883-------------LQALFKNKRTKLLSQDDVNE.----------------------------------------------
J9M470_ACYPI/1505-1904-------------LNTLYTKERNTKISRGHNES.----------------------------------------------
Q59SM7_CANAL/1519-1901-------------IHKIYREIFES...KREKLDK----------------------------------------------

PF03175

DPOL_ADEG1/239-749-----------..............VERWSRGIVSHQ--------DARSV...........FVRFMVRDTLQ--------
Q9QM79_9ADEN/239-780-----------..............LHRWARGVVAPS--------DSRTV...........FVRFMVRDTLQ--------
Q9YUR6_9ADEN/339-828-----------KN.......NKSEILSQIKEGIPHPE--------SIKNL...........YIKSMVRDTFQ--------
DPOL_ADEB3/263-744-----------................DWEEGTPTSA--------DYKFQ...........FVKFMVRDTFA--------
DPOL_ADECT/392-875-----------................HWEQGQVLAS--------DLKSQ...........YIKFMVRDTFS--------
DPOL_ADEB2/268-751-----------................DWECGKLTAA--------DHKYQ...........FVKFMVRDTFA--------
DPOL_ADE40/434-918-----------................LWEQGACDDS--------DFKYQ...........FLKVMVRDTFA--------
DPOL_ADE12/307-791-----------................LWEHGGCDDQ--------DFKYQ...........YLKVMVRDTFA--------
DPOL_ADE02/443-927-----------................LWEQGGCDDT--------DFKYQ...........YLKVMVRDTFA--------
Q9WF13_ADE17/336-820-----------................LWEHGGCDDS--------DFKYQ...........FLKVMVRDTFA--------
DPOL_ADE04/438-922-----------................LWEQGGCDDI--------DFKHQ...........FLKVMVRDTFA--------
Q83895_ADEO7/319-798-----------..............YERWKNGIINFE--------DMKWQ...........GIKFMVRDTFL--------
O11414_9ADEN/324-802-----------..............FDRWQNGMLDKQ--------DLKWQ...........GVKFMVRDTYL--------
DPO2_KLULA/409-871-----------KC.........IKDKYIIKNNMITYG--------ELYYE...........NAIIYLKDPYL--------
Q09038_LACKL/414-876-----------KC.........IKDKYIIKNNMITYS--------ELYFK...........HSKIILKDPFL--------
DPO1_KLULA/416-866-----------PA.........AIKNILIRNNSFISF--------NFAHD...........GVKFSVKDSYS--------
O74719_DEBHN/419-870-----------SS.........DIKNILIRNNNFISF--------SFVHD...........DITFNIKDSYS--------
DPOL_BPCP1/57-480-----------DI.........ECTYFINDMGVWYSI--------TLEFP...........DFTLTFRDSLK--------
Q96206_BPGA1/50-479-----------NG.............YVHTEEDRTNT--------PKEFT......................--------
DPOL_BPM2/50-474-----------HG.............FKWSNEGLPNT--------...YN......................--------
DPOL_BPPZA/50-474-----------NG.............FKWSADGLPNT--------...YN......................--------
DPOL_BPPRD/2-433-----------FY.......NGEIYKDYWGDDCIEQF--------IYWLD...............TIEEPHV--------
O21376_PICKL/474-939-----------.YTRVKGSESDITFKIIRREAKVLKM--------TVRYM......DESGKESQMVMLDSLT--------
Q35599_PHYPO/8-446-----------SL...........FDFLLKEKNANNY--------WYLYS..............YEITQLFN--------
O99973_PORPU/80-478-----------.............IKTIWEGAKYIKL--------IYTIL..........TTHILSLRDSLN--------
Q9XNK1_PLEOS/738-1218-----------TS....KSHDLKIKVLSKNDGTIISL--------EIKKI......LINKKIIKITLLDSLH--------
E6ZE21_BETVM/147-562-----------HN.......DEYEIRPLMRNGRLYEV--------VVYFK..........KRMLFRFRDSLN--------
DPOM_MAIZE/299-724-----------SY.......KNCHIEPIMRNDCIYSI--------KLYKV.....SKNGDKRLVLTFMDSYL--------
Q9TEH5_9PEZI/309-758-----------NF..........VVKPLYKDRTILQL--------DMTLK.TFETNTKKCKNKRMVLKDSYL--------
DPOM_NEUCS/366-859-----------EF.........VVEKIISKDLDILSI--------KISYKFEPKKKGGKAERHTITIADSCR--------
O78938_AGRAE/67-512-----------LG.........FIDNIIINKGRIITL--------KFIYN...........KYSITFKDSYL--------
DPOM_NEUIN/401-859-----------LG..........EVKPFMRNGKILKL--------TFNFT.....LPNSKRKYTLYFMDSLL--------
DPOM_ASCIM/589-1039-----------LG..........KIDIIMRDDKIMKL--------KITFK.....IPGKNTEYSISFLDSLL--------
DPOM_CLAPU/432-888-----------NLTTEGLNNPYEFPAPLTRNSDILKL--------TIKRT.......VDGKTRKVTIMDSFA--------
DPOM_PODAS/450-889-----------IS.............TILRDDRILKC--------VIKVK.......TPSGYNKITFIDSYN--------

PF03337

Q98188_MCV1/6-651-----------GRGVVVNADTFQSTARLC.ALQSARV...LAACPVREMPSPPAPA....LVMAALETDSFFSPQSSATP
Q9Q8S1_MYXVL/6-624-----------GKGVVVYAGNLEDVKSMV.SVSELDV.VGVTPH.AEPVSLPASPINS..LCIHETDTDVYYFPKTCKSP
Q070L3_CPRVZ/15-682-----------GP.FCLSAENLERYQRLY.GDCSVRV........VDAVQRPP.PSERDLRTMRLRGEDV...PRRHFAP
Q6TUY6_YMTV5/10-640-----------GKGVIVHANNASHAKCML.NLSLLEI.VGITKY.VEPSPLPDKPISN..LHIQSVDTETYYSPETSTSP
Q08FW7_DPV83/7-651-----------GKGIIVYSSNLSMVKSMI.DLTTLEI.AGITKY.VEPCPPPMGPISK..LFIDESESDNYYSPATARSP
Q6TVW0_ORFSA/6-637-----------GKTMIFDAEGARAAAVVLPSLKSVRISCTFIDARTDALAPPPAPATQRFAIVSRHDPDCYI.PDSS.SP
F12_VACCW/6-635-----------GRGILIYDDNIDSIMSMM.NITRLEV.IGLTTHCTKLRSSPPIPMSR..LFMDEIDHESYYSPKTSDYP
Q8V3R9_SWPV1/5-644-----------GKGIIVYSGNLVYVQSMV.DISDLEI.IGITKY.VEPYPKPIKPIGN..LFIDELDTELFYSPKTSISP

PF00136

DPOD_YEAST/555-991.......................ASDDQYEGATVIEP--------IRGYY----------DVPIA.TLDFNS--------
DPOD1_CAEEL/520-978......................SGDGEGYEGATVIDP--------IRGFY----------NEPIA.TLDFAS--------
DPOL_FOWPN/483-977........................VRYPYIGGKVFLP--------SQKTF----------ENNVM.IFDYNS--------
DPOL_IIV6/578-1226......................VDEKERYRGAEVFDP--------VPGLK----------RNVVP..LDFAS--------
DPOL_MUHVS/543-1050........GGEGDETSEGENSNNSRTVGYQGATVLEP--------ECGFH----------HVPVC.VFDFAS--------
DPOLA_ORYSJ/834-1303..RPDEADPSIDDEGHHVDQGKTKKGPSYAGGLVLEP--------KKGLY----------DKYVL.LLDFNS--------
DPOL_BPT4/383-855................SIIRQVNISPETIRGQFKVHP--------IHEYI----------AGTAPKPSDEYS--------
Q98207_MCV1/494-994........................ARYTYGGGKVFLP--------RQKLF----------DTNVM.VFDYNS--------
DPOL_EHV2/530-1004........................DAEGYQGATVIDP--------SPGFY----------NTPVL.VVDFAS--------
DPOLA_DROME/805-1258...........ATLSGADATMQTKKKAAYAGGLVLEP--------MRGLY----------EKYVL.LMDFNS--------
DPOL_VZVD/597-1136......EEEMDEDESVSPTGTSSGRNVGYKGARVFDP--------DTGFY----------IDPVV.VLDFAS--------
DPOD1_DROME/534-994.......................GSDEQYEGATVIEP--------KRGYY----------ADPIS.TLDFAS--------
DPOL_EBVB9/532-1013........................DRDGYQGATVIQP--------LSGFY----------NSPVL.VVDFAS--------
DPOA_YEAST/792-1248............QNEENADAPVNSKKAKYQGGLVFEP--------EKGLH----------KNYVL.VMDFNS--------
DPOL_SFAVA/492-1090...............FETVAATQKKQLSYSGAYVKDP--------EPGLY----------SMVGS..LDVNN--------
Q9Q8R2_MYXVL/498-996........................NKYPYEGGKVFAP--------KQKMF----------INNVL.IFDYNS--------
DPOD_SCHPO/534-990.......................GTDEQYEGATVIEP--------IKGYY----------DTPIA.TLDFSS--------
DPOZ_YEAST/919-1384.....................VRKQKALECVPLVMEP--------ESAFY----------KSPLI.VLDFQS--------
DPOLA_HUMAN/783-1246..........EEIDGDTNKYKKGRKKAAYAGGLVLDP--------KVGFY----------DKFIL.LLDFNS--------
DPOL_ALHV1/550-1026........................SQEGYQGATVINP--------ISGFY----------NTPVL.VVDFAS--------
DPOD1_SOYBN/511-969......................GSEQGTFEGATVLEA--------RAGFY----------EKPIA.TLDFAS--------
DPOL_SHV21/522-994........................NADGFQGATVINP--------IPGFY----------NNAVL.VVDFAS--------
DPOA_SCHPO/773-1222............AEDGLQEESLGKKKDKYKGGLVFEP--------QKGLY----------ETCIL.VMDFNS--------
B6KU35_TOXGO/1007-1611GEGRDEEEAANEGHREGEEKVGARAKASYAGGLVLEP--------RVGLY----------DTFVL.LLDFNS--------
G8BKE7_CANPC/526-956.......................GSSEEFEGATVIEP--------ERGYY----------DVPIA.TLDFSS--------
DPOL_VACCW/499-994........................QKFPYEGGKVFAP--------KQKMF----------SNNVL.IFDYNS--------
DPOL_ASFB7/457-973.....................GKREHGKYPGAFVIDP--------VKGLE----------QDKPTTGLDFAS--------
DPOL_HHV2H/617-1200DKDDDEDGDEDGDEREEVARETGGRHVGYQGARVLDP--------TSGFH----------VDPVV.VFDFAS--------
DPOL_HHV8P/533-1003........................AVSGYQGATVISP--------SPGFY----------DDPVL.VVDFAS--------
Q57UW4_TRYB2/686-1135...............REDDDDEGKRKTKYQGGMVLEP--------KSGLY----------SEYIL.LLDFNS--------
Q6TVU5_ORFSA/504-1000........................SKFFYEGGRVMVP--------KQKMH----------DKHVL.IFDYNS--------
DPOL_GAHVM/606-1169..HDSPQEPIHNIKQSSLCHSNSGRTIGYQGAKVLDP--------ISGFH----------VDPVM.VFDFAS--------
DPOL_HHV6Z/517-994.....................HNRQGIGYKGATVLEP--------KTGYY----------AVPTV.VFDFQS--------

PF08490

D8PW53_SCHCM/1455-1844------------------------------GCKAYDY--------PAACD----------FTTTF-HGNDAT--------
K1Q2Z7_CRAGI/498-892------------------------------.....LP--------PANHT----------FDYKL-EKDVRQ--------
K5UTI1_PHACS/1501-1886------------------------------SNISFTY--------PDSLD----------FTTTY-HANDFI--------
T1J6P1_STRMM/1470-1868------------------------------.....IP--------EDGYR----------FDIRT-DSNKSN--------
E0VSJ8_PEDHC/1513-1911------------------------------....ELP--------PDDFT----------FEVHA-ETESKN--------
G8BQ26_TETPH/1521-1912------------------------------HYRSINL--------TKDLN----------FEQFS-YTDITK--------
G0T1H4_RHOG2/1536-1927------------------------------EVGAFEY--------ADRMT----------MIVAY-ASNEDV--------
J0M8E9_LOALO/1625-2027------------------------------IVSFLSR--------KADMN----------FTVSQ-CSAVQR--------
B0WNF0_CULQU/1523-1926------------------------------.TEDSLP--------PADMT----------FESFM-EIDQKQ--------
M5E7V9_MALS4/1436-1836------------------------------GEGAFEY--------PATFS----------PQVHI-HTNEIK--------
E3S8N6_PYRTT/1524-1919------------------------------WQAMIEY--------QDDIH----------FKTTM-VTTKRK--------
W1Q6U0_OGAPD/1501-1875------------------------------.SDLINY--------QDQMK----------FETQY-FTDAVK--------
I1G2M3_AMPQE/1495-1895------------------------------GPGYPLP--------PEDFT----------FDVSI-DTEARR--------
Q9VCN1_DROME/1529-1930------------------------------..QDKIP--------VEDYT----------FEVLI-EVDVKQ--------
DPOE_CANGA/1526-1915------------------------------FNKYINL--------SDNVD----------MNSNH-YTDKKK--------
E2B8B2_HARSA/1525-1925------------------------------...ISKL--------PKTMQ----------FVVQG-ETNFQQ--------
J7RME7_KAZNA/1518-1909------------------------------FSRFIDF--------KETVA----------FNLHS-FTDLNK--------
F4S3B6_MELLP/1559-1958------------------------------NPGVFQY--------EPNLQ----------IEAIN-VATEAL--------
DPOE_ASHGO/1493-1878------------------------------FRHYFMP--------AESAK----------FELHH-FTDKSV--------
B6K1H9_SCHJY/1420-1808------------------------------APSCIKY--------GDTIE----------AGVSF-CNSPKQ--------
A0BZJ9_PARTE/1454-1836------------------------------..FEMPI--------PEKNK----------ITVQS-MKDDKL--------
C5DK88_LACTC/1505-1895------------------------------HYDILRY--------PDSID----------VQSHS-FTDLRA--------
H2YP37_CIOSA/1434-1828------------------------------....VLP--------NAGYL----------FEVRV-EVEVKQ--------
M2NL61_BAUCO/1525-1921------------------------------WQKVVEY--------QDFLH----------FKTVQ-VTTQRR--------
U1M0G7_ASCSU/1468-1870------------------------------AASLLER--------KPMLN----------FSTFQ-CSTNKE--------
B0DWP2_LACBS/1522-1912------------------------------PSVSITY--------PTAPK----------FNTAY-HSNDTT--------
R4X9Y3_TAPDE/1534-1914------------------------------GSALFEY--------PTELE----------CSTVT-VNTETR--------
R1GQ63_BOTPV/1519-1912------------------------------WQETFEY--------QAAIH----------FKTVQ-VTTKRK--------
K1VVE5_TRIAC/1494-1883------------------------------AGGAFKY--------PEELN----------STVNY-YPTEAG--------
B3S6C7_TRIAD/1510-1905------------------------------.....LP--------PEKYS----------FQLHI-ETDMRR--------
N1JGF4_BLUG1/1511-1904------------------------------LQTCFEY--------QKKME----------FKTKQ-VTTRRK--------
W4ZAF4_STRPU/37-438------------------------------....LLP--------REDHT----------FEIVV-EKDMKK--------
M5BQD5_THACB/1537-1929------------------------------RTSLYEY--------PEEIE----------TQYMF-HKDEQK--------
M3ALS7_MYCFI/1503-1901------------------------------WQPTFDY--------QESIH----------FKTVQ-VTTQRR--------
I2GW49_TETBL/1546-1937------------------------------DIKLVKL--------SEDMI----------FELDS-FTDISQ--------
F6GW32_VITVI/1705-2088------------------------------SIEPPQP--------RNGIS----------FKVDY-VGYVKD--------
S7ZMV2_PENO1/1499-1887------------------------------SQNAFEY--------QDKIH----------FKTTQ-VMTRRK--------
DPOE_SCHPO/1498-1886------------------------------KESSIEY--------PDTLS----------CNVIF-SGNERK--------
H9J5N5_BOMMO/1546-1951------------------------------....TLP--------GPELS----------WEVVV-ESSTRA--------
H2AUI7_KAZAF/1512-1900------------------------------NTRWVEL--------KETTQ----------FHFTY-FTVLNK--------
I1BIP1_RHIO9/1528-1924------------------------------MDDAVQA--------PNTMD----------FETSY-HSNERE--------
DPOE_CRYNJ/1529-1917------------------------------ERGVFSY--------PDMLD----------FTTSY-HSSESS--------
F8QB37_SERL3/1530-1921------------------------------GSTCIDY--------PKTRE----------FTTTY-HNNDIT--------
G7E3T0_MIXOS/1542-1933------------------------------ARGAFDY--------PEDLT----------FDTSV-YDREDV--------
R9P7N8_PSEHS/1532-1932------------------------------GSGVFEY--------SDTMR----------VDVRV-HTSTAR--------
C1FJ68_MICSR/1644-2054------------------------------DAATQSA--------DGAID----------WTVEY-VKDDES--------
A5DEB2_PICGU/1518-1900------------------------------TSSILDY--------SSTME----------FDTVY-YNDRGK--------
L8G4R0_PSED2/1520-1914------------------------------WQDCFDY--------QDKIQ----------FTTKV-VSTKRK--------
C4QV66_PICPG/1520-1895------------------------------.HTIIQY--------DEQLS----------FDVVD-FTDKNK--------
K1XY13_MARBU/1520-1913------------------------------WQNCFKY--------QAKLQ----------FKTSQ-VTTRRK--------
A7TF62_VANPO/1518-1909------------------------------LSHIIDF--------SEGVK----------FEVQN-FRDITK--------
A5E0L0_LODEL/484-866------------------------------SQRIIEY--------PPKIT----------FEALY-YHDKLK--------
Q7Q7P3_ANOGA/1541-1943------------------------------..EDMLP--------PSDMT----------FEVFM-EIDAKQ--------
G8BGB3_CANPC/1514-1896------------------------------MSRVIDY--------PDEMA----------FDVSY-FHDKLK--------
H9K9J3_APIME/1527-1928------------------------------...VKFL--------PESMQ----------FTLKF-ETNFQQ--------
T1HUW2_RHOPR/1490-1890------------------------------..EHLLP--------PAGVS----------FDVKI-ETDPKQ--------
V5I1Z1_BYSSN/1523-1915------------------------------VQEAFSY--------QEKLH----------FKSTQ-VTTRRK--------
A7SIT9_NEMVE/1502-1904------------------------------.ESFSLP--------PENHT----------FEIRV-DTNARQ--------
DPOE_YARLI/1514-1873------------------------------DCTVFSF--------PDTMQ----------YEVEY-CSNHRR--------
R9AMW8_WALI9/1475-1880------------------------------NDEAFEY--------SSEMS----------FEVTF-HGGEQS--------
D8SJG5_SELML/1443-1816------------------------------MEEFNMD--------TSDVN----------FEIEY-LATYAE--------
S8FUF8_FOMPI/1617-2006------------------------------NSVAYSY--------PDACD----------FTSTY-HGTDVA--------
G1X6W6_ARTOA/1520-1907------------------------------.QGPFEY--------LDTVH----------FKTTY-INKPRL--------
Q17H50_AEDAE/1518-1917------------------------------...DNLP--------PEDLT----------FSIYN-EIDINQ--------
G1RBL5_NOMLE/1514-1911------------------------------.....LP--------PPKHT----------FEVRA-ETDLKT--------
D5GGS6_TUBMM/1460-1851------------------------------GDSMIEY--------PATLH----------FQTTY-VNTKKK--------
H2UTB8_TAKRU/1527-1926------------------------------.....LP--------PEKHN----------FEVRA-ESDIKA--------
G8ZQL0_TORDC/1514-1906------------------------------FSRFFPL--------NEDMD----------FELQA-FADRSK--------
S3BV94_OPHP1/1618-2007------------------------------WRDCFPY--------QDALT----------VKVTQ-VTTRRK--------
G0V590_NAUCC/1533-1922------------------------------FTHLADV--------KEDAS----------FEFSY-FDDIAK--------
K5XRW0_AGABU/1528-1917------------------------------APKSYNY--------VETLD----------ISTTY-HSNDVT--------
E9H7I0_DAPPU/1517-1917------------------------------...SSVP--------ARDYS----------FSIQV-ETDIRQ--------
G3B805_CANTC/1530-1912------------------------------MYNIIEY--------PNEMK----------FNVTY-FNDNSK--------
D6WSX8_TRICA/1501-1896------------------------------....SLP--------PASVT----------FEIRV-ESDLGQ--------
A8NMZ4_COPC7/1518-1909------------------------------KSNTFPY--------PTSLS----------FETVH-HSNDVT--------
G0WD71_NAUDC/1559-1949------------------------------FTHLVDV--------KEDVE----------FNFEY-FTDISK--------
S2J5L9_MUCC1/1535-1930------------------------------TSDTVEI--------LESAE----------FETSY-FPNERE--------
C5GX57_AJEDR/1519-1912------------------------------WQQIFDY--------QDNIH----------FKITQ-VTTRRK--------
E9D9U9_COCPS/1514-1907------------------------------WQQVFEY--------QHALH----------FRTMQ-VTAKRK--------
K7J3X8_NASVI/1487-1888------------------------------...VDSI--------PESMT----------FHVKV-ETDVKV--------
O62218_CAEEL/1468-1869------------------------------RGQLCHT--------SESMP----------FTVKR-FSSNTE--------
V2XXQ2_MONRO/1528-1918------------------------------KSRSLAY--------PESRE----------FNTTY-HSTDLT--------
R7YYU2_CONA1/1520-1913------------------------------WQSTIQY--------QDNIH----------FKTVQ-VTTKRK--------
B6QRD6_PENMQ/1519-1904------------------------------STGAFDY--------QEKVH----------FKTTQ-VTTLRK--------
G6CJ62_DANPL/1482-1880------------------------------....SLP--------NADLS----------WEVVV-ETEPRA--------
G8YP31_PICSO/1529-1911------------------------------LYNIIDY--------PSEMV----------FETSY-FQDMPK--------
S9XA99_SCHCR/1491-1879------------------------------KMSVIDY--------PESIT----------FSVSY-SKNEKK--------
N1PFE7_MYCP1/1521-1915------------------------------WQTIVEY--------QDAIH----------FKSVQ-VTTQRR--------
J4I9U6_FIBRA/1520-1910------------------------------SNVSYTY--------PSTCD----------FTSTY-HGSDLM--------
M7NNI3_PNEMU/1489-1876------------------------------NDSAFEF--------SDSIT----------FKILI-LKNEKK--------
DPOE_YEAST/1528-1919------------------------------YSYLVDI--------KEDIN----------FEFVY-FTDISK--------
M2QWE4_CERS8/1506-1894------------------------------PNISYIY--------PAQCE----------FTSTY-HGTDST--------
G2X166_VERDV/1512-1902------------------------------WQECFPY--------QEKLN----------FKITQ-VTTRRK--------
U4LW68_PYROM/1510-1903------------------------------WKKPFEY--------QEKIH----------FKVST-TDKRNK--------
Q7RWE3_NEUCR/1534-1926------------------------------WQECFPY--------QEKLN----------IKITQ-VTTRRK--------
G4TAK9_PIRID/1551-1940------------------------------QPSVIDY--------TDTME----------FTVSY-HSNDTT--------
H6BPG7_EXODN/1517-1908------------------------------IQDIFQY--------QSNLS----------FKVSQ-VTTKRK--------
C4XXS2_CLAL4/253-635------------------------------LYNFIDY--------MPEMT----------FDTSY-FNNPST--------
DPOE_KLULA/1498-1882------------------------------YYDLIKI--------NKNVS----------FNVND-YTELKR--------
G8JME6_ERECY/1494-1883------------------------------FYDYLKP--------KSRLS----------FDVQS-FTEISK--------
E3L3C9_PUCGT/1547-1947------------------------------EPGVFEY--------DPNML----------VEVTN-VATETL--------
DPOE_EMENI/1496-1885------------------------------AEGAFQY--------QEKIH----------FRTTQ-ITTRRK--------
DPOE_DEBHA/1534-1916------------------------------MYSIIEY--------PDEMK----------FETTY-FHDTAK--------
F4NWW9_BATDJ/1562-1979------------------------------TRGSINY--------PEQLE----------ITTTI-YQTEAR--------
E5RYM0_TRISP/1442-1827------------------------------.....FP--------EEDYT----------FKVTM-ETNVRQ--------
F4PWS2_DICFS/1559-1964------------------------------LNSLSEK--------HPNVK----------FSLEI-GKSIDG--------
K0KG22_WICCF/1507-1890------------------------------LYGIIDY--------QEELE----------FETVY-FEELPK--------
J5JYN7_BEAB2/1524-1910------------------------------WQDCFTY--------QEQVN----------FKITQ-VTTRRK--------
U1GF87_ENDPU/1518-1911------------------------------WQATFQY--------QDKVH----------FKTSQ-VTTKRK--------
C5DYX0_ZYGRC/1500-1892------------------------------YSRFFDL--------KDHMK----------FELHG-FVDIAK--------
F2PJ05_TRIEC/1466-1860------------------------------WQQVFQY--------QDKIH----------FKTTQ-VTTKRK--------
F6WUQ7_CIOIN/1486-1883------------------------------...DVLP--------HPDYQ----------FEARV-DVDVKQ--------
J9M470_ACYPI/1505-1904------------------------------....NIP--------PSDIT----------FEVRV-ETEERQ--------
Q59SM7_CANAL/1519-1901------------------------------VSNVVNY--------PAEMS----------FDVKY-YHESAK--------

PF03175

DPOL_ADEG1/239-749-----LTSG-------AKLSKAA---------------------------------------------------------
Q9QM79_9ADEN/239-780-----FTSG-------AKLSKAA---------------------------------------------------------
Q9YUR6_9ADEN/339-828-----ITH.-------TSLKEAA---------------------------------------------------------
DPOL_ADEB3/263-744-----LTH.-------TSLRNAA---------------------------------------------------------
DPOL_ADECT/392-875-----LTH.-------TSLKNAA---------------------------------------------------------
DPOL_ADEB2/268-751-----LTH.-------TSLRNAA---------------------------------------------------------
DPOL_ADE40/434-918-----LTH.-------TSLRKAA---------------------------------------------------------
DPOL_ADE12/307-791-----LTH.-------TSLRKAA---------------------------------------------------------
DPOL_ADE02/443-927-----LTH.-------TSLRKAA---------------------------------------------------------
Q9WF13_ADE17/336-820-----LTH.-------TSLRKAA---------------------------------------------------------
DPOL_ADE04/438-922-----LTH.-------TSLRKAA---------------------------------------------------------
Q83895_ADEO7/319-798-----LTH.-------SSLRDAA---------------------------------------------------------
O11414_9ADEN/324-802-----LTH.-------TSLRNAA---------------------------------------------------------
DPO2_KLULA/409-871-----FIL.-------TSLDKAS---------------------------------------------------------
Q09038_LACKL/414-876-----FIL.-------TSLDKAA---------------------------------------------------------
DPO1_KLULA/416-866-----FLL.-------CSLANAS---------------------------------------------------------
O74719_DEBHN/419-870-----FLL.-------CSLANAA---------------------------------------------------------
DPOL_BPCP1/57-480-----ILN.-------FSIATMA---------------------------------------------------------
Q96206_BPGA1/50-479-----....-------TTISGMG---------------------------------------------------------
DPOL_BPM2/50-474-----....-------TIISKMG---------------------------------------------------------
DPOL_BPPZA/50-474-----....-------TIISRMG---------------------------------------------------------
DPOL_BPPRD/2-433-----IYA.-------HNGGKFD---------------------------------------------------------
O21376_PICKL/474-939-----VLN.-------ASLRKTS---------------------------------------------------------
Q35599_PHYPO/8-446-----LL..-------KSLQD.S---------------------------------------------------------
O99973_PORPU/80-478-----LLP.-------MSLNDLG---------------------------------------------------------
Q9XNK1_PLEOS/738-1218-----LLP.-------FSLRDLG---------------------------------------------------------
E6ZE21_BETVM/147-562-----LLP.-------GSLDYLS---------------------------------------------------------
DPOM_MAIZE/299-724-----LLK.-------VKLADLA---------------------------------------------------------
Q9TEH5_9PEZI/309-758-----LLP.-------ESLKRLG---------------------------------------------------------
DPOM_NEUCS/366-859-----LLP.-------GSLDKLA---------------------------------------------------------
O78938_AGRAE/67-512-----LLP.-------SSLRKLC---------------------------------------------------------
DPOM_NEUIN/401-859-----ILP.-------DSLDKLS---------------------------------------------------------
DPOM_ASCIM/589-1039-----MLP.-------NSLDNLS---------------------------------------------------------
DPOM_CLAPU/432-888-----LLP.-------RSLRDLC---------------------------------------------------------
DPOM_PODAS/450-889-----ILP.-------DKLDNLA---------------------------------------------------------

PF03337

Q98188_MCV1/6-651.....LAKILFHRASGEDNEDLL---------------------------------------------------------
Q9Q8S1_MYXVL/6-624.....LLDILKKRF..KHDPLIR---------------------------------------------------------
Q070L3_CPRVZ/15-682SHGDCLAKILARRASEQGLAELA---------------------------------------------------------
Q6TUY6_YMTV5/10-640.....LIDILRLKS..KQYHDLN---------------------------------------------------------
Q08FW7_DPV83/7-651.....LIDILIKRA..SSEKEIE---------------------------------------------------------
Q6TVW0_ORFSA/6-637.....FLDILRQRA..ETEPELR---------------------------------------------------------
F12_VACCW/6-635.....LIDIIRKRS..HEQGDIA---------------------------------------------------------
Q8V3R9_SWPV1/5-644.....LIDILKKRF..CNDDNIK---------------------------------------------------------

PF00136

DPOD_YEAST/555-991-----LYP--------SIMMAHN.....LCYTTLCNK...........................................
DPOD1_CAEEL/520-978-----LYP--------SIMIAHN.....LCYTTLLKS...........................................
DPOL_FOWPN/483-977-----LYP--------NVCIYGN.....LSPEKLVCILLNS.......................................
DPOL_IIV6/578-1226-----LYP--------SLIIARN.....MCYSTFVDNDDIPDEMCHVMEWDDHVACSHDPKVIRKNAITEELEKLKKIAN
DPOL_MUHVS/543-1050-----LYP--------SIIMSNN.....LCYSTLLVE...........................................
DPOLA_ORYSJ/834-1303-----LYP--------SIIQEYN.....ICFTTVDRS...........................................
DPOL_BPT4/383-855-----CSP--------NGWMYDKHQEGIIPKEIAKVFFQ.........................................
Q98207_MCV1/494-994-----LYP--------NVCIFGN.....LSPETLVGVVANA.......................................
DPOL_EHV2/530-1004-----LYP--------TIIQAHN.....LCYSTMIPGD..........................................
DPOLA_DROME/805-1258-----LYP--------SIIQEYN.....ICFTTVQQP...........................................
DPOL_VZVD/597-1136-----LYP--------SIIQAHN.....LCFTTLTLNF..........................................
DPOD1_DROME/534-994-----LYP--------SIMMAHN.....LCYTTLVLG...........................................
DPOL_EBVB9/532-1013-----LYP--------SIIQAHN.....LCYSTMITPG..........................................
DPOA_YEAST/792-1248-----LYP--------SIIQEFN.....ICFTTVDR............................................
DPOL_SFAVA/492-1090-----MYP--------TLMIAYN.....LCYSTVVDEHSPSAFTDDHFEYIRWEDHVGCEHDPVQVELKSLRSMFEMKAL
Q9Q8R2_MYXVL/498-996-----LYP--------NVCLFGN.....LSPETLVCVFVAN.......................................
DPOD_SCHPO/534-990-----LYP--------SIMQAHN.....LCYTTLLDSN..........................................
DPOZ_YEAST/919-1384-----LYP--------SIMIGYN.....YCYSTMIGRVRE........................................
DPOLA_HUMAN/783-1246-----LYP--------SIIQEFN.....ICFTTVQRVA..........................................
DPOL_ALHV1/550-1026-----LYP--------SIIQAHN.....LCYSTLIKQQ..........................................
DPOD1_SOYBN/511-969-----LYP--------SIMMAYN.....LCYCTLVIP...........................................
DPOL_SHV21/522-994-----LYP--------SIIQAHN.....LCYSTLIPHH..........................................
DPOA_SCHPO/773-1222-----LYP--------SIIQEYN.....ICFTTVDRS...........................................
B6KU35_TOXGO/1007-1611-----LYP--------SIIQEYN.....VCFSTVKRPVRTRISR....................................
G8BKE7_CANPC/526-956-----LYP--------SIMMAHN.....LCYTTLLNRN..........................................
DPOL_VACCW/499-994-----LYP--------NVCIFGN.....LSPETLVGVVVST.......................................
DPOL_ASFB7/457-973-----LYP--------SLIMAYN.....FSPEKFVASR..........................................
DPOL_HHV2H/617-1200-----LYP--------SIIQAHN.....LCFSTLSLRP..........................................
DPOL_HHV8P/533-1003-----LYP--------SIIQAHN.....LCYSTLIPGD..........................................
Q57UW4_TRYB2/686-1135-----LYP--------SLIQEFN.....VCYTTIDRD...........................................
Q6TVU5_ORFSA/504-1000-----LYP--------NVCIYAN.....LSPETLVGVV..........................................
DPOL_GAHVM/606-1169-----LYP--------SIIQAHN.....LCFTTLVHDD..........................................
DPOL_HHV6Z/517-994-----LYP--------SIMMAHN.....LCYSTLVLDE..........................................

PF08490

D8PW53_SCHCM/1455-1844-----ALK--------AVSRELG---------------------------------------------------------
K1Q2Z7_CRAGI/498-892-----VYR--------SIQRSLS---------------------------------------------------------
K5UTI1_PHACS/1501-1886-----AMK--------AISRELG---------------------------------------------------------
T1J6P1_STRMM/1470-1868-----VHR--------AIQRLLM---------------------------------------------------------
E0VSJ8_PEDHC/1513-1911-----IYK--------SIHNVLN---------------------------------------------------------
G8BQ26_TETPH/1521-1912-----VYK--------KLSQILS---------------------------------------------------------
G0T1H4_RHOG2/1536-1927-----ALR--------HLSRDLD---------------------------------------------------------
J0M8E9_LOALO/1625-2027-----ADR--------IIQRYIR---------------------------------------------------------
B0WNF0_CULQU/1523-1926-----VYQ--------KLSRLLS---------------------------------------------------------
M5E7V9_MALS4/1436-1836-----AFR--------ALMKDVR---------------------------------------------------------
E3S8N6_PYRTT/1524-1919-----ALL--------EIGDVIK---------------------------------------------------------
W1Q6U0_OGAPD/1501-1875-----LYK--------KLNSKLL---------------------------------------------------------
I1G2M3_AMPQE/1495-1895-----ALR--------SIQRLLV---------------------------------------------------------
Q9VCN1_DROME/1529-1930-----IYR--------HIQRALT---------------------------------------------------------
DPOE_CANGA/1526-1915-----LFK--------AINQEFA---------------------------------------------------------
E2B8B2_HARSA/1525-1925-----VCR--------TLQAALT---------------------------------------------------------
J7RME7_KAZNA/1518-1909-----LTR--------HLTVSIG---------------------------------------------------------
F4S3B6_MELLP/1559-1958-----GLK--------ALNRDLS---------------------------------------------------------
DPOE_ASHGO/1493-1878-----LLR--------SLSKVVS---------------------------------------------------------
B6K1H9_SCHJY/1420-1808-----MYK--------SLTDKLS---------------------------------------------------------
A0BZJ9_PARTE/1454-1836-----AID--------YISNNFE---------------------------------------------------------
C5DK88_LACTC/1505-1895-----LYK--------KLSKSIS---------------------------------------------------------
H2YP37_CIOSA/1434-1828-----MYR--------NMQRYLT---------------------------------------------------------
M2NL61_BAUCO/1525-1921-----ALQ--------ELGDAIK---------------------------------------------------------
U1M0G7_ASCSU/1468-1870-----AER--------IVHKYVR---------------------------------------------------------
B0DWP2_LACBS/1522-1912-----ALK--------AVSRELG---------------------------------------------------------
R4X9Y3_TAPDE/1534-1914-----FYK--------AVNEAIR---------------------------------------------------------
R1GQ63_BOTPV/1519-1912-----AHL--------EVADAIK---------------------------------------------------------
K1VVE5_TRIAC/1494-1883-----AMR--------QLAKDLQ---------------------------------------------------------
B3S6C7_TRIAD/1510-1905-----VYR--------TLIRSLI---------------------------------------------------------
N1JGF4_BLUG1/1511-1904-----ALL--------ELGNLIK---------------------------------------------------------
W4ZAF4_STRPU/37-438-----AYR--------TIHRLLL---------------------------------------------------------
M5BQD5_THACB/1537-1929-----LMA--------SLSAELS---------------------------------------------------------
M3ALS7_MYCFI/1503-1901-----ALQ--------ELGDAIK---------------------------------------------------------
I2GW49_TETBL/1546-1937-----LYR--------KLNKSIT---------------------------------------------------------
F6GW32_VITVI/1705-2088-----AEK--------FLQRTIN---------------------------------------------------------
S7ZMV2_PENO1/1499-1887-----AHL--------EVGDLIR---------------------------------------------------------
DPOE_SCHPO/1498-1886-----AYK--------LIDEKLL---------------------------------------------------------
H9J5N5_BOMMO/1546-1951-----LCR--------GLQAALG---------------------------------------------------------
H2AUI7_KAZAF/1512-1900-----LNK--------SLASEIS---------------------------------------------------------
I1BIP1_RHIO9/1528-1924-----ALK--------AINKALL---------------------------------------------------------
DPOE_CRYNJ/1529-1917-----AFK--------ALGKDLQ---------------------------------------------------------
F8QB37_SERL3/1530-1921-----ALK--------AISRELG---------------------------------------------------------
G7E3T0_MIXOS/1542-1933-----AFR--------AVSRELT---------------------------------------------------------
R9P7N8_PSEHS/1532-1932-----AFK--------AITKDLA---------------------------------------------------------
C1FJ68_MICSR/1644-2054-----AGA--------AVSRHLQ---------------------------------------------------------
A5DEB2_PICGU/1518-1900-----LFK--------RIDKDLR---------------------------------------------------------
L8G4R0_PSED2/1520-1914-----ALL--------EVGDLVK---------------------------------------------------------
C4QV66_PICPG/1520-1895-----LLR--------NLNIKCG---------------------------------------------------------
K1XY13_MARBU/1520-1913-----ALL--------EVGDIVK---------------------------------------------------------
A7TF62_VANPO/1518-1909-----LYR--------KLSNSIT---------------------------------------------------------
A5E0L0_LODEL/484-866-----LFK--------KLNQAIG---------------------------------------------------------
Q7Q7P3_ANOGA/1541-1943-----VYQ--------RVTRALS---------------------------------------------------------
G8BGB3_CANPC/1514-1896-----LLK--------KVNQAIG---------------------------------------------------------
H9K9J3_APIME/1527-1928-----VCR--------IIQAAIT---------------------------------------------------------
T1HUW2_RHOPR/1490-1890-----AYR--------HIVAALQ---------------------------------------------------------
V5I1Z1_BYSSN/1523-1915-----AHL--------EIGDLVK---------------------------------------------------------
A7SIT9_NEMVE/1502-1904-----AWR--------AVQRLLM---------------------------------------------------------
DPOE_YARLI/1514-1873-----MLQ--------KVSKACD---------------------------------------------------------
R9AMW8_WALI9/1475-1880-----AVK--------NMFRYLN---------------------------------------------------------
D8SJG5_SELML/1443-1816-----AGR--------RLQRTLH---------------------------------------------------------
S8FUF8_FOMPI/1617-2006-----ALK--------AISRELG---------------------------------------------------------
G1X6W6_ARTOA/1520-1907-----LYR--------NIDDAIK---------------------------------------------------------
Q17H50_AEDAE/1518-1917-----VYK--------RLGSTLA---------------------------------------------------------
G1RBL5_NOMLE/1514-1911-----ICR--------AIQRFLL---------------------------------------------------------
D5GGS6_TUBMM/1460-1851-----LEK--------ELTDLLK---------------------------------------------------------
H2UTB8_TAKRU/1527-1926-----IYR--------ALQRILL---------------------------------------------------------
G8ZQL0_TORDC/1514-1906-----LYR--------KLSLQIN---------------------------------------------------------
S3BV94_OPHP1/1618-2007-----AFL--------EIGDIVK---------------------------------------------------------
G0V590_NAUCC/1533-1922-----LYR--------RLSQDIS---------------------------------------------------------
K5XRW0_AGABU/1528-1917-----ALK--------AISRELG---------------------------------------------------------
E9H7I0_DAPPU/1517-1917-----VYR--------QMNRLLQ---------------------------------------------------------
G3B805_CANTC/1530-1912-----LFK--------KLDKTIA---------------------------------------------------------
D6WSX8_TRICA/1501-1896-----VYK--------TLQKALQ---------------------------------------------------------
A8NMZ4_COPC7/1518-1909-----ALK--------AISRELG---------------------------------------------------------
G0WD71_NAUDC/1559-1949-----LYR--------KISINMN---------------------------------------------------------
S2J5L9_MUCC1/1535-1930-----ALK--------AINKSLS---------------------------------------------------------
C5GX57_AJEDR/1519-1912-----ALL--------EVGDLIK---------------------------------------------------------
E9D9U9_COCPS/1514-1907-----AHL--------EVGDLLR---------------------------------------------------------
K7J3X8_NASVI/1487-1888-----IYT--------QLQNALK---------------------------------------------------------
O62218_CAEEL/1468-1869-----CER--------QLGRALR---------------------------------------------------------
V2XXQ2_MONRO/1528-1918-----ALK--------AISRELG---------------------------------------------------------
R7YYU2_CONA1/1520-1913-----ALL--------EVEDAIK---------------------------------------------------------
B6QRD6_PENMQ/1519-1904-----AIL--------EVGDLVK---------------------------------------------------------
G6CJ62_DANPL/1482-1880-----VYR--------GVQRALQ---------------------------------------------------------
G8YP31_PICSO/1529-1911-----LLK--------KLDSAIS---------------------------------------------------------
S9XA99_SCHCR/1491-1879-----AYK--------LIDERIL---------------------------------------------------------
N1PFE7_MYCP1/1521-1915-----ALQ--------EIGDAVK---------------------------------------------------------
J4I9U6_FIBRA/1520-1910-----ALK--------AISRELG---------------------------------------------------------
M7NNI3_PNEMU/1489-1876-----LYK--------SFSTCLR---------------------------------------------------------
DPOE_YEAST/1528-1919-----LYR--------RLSQETT---------------------------------------------------------
M2QWE4_CERS8/1506-1894-----ALK--------AISRELG---------------------------------------------------------
G2X166_VERDV/1512-1902-----LHL--------ELGDIVK---------------------------------------------------------
U4LW68_PYROM/1510-1903-----LSK--------VLSNIIK---------------------------------------------------------
Q7RWE3_NEUCR/1534-1926-----AFL--------EVGDIVK---------------------------------------------------------
G4TAK9_PIRID/1551-1940-----AMK--------ALNRELG---------------------------------------------------------
H6BPG7_EXODN/1517-1908-----ANL--------AIADVLQ---------------------------------------------------------
C4XXS2_CLAL4/253-635-----LYK--------KLNSVFR---------------------------------------------------------
DPOE_KLULA/1498-1882-----LLK--------DLSKMLQ---------------------------------------------------------
G8JME6_ERECY/1494-1883-----LYR--------SLSKHLE---------------------------------------------------------
E3L3C9_PUCGT/1547-1947-----ALK--------AISRELA---------------------------------------------------------
DPOE_EMENI/1496-1885-----AYL--------EVSDLIK---------------------------------------------------------
DPOE_DEBHA/1534-1916-----IFK--------KMDNCIS---------------------------------------------------------
F4NWW9_BATDJ/1562-1979-----AFA--------AVNTHLN---------------------------------------------------------
E5RYM0_TRISP/1442-1827-----VYR--------SMQRALR---------------------------------------------------------
F4PWS2_DICFS/1559-1964-----AKK--------LVNAQLQ---------------------------------------------------------
K0KG22_WICCF/1507-1890-----LHR--------KLNSFIN---------------------------------------------------------
J5JYN7_BEAB2/1524-1910-----AHL--------EIGDVIK---------------------------------------------------------
U1GF87_ENDPU/1518-1911-----THL--------EVGDLVK---------------------------------------------------------
C5DYX0_ZYGRC/1500-1892-----LYR--------KITSQIN---------------------------------------------------------
F2PJ05_TRIEC/1466-1860-----AHL--------EVGDIIK---------------------------------------------------------
F6WUQ7_CIOIN/1486-1883-----LYR--------NMQRYLS---------------------------------------------------------
J9M470_ACYPI/1505-1904-----VYR--------QIQRTLQ---------------------------------------------------------
Q59SM7_CANAL/1519-1901-----LFK--------KLNQVIG---------------------------------------------------------

PF03175

DPOL_ADEG1/239-749--------------------------------------------------------------------------------
Q9QM79_9ADEN/239-780--------------------------------------------------------------------------------
Q9YUR6_9ADEN/339-828--------------------------------------------------------------------------------
DPOL_ADEB3/263-744--------------------------------------------------------------------------------
DPOL_ADECT/392-875--------------------------------------------------------------------------------
DPOL_ADEB2/268-751--------------------------------------------------------------------------------
DPOL_ADE40/434-918--------------------------------------------------------------------------------
DPOL_ADE12/307-791--------------------------------------------------------------------------------
DPOL_ADE02/443-927--------------------------------------------------------------------------------
Q9WF13_ADE17/336-820--------------------------------------------------------------------------------
DPOL_ADE04/438-922--------------------------------------------------------------------------------
Q83895_ADEO7/319-798--------------------------------------------------------------------------------
O11414_9ADEN/324-802--------------------------------------------------------------------------------
DPO2_KLULA/409-871--------------------------------------------------------------------------------
Q09038_LACKL/414-876--------------------------------------------------------------------------------
DPO1_KLULA/416-866--------------------------------------------------------------------------------
O74719_DEBHN/419-870--------------------------------------------------------------------------------
DPOL_BPCP1/57-480--------------------------------------------------------------------------------
Q96206_BPGA1/50-479--------------------------------------------------------------------------------
DPOL_BPM2/50-474--------------------------------------------------------------------------------
DPOL_BPPZA/50-474--------------------------------------------------------------------------------
DPOL_BPPRD/2-433--------------------------------------------------------------------------------
O21376_PICKL/474-939--------------------------------------------------------------------------------
Q35599_PHYPO/8-446--------------------------------------------------------------------------------
O99973_PORPU/80-478--------------------------------------------------------------------------------
Q9XNK1_PLEOS/738-1218--------------------------------------------------------------------------------
E6ZE21_BETVM/147-562--------------------------------------------------------------------------------
DPOM_MAIZE/299-724--------------------------------------------------------------------------------
Q9TEH5_9PEZI/309-758--------------------------------------------------------------------------------
DPOM_NEUCS/366-859--------------------------------------------------------------------------------
O78938_AGRAE/67-512--------------------------------------------------------------------------------
DPOM_NEUIN/401-859--------------------------------------------------------------------------------
DPOM_ASCIM/589-1039--------------------------------------------------------------------------------
DPOM_CLAPU/432-888--------------------------------------------------------------------------------
DPOM_PODAS/450-889--------------------------------------------------------------------------------

PF03337

Q98188_MCV1/6-651--------------------------------------------------------------------------------
Q9Q8S1_MYXVL/6-624--------------------------------------------------------------------------------
Q070L3_CPRVZ/15-682--------------------------------------------------------------------------------
Q6TUY6_YMTV5/10-640--------------------------------------------------------------------------------
Q08FW7_DPV83/7-651--------------------------------------------------------------------------------
Q6TVW0_ORFSA/6-637--------------------------------------------------------------------------------
F12_VACCW/6-635--------------------------------------------------------------------------------
Q8V3R9_SWPV1/5-644--------------------------------------------------------------------------------

PF00136

DPOD_YEAST/555-991.............................................................ATVERL.............
DPOD1_CAEEL/520-978............................................................PQGVENE.............
DPOL_FOWPN/483-977......................................................NKLESEINMRTIKSKY.........P
DPOL_IIV6/578-1226AKKMYTQGTRTYKKMMCSYLVMENTKEKTEMSKHLKDLDRENNELLNIVNKQTPGYIESIKKKISDLTSE.........R
DPOL_MUHVS/543-1050...........................................................GSPEVPEK.............
DPOLA_ORYSJ/834-1303............................................................ADGNVPN.............
DPOL_BPT4/383-855.......................................................RKDWKKKMFAEEM............
Q98207_MCV1/494-994......................................................HRLDAEINMQELRRRF.........P
DPOL_EHV2/530-1004........................................................RLCLHPHLGPG.............
DPOLA_DROME/805-1258...............................................................VDAD.............
DPOL_VZVD/597-1136..........................................................ETVKRLN.PS............
DPOD1_DROME/534-994............................................................GTREKLRQQ...........
DPOL_EBVB9/532-1013........................................................EEHRLAGLRPGE............
DPOA_YEAST/792-1248.............................................................NKEDID.............
DPOL_SFAVA/492-1090TDKRKR...IGVTAITKYFKPIQGPRIIQKIMDDRYAESTCRYDDGDEFCENDDEKEVIAAIKTPLEMQR.........A
Q9Q8R2_MYXVL/498-996......................................................NKLEAEINKQEIQKMY.........P
DPOD_SCHPO/534-990.........................................................TAELLKLKQDV............
DPOZ_YEAST/919-1384......................................................INLTENNLGVSKFSLP.........R
DPOLA_HUMAN/783-1246..........................................................SEAQKVTEDGE...........
DPOL_ALHV1/550-1026........................................................DLPKFTNLTAN.............
DPOD1_SOYBN/511-969............................................................EDARKLN.............
DPOL_SHV21/522-994........................................................ALHNYPHLKSS.............
DPOA_SCHPO/773-1222...........................................................PSNSDSDD.............
B6KU35_TOXGO/1007-1611..................................................VQATNGPD.........GEIAD.....AFR
G8BKE7_CANPC/526-956...........................................................SIKAFDLK.............
DPOL_VACCW/499-994.....................................................NRLEE........EINNQLLLQKYPPP
DPOL_ASFB7/457-973..........................................................DEAKSLMAKGESL........H
DPOL_HHV2H/617-1200..........................................................EAVAHLEADR............
DPOL_HHV8P/533-1003........................................................SLHLHPHLSPD.............
Q57UW4_TRYB2/686-1135............................................................ENTVSAEV............
Q6TVU5_ORFSA/504-1000..........................................................VSDNRLDAEVAAVDVR..RMFP
DPOL_GAHVM/606-1169..........................................................TNLSNLRPQD............
DPOL_HHV6Z/517-994..........................................................RQIAGLSES.............

PF08490

D8PW53_SCHCM/1455-1844--------------------------------------------------------------------------------
K1Q2Z7_CRAGI/498-892--------------------------------------------------------------------------------
K5UTI1_PHACS/1501-1886--------------------------------------------------------------------------------
T1J6P1_STRMM/1470-1868--------------------------------------------------------------------------------
E0VSJ8_PEDHC/1513-1911--------------------------------------------------------------------------------
G8BQ26_TETPH/1521-1912--------------------------------------------------------------------------------
G0T1H4_RHOG2/1536-1927--------------------------------------------------------------------------------
J0M8E9_LOALO/1625-2027--------------------------------------------------------------------------------
B0WNF0_CULQU/1523-1926--------------------------------------------------------------------------------
M5E7V9_MALS4/1436-1836--------------------------------------------------------------------------------
E3S8N6_PYRTT/1524-1919--------------------------------------------------------------------------------
W1Q6U0_OGAPD/1501-1875--------------------------------------------------------------------------------
I1G2M3_AMPQE/1495-1895--------------------------------------------------------------------------------
Q9VCN1_DROME/1529-1930--------------------------------------------------------------------------------
DPOE_CANGA/1526-1915--------------------------------------------------------------------------------
E2B8B2_HARSA/1525-1925--------------------------------------------------------------------------------
J7RME7_KAZNA/1518-1909--------------------------------------------------------------------------------
F4S3B6_MELLP/1559-1958--------------------------------------------------------------------------------
DPOE_ASHGO/1493-1878--------------------------------------------------------------------------------
B6K1H9_SCHJY/1420-1808--------------------------------------------------------------------------------
A0BZJ9_PARTE/1454-1836--------------------------------------------------------------------------------
C5DK88_LACTC/1505-1895--------------------------------------------------------------------------------
H2YP37_CIOSA/1434-1828--------------------------------------------------------------------------------
M2NL61_BAUCO/1525-1921--------------------------------------------------------------------------------
U1M0G7_ASCSU/1468-1870--------------------------------------------------------------------------------
B0DWP2_LACBS/1522-1912--------------------------------------------------------------------------------
R4X9Y3_TAPDE/1534-1914--------------------------------------------------------------------------------
R1GQ63_BOTPV/1519-1912--------------------------------------------------------------------------------
K1VVE5_TRIAC/1494-1883--------------------------------------------------------------------------------
B3S6C7_TRIAD/1510-1905--------------------------------------------------------------------------------
N1JGF4_BLUG1/1511-1904--------------------------------------------------------------------------------
W4ZAF4_STRPU/37-438--------------------------------------------------------------------------------
M5BQD5_THACB/1537-1929--------------------------------------------------------------------------------
M3ALS7_MYCFI/1503-1901--------------------------------------------------------------------------------
I2GW49_TETBL/1546-1937--------------------------------------------------------------------------------
F6GW32_VITVI/1705-2088--------------------------------------------------------------------------------
S7ZMV2_PENO1/1499-1887--------------------------------------------------------------------------------
DPOE_SCHPO/1498-1886--------------------------------------------------------------------------------
H9J5N5_BOMMO/1546-1951--------------------------------------------------------------------------------
H2AUI7_KAZAF/1512-1900--------------------------------------------------------------------------------
I1BIP1_RHIO9/1528-1924--------------------------------------------------------------------------------
DPOE_CRYNJ/1529-1917--------------------------------------------------------------------------------
F8QB37_SERL3/1530-1921--------------------------------------------------------------------------------
G7E3T0_MIXOS/1542-1933--------------------------------------------------------------------------------
R9P7N8_PSEHS/1532-1932--------------------------------------------------------------------------------
C1FJ68_MICSR/1644-2054--------------------------------------------------------------------------------
A5DEB2_PICGU/1518-1900--------------------------------------------------------------------------------
L8G4R0_PSED2/1520-1914--------------------------------------------------------------------------------
C4QV66_PICPG/1520-1895--------------------------------------------------------------------------------
K1XY13_MARBU/1520-1913--------------------------------------------------------------------------------
A7TF62_VANPO/1518-1909--------------------------------------------------------------------------------
A5E0L0_LODEL/484-866--------------------------------------------------------------------------------
Q7Q7P3_ANOGA/1541-1943--------------------------------------------------------------------------------
G8BGB3_CANPC/1514-1896--------------------------------------------------------------------------------
H9K9J3_APIME/1527-1928--------------------------------------------------------------------------------
T1HUW2_RHOPR/1490-1890--------------------------------------------------------------------------------
V5I1Z1_BYSSN/1523-1915--------------------------------------------------------------------------------
A7SIT9_NEMVE/1502-1904--------------------------------------------------------------------------------
DPOE_YARLI/1514-1873--------------------------------------------------------------------------------
R9AMW8_WALI9/1475-1880--------------------------------------------------------------------------------
D8SJG5_SELML/1443-1816--------------------------------------------------------------------------------
S8FUF8_FOMPI/1617-2006--------------------------------------------------------------------------------
G1X6W6_ARTOA/1520-1907--------------------------------------------------------------------------------
Q17H50_AEDAE/1518-1917--------------------------------------------------------------------------------
G1RBL5_NOMLE/1514-1911--------------------------------------------------------------------------------
D5GGS6_TUBMM/1460-1851--------------------------------------------------------------------------------
H2UTB8_TAKRU/1527-1926--------------------------------------------------------------------------------
G8ZQL0_TORDC/1514-1906--------------------------------------------------------------------------------
S3BV94_OPHP1/1618-2007--------------------------------------------------------------------------------
G0V590_NAUCC/1533-1922--------------------------------------------------------------------------------
K5XRW0_AGABU/1528-1917--------------------------------------------------------------------------------
E9H7I0_DAPPU/1517-1917--------------------------------------------------------------------------------
G3B805_CANTC/1530-1912--------------------------------------------------------------------------------
D6WSX8_TRICA/1501-1896--------------------------------------------------------------------------------
A8NMZ4_COPC7/1518-1909--------------------------------------------------------------------------------
G0WD71_NAUDC/1559-1949--------------------------------------------------------------------------------
S2J5L9_MUCC1/1535-1930--------------------------------------------------------------------------------
C5GX57_AJEDR/1519-1912--------------------------------------------------------------------------------
E9D9U9_COCPS/1514-1907--------------------------------------------------------------------------------
K7J3X8_NASVI/1487-1888--------------------------------------------------------------------------------
O62218_CAEEL/1468-1869--------------------------------------------------------------------------------
V2XXQ2_MONRO/1528-1918--------------------------------------------------------------------------------
R7YYU2_CONA1/1520-1913--------------------------------------------------------------------------------
B6QRD6_PENMQ/1519-1904--------------------------------------------------------------------------------
G6CJ62_DANPL/1482-1880--------------------------------------------------------------------------------
G8YP31_PICSO/1529-1911--------------------------------------------------------------------------------
S9XA99_SCHCR/1491-1879--------------------------------------------------------------------------------
N1PFE7_MYCP1/1521-1915--------------------------------------------------------------------------------
J4I9U6_FIBRA/1520-1910--------------------------------------------------------------------------------
M7NNI3_PNEMU/1489-1876--------------------------------------------------------------------------------
DPOE_YEAST/1528-1919--------------------------------------------------------------------------------
M2QWE4_CERS8/1506-1894--------------------------------------------------------------------------------
G2X166_VERDV/1512-1902--------------------------------------------------------------------------------
U4LW68_PYROM/1510-1903--------------------------------------------------------------------------------
Q7RWE3_NEUCR/1534-1926--------------------------------------------------------------------------------
G4TAK9_PIRID/1551-1940--------------------------------------------------------------------------------
H6BPG7_EXODN/1517-1908--------------------------------------------------------------------------------
C4XXS2_CLAL4/253-635--------------------------------------------------------------------------------
DPOE_KLULA/1498-1882--------------------------------------------------------------------------------
G8JME6_ERECY/1494-1883--------------------------------------------------------------------------------
E3L3C9_PUCGT/1547-1947--------------------------------------------------------------------------------
DPOE_EMENI/1496-1885--------------------------------------------------------------------------------
DPOE_DEBHA/1534-1916--------------------------------------------------------------------------------
F4NWW9_BATDJ/1562-1979--------------------------------------------------------------------------------
E5RYM0_TRISP/1442-1827--------------------------------------------------------------------------------
F4PWS2_DICFS/1559-1964--------------------------------------------------------------------------------
K0KG22_WICCF/1507-1890--------------------------------------------------------------------------------
J5JYN7_BEAB2/1524-1910--------------------------------------------------------------------------------
U1GF87_ENDPU/1518-1911--------------------------------------------------------------------------------
C5DYX0_ZYGRC/1500-1892--------------------------------------------------------------------------------
F2PJ05_TRIEC/1466-1860--------------------------------------------------------------------------------
F6WUQ7_CIOIN/1486-1883--------------------------------------------------------------------------------
J9M470_ACYPI/1505-1904--------------------------------------------------------------------------------
Q59SM7_CANAL/1519-1901--------------------------------------------------------------------------------

PF03175

DPOL_ADEG1/239-749----AAYAL..........DL.CKGHCPYEAIN...EF----------------ISTGRFHADADGFPVERYWEDPSVIA
Q9QM79_9ADEN/239-780----AAYAL..........EL.SKGQCPYEAVN...EH----------------VSIGGYEQDSDGFPVARYWEDPSVIA
Q9YUR6_9ADEN/339-828----KAYNL..........KI.HKGCCPFKAIN...EY----------------MSTNSLSTDSDSFPSEKYWSSKEEYN
DPOL_ADEB3/263-744----AAYAL..........PV.EKGCCPYKAVN...EF----------------YMLGTYRTDADSFPQRDYWSSDEEYL
DPOL_ADECT/392-875----KAYSL..........TV.SKGCCPYQAVN...EF----------------YMLGSYQQDADGFPDLKYWKDQEEYS
DPOL_ADEB2/268-751----GAYEL..........PV.EKGSCPYEAVN...EF----------------YRIGSYQQDEDGFPSLRYWKSSEEYQ
DPOL_ADE40/434-918----QAYTL..........PV.EKGCCPYKAVN...EF----------------YMLGSYRADERGFPAEDYWKDREEYL
DPOL_ADE12/307-791----QAYAL..........PV.EKGCCPYKAVN...QF----------------YMLGSYRADANGFPLEEYWKDKEEYL
DPOL_ADE02/443-927----QAYAL..........PV.EKGCCAYQAVN...QF----------------YMLGSYRSEADGFPIQEYWKDREEFV
Q9WF13_ADE17/336-820----QAYAL..........PV.EKGCCPYKAVN...HF----------------YMLGSYRADDRGFPLREYWKDDEEYA
DPOL_ADE04/438-922----QAYAL..........PV.EKGCCAYKAVN...QF----------------YMLGSYRADQDGFPLEEYWKDREEFL
Q83895_ADEO7/319-798----TAYQL..........SV.SKGYCPYRAIN...DF----------------FMLGEYEKENNGYPVQKYWNSFEEYL
O11414_9ADEN/324-802----TAYQL..........PI.SKGCCPYEAVN...EY----------------LMTGNYEQETNGYPTLKYWNNADEYH
DPO2_KLULA/409-871----KAFNV...........I.NKGEFPHSIIHSWEDL----------------NKILPNWVKIQKRMIEYKDDNKLNIY
Q09038_LACKL/414-876----KAFNV...........I.NKGSFPHSLIKDWPDL----------------QKIYPHWIKTQRKIIEFKHDNKLNIK
DPO1_KLULA/416-866----KAFLN.........EETFKKTDFPHHDLKTADDL----------------YKVYKEWSSVNTEINHVVEKEKLLIT
O74719_DEBHN/419-870----KAFLS.......GNHDF.GKTDFPHHDVRSKADL----------------EKVYRKWRSIDNIIDIEIEKEKLLIS
DPOL_BPCP1/57-480----GLFKM..........PI.AKGTTPLLKHK.....----------------..........................
Q96206_BPGA1/50-479----QWYAV..........DV....CINTRGKN...KN----------------HVVFYDSLKKLPFKVEQIAKGFGLPV
DPOL_BPM2/50-474----QWYMI..........DI....CFGYKGKR...KL----------------HTVIYDSLKKLPFPVKKIAKDFQLPL
DPOL_BPPZA/50-474----QWYMI..........DI....CLGYKGKR...KI----------------HTVIYDSLKKLPFPVKKIAKDFKLTV
DPOL_BPPRD/2-433----FLFLM..........KY.FRGKLKIVNGRILEVE----------------HGIHKFRDSYAILPVPLAASDEKIEI
O21376_PICKL/474-939----QLFEL..........EH.QKGYLPYDWVS.....----------------.TNTNYMGPIPQSFNDDVKAYLLELF
Q35599_PHYPO/8-446----SFYTF...............KQFTYQNIM.....----------------...YSLEISCFLYPKKKILIKD....
O99973_PORPU/80-478----KSFIN.............................----------------....RSKLDINPIFTLERISKEKNFI
Q9XNK1_PLEOS/738-1218----KVFSLKKNSFYNETKNIIGKGNFPHDFIQ.KLGI----------------DKALEYKGLVPDIKYFDNLSEEDYIT
E6ZE21_BETVM/147-562----SNLCP..........ELGNKGSFDHSSMN.....----------------..........................
DPOM_MAIZE/299-724----DSFCP..........ELGGKGSFDHQNVT.....----------------.........VDKLP............
Q9TEH5_9PEZI/309-758----TNFNT..........NI.QKGYFPYDFVN...EN----------------RLEY.....IGEIPNYQYFKNQLTQT
DPOM_NEUCS/366-859----KDHNI...........ITKKGKFPYKFVN...KD----------------NLEYVGLLPDYEYYIDPKKGEMITLF
O78938_AGRAE/67-512----KSFNT..........QT.QKDIFPYLLDD.....----------------.INYIGEVPDYKYFCNLEMEEYNNYK
DPOM_NEUIN/401-859----NFFNN..........KV.KKLFFPHSFLD...DN----------------TIPINYVGKCPDYKYFPKAYTEDFTI
DPOM_ASCIM/589-1039----KAFNI..........EN.KKSVFPLKFTN...GA----------------VTPFNYIGAVPGYEYFYNTPNKKFTK
DPOM_CLAPU/432-888----KDYNI..........DN.PKSYFPYLFSV...DS----------------HLFYTGATPNINYYLDIPKAEYLKLV
DPOM_PODAS/450-889----KSFGT..........EI.QKGLFPYEFVK...SN----------------TLNYVGITPSIEYYKIN......NEV

PF03337

Q98188_MCV1/6-651----RALLQ----------PGEP.PGLSLTDINWWLQT----------------RGLGRYCFMTLSTFRA.RELPRGSLT
Q9Q8S1_MYXVL/6-624----TLQER----------......DYTVSEINYWLYC----------------NGLEAYRFVNYKDEKA....NDSQYT
Q070L3_CPRVZ/15-682----AALAE----------PRAPDALAGAAAANQWLAR----------------HGLERFRVVNYKDAAA..LAARPQAT
Q6TUY6_YMTV5/10-640----EFVLK----------LSKQ.GNVSISEINNCMCL----------------NGMSKYRFFNYKDERF.IEKEKNLYT
Q08FW7_DPV83/7-651----NNIKK----------LDIK.GNVTVSEINYWMCC----------------NGLAKYRFMNYRDDKI....KETSYT
Q6TVW0_ORFSA/6-637----AAFED----------SPPPRDALSMDELNQWLSD----------------VGLYDLRMVSHDAVRR.LGTPLRRQT
F12_VACCW/6-635----LALEQ----------YGIE.NTDSISEINEWLSS----------------KGLACYRFVKFNDYRKQMYRKFSRCT
Q8V3R9_SWPV1/5-644----TIIGS----------MTIC.GNVSVSEINYWMYR----------------NGLYKYRFMNYRDSKI...TKDCEYT

PF00136

DPOD_YEAST/555-991..NLKIDE.----------.DYVITPNGDYFVT..TKR----------------RRGILPIILDELIS......ARKRAK
DPOD1_CAEEL/520-978...DYIR..----------.....TPSGQYFAT..KSK----------------RRGLLPEILEDILA......ARKRAK
DPOL_FOWPN/483-977YPEYVCVSC----------ESRLSDYYSEIIVY..DRR----------------EKGIIPKLLEMFIG......KRKEYK
DPOL_IIV6/578-1226SEITKKLSK----------SVMCVSNRRYRFLKEPKGI----------------LPTIIQNLLDARKNTRTEIKNYKSRL
DPOL_MUHVS/543-1050....DVLR.----------.VEIGDQC.HRFVR..ENV----------------HRSLLAELLVRWLT......QRKLVR
DPOLA_ORYSJ/834-1303......LP.----------................ASK----------------TTGVLPELLKSLVE......RRRMVK
DPOL_BPT4/383-855..NAEAIK.----------.KI.......IMKG..AGS----------------CSTKPEVERYVKFSDDFLNELSNYTE
Q98207_MCV1/494-994EPAFLHVLC----------EARARDGYSEIAVF..DRR----------------RQGIIPKLLGTFME......QRARYK
DPOL_EHV2/530-1004....DYET.----------.FELASGP.VHFVK..KHK----------------AVSLLATLLNVWLA......KRKAIR
DPOLA_DROME/805-1258..ELPTLP.----------.D..............SKT----------------EPGILPLQLKRLVE......SRKEVK
DPOL_VZVD/597-1136....DYAT.----------.FTVGGKR.LFFVR..SNV----------------RESLLGVLLKDWLA......MRKAIR
DPOD1_DROME/534-994.ENLQDD..----------.QVERTPANNYFVK..SEV----------------RRGLLPEILESLLA......ARKRAK
DPOL_EBVB9/532-1013....DYES.----------.FRLTGGV.YHFVK..KHV----------------HESFLASLLTSWLA......KRKAIK
DPOA_YEAST/792-1248..ELPSVP.----------.P........SEVD..QGV----------------LPRLLANLVD..RR.......REVKK
DPOL_SFAVA/492-1090AIRLKVLKS----------RASGGSVLCAKQCVKILKT----------------RRGILPDLVECLLQ......ARKRVR
Q9Q8R2_MYXVL/498-996GPRYISVQC----------EPRSEDLVSEIAVF..DRS----------------VEGIIPKLLKTFLT......ERLKYK
DPOD_SCHPO/534-990.........----------.DYSVTPNGDYFVK..PHV----------------RKGLLPIILADLLN......ARKKAK
DPOZ_YEAST/919-1384NILALLKN.----------.DVTIAPNGVVYAK..TSV----------------RKSTLSKMLTDILD......VRVMIK
DPOLA_HUMAN/783-1246QEQIPELP.----------.D..............PSL----------------EMGILPREIRKLVE......RRKQVK
DPOL_ALHV1/550-1026....DYET.----------.FMISGGP.VHFVK..KHK----------------TESLLASLLKTWLA......KRKSIK
DPOD1_SOYBN/511-969...IPPE..----------.SVNRTPSGETFVK..SNL----------------QKGILPEILEELLT......ARKRAK
DPOL_SHV21/522-994....DYET.----------.FMLSSGP.IHFVK..KHI----------------QASLLSRLLTVWLS......KRKAIR
DPOA_SCHPO/773-1222..QIPDTP.----------.S........ASAN..QGI----------------FPRLIANLVE..RR.......RQIKG
B6KU35_TOXGO/1007-1611EPDDRNLP.----------.HAAEEDVQGIAST..PGL----------------LPRILRQLVQ..........RRRAVK
G8BKE7_CANPC/526-956..EEDYTK.----------.....TPNGDYFVH..ADK----------------KKGILPTILNELLT......ARKKAK
DPOL_VACCW/499-994RYITVHCE.----------.PRLPNLISEIAIF..DRS----------------IEGTIPRLLRTFLA......ERARYK
DPOL_ASFB7/457-973YVS.FHFNN----------RLVEGWFVRHNNVPDKMGL----------------YPKVLIDLLNKRTALKQELKKLGEKK
DPOL_HHV2H/617-1200....DYLE.----------.IEVGGRR.LFFVK..AHV----------------RESLLSILLRDWLA......MRKQIR
DPOL_HHV8P/533-1003....DYET.----------.FVLSGGP.VHFVK..KHK----------------RESLLAKLLTVWLA......KRKEIR
Q57UW4_TRYB2/686-1135...PPPES.----------.LICLSCRAAGLPS..PCL----------------HKCILPKVIRGLVD......SRREIK
Q6TVU5_ORFSA/504-1000APRYIAVPC----------EPRSPELVAEVAIF..DRE----------------AKGIIPMLLRSFLD......ARAKYK
DPOL_GAHVM/606-1169....DYLE.----------.INVQGKL.LRFVK..PHI----------------RESLLAILLKDWLA......MRKAIR
DPOL_HHV6Z/517-994....DILT.----------.VKLGDET.HRFVK..PCV----------------RESVLGSLLKDWLA......KRREVK

PF08490

D8PW53_SCHCM/1455-1844----LIEN------------RG....YTVVISS--SKD................QSYFDRS.VQKLT.------KFPILS
K1Q2Z7_CRAGI/498-892----AYKD------------EK.RGPTYIAIQS--PQD................FQHLTSS.MPGLN.------DFPLVP
K5UTI1_PHACS/1501-1886----LAEN------------QG....LTVVISS--LKE................QTYFDAY.IPKLA.------KFPVLS
T1J6P1_STRMM/1470-1868----AYKN------------EK.RGPTMLVVQS--SKT................FQDWINV.MPALV.------EFPFVP
E0VSJ8_PEDHC/1513-1911----SYKK------------EG.QGATVILLQS--YLD................FNILSAS.IPSLL.------EFPVIT
G8BQ26_TETPH/1521-1912----DIKD------------EK.GLQFLMLIQS--PYI.................MKLLNF.VKYLN.------QVPLIE
G0T1H4_RHOG2/1536-1927----ALSK------------QK.SMASLLVVHS--PKP................RSYFDEK.VRGAA.------NFPLIA
J0M8E9_LOALO/1625-2027----SLLH------------VD.SYPTVIAVQS--RQQ................LSALVKR.LPALD.------SYPLVR
B0WNF0_CULQU/1523-1926----AYKD------------EK.RGPTILCVQT--ALG................LQKLNQL.IPVCL.------EFPETQ
M5E7V9_MALS4/1436-1836----EARS------------GK.QGAPLLALCS--SRP................LSYYDSR.MGLSS.------EMPVLM
E3S8N6_PYRTT/1524-1919----RMKA------------DE.SGPVIVVMQS--PNH.................ALLSHD.VPILK.------DLPILP
W1Q6U0_OGAPD/1501-1875----TLDE------------HS.ASKSLLVVQS--PYS.................SKIARH.LAATA.------QFPCVR
I1G2M3_AMPQE/1495-1895----DYKE------------SH.HGPTVILIQT--HTG................IAELRNA.VPALD.------QFPHVL
Q9VCN1_DROME/1529-1930----TYKQ------------EH.QGPTILCLQT--ALS................ARKLSLA.MPILL.------EFPQAE
DPOE_CANGA/1526-1915----MIKE------------QK.GQQVLLLMQS--PFP.................SLIKKN.IRYST.------QIPIIE
E2B8B2_HARSA/1525-1925----AYKN------------EG.HGATIIINQT--AMD................KVMLTAE.MPLLN.------DFPIVS
J7RME7_KAZNA/1518-1909----KMKE------------EK.GQQFLMLLKS--PSN.................KKLTSK.IKNLR.------TLPVLE
F4S3B6_MELLP/1559-1958----TLKG------------KRIASDYVVMIHS--DKD................YAYYDDG.ITSMS.------RFPTLM
DPOE_ASHGO/1493-1878----SWSE------------LK.GSQLLLLLQS--PTP.................SRLLKS.IRILN.------QLPVVQ
B6K1H9_SCHJY/1420-1808----KFVS------------SK.LGVCTLILET--SEA.................FILKKN.LKILD.------DIPFAV
A0BZJ9_PARTE/1454-1836----TRGQ------------SM....KLCILQS--NKE................LTYLQSQGLQFLCL------KIPTFC
C5DK88_LACTC/1505-1895----QMNE------------EK.GAQCLMLLQS--PYT.................QKLRQT.IKPFR.------QMPLVE
H2YP37_CIOSA/1434-1828----TYKN------------ER.RGPTVVIYQS--SML................LDGMKSK.LPILN.------DFPVIT
M2NL61_BAUCO/1525-1921----KIQK------------ED.SGPTVLVLQS--GSA.................QMLAND.LPVLQ.------SYPLLQ
U1M0G7_ASCSU/1468-1870----GIRE------------LD.TQPMFMTVQT--NET................SAELIRR.IPALG.------DLPLVR
B0DWP2_LACBS/1522-1912----LFED------------KS....FIVVISS--SKD................QSYFDRL.VPKLA.------KFPVLC
R4X9Y3_TAPDE/1534-1914----NMKA------------DR.SGPLAIILSS--PGV.................NELQKR.LPICG.------EHPIMC
R1GQ63_BOTPV/1519-1912----KMRN------------DE.SKPIVLVVRA--ENQ.................KLLAHD.IPILK.------DMPVLP
K1VVE5_TRIAC/1494-1883----SVR.------------...SGLNVIALCS--PFE................HAYYQAR.AAVFS.------EFPVIT
B3S6C7_TRIAD/1510-1905----SYKE------------MR.YGPTILLIQS--PTD................YIKLATY.IPAIN.------DFPVAS
N1JGF4_BLUG1/1511-1904----KIKS------------DE.SKPLILVIQS--PQC.................RSLLHD.VPVLN.------EFPVLS
W4ZAF4_STRPU/37-438----AYKD------------EK.RGPTFISVQS--TLS................NRELARS.IPAME.------DFPLVK
M5BQD5_THACB/1537-1929----VVSD------------KY....YSIILSS--SRD................PEYFDLR.VKNMH.------KFPVIP
M3ALS7_MYCFI/1503-1901----KIQK------------EE.TLPIMLVLQS--HSA.................TMLVHD.LPMLQ.------NLPSLR
I2GW49_TETBL/1546-1937----KVKE------------EK.GIQLILFLQS--PYI.................QKLTRF.LKPLN.------QVPIVK
F6GW32_VITVI/1705-2088----DHRH------------QH.HGPEVAVIEC--PNV..................HLLKSGIRALD.------DLPCVN
S7ZMV2_PENO1/1499-1887----KLRN------------DE.TQPAIMVIQS--QQK.................DRLCHD.IPVLK.------DYPTLA
DPOE_SCHPO/1498-1886----QYFS------------TK.TKNSLLIIES--SLP.................HILKAN.VKQIE.------ELPYIM
H9J5N5_BOMMO/1546-1951----RGRT------------ER.AGPALLAVQA--ALS................LPALTAL.MPGLV.------DYPIVP
H2AUI7_KAZAF/1512-1900----GMKE------------EK.GQQFILFLQS--PYT.................KNILKS.IKHFK.------TLPVIE
I1BIP1_RHIO9/1528-1924----KYQD------------AK.KGKTILAINS--PRS................SVHLIQY.ARMLS.------EFPYIR
DPOE_CRYNJ/1529-1917----AIN.------------...HGLNVIALCS--PFE................HSYYQAK.APVYS.------NFPFIT
F8QB37_SERL3/1530-1921----LLEN------------MS....YSIVVSS--TKE................QTYFDTW.VPKMS.------KFPVLS
G7E3T0_MIXOS/1542-1933----GLHA------------RK.EGPTVLIAYT--PKD................RPFLEEH.LPAAA.------NFPLVM
R9P7N8_PSEHS/1532-1932----TLKS------------VK.QGSAMLALCT--SKD................QSYYESR.IPSVA.------EFPVIR
C1FJ68_MICSR/1644-2054----AYLE------------DP.KGPAVCVVEA--PGDSGVDVVDGSSIRREGVAGRLGAI.IPALA.------RLPVVH
A5DEB2_PICGU/1518-1900----KLEE------------TR.STKALLAIQS--PYA.................NALLSQ.LKSVQ.------DYPTIR
L8G4R0_PSED2/1520-1914----KIKS------------DE.TKPLILVIQS--PQK.................RMLLHD.MPVLA.------DFPVLT
C4QV66_PICPG/1520-1895----EANE------------EK.SSKSLMVIQS--NQC.................TKLVRA.LKNLN.------EQPVIS
K1XY13_MARBU/1520-1913----KMKN------------DE.SKPLMLVVQS--PQR.................RMLIHD.VPILA.------DFPVLP
A7TF62_VANPO/1518-1909----KMKD------------EK.GLQFIMLIQS--PFI.................NKIMNT.VRVIN.------QIPTIH
A5E0L0_LODEL/484-866----KLHE------------SR.SAKALFAIQS--PYA.................DRVLNG.LSSTF.------DFPTVK
Q7Q7P3_ANOGA/1541-1943----AYRD------------EK.RGPTLLCLQT--ALG................LHKLNQH.LPICL.------EFPEVS
G8BGB3_CANPC/1514-1896----KIHE------------SR.SNKALLAIQS--PYI.................SKIVPL.LTSVA.------EFPTIK
H9K9J3_APIME/1527-1928----AYKN------------EG.YSIPIFITQT--ALD................KTALIAQ.MPLLN.------DFPLIS
T1HUW2_RHOPR/1490-1890----VYRD------------EK.KGPTLIAVQS--NRD................IQETTML.LPIIN.------EWPFMS
V5I1Z1_BYSSN/1523-1915----KFRS------------EE.SQPVMLVIQS--QQR.................ERLCHD.IPILK.------EYPLLT
A7SIT9_NEMVE/1502-1904----GYKE------------EK.RGPTMVLVQS--AWD................LSHLTSS.VPVLG.------DFPLVP
DPOE_YARLI/1514-1873----SLSG------------SR.NGQLVFALHS--PD..................RNVDEK.VAALA.------RIPCIR
R9AMW8_WALI9/1475-1880----TLGG------------QR.QGPTIVVLNS--PQS................QSYFSQF.GDGLN.------NYPVIA
D8SJG5_SELML/1443-1816----DYLD------------QF.RRPAVAIVEC--PSM.................ENIVAH.VPAIL.------EVPRVQ
S8FUF8_FOMPI/1617-2006----TMEN------------QS....YTVVISS--SKE................QPYFDAH.VPKLG.------KFPVLS
G1X6W6_ARTOA/1520-1907----KLKS------------EE.QKAFVLVIQS--PYK.................STLCKE.IRSLN.------EFPMLS
Q17H50_AEDAE/1518-1917----SYKA------------EK.RGPTILCAQT--GFS................LQKLNQL.VPACL.------DFPETQ
G1RBL5_NOMLE/1514-1911----AYKE------------ER.RGPTLIAVQS--TWE................LKRLASE.IPVLE.------EFPLVP
D5GGS6_TUBMM/1460-1851----GIRN------------EE.SKPTTLVIQS--PQQ.................RTLVDA.VSILS.------EFPILT
H2UTB8_TAKRU/1527-1926----NYKE------------ER.RGPTLIAMQS--NWE................LKRLASG.MPVLE.------EFPVVP
G8ZQL0_TORDC/1514-1906----KLKE------------EK.GLQFLLLLQS--PFP.................TNLTKR.IKVLG.------QVPVVE
S3BV94_OPHP1/1618-2007----KMRK------------EEIGRPQMLVIQS--SQR.................NMLVHD.VPVLS.------EFPVLP
G0V590_NAUCC/1533-1922----KIKE------------EK.GQQFLFLLQS--PYP.................KKIMKS.VKYLN.------QIPVVE
K5XRW0_AGABU/1528-1917----LLED------------KS....FTVVISS--SKD................DAYFEQQ.LPKLA.------KFPTLS
E9H7I0_DAPPU/1517-1917----TYKD------------EK.RGPTFVAIQS--PQD................LHATASQ.IQTLN.------EFPLVP
G3B805_CANTC/1530-1912----KINE------------SK.SNKALLTIQS--PYT.................DRLLSI.LGSTA.------NFPTVK
D6WSX8_TRICA/1501-1896----FYKD------------EK.KGPTLLAVQS--ALE................PATLRSR.IPLFS.------DFPQVQ
A8NMZ4_COPC7/1518-1909----LLTD------------SS....LMVVISS--NKD................VSYFDRL.VPRLS.------KFPVVA
G0WD71_NAUDC/1559-1949----KLKE------------EK.GQQFLLLLQS--PYS.................KKMMKS.IQFLN.------QVPVVK
S2J5L9_MUCC1/1535-1930----KYLD------------NK.RGKSILAINS--PRS................STYLTSN.ARMLN.------SIPFVR
C5GX57_AJEDR/1519-1912----KFRN------------ES.NQAIMLVVQS--PQR.................RQLMQE.IPIIK.------EHPVLP
E9D9U9_COCPS/1514-1907----KFRN------------ES.SYPTLIVLQS--PHK.................QQLLHE.VSAFK.------DFPVLS
K7J3X8_NASVI/1487-1888----NYKN------------EA.RGGTILILQT--PIA................TSTLINK.MPYLN.------EFPLIK
O62218_CAEEL/1468-1869----VYRE------------VS.SKTAIVLLLS--DTD................PFRLARK.LPNLG.------LFPNVQ
V2XXQ2_MONRO/1528-1918----LHEN------------KS....YTVVLSS--SKD................DDYFIHH.LPKLV.------NFPVLS
R7YYU2_CONA1/1520-1913----KMRR------------DE.NGATVLAIQS--QQH.................RMLTHD.IPSLR.------DYPILP
B6QRD6_PENMQ/1519-1904----KLRN------------EE.SQPVVFVIQS--QQK.................RKLCHD.IPILK.------DYPMLS
G6CJ62_DANPL/1482-1880----RYRD------------ER.CGPTMVALQT--TLS................SHALLAL.MPGLS.------EFPLVP
G8YP31_PICSO/1529-1911----KIDE------------SR.SNKAILAVQS--PYT.................SRILEV.LKSSS.------EYPVIR
S9XA99_SCHCR/1491-1879----QYLS------------AK.TKNSLLVIES--TSP.................ERLKAN.LKQLE.------ELPYTI
N1PFE7_MYCP1/1521-1915----KIQK------------EE.SQPIMLVLQS--HGA.................QMLMHD.LPILQ.------TFPVLK
J4I9U6_FIBRA/1520-1910----LLES------------QA....YMLVISS--SKE................QTYFDTH.IPRLS.------KFPVLS
M7NNI3_PNEMU/1489-1876----EYQT------------ER.HGPTIVVHTL--KY..................DQLSQS.FPILL.------DFPLMK
DPOE_YEAST/1528-1919----KLKE------------ER.GLQFLLLLQS--PFI.................TKLLGT.IRLLN.------QMPIVK
M2QWE4_CERS8/1506-1894----LMEN------------QS....YTVVISS--TKE................PAYFDTN.VEKLA.------KFPVLS
G2X166_VERDV/1512-1902----KLRK------------DE.VKPLMLVIQS--SQR.................NHLISE.VPVLS.------EFPVLA
U4LW68_PYROM/1510-1903----NM.N------------DD.TKPVMVVVQS--AKR.................QLLLDT.VPALS.------EFPILP
Q7RWE3_NEUCR/1534-1926----KLRK------------EE.SGPTMVVIQS--SQR.................NLLVHE.IPILG.------EFPVMP
G4TAK9_PIRID/1551-1940----LAEY------------KA....KILTLAS--RKD................LGYYETG.IAAIS.------NLPVLR
H6BPG7_EXODN/1517-1908----KWRS------------DE.SQPTILLLQT--NSH.................RQLVHD.IRIMK.------EYPILC
C4XXS2_CLAL4/253-635----KFHE------------SR.SNKALLSIQS--PYC.................NKVLDL.LEAAS.------DFPTIK
DPOE_KLULA/1498-1882----NIKE------------EK.GSHTMVILQS--PYT.................HRVAKL.LQPLN.------AFPVVE
G8JME6_ERECY/1494-1883----NLSE------------EK.GFQSILLLQS--PFT.................KKLQKT.IRVLS.------QIPTVE
E3L3C9_PUCGT/1547-1947----LLKG------------QKTGPGYVLMIHS--MKD................LSYYQEK.VLSVS.------KYPVVM
DPOE_EMENI/1496-1885----KLRN------------DE.SLPAIMIIQS--QQR.................SRLCHD.IPILK.------EYPILS
DPOE_DEBHA/1534-1916----KIYE------------SR.SNRALLAVQS--PYT.................TKVLNL.LKSTS.------SFPTIK
F4NWW9_BATDJ/1562-1979----NYFD------------QR.RGATALAIQS--ASS................RKYFENAGITAIR.------SVPIIT
E5RYM0_TRISP/1442-1827----SYHD------------GK.HGPTMVAYIS--SHE................CDQLMSL.ISSLS.------YFPVVK
F4PWS2_DICFS/1559-1964----VYIG------------AR.RGATIVITQ.--...................CSEFMKRDIPALR.------EFPKVA
K0KG22_WICCF/1507-1890----KINE------------ES.PTKPLFVLQS--PTA.................NNLSKS.FKTLS.------DFPVIH
J5JYN7_BEAB2/1524-1910----QMRK------------DE.HRPQMMIIQS--SQR.................NLLVHD.VPVLG.------EFPILP
U1GF87_ENDPU/1518-1911----KWRN------------EE.TKPMLLVIQS--PQQ.................RQLVHD.ITILK.------EYPVLA
C5DYX0_ZYGRC/1500-1892----QQKE------------DK.GFQFLLMLQS--PYS.................SKLLNA.LRVLN.------QVPIIE
F2PJ05_TRIEC/1466-1860----KFRN------------EN.TMPLMVVVQS--PKS.................RQLPRL.ISSLK.------DYPMVS
F6WUQ7_CIOIN/1486-1883----TYKD------------ER.RGPTMIIYQS--TSS................VKKIKSK.LPILH.------DFPIIH
J9M470_ACYPI/1505-1904----SYRD------------EK.RGPTMLVIQS--PID................IQVMLSN.IPIMN.------EFPVVT
Q59SM7_CANAL/1519-1901----KIHE------------SR.SNKAFLAIQS--PYS.................SRILNV.LNTTD.------DFPTIK

PF03175

DPOL_ADEG1/239-749EQKNLWQKEHP------------GQQYDIVQACLEYCMQDVRV-TQK.LAHTLHDSYDAYFQRELGM.EGHFNIF-VR--
Q9QM79_9ADEN/239-780EQKALWRQEHP------------GRPYDIVQACLEYCMQDVRV-TQK.LALTLYDSYDKYFKDELGM.HGDFNIF-LR--
Q9YUR6_9ADEN/339-828EQKEIWLEKKE------------V.KYDIVKELIDYCIKDVKI-TEE.LTKTLLNTFDTFIKEELNL.KCNFNIF-KR--
DPOL_ADEB3/263-744LNKSLWLQENS------------G.AYDIVQRTLDYCAMDVLV-TAE.LVKKLQASYLDFVHTSVGLPHCNFNVL-QR--
DPOL_ADECT/392-875FNKDLWIKEKK------------G.AYDIIQQTLDYCALDVQV-TAQ.LVNKLIESYQIFIKNSVNLPETSFNVF-QR--
DPOL_ADEB2/268-751LNKALWREKNV------------G.AYDIIQQTLHYCVQDVLV-TSA.LVNKLQESYKNFIASQVNLPDASFNIF-QR--
DPOL_ADE40/434-918LNRELWEKKQC------------P.HYDLVRETLDYCALDVLV-TAA.LVQKLRESYAQFIRDAVGLPEASFNVF-QR--
DPOL_ADE12/307-791LNQELWKKKGE------------K.NYNLIGETLNYCALDVLV-TAS.LVEKLRSSYAQFVTDAVGLDAAHFNVF-QR--
DPOL_ADE02/443-927LNRELWKKKGQ------------D.KYDIIKETLDYCALDVQV-TAE.LVNKLRDSYASFVRDAVGLTDASFNVF-QR--
Q9WF13_ADE17/336-820LNRELWEKKGE------------A.GYDIIRETLDYCAMDVLV-TAE.FVAKLQDSYAHFIRDSVRLPHAHFNIF-QR--
DPOL_ADE04/438-922LNRELWKQKGQ------------L.KYDIIQETLDYCALDVLV-TAE.LVAKLQDSYAHFIRDSVGLPHAHFNIF-QR--
Q83895_ADEO7/319-798QNKPKHNQ...------------..KYNLLEEAKEYCIDDVIV-TAQ.LVEKLIEGYQEFCTTSLKL.ECSFNIF-QR--
O11414_9ADEN/324-802QNKIKG.....------------..PYDILKEALIYCIADVKV-TSQ.LTRKLIEGYQSFCNDQIKL.TCQFHIF-QR--
DPO2_KLULA/409-871YKNIEIFENDR------------N.YNTILENAIEYCKVDVLA-MEK.VWIKFKKLLEKNL.......NITVSV.-KT--
Q09038_LACKL/414-876INTTLEEDNIT------------N.NSTIIEKAIEYCSIDVIA-MKQ.VWQKFKKLVKENL.......QISISE.-KT--
DPO1_KLULA/416-866SEHIVNFTKND------------K.SKTLIEWSKDYCRNDVLV-LSK.VWLEFKNAVEDIF.......NCELVD.-QT--
O74719_DEBHN/419-870SHNIINYETDG------------K.SKKLLDWSREYCCNDVIV-LAK.VWLEFKIAVYEIF.......SAKVVD.-QS--
DPOL_BPCP1/57-480...........------------..PEVIKPEWIDYIHVDVAI-LARGIFAMYYE.................ENF-TK--
Q96206_BPGA1/50-479LKGDIDYKKYR------------PVGYVMDDNEIEYLKHDLLI-....VALALRSMFD..............NDF-TS--
DPOL_BPM2/50-474LKGDIDYHTER------------PVGHEITPEEYEYIKNDIEI-IARALDIQFKQGLD.................-.R--
DPOL_BPPZA/50-474LKGDIDYHKER------------PVGYEITPDEYAYIKNDIQI-IAEALLIQFKQGLD.................-.R--
DPOL_BPPRD/2-433DYGKMERETRE------------QHKAEILE....YLKGDCVT-LHK.MVSLFIAEFG.................-MR--
O21376_PICKL/474-939PNGMM......------------..NTKMATKT..YTDTDVRL-LTM.IMDKFKNIMYS.........TARVDLT-KC--
Q35599_PHYPO/8-446...........------------..LYNFFSENIIY..NDVVK-DYK.LLAILYNEIQTAY.......NININRK-YI--
O99973_PORPU/80-478IK.........------------............YLTNDIEM-LRD.IIISFENMVNESY.........NMICH-NN--
Q9XNK1_PLEOS/738-1218EIVNRIKNEEN------------G.VWDCEKELLKYLNGDIDT-LYS.VMYTFGEFIFDKF.........NINIT-RI--
E6ZE21_BETVM/147-562......LENVK------------K.KRDVVIE...YMKQDIRL-LGG.VMQKAQDIYWNLF.........EVDLV-DW--
DPOM_MAIZE/299-724...........------------....SIREDSLTYLKQDILI-TAA.VMQRAKAIIWEEY.........GIDIL-KV--
Q9TEH5_9PEZI/309-758EYDEIKNSPDS------------S.KRDLKKETIKYLEQDIKT-LCE.VLIKFSDEIW..........EERENIT-KC--
DPOM_NEUCS/366-859EWAAMYTN...------------..KWSMRKETIIYLEKDIKA-LYQ.LMMEMSNNTYSTF.........RINIT-RV--
O78938_AGRAE/67-512SNFK.......------------..VWNFREEAIKYCNLDCIS-LYE.ILYKFNTLVFNKF.........ELNIN-KY--
DPOM_NEUIN/401-859EQYQEYANKFK------------NNNWDLKKELIKYCEIDTIA-LYQ.VLVSFQRKIYEKF.........MIDCT-KY--
DPOM_ASCIM/589-1039DDYKKYCKDFN------------N.NWDFNKELKNYCEIDCLA-LHD.ILTLFAKMIHNEF.........SVDIT-RY--
DPOM_CLAPU/432-888KD.........------------..DWDFKDETLEYLNLDLIS-LHQ.VLVKVNKAINFLF.........DIEFT-SC--
DPOM_PODAS/450-889ISQELYNELIV------------P.QWDLRKQTLHYLERDLLS-LLE.IINTYNHYVYKRY.........NVQLT-ES--

PF03337

Q98188_MCV1/6-651LIDDMVVGCLG------------Y-HAIWVKDPERYTRPEIDI.HRYDVQAVAAPENWAP..........LRART-AR--
Q9Q8S1_MYXVL/6-624LIDDMIISYIG------------N-HYIWVKKKEAYQRPEIDV.YPYDLERLSSPSNWTE..........LRP..-NK--
Q070L3_CPRVZ/15-682VVDDMRIRNLG------------Y-YAIWVRDVRVYARPEMDIDYGVSLADLCDLRHWGP..........V..DL-EE--
Q6TUY6_YMTV5/10-640FLDEMNISYIG------------H-HYIWVKDK.NYVRPDLDI.LPYNIKSINFNAEWKK..........L.PMF-NE--
Q08FW7_DPV83/7-651LIDEMIITYIG------------N-HYIWVKDKLSYTRPELDI.LPYDIQSISQKNMWSK..........IYP.Y-NR--
Q6TVW0_ORFSA/6-637LLDLMNVCCVG------------S-YAIWIKDPSAYSRPDTEV.LSHDVHTAASADSWAQPHVHAPSGNSVAAWF-VY--
F12_VACCW/6-635IVDSMIIGHIG------------H-HYIWIKNLETYTRPEIDV.LPFDIKYISRDELWAR..........ISSSL-DQ--
Q8V3R9_SWPV1/5-644MIDEMVITYIG------------N-HYIWVKNK.AYNRPELDI.LPYNVENISLKNNWSK..........IFP.Y-NR--

PF00136

DPOD_YEAST/555-991KDLRDEKDPFK............RDVLNGRQLALKISANSVYG-FTGATVG.KLPCLAISS---------SVTAY-GR--
DPOD1_CAEEL/520-978NDMKNEKDEFK............RMVYNGRQLALKISANSVYG-FTGATVG.KLPCLEISQ---------SVTAF-GR--
DPOL_FOWPN/483-977NLLKTASTTIE............STLYDSLQYIYKIIANSVYG-LMGFSNS.TLYSYSSAK---------TCTTI-GR--
DPOL_IIV6/578-1226ALLMEKENKSKEDIDEITSIENLLPILDKRQNSYKISANSMYG-ATGVRVG.ALPFMPIAM---------CTTYM-GR--
DPOL_MUHVS/543-1050EAMKQCTNEMQ............RMIMDKQQLALKVTCNAFYG-FTGVAAG.MLPCLPIAA---------SITKI-GR--
DPOLA_ORYSJ/834-1303SWLKTASGLK.............RQQFDIQQQALKLTANSMYG-CLGFSNS.RFYAKPLAE---------LITLQ-GR--
DPOL_BPT4/383-855SVLNSLIEECE..........KAATLANTNQLNRKILINSLYG-ALGNIHF.RYYDLRNAT---------AITIF-GQ--
Q98207_MCV1/494-994ALMRAASSGLE............RTLYDSMQYVYKVVANSVYG-LMGFYNS.SLYSYSSAK---------CCTTI-GR--
DPOL_EHV2/530-1004RELATVSDEAV............RTILDKQQLAIKVTCNAVYG-FTGVASG.ILPCLKIAE---------TVTFQ-GR--
DPOLA_DROME/805-1258KLM.AAPDLSP..........ELQMQYHIRQMALKLTANSMYG-CLGFAHS.RFFAQHLAA---------LVTHK-GR--
DPOL_VZVD/597-1136ARIPGSSSDE.............AVLLDKQQAAIKVVCNSVYG-FTGVAQG.FLPCLYVAA---------TVTTI-GR--
DPOD1_DROME/534-994NDLKVETDPFK............RKVLDGRQLALKISANSVYG-FTGAQVG.KLPCLEISG---------SVTAY-GR--
DPOL_EBVB9/532-1013KLLAACEDPRQ............RTILDKQQLAIKCTCNAVYG-FTGVANG.LFPCLSIAE---------TVTLQ-GR--
DPOA_YEAST/792-1248VMK.TETDPHK..........RVQCD..IRQQALKLTANSMYG-CLGYVNS.RFYAKPLAM---------LVTNK-GR--
DPOL_SFAVA/492-1090GNMKSVTDPMA...........R.DILDKSQLAYKVTANSIYG-STGASNG.KLPCQNVAK---------VTTAL-GR--
Q9Q8R2_MYXVL/498-996KMIKETNDVVE............KAIYDSMQYTYKIIANSVYG-LMGFKNS.ALYSYASAK---------SCTAI-GR--
DPOD_SCHPO/534-990ADLKKETDPFK............KAVLDGRQLALKVSANSVYG-FTGATNG.RLPCLAISS---------SVTSY-GR--
DPOZ_YEAST/919-1384KTMNEIGDDNT..........TLKRLLNNKQLALKLLANVTYG-YTSASFSGRMPCSDLAD---------SIVQT-GR--
DPOLA_HUMAN/783-1246QLMKQ.QDLNP..........DLILQYDIRQKALKLTANSMYG-CLGFSYS.RFYAKPLAA---------LVTYK-GR--
DPOL_ALHV1/550-1026KELEQCQDAKM............KTILDKQQLAIKVTCNSVYG-FTGVASG.MLPCLMIAE---------TVTLQ-GR--
DPOD1_SOYBN/511-969ADLKEAKDPLE............KAVLDGRQLALKISANSVYG-FTGATIG.QLPCLEISS---------SVTSY-GR--
DPOL_SHV21/522-994QKLAECEDLDT............KTILDKQQLAIKVTCNAVYG-FTGVASG.LLPCISIAE---------TVTLQ-GR--
DPOA_SCHPO/773-1222LLKDNSATPTQ..........RLQWD..IQQQALKLTANSMYG-CLGYTKS.RFYARPLAV---------LITYK-GR--
B6KU35_TOXGO/1007-1611ASMKGESNPVK............RATQEIKQLALKLTANSIYG-CLGFSRS.RFYAKEIAA---------FITQQ-GR--
G8BKE7_CANPC/526-956TDLKNEKDPFK............KDVLNGRQLALKISANSVYG-FTGATVG.KLPCLAISS---------SVTAF-GR--
DPOL_VACCW/499-994KMLKQATSSTE............KAIYDSMQYTYKIVANSVYG-LMGFRNS.ALYSYASAK---------SCTSI-GR--
DPOL_ASFB7/457-973ECIHESHPGFKEL.......QFRHAMVDAKQKALKIFMNTFYG-EAGNNLS.PFFLLPLAG---------GVTSS-GQ--
DPOL_HHV2H/617-1200SRIPQSTPEE.............AVLLDKQQAAIKVVCNSVYG-FTGVQHG.LLPCLHVAA---------TVTTI-GR--
DPOL_HHV8P/533-1003KTLASCTDPAL............KTILDKQQLAIKVTCNAVYG-FTGVASG.ILPCLNIAE---------TVTLQ-GR--
Q57UW4_TRYB2/686-1135RMMKSERDPGN............LAMLEIRQLALKLTANSMYG-CLGFEYS.RFYAQPLAE---------LVTRQ-GR--
Q6TVU5_ORFSA/504-1000KLMKAAETAVD............REIYNSMQYTYKITANSVYG-LMGFRNS.ALFSYASAK---------SCTAI-GR--
DPOL_GAHVM/606-1169AKIPESCDEI.............AVLLDKQQAAIKVVCNSVYG-FCGVSNG.LLPCIDVAA---------TVTTI-GR--
DPOL_HHV6Z/517-994AEMQNCSDPMM............KLLLDKKQLALKTTCNSVYG-VTGAAHG.LLPCVAIAA---------SVTCL-GR--

PF08490

D8PW53_SCHCM/1455-1844MTKIRQ.AHTL------------DV.FPWQLHVAHKMNARYLA-MGPWLDRLIATAQYFDV---------PIGHL.DG..
K1Q2Z7_CRAGI/498-892IHITDS.DRLY------------SV.LDWQRVGCRRMIQHYLN-VKIILQSMTEQCRYLHI---------PLGNL.PK..
K5UTI1_PHACS/1501-1886MSKAKA.LHSL------------DV.LPWQPAAAQKMIRRYLT-MGAWLDRTIALADYYDV---------PVGHI.DG..
T1J6P1_STRMM/1470-1868IYKNDS.DAIF------------NV.MDWQRVGAKLIIQHFLK-AETILQVLIEHCRYLHI---------PVGNL.PH..
E0VSJ8_PEDHC/1513-1911FHTKDP.DNLY------------AT.LEWQKLGTRIMIHHFLN-SITTLNSVLYQSKFFHA---------PPGNI.PA..
G8BQ26_TETPH/1521-1912LASN...ELSL------------PQ.LNWQTILSKIIVSNLVS-SGSSLHTLITLSHYSNI---------PICNL.KL..
G0T1H4_RHOG2/1536-1927IQSSKA.ENTF------------PTALAWQAPACRRMIQHYLR-AAVWIRERIELADRFDV---------PVCNL.EK..
J0M8E9_LOALO/1625-2027IHASEP.SGLF------------NV.LDWQRIVLRRIIKHYFN-MFLYLHQYVEVSRYLHI---------PIGNI.PE..
B0WNF0_CULQU/1523-1926IHIADD.ASLL------------SG.LEWQRHGARSMVRHFLN-LNHVVEMMLDQCRYFQL---------PIGNM.PA..
M5E7V9_MALS4/1436-1836VPAARA.EDSL------------PA.LGWQPYAARRMVNCYLR-TSLWLVRWIELAAHLDI---------PLGNM.PR..
E3S8N6_PYRTT/1524-1919LHPDES.DKQL------------PP.LGWQAFIARRLVGHYLD-LGSWVAHLLELARYGDI---------PLCNL.ES..
W1Q6U0_OGAPD/1501-1875MGAG...QIHI------------NS.LSWHSLIMKRIINHYLS-VAGWLQKIISLARYSNI---------PLCNL.EI..
I1G2M3_AMPQE/1495-1895IPFIES.DNHY------------LL.LDWQRSASKKMIAQLLN-APTWLHNRLEYARYAHI---------PVGNF.CP..
Q9VCN1_DROME/1529-1930IHISDD.ASLL------------SG.LDWQRQGSRAVIRHFLN-LNNVLDLMLDQCRYFHV---------PIGNM.PP..
DPOE_CANGA/1526-1915LSMN...ILAL------------PQ.LNWQNVMINKLCSYIIS-TSYWVSHLVSLSQHSNV---------PICNI.NL..
E2B8B2_HARSA/1525-1925THVQDV.ENLY------------NM.LEWQKIGAKMMVRHYLK-SQQIIELMAEQCRFFHA---------PIGNI.PA..
J7RME7_KAZNA/1518-1909LATT...PLTL------------PQ.LNWQSNLCSKIINQIFS-CSSWVAHMVKVARYSNI---------PVCNL.QL..
F4S3B6_MELLP/1559-1958IHSNKA.DNKF------------EA.FGWQRYAAERMVQHFLR-ASSFIQERILQAEQFDV---------PVCNF.ES..
DPOE_ASHGO/1493-1878LSTC...ELAF------------PT.LNWQDQLIKKTVSHILQ-LGSWLSNLTILSNYTRI---------PICNL.NL..
B6K1H9_SCHJY/1420-1808IERH...DTAN------------MS.FSWKSTYAKMMIRHYLG-IGPWITHQRQLAAYASI---------PFCNF.EK..
A0BZJ9_PARTE/1454-1836IPNLHR.ESRK------------E..FQWDINTVKQQLESYCK-LRETIAQHIKYCKYVKV---------PLCNLTASNL
C5DK88_LACTC/1505-1895ISSA...ELAL------------PH.LKWQHIVTKKITNHILS-LGKWLQNLMNLSRYSNI---------PICNI.RL..
H2YP37_CIOSA/1434-1828APCKAS.MEYN------------DE.LTWQKEAASEMIEHFLE-SEMVFPRLLSYSKYFHI---------PVGNL.PN..
M2NL61_BAUCO/1525-1921LQPEEN.DKAL------------PP.LGWQSFVAKRLVSHYLD-LGTWISHLVEFARYGNV---------PLCNL.EK..
U1M0G7_ASCSU/1468-1870IHSAEP.TNLL------------DV.LDWQRVVIRRIIKHYFN-SFIYLHDYVEVSRYLRI---------PLGNV.PA..
B0DWP2_LACBS/1522-1912MSQAKG.PHTL------------DI.FPWHSHLAQKMLNRYLS-LGLWLDRMIDLAEYYDV---------PVGHI.EG..
R4X9Y3_TAPDE/1534-1914MPTA...DTLS------------NS.LNWQSIVMKTLVAKFLT-IRSWLEYRIMLSRYGQV---------PICNL.GD..
R1GQ63_BOTPV/1519-1912LQADEA.DKQL------------PP.LGWQSFVARRLVDHYLD-LGTWIAHLIGLARYGDI---------PLCNL.ER..
K1VVE5_TRIAC/1494-1883IKPLREEEPS.------------...LMWLVNTARRMIAQYMK-LSAWIAGQLEIAAHYDV---------PVGNL.GP..
B3S6C7_TRIAD/1510-1905VSSNDS.DNRY------------PI.LDWQRHAVRRMIQHHLN-IEIWLENRLDHARYAHI---------PLGNM.PA..
N1JGF4_BLUG1/1511-1904LKNEIS.DASL------------PL.LAWQLFIAKRLINNYLS-LGSWILHFIELAKYGDI---------PLCNL.ER..
W4ZAF4_STRPU/37-438LHIAES.DNIY------------SV.LDWQRQGSRRLLQHYLN-ADYLLLSYLEQSRYFHI---------PVGNL.PE..
M5BQD5_THACB/1537-1929MLTDRA.AHVV------------TAPLQWQSETVEKLMTQYLS-FDSWLQTAVEQSTYFDV---------PLGNI.GA..
M3ALS7_MYCFI/1503-1901LKANET.DKQL------------PP.LGWQSIVARRLVSHYLD-LGLWISHLLEFARYGNV---------PLGNL.EV..
I2GW49_TETBL/1546-1937VSMS...EVTL------------PP.LNWQGTMTKRISQYLVS-LGSWYAHLLALSKYSNI---------PLCNL.QL..
F6GW32_VITVI/1705-2088IPSNAR.DSHY------------QA.LGWQIVAAKIGMQRCAA-ATQWLNERISLARYAHV---------PLGNF.EP..
S7ZMV2_PENO1/1499-1887VKPEVS.DMDL------------PP.LGWQAFIARRIVTHYLY-LAAWIQHLALLARYGDV---------PLCNL.ET..
DPOE_SCHPO/1498-1886IPRL...ESNI------------QS.LSWKQHIATKMIQHFLA-IGSWLFHRIQLSRFSDI---------PLCNF.ES..
H9J5N5_BOMMO/1546-1951LHVRDV.ETLY------------NT.LEWQRIGARAIVRHYLN-LESVLALTIEQCRYFHV---------PLGNM.PA..
H2AUI7_KAZAF/1512-1900WTMN...ELQL------------PQ.LNWQTGLVSKLVKHLFS-SGYGISHMINIAKYSNI---------PIGNL.QL..
I1BIP1_RHIO9/1528-1924VPTAQQ.DKKF------------DA.LNWVQPMLKRVFKYYME-LGSLVDERLSQARYANV---------PFCNI.PE..
DPOE_CRYNJ/1529-1917YRLGKEEDPG.------------...LMWLLQTSRRMIGLYLR-LSSWLKEQIQIASHFDV---------PIGNL.GA..
F8QB37_SERL3/1530-1921MSKTKA.AHTL------------DV.FPWQTHVAQKLLYRYLS-VGGWLDRLVVLADYYDV---------PIGHI.EG..
G7E3T0_MIXOS/1542-1933IRANKA.DNVL------------PA.LAWQEPASKRMLQHYLR-VSHWLKDRIALAEEFDI---------PLCNL.EG..
R9P7N8_PSEHS/1532-1932IAAAAL.EDDL------------PA.LGWQLYSARRMLQCYLR-ASNWIRGWIELASHFDL---------PVCNM.EK..
C1FJ68_MICSR/1644-2054VPANAADTASM------------PA.IGWQVNAAKTACTRLAA-HGDWLAERVAISRYAHI---------PVGNL.GQ..
A5DEB2_PICGU/1518-1900MGMR...ELKL------------PA.IGWQSLISKRIVNHYFV-LGAWIKNLISISKYGNI---------PLCNL.EI..
L8G4R0_PSED2/1520-1914LPHDKK.DISF------------PP.LGWQAFIAKRIINNYLN-LGSWISELTNLARYGDV---------PLCNL.ER..
C4QV66_PICPG/1520-1895MNLR...ELNL------------SP.LSWKSSVINKIINHYLS-LGAGLKDLISMARYGNI---------PLCNL.NV..
K1XY13_MARBU/1520-1913LKYEIS.DSNL------------PP.LQWQAFIAKRLVNHYLS-LGSWILHLTELARYGDV---------PLCNL.ER..
A7TF62_VANPO/1518-1909LGMK...ELSL------------PQ.LNWQSVLARKICSHILL-CGQWLSHLVELSRYSNI---------PIGNL.QL..
A5E0L0_LODEL/484-866MAVN...ELSL------------PA.VGWQVLISKRVINHYFV-LGSWLQNLIALSRYGGV---------PLCNL.QI..
Q7Q7P3_ANOGA/1541-1943IHIADD.AALL------------SG.LDWQRHGARSMIRHFLN-LGRVLQMMLEQCLYFQL---------PLGNM.PP..
G8BGB3_CANPC/1514-1896MAIS...ELTL------------PA.IGWQVLISKRVMNHYFA-LASWIKNLIALSKYGRV---------PLCNL.QI..
H9K9J3_APIME/1527-1928THVQDI.ENLY------------NT.LEWQKVGAKIMIRHYFK-SQQILELMSEQCRFFHA---------PIGNI.PA..
T1HUW2_RHOPR/1490-1890IYVQES.EPIY------------ST.LDWQRLGSKLMVKHYLN-SEKAIALQAELCRYFHV---------PIGNI.PQ..
V5I1Z1_BYSSN/1523-1915VKPEAA.DMEF------------PP.LGWQSFVAKRLVRRYMY-LGTWIQNLTLLARYGDV---------PVGNL.ES..
A7SIT9_NEMVE/1502-1904LPYSDS.DAQY------------NV.LDWQRHASRRMIRHYLE-VDIYVQAQLEHARYFHV---------PIGNV.ST..
DPOE_YARLI/1514-1873LRPV...PPST------------AA.VGWQRDLVRRLIASFLS-HGANISYLVEMARYAKM---------PLCHV.....
R9AMW8_WALI9/1475-1880VPTSRK.DLSI------------DESLMWLPKISKRMIGMYFR-MSAWIHERIGLAKHYDV---------PVGNI.ER..
D8SJG5_SELML/1443-1816VPWNSR.HSDY------------KL.LGWQPVAAKLAMQRCAA-SPSWLSERIALCRYAHV---------PLGNL.DS..
S8FUF8_FOMPI/1617-2006MPKTKV.AHTL------------DV.FPWQTNVAQKMVNRYLA-MGTWLDRTIALASYYNM---------PIGHI.DG..
G1X6W6_ARTOA/1520-1907LQIDQT.DSSL------------PP.LGWQNFVAKRIVIRYLS-LGSWLSHLIELARYGNV---------PLCNL.VN..
Q17H50_AEDAE/1518-1917IHIMDD.ASLL------------FG.LEWQRNGVRTMIRHYLR-LNPVIDMMLDQCRYFQI---------PLGNM.PF..
G1RBL5_NOMLE/1514-1911ICVAD..KINY------------GV.LDWQRHGARRMIRHYLN-LDTCLSQAFEMSRYFHI---------PIGNL.PE..
D5GGS6_TUBMM/1460-1851LRSDPA.DNSL------------P..LGWQTFVAKRIVTHYLA-LGAWILHLVELARYGRI---------PLCNL.ER..
H2UTB8_TAKRU/1527-1926VHVVD..EISY------------NV.LDWQRLGARRMIRHYLN-LDSCLSQAFDMARYYHL---------PVGNL.PQ..
G8ZQL0_TORDC/1514-1906ITMN...ELDL------------PQ.LQWEVVLSKKMISHFLS-CGSWLSHLVTISQSSSI---------PICNL.KL..
S3BV94_OPHP1/1618-2007LKYDPL.DSSL------------PP.LGWQSVVARRLVSHYLA-LGSWVLHLVGLARYGDV---------PVCNL.ER..
G0V590_NAUCC/1533-1922LASN...ELAL------------PQ.LNWQGVLIKKIVNHLLS-CGSWVSHLITLSQYSNI---------PIGNL.NL..
K5XRW0_AGABU/1528-1917MPKAKA.PHTL------------DV.FPWQTHVAAKLMTRYLT-MGSWIDRLVTLADYYDI---------PMGHI.EG..
E9H7I0_DAPPU/1517-1917IHSTDP.DGLY------------NV.LDWQRVGSKVCLRHFLR-LRTVLDANLEQCRYFHI---------PIGNL.PS..
G3B805_CANTC/1530-1912MNVN...SLSL------------PA.VGWHSLVTKRVVNHFFV-LASWMKNLISLSKYGNI---------PICNL.QA..
D6WSX8_TRICA/1501-1896IHITDE.EELY------------NV.MDWQKIGGRALVRHYLN-SEKVLDLMIEQSRYFHL---------PVGNM.PP..
A8NMZ4_COPC7/1518-1909MSSARN.AHLL------------NS.LPWQSTAGVKILKRYLA-LGPWLDRMIALADYYDV---------PIGHI.EG..
G0WD71_NAUDC/1559-1949LALN...ELNL------------PQ.LNWQNGLIKKLVSHLLS-CGSWVSHLIELAKYSNI---------PIGNL.NL..
S2J5L9_MUCC1/1535-1930IPSLQE.DNRF------------DA.LNWVTSIVNRMIKHYME-LGTWIDEKISQARYSNI---------PFCNI.PD..
C5GX57_AJEDR/1519-1912LRSEAS.DNDL------------PP.LGWQSFVAKQIVMHYLA-LDSWLFHLGELARYGDV---------PICNL.EK..
E9D9U9_COCPS/1514-1907LRSDPS.DNEL------------PR.LGWQPFVAKQIVMHYLA-LDSWISHLIEFARYGDI---------PLCNL.ER..
K7J3X8_NASVI/1487-1888AHIQDL.DNLY------------DT.LDWQRTGSKMLLRHYFK-SEDVLKQLVEQARYFYA---------PVGNL.PP..
O62218_CAEEL/1468-1869LHITEP.SSLL------------NQ.IDWQKVVARRVLQHYFN-SFFFLADYLEWARYLRV---------PIGNL.PA..
V2XXQ2_MONRO/1528-1918MSKAKS.AHTL------------DV.FPWQSHVAQKMLNRYLS-LASWLDRLVVLADYYDI---------PIGHI.EG..
R7YYU2_CONA1/1520-1913LRVDEA.DKKL------------PP.IGWQSVIAKRLVHNYLD-LGQWISHLTELARYGDI---------PLCNL.ER..
B6QRD6_PENMQ/1519-1904VKPEVS.DTDM------------PP.LGWQSFIAKRLLTHYLY-LGSWIQHLKMLARYGDV---------PVCNL.ES..
G6CJ62_DANPL/1482-1880LHVRDV.ETLY------------NT.LEWQRIGARAIVRHYLN-LDSVLELTIEQCRYFHL---------PLGNT.SS..
G8YP31_PICSO/1529-1911MNIS...ELTL------------PA.IGWQSLIIRRAVNHYFV-LATWLRKLISLSRYSNV---------PLCNL.QI..
S9XA99_SCHCR/1491-1879ISRR...EAAI------------QS.LSWKQYVSKKMIQHFLA-VGAWINHRIQLSRYADI---------PLCNF.ES..
N1PFE7_MYCP1/1521-1915LHADED.DKHL------------PP.LGWQSFVAKRFVSHYLD-LGSWIAHLLAFSQYGNV---------PLCNL.EV..
J4I9U6_FIBRA/1520-1910MPKAKV.PHTL------------DV.FPWQTGVAQKLVGRYLT-MGTWLDRSISLANYYDV---------PLGHI.DG..
M7NNI3_PNEMU/1489-1876FPQD...DNNV------------PS.LGWQTYLGKSLITSFLH-LSVFILYRIKLSRYSNI---------PLCEM.SE..
DPOE_YEAST/1528-1919LSLN...EVLL------------PQ.LNWQPTLLKKLVNHVLS-SGSWISHLIKLSQYSNI---------PICNL.RL..
M2QWE4_CERS8/1506-1894MPKAKV.AHTL------------DV.FPWQSSVGHKMLTRYLY-MGTWLDRTIALADYYDV---------PIGHI.EG..
G2X166_VERDV/1512-1902LKYDTT.DSSL------------PP.LGWQTVAARRLVGHYLG-LGSWVMHLMSLARYGDV---------PLCNL.ER..
U4LW68_PYROM/1510-1903LKPDPS.DSNL------------PP.LGWQTFVAKRIVTHYLA-LGSWISHLTDLARYGDV---------PICNL.EK..
Q7RWE3_NEUCR/1534-1926LRYDQG.DSSL------------PP.LGWQSVVARRLVNHYLS-LGSWITHMTALARYGDV---------PLCNL.ER..
G4TAK9_PIRID/1551-1940MASNR..NTSL------------DR.LDWQRVAIQGFLSHYFA-FGEWLRDSIDNSVYYDV---------PIGNT.PT..
H6BPG7_EXODN/1517-1908LPTDQA.DTDL------------PS.LGWQGFAFKQLISHYFN-VGGWLSHLIELARYGDV---------PLCNL.EK..
C4XXS2_CLAL4/253-635LSVG...EISL------------PA.VGWQSLIAKRIVNHYFS-LASWLKNMTSLSSYGKV---------PLCNL.QI..
DPOE_KLULA/1498-1882IATA...ETHL------------PA.LNWQGQLMRKAVNHILS-LGSWISNLITLSKYSNI---------PICNL.KV..
G8JME6_ERECY/1494-1883ISMG...ELIL------------PN.LNWQTLLIKKIVNYILS-LGSWVSNLVSLSKYTNI---------PICNL.KL..
E3L3C9_PUCGT/1547-1947VHSSQA.DNKF------------EA.FGWQRFAAERMVQHYVR-ASSFLRERVAQAEQFDV---------PVANF.EM..
DPOE_EMENI/1496-1885VKPEVS.DMNL------------PP.LGWQSFIAKRLVTHYLY-LSSWVQHLTMLARYGDV---------PLCNL.ES..
DPOE_DEBHA/1534-1916MNVS...ELSL------------PA.VGWQSLIIKRVVNHYFV-LASWIKKLISLAKYGNV---------PLCNL.QI..
F4NWW9_BATDJ/1562-1979VPSHKN.DVQF------------PP.IGWQQHGLRRMFGHFLN-LDDFITDRIKLARYADI---------PLCNI.ES..
E5RYM0_TRISP/1442-1827LRIVDGC....------------...LDWQRVGCKKVVTHFLN-VNSYLTTFKDLCRYMRI---------PLGNV.PT..
F4PWS2_DICFS/1559-1964MPYHDQ.DSNY------------SP.FNWEVHCIKPIATRYEE-VDKWWMHYVGMARYSNI---------PIGNLVGG..
K0KG22_WICCF/1507-1890MNVG...EINV------------PA.IGWQGIVLKRVCNHYLA-LASWIKHLLALAKYGNI---------PLCNL.RA..
J5JYN7_BEAB2/1524-1910LRYDVA.DSSL------------PP.LGWQAVVARRLVGHYLG-LGSWVLHLTALARYGEV---------PLCNL.ER..
U1GF87_ENDPU/1518-1911LRSETS.DSDL------------PP.LGWQAYAARRSVSHYLT-LSSWISHLVELARYGDV---------PLCNL.AC..
C5DYX0_ZYGRC/1500-1892IAMT...ELIL------------PR.LNWQGALNKKLISNILS-CGPRLSHLVTLSQFSNI---------PLCNL.KV..
F2PJ05_TRIEC/1466-1860LRSNAS.DNEL------------PP.LGWQPYAARQIVMHYLA-LDSWINHLLGFARYGSV---------PIGNL.EK..
F6WUQ7_CIOIN/1486-1883IHNNNA.DQFN------------DE.LTWQKDASNIMVDHFLE-SKLIFPRLLSFSKYFHI---------PVANF.PS..
J9M470_ACYPI/1505-1904LHVQDSTASMY------------AQ.MEWQRLGCSLIVNHYLN-SPENINIMLEQCRYLQI---------PLGNL.PA..
Q59SM7_CANAL/1519-1901MNIS...ELSL------------PA.VGWQSLISKRVINHYFV-LGSWIKNLVAFAKYANV---------PLCNL.QI..

PF03175

DPOL_ADEG1/239-749----------PTIPSNTHAFWKQ---------------------------------------------------LT...F
Q9QM79_9ADEN/239-780----------PTIPSNTHAFWKQ---------------------------------------------------LT...F
Q9YUR6_9ADEN/339-828----------PTISSNSHAIFRQ---------------------------------------------------LH...F
DPOL_ADEB3/263-744----------PTISSNSHAIFRQ---------------------------------------------------VV...Y
DPOL_ADECT/392-875----------PTISSNSHAIFKQ---------------------------------------------------IL...Y
DPOL_ADEB2/268-751----------PTISSNSHAIFKQ---------------------------------------------------IL...Y
DPOL_ADE40/434-918----------PTISSNSHAIFRQ---------------------------------------------------IL...Y
DPOL_ADE12/307-791----------PTISSNSHAIFRQ---------------------------------------------------IL...Y
DPOL_ADE02/443-927----------PTISSNSHAIFRQ---------------------------------------------------IV...F
Q9WF13_ADE17/336-820----------PTISSNSHAIFRQ---------------------------------------------------IV...F
DPOL_ADE04/438-922----------PTISSNSHAIFRQ---------------------------------------------------IV...Y
Q83895_ADEO7/319-798----------PTISSNTQALFKQ---------------------------------------------------IF...Y
O11414_9ADEN/324-802----------PTISSNTHALFKQ---------------------------------------------------IL...Y
DPO2_KLULA/409-871----------FTLSQLSMKIMES---------------------------------------------------KL....
Q09038_LACKL/414-876----------FTLSQLSMKIMEA---------------------------------------------------SL...D
DPO1_KLULA/416-866----------MTLAGLSYKLFQA---------------------------------------------------NM....
O74719_DEBHN/419-870----------YTLAGMSFKLFES---------------------------------------------------NL...D
DPOL_BPCP1/57-480----------YTSASEALTEFKR---------------------------------------------------IF....
Q96206_BPGA1/50-479----------MTVGSDALNTYKE---------------------------------------------------ML....
DPOL_BPM2/50-474----------MTAGSDSLKGFKD---------------------------------------------------IL..ST
DPOL_BPPZA/50-474----------MTAGSDDLKGFKD---------------------------------------------------II...T
DPOL_BPPRD/2-433----------LTIGGTAMNELKQ---------------------------------------------------FH....
O21376_PICKL/474-939----------MTISKLALSMYSN---------------------------------------------------MC....
Q35599_PHYPO/8-446----------LSTASLSLRIFKK---------------------------------------------------SF....
O99973_PORPU/80-478----------LTSTSLSYKIFKK---------------------------------------------------YY....
Q9XNK1_PLEOS/738-1218----------RTYSGLAFLIYTS---------------------------------------------------RY...Y
E6ZE21_BETVM/147-562----------ITVASQALGIFRM---------------------------------------------------NF...F
DPOM_MAIZE/299-724----------LTISALALKIFRR---------------------------------------------------VY...Y
Q9TEH5_9PEZI/309-758----------SSLSGLAYLIFKT---------------------------------------------------NY....
DPOM_NEUCS/366-859----------KTASALAFLVYRT---------------------------------------------------IFLPNE
O78938_AGRAE/67-512----------PTLPSLSFALFKT---------------------------------------------------KY....
DPOM_NEUIN/401-859----------PTIPSLAFAIFRK---------------------------------------------------KY....
DPOM_ASCIM/589-1039----------VSLSSITFAIFRT---------------------------------------------------NF....
DPOM_CLAPU/432-888----------ATVSSLANKIFLS---------------------------------------------------KF...Y
DPOM_PODAS/450-889----------LTIARLALNIYLK---------------------------------------------------RY....

PF03337

Q98188_MCV1/6-651----------APMRAMLLYARAS---------------------------------------------------TGCTPP
Q9Q8S1_MYXVL/6-624----------QYLKFITILVNAT---------------------------------------------------ITPNGA
Q070L3_CPRVZ/15-682----------PRARAVPVVCFQT---------------------------------------------------MV.HGR
Q6TUY6_YMTV5/10-640----------QFLNFFTFSINSI---------------------------------------------------ITSTGP
Q08FW7_DPV83/7-651----------HFLKIFSIYVNAI---------------------------------------------------ITPTGP
Q6TVW0_ORFSA/6-637----------RFSSDGTVRLNSI---------------------------------------------------ATNAGP
F12_VACCW/6-635----------THIKTIAVSVYGA---------------------------------------------------ITDNGP
Q8V3R9_SWPV1/5-644----------DLIKIIAISINAV---------------------------------------------------ITPTGP

PF00136

DPOD_YEAST/555-991----------TMILKTKTAVQEKYCI................................KNGY..............----
DPOD1_CAEEL/520-978----------KMIDMTKLEVERIYKKG.............................ALDGKC..............----
DPOL_FOWPN/483-977----------NMITYLDSIMNGAVWENDKLILAD................FPRNIFSGETMFNKELEV...PNMNE----
DPOL_IIV6/578-1226----------KSIVEVSQYLKEL.....................................................----
DPOL_MUHVS/543-1050----------DMLLATAGHIEDRCNRPDFL.......................RTVLGLPPEAID.........PE----
DPOLA_ORYSJ/834-1303----------EILQNTVDLVQNN......................................L..............----
DPOL_BPT4/383-855----------VGIQWIARKINEYLN..................................KVCG............T----
Q98207_MCV1/494-994----------VMITYLDRVVDGATLCAGVLRLAA...............EPRNPLLASAPPRARDVDVSAALGHEL----
DPOL_EHV2/530-1004----------RMLENSKRYIEG.VTPEGL.........................ADILGRRVEC..........AP----
DPOLA_DROME/805-1258----------EILTNTQQLVQK.......................................M..............----
DPOL_VZVD/597-1136----------QMLLSTRDYIHNNWAAFERF.......................ITAFPDIESSVL........SQK----
DPOD1_DROME/534-994----------TMIEMTKNEVESHYTQ................................ANGY..............----
DPOL_EBVB9/532-1013----------TMLERAKAFVEA.LSPANLQ........................ALAPSPDAWAP........LNP----
DPOA_YEAST/792-1248----------EILMNTRQLAES.......................................M..............----
DPOL_SFAVA/492-1090----------MTILQAIEIART.......................................E..............----
Q9Q8R2_MYXVL/498-996----------QMIHYLNSVLNGCKLSSGKFQLAA................YPINPFFQDDRSVDLYAST.NLPTEY----
DPOD_SCHPO/534-990----------QMIEKTKDVVEKRYRI................................ENGY..............----
DPOZ_YEAST/919-1384----------ETLEKAIDIIEK.D....................................ET..............----
DPOLA_HUMAN/783-1246----------EILMHTKEMVQK.......................................M..............----
DPOL_ALHV1/550-1026----------TMLEKTKQFVEN.VTVEYLQ........................KICNFEVQCLP........QHP----
DPOD1_SOYBN/511-969----------QMIEHTKKLVEDKFTT................................LNGY..............----
DPOL_SHV21/522-994----------TMLEKSKIFIEA.MTPDTL.........................QEIVPHIVKH..........EP----
DPOA_SCHPO/773-1222----------EALMNTKELADQ.......................................M..............----
B6KU35_TOXGO/1007-1611----------NILMAAKDKVERI.....................................................----
G8BKE7_CANPC/526-956----------EMIEKTKNEVQER......................................YSKK........NGY----
DPOL_VACCW/499-994----------RMILYLESVLNGAELSNGMLRFANPLSN.......PFYMDDRDINPIVKTSLPI..........DY----
DPOL_ASFB7/457-973----------YNLKLVYNFVINK.....................................................----
DPOL_HHV2H/617-1200----------EMLLATRAYVHARWAEFDQLL......................ADFPEAAGMRA..........PG----
DPOL_HHV8P/533-1003----------KMLERSQAFVEAISPERLA..........................GLLRRPVDV..........SP----
Q57UW4_TRYB2/686-1135----------LALQNTVELIPQI......................................S..............----
Q6TVU5_ORFSA/504-1000----------TMIAYLERTLDGASVCGTRLSLAAAPDNPLLRDEAFAGRAAELEIDAAVAGERT...........E----
DPOL_GAHVM/606-1169----------NMLLTVRDYIHKQWGTRDALL.....................REFPNLSNFMRP...........E----
DPOL_HHV6Z/517-994----------EMLCSTVDYVNSKMQSEQF..........................FCEELGLTASD.......FTG----

PF08490

D8PW53_SCHCM/1455-1844..........DQPLVVSDISFAR---------------------------------------------------RL----
K1Q2Z7_CRAGI/498-892..........DITMFGCDLFFAR---------------------------------------------------HL----
K5UTI1_PHACS/1501-1886..........DQPLLLADIEFAR---------------------------------------------------RL----
T1J6P1_STRMM/1470-1868..........DATLFAADLFFAR---------------------------------------------------YL----
E0VSJ8_PEDHC/1513-1911..........DATLFGTDLFYAR---------------------------------------------------HL----
G8BQ26_TETPH/1521-1912..........HEMNFIIDVLYAR---------------------------------------------------KL----
G0T1H4_RHOG2/1536-1927..........DVPLFLADIDFAR---------------------------------------------------RL----
J0M8E9_LOALO/1625-2027..........DFSTFGPDVLFAR---------------------------------------------------SL----
B0WNF0_CULQU/1523-1926..........DTVLFGADLFYAR---------------------------------------------------HL----
M5E7V9_MALS4/1436-1836..........DFAMFGSDLDLAR---------------------------------------------------RL----
E3S8N6_PYRTT/1524-1919..........NDPRFLIDVAYAR---------------------------------------------------RL----
W1Q6U0_OGAPD/1501-1875..........DNLGYMIDIEYAR---------------------------------------------------KL----
I1G2M3_AMPQE/1495-1895..........DAVVYAADVFYSR---------------------------------------------------HL----
Q9VCN1_DROME/1529-1930..........DTVLFGADLFFAR---------------------------------------------------LL----
DPOE_CANGA/1526-1915..........EKMDFVIDVIYAR---------------------------------------------------RL----
E2B8B2_HARSA/1525-1925..........DPTLFGADLFYAR---------------------------------------------------HL----
J7RME7_KAZNA/1518-1909..........DNMGYVIDVLYAR---------------------------------------------------KL----
F4S3B6_MELLP/1559-1958..........DAASFLMDLEFCK---------------------------------------------------KL----
DPOE_ASHGO/1493-1878..........TNLGYVIDIMYAR---------------------------------------------------RL----
B6K1H9_SCHJY/1420-1808..........DNMQYLLDIEYAR---------------------------------------------------RL----
A0BZJ9_PARTE/1454-1836GKTDVFKTDIEMLNYTTDIFFQR---------------------------------------------------VL----
C5DK88_LACTC/1505-1895..........EKMSFVIDVMYAR---------------------------------------------------RL----
H2YP37_CIOSA/1434-1828..........QPATFVTDLLCAR---------------------------------------------------HL----
M2NL61_BAUCO/1525-1921..........DDPRFLIDITYAR---------------------------------------------------RL----
U1M0G7_ASCSU/1468-1870..........DLSLFAADLFYAR---------------------------------------------------NL----
B0DWP2_LACBS/1522-1912..........DQPLMLSDISFAR---------------------------------------------------RL----
R4X9Y3_TAPDE/1534-1914..........DEAKTVIDLTMAR---------------------------------------------------RL----
R1GQ63_BOTPV/1519-1912..........DDPRFLIDISYAR---------------------------------------------------RL----
K1VVE5_TRIAC/1494-1883..........DPPMLLSDLEFAR---------------------------------------------------RL----
B3S6C7_TRIAD/1510-1905..........DVPLFVNDLFFAR---------------------------------------------------YL----
N1JGF4_BLUG1/1511-1904..........DDPKYLIDIAYAR---------------------------------------------------RL----
W4ZAF4_STRPU/37-438..........DSGIAGADLFFAR---------------------------------------------------HL----
M5BQD5_THACB/1537-1929..........DAPLFFADVDFAR---------------------------------------------------RL----
M3ALS7_MYCFI/1503-1901..........DDPRFLIDIAYAR---------------------------------------------------RL----
I2GW49_TETBL/1546-1937..........DNMGYVIDVIYAR---------------------------------------------------KL----
F6GW32_VITVI/1705-2088..........DWLIFTADLFFSR---------------------------------------------------AL----
S7ZMV2_PENO1/1499-1887..........DDPRFLIDVAYAR---------------------------------------------------RL----
DPOE_SCHPO/1498-1886..........DDIQYSIDVVYSR---------------------------------------------------KL----
H9J5N5_BOMMO/1546-1951..........DPTLFGADLFYAR---------------------------------------------------HL----
H2AUI7_KAZAF/1512-1900..........NNMGYVIDILYAR---------------------------------------------------RL----
I1BIP1_RHIO9/1528-1924..........DPYVFMSDVIFAR---------------------------------------------------TM----
DPOE_CRYNJ/1529-1917..........DIAVFLADIEFAR---------------------------------------------------RL----
F8QB37_SERL3/1530-1921..........DQPLLLSDITFAR---------------------------------------------------RL----
G7E3T0_MIXOS/1542-1933..........DVPIMVADIEYAR---------------------------------------------------RL----
R9P7N8_PSEHS/1532-1932..........DFTIFGADIDFAR---------------------------------------------------RL----
C1FJ68_MICSR/1644-2054..........DWCLHTADTFFAR---------------------------------------------------AL----
A5DEB2_PICGU/1518-1900..........DNLGYLIDVEYAR---------------------------------------------------RL----
L8G4R0_PSED2/1520-1914..........DDPRFLIDIAYAR---------------------------------------------------RL----
C4QV66_PICPG/1520-1895..........EDKSYLIDIQYAR---------------------------------------------------KL----
K1XY13_MARBU/1520-1913..........DDPRFLIDIAYAR---------------------------------------------------RL----
A7TF62_VANPO/1518-1909..........NNIGYIIDILYAR---------------------------------------------------KL----
A5E0L0_LODEL/484-866..........ENMSYLIDVEYAR---------------------------------------------------RL----
Q7Q7P3_ANOGA/1541-1943..........DTVLFGADLFFAR---------------------------------------------------LL----
G8BGB3_CANPC/1514-1896..........ENVGYLIDVEYAR---------------------------------------------------RL----
H9K9J3_APIME/1527-1928..........DPVIFGADLFFAR---------------------------------------------------HL----
T1HUW2_RHOPR/1490-1890..........DTTMFGADLFFAR---------------------------------------------------HL----
V5I1Z1_BYSSN/1523-1915..........EDPRYLIDVSYAR---------------------------------------------------RL----
A7SIT9_NEMVE/1502-1904..........DPTLFAADLFFAR---------------------------------------------------HL----
DPOE_YARLI/1514-1873..........QDTRDVIDVSYAR---------------------------------------------------RL----
R9AMW8_WALI9/1475-1880..........DAPIQLSDISFAR---------------------------------------------------RL----
D8SJG5_SELML/1443-1816..........DWILFTADAFYAR---------------------------------------------------VL----
S8FUF8_FOMPI/1617-2006..........DQPLLLADVDFAR---------------------------------------------------RL----
G1X6W6_ARTOA/1520-1907..........HDPRFLVDIAYAR---------------------------------------------------RL----
Q17H50_AEDAE/1518-1917..........DTVLFGADLFYAR---------------------------------------------------HL----
G1RBL5_NOMLE/1514-1911..........DISTFGSDLFFAR---------------------------------------------------HL----
D5GGS6_TUBMM/1460-1851..........DDPTFLIDIDYAR---------------------------------------------------RL----
H2UTB8_TAKRU/1527-1926..........DVSIFGSDLFLAR---------------------------------------------------HL----
G8ZQL0_TORDC/1514-1906..........DNAGFVIDVLYSR---------------------------------------------------QL----
S3BV94_OPHP1/1618-2007..........DDPRFLIDVAYAR---------------------------------------------------RL----
G0V590_NAUCC/1533-1922..........DNMSYVIDMIYVR---------------------------------------------------RL----
K5XRW0_AGABU/1528-1917..........DQPLHCIDVNFAR---------------------------------------------------KL----
E9H7I0_DAPPU/1517-1917..........DANLFGADLFFAR---------------------------------------------------HL----
G3B805_CANTC/1530-1912..........ENISYLIDIEYAR---------------------------------------------------RL----
D6WSX8_TRICA/1501-1896..........DPALFGSDLFYAR---------------------------------------------------HL----
A8NMZ4_COPC7/1518-1909..........DTPLLLSDITYAR---------------------------------------------------RL----
G0WD71_NAUDC/1559-1949..........DTMNFIIDVLYAR---------------------------------------------------KL----
S2J5L9_MUCC1/1535-1930..........DPYLFISDVLFAR---------------------------------------------------KL----
C5GX57_AJEDR/1519-1912..........DDPKYLIDIAYAR---------------------------------------------------RL----
E9D9U9_COCPS/1514-1907..........DDPKFLIDIAYAR---------------------------------------------------RL----
K7J3X8_NASVI/1487-1888..........DVVIFGADLFYAR---------------------------------------------------HL----
O62218_CAEEL/1468-1869..........DHALFGLDLLFAR---------------------------------------------------NL----
V2XXQ2_MONRO/1528-1918..........DQPLFTADVTFAR---------------------------------------------------RL----
R7YYU2_CONA1/1520-1913..........DDPRFLIDVAYAR---------------------------------------------------RL----
B6QRD6_PENMQ/1519-1904..........DDPRYLIDVSYAR---------------------------------------------------RL----
G6CJ62_DANPL/1482-1880..........DPTQFGADVFFAR---------------------------------------------------HL----
G8YP31_PICSO/1529-1911..........ENMGYLIDMEYAR---------------------------------------------------RL----
S9XA99_SCHCR/1491-1879..........DELQYVIDLLYAR---------------------------------------------------KL----
N1PFE7_MYCP1/1521-1915..........DDPRFLIDIAYAR---------------------------------------------------RL----
J4I9U6_FIBRA/1520-1910..........DQPLLLSDIEFAR---------------------------------------------------KL----
M7NNI3_PNEMU/1489-1876..........DDPKFVIDVTFAR---------------------------------------------------CL----
DPOE_YEAST/1528-1919..........DSMDYIIDVLYAR---------------------------------------------------KL----
M2QWE4_CERS8/1506-1894..........DQPLLLSDIEFAR---------------------------------------------------RL----
G2X166_VERDV/1512-1902..........DDPRFLIDIAYAR---------------------------------------------------RL----
U4LW68_PYROM/1510-1903..........DDPKFLIDIAYAR---------------------------------------------------RL----
Q7RWE3_NEUCR/1534-1926..........DDPRFLIDIAYAR---------------------------------------------------RL----
G4TAK9_PIRID/1551-1940..........DQSLFFMDVAFAR---------------------------------------------------KL----
H6BPG7_EXODN/1517-1908..........DDPRFLIDLAYAR---------------------------------------------------RL----
C4XXS2_CLAL4/253-635..........ETPGYLIDIEYSR---------------------------------------------------RL----
DPOE_KLULA/1498-1882..........DNLGYIIDLMYAR---------------------------------------------------QL----
G8JME6_ERECY/1494-1883..........ENLGYVIDILYSR---------------------------------------------------KL----
E3L3C9_PUCGT/1547-1947..........DAPRSLMDLEFAR---------------------------------------------------RL----
DPOE_EMENI/1496-1885..........DDPRFLIDISYAR---------------------------------------------------RL----
DPOE_DEBHA/1534-1916..........ENMGYLIDIEYAR---------------------------------------------------RL----
F4NWW9_BATDJ/1562-1979..........DYTMFLSDVFMAR---------------------------------------------------RL----
E5RYM0_TRISP/1442-1827..........NPTQYGSDLSYAR---------------------------------------------------HL----
F4PWS2_DICFS/1559-1964..........DYAQMVTDTEFSR---------------------------------------------------LL----
K0KG22_WICCF/1507-1890..........DNIGYLIDIEYAR---------------------------------------------------RL----
J5JYN7_BEAB2/1524-1910..........DDPRYLIDIAYAR---------------------------------------------------RL----
U1GF87_ENDPU/1518-1911..........DDPRFLVDIAYAR---------------------------------------------------RL----
C5DYX0_ZYGRC/1500-1892..........DTMGYIIDILYAR---------------------------------------------------RL----
F2PJ05_TRIEC/1466-1860..........DDPKHLIDILYAR---------------------------------------------------QL----
F6WUQ7_CIOIN/1486-1883..........PLGTFVTDLLCAR---------------------------------------------------HL----
J9M470_ACYPI/1505-1904..........DVTLFASDIFFAR---------------------------------------------------HL----
Q59SM7_CANAL/1519-1901..........ENIGFLVDIEYAR---------------------------------------------------RL----

PF03175

DPOL_ADEG1/239-749SNYVREQRATCPPSVPEPP...............................KKKGRTKKKKQPSPDYVAEVYAPHRPMFKY
Q9QM79_9ADEN/239-780TAYVEEQERAS..TVERPPSKYKRKVALKKNDIKGNPHDADVHDVERASANKNTKKRKKRLPSPEYVAEIYAPHRPMFKY
Q9YUR6_9ADEN/339-828........................................................KQNGTKASTL.PDIVAPSDEMYSF
DPOL_ADEB3/263-744........................................................RSQRPNRSSLGNFLLAPSNEMYDY
DPOL_ADECT/392-875........................................................KAEKPNTHHLSTILMAPSNEMYEY
DPOL_ADEB2/268-751........................................................REVRPNKANLDNVLLAPSHEMYDY
DPOL_ADE40/434-918........................................................RTVKPQRSDLGGSLLAPSHEMYDY
DPOL_ADE12/307-791........................................................RAEKPQRTHLGPNILAPSHELYDY
DPOL_ADE02/443-927........................................................RAEQPARSNLGPDLLAPSHELYDY
Q9WF13_ADE17/336-820........................................................RAEQPQRTNFGPGLLGPSHELYEY
DPOL_ADE04/438-922........................................................RAEKPSRANLGAGLLAPSHELYDY
Q83895_ADEO7/319-798........................................................NEEDHPSEFL.RNLEAPSEKMYDF
O11414_9ADEN/324-802........................................................RAEKGQTEHL.PGLQAPSEKMYDH
DPO2_KLULA/409-871........................................................PKYVK........LYVPTLEEYSK
Q09038_LACKL/414-876........................................................RNIEL.........YVPTSEEYQF
DPO1_KLULA/416-866.........................................................PFDV.......ELRHPNKEDYFN
O74719_DEBHN/419-870........................................................PNIDL.........RHPKKEDYMN
DPOL_BPCP1/57-480........................................................RKSKR...KFRDFFPILDEKVDDF
Q96206_BPGA1/50-479......................................................GVKQWEK.......YFPVLSLKVNSE
DPOL_BPM2/50-474........................................................KKFNK.......VFPKLSLPMDKE
DPOL_BPPZA/50-474T.......................................................KKFKK.......VFPTLSLGLDKE
DPOL_BPPRD/2-433.........................................................PYDP...........VRKGFDEA
O21376_PICKL/474-939........................................................HDETK......KMPLMSSTMDDTF
Q35599_PHYPO/8-446........................................................PEKYR.......LIPHLTRDEDNY
O99973_PORPU/80-478........................................................LKTHK........IEVPKTYYDKF
Q9XNK1_PLEOS/738-1218........................................................DSIKK.......PIFLTTGKIDNY
E6ZE21_BETVM/147-562........................................................NDMDF.......HIHIPNRNEDTF
DPOM_MAIZE/299-724........................................................KDDDD......NWIYIPDDNEAQF
Q9TEH5_9PEZI/309-758........................................................IKDSK.........LSMVKGVAHE
DPOM_NEUCS/366-859VEEENETNSPNNILSLF.......................................DKKEEKKLTPKYFLPKLKGRLERA
O78938_AGRAE/67-512........................................................LKENE........VHMLSGSIATN
DPOM_NEUIN/401-859........................................................LVEDM........IPNIKSKLHNI
DPOM_ASCIM/589-1039........................................................LPENK.......IPNITCTKLHYI
DPOM_CLAPU/432-888........................................................DDKNK......AIPLVKDIDLFND
DPOM_PODAS/450-889........................................................LGDNL.......IPVVLNNSLFTS

PF03337

Q98188_MCV1/6-651EPYMISVYPEGRVF------------------------------------------FDADSGTGVIADFLHWLLSVFTEQ
Q9Q8S1_MYXVL/6-624SVYMITTH.PGRCF------------------------------------------TSFDPKK.LVMDFLRWIRE.SMVN
Q070L3_CPRVZ/15-682EPVAVATYPGGRAY------------------------------------------FDSSCGKRVTEFLLECLAERFDAE
Q6TUY6_YMTV5/10-640SIYMISTY.PGKCF------------------------------------------VNFDSNK.LIITFLGWITE.NMKD
Q08FW7_DPV83/7-651SIYMISVY.PGKCF------------------------------------------IDFDSKK.LISEFLKWVRE.TMNN
Q6TVW0_ORFSA/6-637.............V------------------------------------------FSGDCAKLVVRDFLMWLTT.....
F12_VACCW/6-635MPYMISTY.PGNTF------------------------------------------VNFNSVKNLILNFLDWIKD.IMTS
Q8V3R9_SWPV1/5-644SIYMITTYPPGKTF------------------------------------------INFDSNK.LLSEFFKWLREDIMNN

PF00136

DPOD_YEAST/555-991--------------------------------------------------------KHDAVVV-YGDTDSVMVKFGTTDL
DPOD1_CAEEL/520-978--------------------------------------------------------PADAKVI-YGDTDSVMVKFGVETV
DPOL_FOWPN/483-977--------------------------------------------------------SFKFRSV-YGDTDSIFSEISTKDI
DPOL_IIV6/578-1226--------------------------------------------------------..GGRVV-YGDTDSNYVTFDDVVD
DPOL_MUHVS/543-1050--------------------------------------------------------ALRVKII-YGDTDSVFAAFYGIDK
DPOLA_ORYSJ/834-1303--------------------------------------------------------..NLEVI-YGDTDSIMIHTGLDDI
DPOL_BPT4/383-855--------------------------------------------------------NDEDFIA-AGDTDSVYVCVDK...
Q98207_MCV1/494-994--------------------------------------------------------ELRFRSV-YGDTDSIFLELNLREV
DPOL_EHV2/530-1004--------------------------------------------------------DASFKVI-YGDTDSLFIHCRGYRP
DPOLA_DROME/805-1258--------------------------------------------------------..NYDVV-YGDTDSLMINTNITDY
DPOL_VZVD/597-1136--------------------------------------------------------AYEVKVI-YGDTDSVFIRFKGVSV
DPOD1_DROME/534-994--------------------------------------------------------ENNAVVI-YGDTDSVMVNFGVKTL
DPOL_EBVB9/532-1013--------------------------------------------------------EGQLRVI-YGDTDSLFIECRGFSE
DPOA_YEAST/792-1248--------------------------------------------------------..NLLVV-YGDTDSVMIDTGCDN.
DPOL_SFAVA/492-1090--------------------------------------------------------.RNVTTI-YSDTDSMYVQLQDDPA
Q9Q8R2_MYXVL/498-996--------------------------------------------------------NYDFKGV-YGDTDSVFLEINTNDV
DPOD_SCHPO/534-990--------------------------------------------------------SHDAVVI-YGDTDSVMVKFGVKTL
DPOZ_YEAST/919-1384--------------------------------------------------------.WNAKVV-YGDTDSLFVYLPGKTA
DPOLA_HUMAN/783-1246--------------------------------------------------------..NLEVI-YGDTDSIMINTNSTNL
DPOL_ALHV1/550-1026--------------------------------------------------------NPKFRVV-YGDTDSLFIKCEGFAM
DPOD1_SOYBN/511-969--------------------------------------------------------EHNAEVI-YGDTDSVMVQFGVSAV
DPOL_SHV21/522-994--------------------------------------------------------DAKFRVI-YGDTDSLFVECVGYSV
DPOA_SCHPO/773-1222--------------------------------------------------------..GLQVI-YGDTDSVMLNTNVTD.
B6KU35_TOXGO/1007-1611--------------------------------------------------------.LRLEVV-YGDTDSIMINTGLHDD
G8BKE7_CANPC/526-956--------------------------------------------------------PYDAHVI-YGDTDSVMVKFGYQDL
DPOL_VACCW/499-994--------------------------------------------------------RFRFRSV-YGDTDSVFTEIDSQDV
DPOL_ASFB7/457-973--------------------------------------------------------..GYGIK-YGDTDSLYITCPDSLY
DPOL_HHV2H/617-1200--------------------------------------------------------PYSMRII-YGDTDSIFVLCRGLTA
DPOL_HHV8P/533-1003--------------------------------------------------------DARFKVI-YGDTDSLFICCMGFNM
Q57UW4_TRYB2/686-1135--------------------------------------------------------.PSIRVI-YGDTDSVMIQTGIKDD
Q6TVU5_ORFSA/504-1000--------------------------------------------------------RVGFRSV-YGDTDSVFLEVGASDI
DPOL_GAHVM/606-1169--------------------------------------------------------DYSVSVI-YGDTDSVFIKFKGVDI
DPOL_HHV6Z/517-994--------------------------------------------------------DLKVEVI-YGDTDSIFMSVRNMAN

PF08490

D8PW53_SCHCM/1455-1844--------------------------------------------------------VQQDMVL.WWSP.GENPDLGGIEC
K1Q2Z7_CRAGI/498-892--------------------------------------------------------QKNNHVL.WCSP.TERPDLGGKEA
K5UTI1_PHACS/1501-1886--------------------------------------------------------TAQDILL.WWSP.TDRPDLGGIED
T1J6P1_STRMM/1470-1868--------------------------------------------------------MQNNCVL.WCSS.SDRPDLGGKEV
E0VSJ8_PEDHC/1513-1911--------------------------------------------------------LKNNFVL.WCSD.NELPDFGGTEA
G8BQ26_TETPH/1521-1912--------------------------------------------------------KNEGIVL.WWNDKTPLPDYGGTQK
G0T1H4_RHOG2/1536-1927--------------------------------------------------------SKADCVL.WWSP.AARPDLGGREA
J0M8E9_LOALO/1625-2027--------------------------------------------------------INQGYVL.WASP.LSRPDLGGKEL
B0WNF0_CULQU/1523-1926--------------------------------------------------------LKSNFIL.WWSP.SSRPDLGGREA
M5E7V9_MALS4/1436-1836--------------------------------------------------------QQSDMVL.WWSE.GPRPDLGGRED
E3S8N6_PYRTT/1524-1919--------------------------------------------------------QKDRVIL.WWSG.QAKPDHAGYEK
W1Q6U0_OGAPD/1501-1875--------------------------------------------------------SQANIVL.WWSP.TPNPDLGGVEK
I1G2M3_AMPQE/1495-1895--------------------------------------------------------ARHNHVI.WATP.TDQPDLGGHES
Q9VCN1_DROME/1529-1930--------------------------------------------------------QRHNFVL.WWSA.STRPDLGGREA
DPOE_CANGA/1526-1915--------------------------------------------------------KLDNIIL.WWNEQSPLPDHGGMEN
E2B8B2_HARSA/1525-1925--------------------------------------------------------HRNNFVL.WCSP.TEKPDLGGSEN
J7RME7_KAZNA/1518-1909--------------------------------------------------------RHENIVL.WWNENGPLPDLAGIEK
F4S3B6_MELLP/1559-1958--------------------------------------------------------TRSDHIL.WWSS.SPKPDLGGREN
DPOE_ASHGO/1493-1878--------------------------------------------------------KLENIVL.WWNQKQPLPDRGGIQN
B6K1H9_SCHJY/1420-1808--------------------------------------------------------TEKQIIL.WWNK.NPLPDLGGLEH
A0BZJ9_PARTE/1454-1836--------------------------------------------------------RQKTSCLSWYGS........GLGR
C5DK88_LACTC/1505-1895--------------------------------------------------------KKDNIVL.WWNDVYPLPDHGGSEK
H2YP37_CIOSA/1434-1828--------------------------------------------------------RKHNHLL.WCSP.SDQPDLGGVEV
M2NL61_BAUCO/1525-1921--------------------------------------------------------QKERVVL.WWSQ.GARPDHAGHEK
U1M0G7_ASCSU/1468-1870--------------------------------------------------------CRYGYVL.WASP.TRRPDLGGKEL
B0DWP2_LACBS/1522-1912--------------------------------------------------------VQQDIVL.WWSP.GDQPDLGGIEH
R4X9Y3_TAPDE/1534-1914--------------------------------------------------------RSEDVVL.WWSG.APQPDQGGREQ
R1GQ63_BOTPV/1519-1912--------------------------------------------------------QKEKVVL.WWSE.GPKPDHAGYEK
K1VVE5_TRIAC/1494-1883--------------------------------------------------------QAADMVL.WWSP.SPRPDLGGSEE
B3S6C7_TRIAD/1510-1905--------------------------------------------------------AKNNHLI.WASR.TPRPDLGGKED
N1JGF4_BLUG1/1511-1904--------------------------------------------------------QRNNVVL.WWSA.GPRPDHAGYEK
W4ZAF4_STRPU/37-438--------------------------------------------------------NKHGHVM.WASP.TNRPDLGGKEA
M5BQD5_THACB/1537-1929--------------------------------------------------------WQNDSLL.WWSP.GLRPDLGGMEH
M3ALS7_MYCFI/1503-1901--------------------------------------------------------QKEKVVL.WWSQ.DARPDHAGHER
I2GW49_TETBL/1546-1937--------------------------------------------------------KREGIII.WWNENGPLPDLGGKQK
F6GW32_VITVI/1705-2088--------------------------------------------------------RDQQQVL.WISD.NGIPDLGGLNE
S7ZMV2_PENO1/1499-1887--------------------------------------------------------QQSNVVL.WWSN.GPRPDHAGFEK
DPOE_SCHPO/1498-1886--------------------------------------------------------KEHNIIL.WWNK.GPTPDLGGIEK
H9J5N5_BOMMO/1546-1951--------------------------------------------------------VKHNFVL.WCSN.LERPDLGGREI
H2AUI7_KAZAF/1512-1900--------------------------------------------------------KHESVVL.WWNEDSPLPDHAGVEK
I1BIP1_RHIO9/1528-1924--------------------------------------------------------IQNDMII.WWST.TKLPDLGGREE
DPOE_CRYNJ/1529-1917--------------------------------------------------------KQQDMLI.WWSS.TPRPDLGGSEE
F8QB37_SERL3/1530-1921--------------------------------------------------------IQQDTVL.WWSP.SERPDLGGLED
G7E3T0_MIXOS/1542-1933--------------------------------------------------------ISADLLL.WWSP.RAKPDLGGRDE
R9P7N8_PSEHS/1532-1932--------------------------------------------------------VKQDMVL.WWSP.HPQPDLGGREQ
C1FJ68_MICSR/1644-2054--------------------------------------------------------RDSSQLL.WTGP.GGVPDLGGGSG
A5DEB2_PICGU/1518-1900--------------------------------------------------------SMNNVVL.WWSP.KALPDHGGFEN
L8G4R0_PSED2/1520-1914--------------------------------------------------------EKNNVVL.WWSS.GPRPDHAGYEK
C4QV66_PICPG/1520-1895--------------------------------------------------------IELGIVL.WWSP.NPLPDHGGFEL
K1XY13_MARBU/1520-1913--------------------------------------------------------QKNNVVL.WWSG.GPRPDHAGYEQ
A7TF62_VANPO/1518-1909--------------------------------------------------------KSESIVL.WWNENSPLADIGGIQK
A5E0L0_LODEL/484-866--------------------------------------------------------IENNIVL.WWSP.NPLPDHGGFEN
Q7Q7P3_ANOGA/1541-1943--------------------------------------------------------HRHNFVL.WFSG.GARPDLGGREA
G8BGB3_CANPC/1514-1896--------------------------------------------------------TENNIVL.WWSP.NPLPDHGGFEM
H9K9J3_APIME/1527-1928--------------------------------------------------------QKNNFVL.WCSP.TEKPDLGGSEH
T1HUW2_RHOPR/1490-1890--------------------------------------------------------LKNNFVL.WCSE.SDRPDLGGREA
V5I1Z1_BYSSN/1523-1915--------------------------------------------------------QQSNVVL.WWSS.GPRPDHAGYEK
A7SIT9_NEMVE/1502-1904--------------------------------------------------------QKHNHIL.WMSP.TDRPDLGGKED
DPOE_YARLI/1514-1873--------------------------------------------------------IQNSVVL.WWSA.A..LSTGGALT
R9AMW8_WALI9/1475-1880--------------------------------------------------------IKSDILL.WWSH.SSKPDLGGREQ
D8SJG5_SELML/1443-1816--------------------------------------------------------KDNQHVL.WISD.DGLPDLGGVPQ
S8FUF8_FOMPI/1617-2006--------------------------------------------------------MEHDFVL.WWSP.GNRPDLGGIEE
G1X6W6_ARTOA/1520-1907--------------------------------------------------------QASNVVL.WWSS.TPIPDHAGHQK
Q17H50_AEDAE/1518-1917--------------------------------------------------------QKHNFVL.WCSP.NSRPDLGGREA
G1RBL5_NOMLE/1514-1911--------------------------------------------------------QRHNHLL.WLSP.TARPDLGGKEA
D5GGS6_TUBMM/1460-1851--------------------------------------------------------QKNNVVL.WWSP.SPKPDHGGYEK
H2UTB8_TAKRU/1527-1926--------------------------------------------------------RKHNHLL.WLSP.TSRPDLGGKEA
G8ZQL0_TORDC/1514-1906--------------------------------------------------------KNDGYVL.WWNDNSPLPDHGGAQR
S3BV94_OPHP1/1618-2007--------------------------------------------------------QANNVVL.WWSG.SPRPDHAGYEK
G0V590_NAUCC/1533-1922--------------------------------------------------------KNEGIVL.WWNENIPLPDHGGVQN
K5XRW0_AGABU/1528-1917--------------------------------------------------------IQQDIVL.WWSS.GERPDLGGIEN
E9H7I0_DAPPU/1517-1917--------------------------------------------------------IRNNCIL.WCSP.TERPDLGGKEA
G3B805_CANTC/1530-1912--------------------------------------------------------SNSNMVL.WWSD.TPLADHGGFEM
D6WSX8_TRICA/1501-1896--------------------------------------------------------TKHNHVL.WCSP.TDKPDLGGVEE
A8NMZ4_COPC7/1518-1909--------------------------------------------------------IHQDTVL.WWSP.SDLPDLGGIEA
G0WD71_NAUDC/1559-1949--------------------------------------------------------KQEGIIM.WWNENVPLPDHGGTEK
S2J5L9_MUCC1/1535-1930--------------------------------------------------------IQNDMVI.WWSA.SPMPDLGGREE
C5GX57_AJEDR/1519-1912--------------------------------------------------------EQNKIVL.WWSP.SPLPDHAGYEK
E9D9U9_COCPS/1514-1907--------------------------------------------------------EQNNVVL.WWSP.NPLPDHAGYEK
K7J3X8_NASVI/1487-1888--------------------------------------------------------QKANFVL.WWSP.TEKPDFGGSEN
O62218_CAEEL/1468-1869--------------------------------------------------------QKSGHAL.WATR.ASRPDLGGKEM
V2XXQ2_MONRO/1528-1918--------------------------------------------------------VQQDIVL.WWSP.SDKPDLGGIEN
R7YYU2_CONA1/1520-1913--------------------------------------------------------MKENVVL.WWSD.GPKPDHAGYEK
B6QRD6_PENMQ/1519-1904--------------------------------------------------------EKSNVVL.WWSA.GPRPDHAGYEK
G6CJ62_DANPL/1482-1880--------------------------------------------------------LKHNFVL.WCSG.SERPDLGGREI
G8YP31_PICSO/1529-1911--------------------------------------------------------SENNIVL.WLSS.KPLPDHGGFEN
S9XA99_SCHCR/1491-1879--------------------------------------------------------KEQNIIL.WWNK.GPMPDLGGLEK
N1PFE7_MYCP1/1521-1915--------------------------------------------------------QKEKVVL.WWSQ.DARPDHAGHEK
J4I9U6_FIBRA/1520-1910--------------------------------------------------------AEHDIVL.WWSP.GDRPDLGGMEN
M7NNI3_PNEMU/1489-1876--------------------------------------------------------IKNNYLL.WWSK.SSVPDYGGYEK
DPOE_YEAST/1528-1919--------------------------------------------------------KKENIVL.WWNEKAPLPDHGGIQN
M2QWE4_CERS8/1506-1894--------------------------------------------------------VGQDIIL.WWSP.GDRPDLGGIED
G2X166_VERDV/1512-1902--------------------------------------------------------QNNNVVL.WWSA.SPRPDHAGYEK
U4LW68_PYROM/1510-1903--------------------------------------------------------QSNNVVL.WWSS.SAKPDHGGYEK
Q7RWE3_NEUCR/1534-1926--------------------------------------------------------MANNVVL.WWSP.SPRPDHAGYEK
G4TAK9_PIRID/1551-1940--------------------------------------------------------MKQDMVL.WWSP.GMKPDLGGRET
H6BPG7_EXODN/1517-1908--------------------------------------------------------KRSNVVL.WWSD.QPRPDHAGYER
C4XXS2_CLAL4/253-635--------------------------------------------------------TQNNVVL.WWSN.KPYPDHGGFQN
DPOE_KLULA/1498-1882--------------------------------------------------------KKNNIVL.WWNDKSPLPDHGGVER
G8JME6_ERECY/1494-1883--------------------------------------------------------KESNVVL.WWNDKQPLPDYGGIQN
E3L3C9_PUCGT/1547-1947--------------------------------------------------------TKADHLI.WWSA.SRKPDLGGKEA
DPOE_EMENI/1496-1885--------------------------------------------------------QQNNVVL.WWSS.TAKPDHAGYEK
DPOE_DEBHA/1534-1916--------------------------------------------------------SQSNIVL.WLSS.RPLPDHGGFEM
F4NWW9_BATDJ/1562-1979--------------------------------------------------------TKADALL.WFSL.SGKPDLGGAEN
E5RYM0_TRISP/1442-1827--------------------------------------------------------CKSGHVL.WCSN.SDVPDFGGKET
F4PWS2_DICFS/1559-1964--------------------------------------------------------TDSSHLL.WMSY.SNSPDLGGTEE
K0KG22_WICCF/1507-1890--------------------------------------------------------KKSDIVL.WWSP.RPTPDYGGLEK
J5JYN7_BEAB2/1524-1910--------------------------------------------------------QANNIVL.WWSP.GPRPDHAGHEK
U1GF87_ENDPU/1518-1911--------------------------------------------------------QRSNVVL.WWSD.KPIPDQAGHEK
C5DYX0_ZYGRC/1500-1892--------------------------------------------------------KKEGMVM.WWNENSPLADHGGVQK
F2PJ05_TRIEC/1466-1860--------------------------------------------------------EQNNVVL.WWSA.SPLPDHGGYEK
F6WUQ7_CIOIN/1486-1883--------------------------------------------------------RKHNHVL.WCST.GDQPDVGGMET
J9M470_ACYPI/1505-1904--------------------------------------------------------MKHNFVL.WISE.TDKPDLGGRES
Q59SM7_CANAL/1519-1901--------------------------------------------------------SENNIVL.WWSP.NPLPDLGGFEM

PF03175

DPOL_ADEG1/239-749-----------------------------IR--------------------QALRGGRC...YP----------------
Q9QM79_9ADEN/239-780-----------------------------IR--------------------QALRGGRC...YP----------------
Q9YUR6_9ADEN/339-828-----------------------------IR--------------------QSVRGGRC...YP----------------
DPOL_ADEB3/263-744-----------------------------VR--------------------ESIRGGRC...YP----------------
DPOL_ADECT/392-875-----------------------------VR--------------------LSIRGGRC...YP----------------
DPOL_ADEB2/268-751-----------------------------VR--------------------QSIRGGRC...YP----------------
DPOL_ADE40/434-918-----------------------------VR--------------------ASIRGGRC...YP----------------
DPOL_ADE12/307-791-----------------------------VR--------------------ASIRGGRC...YP----------------
DPOL_ADE02/443-927-----------------------------VR--------------------ASIRGGRC...YP----------------
Q9WF13_ADE17/336-820-----------------------------VR--------------------ASIRGGRC...YP----------------
DPOL_ADE04/438-922-----------------------------VR--------------------ATIRGGRC...YP----------------
Q83895_ADEO7/319-798-----------------------------VR--------------------MSLRGGRC...YP----------------
O11414_9ADEN/324-802-----------------------------IR--------------------KSVRGGRC...YP----------------
DPO2_KLULA/409-871-----------------------------IR--------------------NAIYGGRV....I----------------
Q09038_LACKL/414-876-----------------------------IR--------------------NSIYGGRV....A----------------
DPO1_KLULA/416-866-----------------------------MR--------------------EALIGGRC....I----------------
O74719_DEBHN/419-870-----------------------------MK--------------------DSLIGGRC....I----------------
DPOL_BPCP1/57-480-----------------------------CR--------------------KHIVGAGRLPTLK----------------
Q96206_BPGA1/50-479-----------------------------IR--------------------KAYKGGFTWV.NP----------------
DPOL_BPM2/50-474-----------------------------IR--------------------KAYRGGFTWL.ND----------------
DPOL_BPPZA/50-474-----------------------------VR--------------------YAYRGGFTWL.ND----------------
DPOL_BPPRD/2-433-----------------------------MR--------------------PFYFGGRC...QA----------------
O21376_PICKL/474-939-----------------------------MR--------------------KALFGGYNNVINP----------------
Q35599_PHYPO/8-446-----------------------------IR--------------------KSYIGGRNEIFEH----------------
O99973_PORPU/80-478-----------------------------IR--------------------KAYYGGRCEVYKP----------------
Q9XNK1_PLEOS/738-1218-----------------------------IR--------------------NAYYGGIV....D----------------
E6ZE21_BETVM/147-562-----------------------------IR--------------------RGYYGGHADAYIP----------------
DPOM_MAIZE/299-724-----------------------------IR--------------------EGYYGGHTDVYKP----------------
Q9TEH5_9PEZI/309-758-----------------------------IW--------------------EAYYGGRCEVSYP----------------
DPOM_NEUCS/366-859-----------------------------VR--------------------AAYFGGRNEIFIP----------------
O78938_AGRAE/67-512-----------------------------IR--------------------KSYTGGSVDMYIP----------------
DPOM_NEUIN/401-859-----------------------------IK--------------------LSYFGGICELYKP----------------
DPOM_ASCIM/589-1039-----------------------------LK--------------------QAYTGGYCDVFKP----------------
DPOM_CLAPU/432-888-----------------------------IH--------------------EAYYGGRVEVFNP----------------
DPOM_PODAS/450-889-----------------------------IK--------------------AAYYGGVAEVYRP----------------

PF03337

Q98188_MCV1/6-651-----------------------------ER....................RLYLVGFLSSCYDLPLLRAYWPRADTGWR
Q9Q8S1_MYXVL/6-624-----------------------------TS....................TVVIIGYLSSVFDFPLLKSSWP.KDSGWF
Q070L3_CPRVZ/15-682-----------------------------DRRREEDGDDEPETGGAAAGGDTVILAGYHSSFFDAPLLRRRA..SDGRWV
Q6TUY6_YMTV5/10-640-----------------------------VN....................TIALIGFFSSVFDIPLLKASWN.NSHGWN
Q08FW7_DPV83/7-651-----------------------------VS....................TIAMVGYLSSIFDFSLLRASWP.EDSGWT
Q6TVW0_ORFSA/6-637-----------------------------...................CKENITVYGFYSSFFDT...RQVMELAGKGWT
F12_VACCW/6-635-----------------------------TR....................TIILVGYMSNLFDIPLLTVYWP.NNCGWK
Q8V3R9_SWPV1/5-644-----------------------------IT....................TIILAGYFSSLFDFELLKASMS.PHMGWS

PF00136

DPOD_YEAST/555-991.............................KE--------------------AMDLGTEAAKYVS----------------
DPOD1_CAEEL/520-978.............................AQ--------------------AMEIGLDAAKEVS----------------
DPOL_FOWPN/483-977.............................EK--------------------TAKIAKHLEHIIN----------------
DPOL_IIV6/578-1226KNVKV...................GTEEFSR--------------------EMKKLWNHAIEIA----------------
DPOL_MUHVS/543-1050.............................EA--------------------LLKAVGALAANVT----------------
DPOLA_ORYSJ/834-1303.............................SR--------------------AKGIAGKVIQEVN----------------
DPOL_BPT4/383-855V..........................IEKV--------------------GLDRFKEQNDLVE----------------
Q98207_MCV1/494-994.............................QT--------------------TLAVARTLERVLN----------------
DPOL_EHV2/530-1004.............................EQ--------------------VTGFCDELAAHMT----------------
DPOLA_DROME/805-1258.............................DQ--------------------VYKIGHNIKQSVN----------------
DPOL_VZVD/597-1136.............................EG--------------------IAKIGEKMAHIIS----------------
DPOD1_DROME/534-994.............................ER--------------------SMELGREAAELVS----------------
DPOL_EBVB9/532-1013.............................SE--------------------TLRFADALAAHTT----------------
DPOA_YEAST/792-1248.............................YA--------------------DAIKIGLGFKR.L----------------
DPOL_SFAVA/492-1090S...........................NQD--------------------PWTYVRELATHIT----------------
Q9Q8R2_MYXVL/498-996.............................LT--------------------SIKIAKELERVIN----------------
DPOD_SCHPO/534-990.............................PE--------------------AMKLGEEAANYVS----------------
DPOZ_YEAST/919-1384.............................IE--------------------AFSIGHAMAERVT----------------
DPOLA_HUMAN/783-1246.............................EE--------------------VFKLGNKVKSEVN----------------
DPOL_ALHV1/550-1026.............................DT--------------------VIKFGDALASHTS----------------
DPOD1_SOYBN/511-969.............................EE--------------------AMNLGREAAEHIS----------------
DPOL_SHV21/522-994.............................DT--------------------VVKFGDFLAAFTS----------------
DPOA_SCHPO/773-1222.............................KN--------------------HALRIGNEFKE.K----------------
B6KU35_TOXGO/1007-1611GGE......................GKTYAA--------------------AVRLGEQVKAEIN----------------
G8BKE7_CANPC/526-956.............................KT--------------------CMKLGEEAANYVS----------------
DPOL_VACCW/499-994.............................DK--------------------SIEIAKELERLIN----------------
DPOL_ASFB7/457-973TEVTDAYLNSQKTIKHYEQLCHEKVLLSMKA--------------------MSTLCAEVNEYLR----------------
DPOL_HHV2H/617-1200.............................AG--------------------LVAMGDKMASHIS----------------
DPOL_HHV8P/533-1003.............................DS--------------------VSDFAEELASITT----------------
Q57UW4_TRYB2/686-1135............................IGK--------------------VRNLGFEIKGKVN----------------
Q6TVU5_ORFSA/504-1000.............................AF--------------------SRRVGRCLERVIN----------------
DPOL_GAHVM/606-1169.............................HG--------------------LVTTGDDMAKRVS----------------
DPOL_HHV6Z/517-994.............................ES--------------------LRRIAPMIAKHIT----------------

PF08490

D8PW53_SCHCM/1455-1844-----------------------------D.--------------------...........RR----------------
K1Q2Z7_CRAGI/498-892-----------------------------DD--------------------NRLCMEL......----------------
K5UTI1_PHACS/1501-1886-----------------------------D.--------------------...........RR----------------
T1J6P1_STRMM/1470-1868-----------------------------DD--------------------NRLLIDQ......----------------
E0VSJ8_PEDHC/1513-1911-----------------------------DD--------------------SRLLGEF......----------------
G8BQ26_TETPH/1521-1912-----------------------------E.--------------------......FDLNTSW----------------
G0T1H4_RHOG2/1536-1927-----------------------------D.--------------------........ANASQ----------------
J0M8E9_LOALO/1625-2027-----------------------------DD--------------------TRLNAVWSSLSI.----------------
B0WNF0_CULQU/1523-1926-----------------------------DD--------------------SRLLAEF......----------------
M5E7V9_MALS4/1436-1836-----------------------------D.--------------------.........MNPG----------------
E3S8N6_PYRTT/1524-1919-----------------------------D.--------------------.........DVLA----------------
W1Q6U0_OGAPD/1501-1875-----------------------------D.--------------------...........TF----------------
I1G2M3_AMPQE/1495-1895-----------------------------DD--------------------YRLMMET......----------------
Q9VCN1_DROME/1529-1930-----------------------------DD--------------------SRLLAEF......----------------
DPOE_CANGA/1526-1915-----------------------------D.--------------------......FDQNTSW----------------
E2B8B2_HARSA/1525-1925-----------------------------DD--------------------NRLLTDF......----------------
J7RME7_KAZNA/1518-1909-----------------------------E.--------------------......YDPNISG----------------
F4S3B6_MELLP/1559-1958-----------------------------D.--------------------........INAQQ----------------
DPOE_ASHGO/1493-1878-----------------------------E.--------------------......YNPHTLS----------------
B6K1H9_SCHJY/1420-1808-----------------------------D.--------------------.........DILH----------------
A0BZJ9_PARTE/1454-1836-----------------------------DN--------------------RDLVP........----------------
C5DK88_LACTC/1505-1895-----------------------------D.--------------------......FNPSMAS----------------
H2YP37_CIOSA/1434-1828-----------------------------GD--------------------KRLGLND......----------------
M2NL61_BAUCO/1525-1921-----------------------------D.--------------------.........DILS----------------
U1M0G7_ASCSU/1468-1870-----------------------------DD--------------------CRIGVDWNSLCV.----------------
B0DWP2_LACBS/1522-1912-----------------------------D.--------------------...........RR----------------
R4X9Y3_TAPDE/1534-1914-----------------------------D.--------------------.........DLVK----------------
R1GQ63_BOTPV/1519-1912-----------------------------D.--------------------.........DILG----------------
K1VVE5_TRIAC/1494-1883-----------------------------D.--------------------...........AN----------------
B3S6C7_TRIAD/1510-1905-----------------------------DD--------------------SSIVS........----------------
N1JGF4_BLUG1/1511-1904-----------------------------D.--------------------.........NVFG----------------
W4ZAF4_STRPU/37-438-----------------------------DD--------------------NRLVTEF......----------------
M5BQD5_THACB/1537-1929-----------------------------D.--------------------.........INAP----------------
M3ALS7_MYCFI/1503-1901-----------------------------D.--------------------.........DVLS----------------
I2GW49_TETBL/1546-1937-----------------------------D.--------------------......FDINTSW----------------
F6GW32_VITVI/1705-2088-----------------------------ED--------------------TCFA.........----------------
S7ZMV2_PENO1/1499-1887-----------------------------D.--------------------.........DIVG----------------
DPOE_SCHPO/1498-1886-----------------------------D.--------------------.........SILQ----------------
H9J5N5_BOMMO/1546-1951-----------------------------DD--------------------NRLASEA......----------------
H2AUI7_KAZAF/1512-1900-----------------------------D.--------------------......FDPNADW----------------
I1BIP1_RHIO9/1528-1924-----------------------------D.--------------------.........ETIS----------------
DPOE_CRYNJ/1529-1917-----------------------------D.--------------------...........AN----------------
F8QB37_SERL3/1530-1921-----------------------------D.--------------------...........FR----------------
G7E3T0_MIXOS/1542-1933-----------------------------D.--------------------..........TFV----------------
R9P7N8_PSEHS/1532-1932-----------------------------D.--------------------........IHAQS----------------
C1FJ68_MICSR/1644-2054-----------------------------DG--------------------ALSGLD.......----------------
A5DEB2_PICGU/1518-1900-----------------------------D.--------------------..........SAQ----------------
L8G4R0_PSED2/1520-1914-----------------------------D.--------------------.........DVLG----------------
C4QV66_PICPG/1520-1895-----------------------------D.--------------------.........QSMA----------------
K1XY13_MARBU/1520-1913-----------------------------D.--------------------.........DVLG----------------
A7TF62_VANPO/1518-1909-----------------------------E.--------------------......FDLNSSW----------------
A5E0L0_LODEL/484-866-----------------------------D.--------------------..........KPI----------------
Q7Q7P3_ANOGA/1541-1943-----------------------------DD--------------------SRLLAEF......----------------
G8BGB3_CANPC/1514-1896-----------------------------D.--------------------..........RVL----------------
H9K9J3_APIME/1527-1928-----------------------------DD--------------------NRLLTDF......----------------
T1HUW2_RHOPR/1490-1890-----------------------------DD--------------------NRLLSDF......----------------
V5I1Z1_BYSSN/1523-1915-----------------------------D.--------------------.........DVVG----------------
A7SIT9_NEMVE/1502-1904-----------------------------DD--------------------NRLGLMT......----------------
DPOE_YARLI/1514-1873-----------------------------D.--------------------.............----------------
R9AMW8_WALI9/1475-1880-----------------------------D.--------------------.......VPPQQF----------------
D8SJG5_SELML/1443-1816-----------------------------DE--------------------PSFT.........----------------
S8FUF8_FOMPI/1617-2006-----------------------------D.--------------------...........AR----------------
G1X6W6_ARTOA/1520-1907-----------------------------D.--------------------.........SIVR----------------
Q17H50_AEDAE/1518-1917-----------------------------DD--------------------SRLLAEF......----------------
G1RBL5_NOMLE/1514-1911-----------------------------DD--------------------NCLVMEF......----------------
D5GGS6_TUBMM/1460-1851-----------------------------D.--------------------.........DILG----------------
H2UTB8_TAKRU/1527-1926-----------------------------DD--------------------SRLVMDS......----------------
G8ZQL0_TORDC/1514-1906-----------------------------D.--------------------......FDLNTSW----------------
S3BV94_OPHP1/1618-2007-----------------------------D.--------------------.........DVAG----------------
G0V590_NAUCC/1533-1922-----------------------------D.--------------------......FDLNTSD----------------
K5XRW0_AGABU/1528-1917-----------------------------D.--------------------...........TH----------------
E9H7I0_DAPPU/1517-1917-----------------------------DD--------------------NRLVTEI......----------------
G3B805_CANTC/1530-1912-----------------------------D.--------------------..........KAP----------------
D6WSX8_TRICA/1501-1896-----------------------------ND--------------------SRLLAEN......----------------
A8NMZ4_COPC7/1518-1909-----------------------------D.--------------------...........IQ----------------
G0WD71_NAUDC/1559-1949-----------------------------E.--------------------......FDLNTSW----------------
S2J5L9_MUCC1/1535-1930-----------------------------D.--------------------.........ESLA----------------
C5GX57_AJEDR/1519-1912-----------------------------D.--------------------.........DILG----------------
E9D9U9_COCPS/1514-1907-----------------------------D.--------------------.........NINS----------------
K7J3X8_NASVI/1487-1888-----------------------------DD--------------------SRLLTDF......----------------
O62218_CAEEL/1468-1869-----------------------------DD--------------------VRLSVDWNPLSI.----------------
V2XXQ2_MONRO/1528-1918-----------------------------D.--------------------...........KR----------------
R7YYU2_CONA1/1520-1913-----------------------------D.--------------------.........DVLG----------------
B6QRD6_PENMQ/1519-1904-----------------------------D.--------------------.........DILG----------------
G6CJ62_DANPL/1482-1880-----------------------------DD--------------------NRLVSES......----------------
G8YP31_PICSO/1529-1911-----------------------------D.--------------------..........RQS----------------
S9XA99_SCHCR/1491-1879-----------------------------D.--------------------.........DVLH----------------
N1PFE7_MYCP1/1521-1915-----------------------------D.--------------------.........DILG----------------
J4I9U6_FIBRA/1520-1910-----------------------------D.--------------------...........AR----------------
M7NNI3_PNEMU/1489-1876-----------------------------D.--------------------.........WMPY----------------
DPOE_YEAST/1528-1919-----------------------------D.--------------------......FDLNTSW----------------
M2QWE4_CERS8/1506-1894-----------------------------D.--------------------...........RR----------------
G2X166_VERDV/1512-1902-----------------------------D.--------------------.........DVTG----------------
U4LW68_PYROM/1510-1903-----------------------------D.--------------------.........DIVG----------------
Q7RWE3_NEUCR/1534-1926-----------------------------D.--------------------.........DVVG----------------
G4TAK9_PIRID/1551-1940-----------------------------D.--------------------........GSAGG----------------
H6BPG7_EXODN/1517-1908-----------------------------D.--------------------.........DILG----------------
C4XXS2_CLAL4/253-635-----------------------------D.--------------------..........HVQ----------------
DPOE_KLULA/1498-1882-----------------------------D.--------------------......FDPRKAE----------------
G8JME6_ERECY/1494-1883-----------------------------Q.--------------------......HDPHKMH----------------
E3L3C9_PUCGT/1547-1947-----------------------------D.--------------------........LNTEL----------------
DPOE_EMENI/1496-1885-----------------------------D.--------------------.........DITG----------------
DPOE_DEBHA/1534-1916-----------------------------D.--------------------..........KAQ----------------
F4NWW9_BATDJ/1562-1979-----------------------------ED--------------------THFAYAV......----------------
E5RYM0_TRISP/1442-1827-----------------------------DD--------------------HRLNVDS......----------------
F4PWS2_DICFS/1559-1964-----------------------------DD--------------------AKFH.........----------------
K0KG22_WICCF/1507-1890-----------------------------D.--------------------.........SILM----------------
J5JYN7_BEAB2/1524-1910-----------------------------D.--------------------.........DLVG----------------
U1GF87_ENDPU/1518-1911-----------------------------D.--------------------.........DIRG----------------
C5DYX0_ZYGRC/1500-1892-----------------------------D.--------------------......YDPNTAW----------------
F2PJ05_TRIEC/1466-1860-----------------------------D.--------------------.........NILG----------------
F6WUQ7_CIOIN/1486-1883-----------------------------ED--------------------KRIVLGM......----------------
J9M470_ACYPI/1505-1904-----------------------------DD--------------------NRMLMDS......----------------
Q59SM7_CANAL/1519-1901-----------------------------D.--------------------..........RMI----------------

PF03175

DPOL_ADEG1/239-749---------NVLGPYLKPVYVFDICGMYASALTH.------PMPHGMPLD-.PKFTAQHVEELNRLLTNES.HLSYFDAR
Q9QM79_9ADEN/239-780---------SVLGPYRHPVYVFDICGMYASALTH.------PMPHGMPLD-.PKFTAKHVDELNELMSSER.PISYFDHR
Q9YUR6_9ADEN/339-828---------THLGIFKEKIFVYDICGMYASALTH.------PMPYGFPIG-.EKERNNEITKLNEKLKKTKTKLSYF.TD
DPOL_ADEB3/263-744---------TYIGVLTEAIYVYDICGMYASALTH.------PFPAGKPLN-.PFDRALAIKNWQDRLTQLHRPIDYFDRT
DPOL_ADECT/392-875---------TYIGVLQEPVFVYDICGMYASALTH.------PFPAGSPLN-.PYERALAIKAYEQKMLNHK.TISYFDKD
DPOL_ADEB2/268-751---------TYIGIMEQPIYVYDICGMYASALTH.------PFPSGQPLN-.PYERALAATEWIRKLENLEQKIDYFDEC
DPOL_ADE40/434-918---------TYIGVLREPLYVYDICGMYASALTH.------PMPWGFPLN-.PYERALAVRDWEHALLQVGTPIDYFNRT
DPOL_ADE12/307-791---------TYIGVLKEPIYVYDICGMYASALTH.------PMPWGPPLN-.PYERALAVRQWQVALENYTCKIDYFDKN
DPOL_ADE02/443-927---------TYLGILREPLYVYDICGMYASALTH.------PMPWGPPLN-.PYERALAARAWQQALDLQGCKIDYFDAR
Q9WF13_ADE17/336-820---------TNIGIFSEPIYVYDICGMYASALTH.------PMPWGPPLN-.PYERAMAAREWQMALDDASSKIDYFDKK
DPOL_ADE04/438-922---------TYIGILDEPLYVYDICGMYASALTH.------PMPWGTPLS-.PYERALAVREWQASLDDLGTCISYFDPD
Q83895_ADEO7/319-798---------SFLGIFEEAIYVYDICGMYASALTH.------PLPYGKTLN-.AFEANAQIDYFQELLQRKE.KIDYFDNS
O11414_9ADEN/324-802---------SYLGVYEGPIYVYDICGMYASALTH.------PMPFGRTED-.PLTASISIKTFQDKLDSPA.KLSYFGES
DPO2_KLULA/409-871---------SKNGIYEENIVYADVVSLYPSAMKLL------KHSYGKP..-....KLVDYIDFE........KHGIYRVT
Q09038_LACKL/414-876---------AKNGTYNEEIVYADVVSLYPSAMKLL------EHSYGKP..-........SKVFSINFN....KHGIYDVT
DPO1_KLULA/416-866---------SVNGIY.KDVLCLDVKSLYPASMAFY------DQPYGSF..-........KRVSSRPKD....ELGIYYVR
O74719_DEBHN/419-870---------SVNGIY.ENILCLDVKSLYPAAMAFY------DQPYGQF..-.........RRVQQRMTE...ELGIYYVR
DPOL_BPCP1/57-480---------HRGRTLNQLIDIYDINSMYPATMLQN------ALPIGIP..-.KRYKGKPKEI..........KEDHYYIY
Q96206_BPGA1/50-479---------KYQGETVYGGMVFDVNSMYPAMMKNK------LLPYGEP..-.VMFKGEYKKNVEYPL.....YIQQVRCF
DPOL_BPM2/50-474---------KYKEKEIGEGMVFDVNSLYPSQMYSR------PLPYGAP..-.IVFQGKYEKDEQYPL.....YIQRIRFE
DPOL_BPPZA/50-474---------RFKEKEIGEGMVFDVNSLYPAQMYSR------LLPYGEP..-.IVFEGKYVWDEDYPL.....HIQHIRCE
DPOL_BPPRD/2-433---------FEKGIIEDDIKVYDVNSMYPHAMRNF------RHPFSD...-.EFYEANEITEETYFIEWEGENNGAVPVR
O21376_PICKL/474-939---------M.....ADEAYYYDVNSFYPAVAVKY------RYPTTKGFD-MSYPEGLDYKDFNYPE.....TTGVLHCE
Q35599_PHYPO/8-446---------V.....AQRNYFYDVNSLYPYIMKKE------KMPIGIP..-.EYRDKEYMKKFEKNIEN...FFGFIDVL
O99973_PORPU/80-478---------TND...SNKIFHYDFNSHYPSSMLN.------KIPTKIS..-.GWKS....PQIREPID....PFTIYDVV
Q9XNK1_PLEOS/738-1218---------SWTFYSEKPLFKYDFKSHYPNQMRNN------PMPGGLP..-.IFSTETNLDL..........IFGFVRAE
E6ZE21_BETVM/147-562---------K.....GTNLYYYDVNSLYPFIMKEY------PMPSGKP..-.VWASNLGGMDLDS.......LYGFIEAY
DPOM_MAIZE/299-724---------Y.....GENLYYYDVNSLYPSSMLD.------DMPIGKT..-.RWVSDLGSKKSKIVLND...MFGFIRAF
Q9TEH5_9PEZI/309-758---------C......IKTKSYDCNSIYPYCMLK.------DMPVEN...-.LFEVTIIILI..........IFRYVYAK
DPOM_NEUCS/366-859---------I.....INNIFSFDFNSLYPTAMMM.------PMPVGIP..-........VHTFCKNLNE...IFGFVRAK
O78938_AGRAE/67-512---------LIEK..DSKIFIYDINSLYPFSMKSF------KFPIGNP..-.TFFKGDITRINKD.......AFGFFYCK
DPOM_NEUIN/401-859---------F.....GVNIKSYDVNSLYPFAMKYF------KMPSGIP..-.KYVKGTLQNIVRFTDSICEVPFGFYNVK
DPOM_ASCIM/589-1039---------E.....GKNIHSYDINSLYPSAMAKF------DMPTGTP..-.LHILG...DPYKFTKD....PFGFVFAE
DPOM_CLAPU/432-888---------IIMADSTKSYYYYDVNSLYPFASIN.------DIPGLKC..-.TFYEVVKANVNIHEL......FGFFYCK
DPOM_PODAS/450-889---------Y.....GKNLRYYDVNSLYPFVAKN.------TMPGHEC..-.KYIESKKGLKLSE.......LFGFFYCK

PF03337

Q98188_MCV1/6-651LLGH.....ALVYRCRYTAVLLDAAPYAHGLCLREYCEHWAGASPRLPSE..MESRADVLRRASASTEAAVHAARLLGTA
Q9Q8S1_MYXVL/6-624FVGNN....HIVSSDGMKLVLIDAAKFVRDMSTMDYLQHWKSRAVSIQGD..MITNEEARTKLKVLEKNSSRVAESLYNA
Q070L3_CPRVZ/15-682AAVGDDAGPTLIYRGRHRVLVRDLGLFNPSFSPDAFVRCWARAERGRLDDRYLRTRADLERYRDQILAYLSESCYYLHCA
Q6TUY6_YMTV5/10-640FVGDE....YIISNNGLKVYLIDALNFSYNCSVSDYVSSWTTSNVELNKD..FIFEQEARLTIKRLKKVSSACTTTLHNA
Q08FW7_DPV83/7-651FIGYN....NIVSKDGLKILLLDVANFSCGMTLKEYCNHWERVIITPPKD..LITKHEAKLKIKLIERCALKTVTTLYNS
Q6TVW0_ORFSA/6-637RISEN....TLLSRLGNRVAFVDLARFAPATLFSEYCEFWGGVCVDVPED..VVSADES...AAAAEEAAAAAAQALSDA
F12_VACCW/6-635IYNN.....TLISSDGARVIWMDAYKFSCGLSLQDYCYHWGSKPESRPFD..LIKKSDAKRNSKSLVKESMASLKSLYEA
Q8V3R9_SWPV1/5-644FIEND....YMVSQDGLKIILMDFANFSFKLTLEEYCQYWNKNNAYNIKD..LITKQEAKIKIKLLEKSSLKFISVLYDS

PF00136

DPOD_YEAST/555-991---------.TL...FKHPINLEFEKAYFPYLLIN.KKRYAGLFWTNPDKF.......DKLDQKGLASVRRDSCSLVSIV
DPOD1_CAEEL/520-978---------.KI...FTPPIKLEFEKVYSPYLLIN.KKRYAGLYFT.KPDV....H..DKMDCKGLETVRRDNCPLVAKV
DPOL_FOWPN/483-977---------TKI...LHANFKIEFEAIYTQLILQS.KKKYTTIKYLANYKPG..DK..PIRVNKGTSETRRDVALFHKHM
DPOL_IIV6/578-1226---------KTISKKFDNPITLEFENAIYFKFLILTKKRYMYYTCGKDGNILMDANGKPKMGQRGVILSRRDNCKYMKDV
DPOL_MUHVS/543-1050---------NAL...FKEPVRLEFEKMFVSLMMIC.KKRYIGKVHG.........S..QNLSMKGVDLVRRTACGFVKAV
DPOLA_ORYSJ/834-1303---------KK.....YRCLEIDLDGIYKRMLLLK.KKKYAAIKVALDGSL....R..ENIERKGLDMVRRDWSLLSKEI
DPOL_BPT4/383-855---------FMN...QFGKKKMEPMIDVAYRELCDYMNNREHLMHMDREAI............SCPPLGSKGVGGFWKAK
Q98207_MCV1/494-994---------EHV...LFENFRVEFEAIYQNLILQS.KKKYSTTKYAADHRAG.DAP...EHVSKGTSETRRDVSRFHKLM
DPOL_EHV2/530-1004---------RTL...FVDPIKLEAEKTFKCLILLT.KKRYIGMMT..........T..DRLLMKGVDLVRKTACRFVQET
DPOLA_DROME/805-1258---------.KL....YKQLELDIDGVFGCLLLLK.KKKYAAIKLSKDSKGN.LRR...EQEHKGLDIVRRDWSQLAVMV
DPOL_VZVD/597-1136---------TAL...FCPPIKLECEKTFIKLLLIT.KKKYIGVIY..........G..GKVLMKGVDLVRKNNCQFINDY
DPOD1_DROME/534-994---------.SK...FVHPIKLEFEKVYYPYLLIN.KKRYAGLYFT.RPDT....Y..DKMDCKGIETVRRDNSPLVANL
DPOL_EBVB9/532-1013---------RSL...FVAPISLEAEKTFSCLMLIT.KKRYVGVLT..........D..GKTLMKGVELVRKTACKFVQTR
DPOA_YEAST/792-1248---------VNE...RYRLLEIDIDNVFKKLLLHA.KKKYAALTVNLDKNGN..GT..TVLEVKGLDMKRREFCPLSRDV
DPOL_SFAVA/492-1090---------SKL....REPMVIEAEDDIHAKVLFLGKKCYIGRKLFRDGSV...AR...DLDWHVVITVRRDHSEYVKSA
Q9Q8R2_MYXVL/498-996---------TKV...LFDNFKIEFEAVYKNLIMQS.KKKYTTLKYVPSSTQN.SIP...VRINKGTSETRRDVSKFHKYM
DPOD_SCHPO/534-990---------.DQ...FPNPIKLEFEKVYFPYLLIS.KKRYAGLFWTRTDTY.......DKMDSKGIETVRRDNCPLVSYV
DPOZ_YEAST/919-1384---------.QN...NPKPIFLKFEKVYHPSILIS.KKRYVGFSYESPSQT....L..PIFDAKGIETVRRDGIPAQQKI
DPOLA_HUMAN/783-1246---------.KL....YKLLEIDIDGVFKSLLLLK.KKKYAALVVEPTSDGN.YVT...KQELKGLDIVRRDWCDLAKDT
DPOL_ALHV1/550-1026---------SVL...FASPIKLESEKVFKCLMLLT.KKRYVGILS..........N..NKILMKGVDLVRKTACVYVQEV
DPOD1_SOYBN/511-969---------.GT...FTKPIKLEFEKVYYPYLLIS.KKRYAGLFWT.KPDN....F..DKMDTKGIETVRRDNCLLVKNL
DPOL_SHV21/522-994---------EKL...FNAPIKLESEKTFQCLLLLA.KKRYIGILS..........N..DKLLMKGVDLVRKTACKFVQNT
DPOA_SCHPO/773-1222---------VNE...RYSKLEIDIDNVYQRMLLHA.KKKYAALQLDSQGKP....N....LDVKGLDMKRREFCTLAKEA
B6KU35_TOXGO/1007-1611---------KS.....YKKLEIDLEGVFRRLLLLK.KKKYVCCIVVDYAKR....Q..YKLEQKGLDIVRRDWAKLTKVV
G8BKE7_CANPC/526-956---------TK....FQNPIKLEFEKVYFPYLLIN.KKRYAGLYWTRPDKF.......DKMDTKGIETVRRDNCRLVQNV
DPOL_VACCW/499-994---------NRV...LFNNFKIEFEAVYKNLIMQS.KKKYTTMKYSASSNSK..SV..PERINKGTSETRRDVSKFHKNM
DPOL_ASFB7/457-973---------QDN...GTSYLRMAYEEVLFPVCFTG.KKKYYGIAHVNTPNF...NT..KELFIRGIDIIKQGQTKLTKTI
DPOL_HHV2H/617-1200---------RAL...FLPPIKLECEKTFTKLLLIA.KKKYIGVIC..........G..GKMLIKGVDLVRKNNCAFINRT
DPOL_HHV8P/533-1003---------NTL...FRSPIKLEAEKIFKCLLLLT.KKRYVGVLSD............DKVLMKGVDLIRKTACRFVQEK
Q57UW4_TRYB2/686-1135---------QR.....YQSLELDIDGVFRAMLLLR.KKKYAALSVVDWQGEG..KV..YKREVKGLDMVRRDWCPLSQHV
Q6TVU5_ORFSA/504-1000---------EHV...LFANFKVEFEAVYCNLIMQS.KKKYTTIKFAVSDGG....G..SERVSKGTSETRRDVAPFHKLM
DPOL_GAHVM/606-1169---------SDL...FPKPIKLECEKTFNKLLLIT.KKKYMGTIH..........G..GRMLMKGVDIVRKNNCRFINTY
DPOL_HHV6Z/517-994---------DRL...FKSPIKLEFEKILCPLILIC.KKRYIGRQDD............SLLIFKGVDLVRKTSCDFVKGV

PF08490

D8PW53_SCHCM/1455-1844---------PT.DD..FPRTEFMSPGAYPNVCLEITIRNLAVNSVLHSVLV-------NELE..GSG..GATAFD...AV
K1Q2Z7_CRAGI/498-892---------...EE..STSVEVNNPGTFPTVCVELGISSLAVNTIIESAHV-------NDQE..GAS..AVSFDTLPQSS
K5UTI1_PHACS/1501-1886---------PT.EE..LPKTEFMSPGCYSNVCLEITVRNLAVDAVLHSMIV-------NELE..GSG..GATAFD...A.
T1J6P1_STRMM/1470-1868---------...EE..YSSIEINNPGSYGSVCLELEIDHLAVNTLLQSNHI-------QEME..GTSS.SIAFDAMPLSS
E0VSJ8_PEDHC/1513-1911---------...DE..LSTTVINKEGCYTSISVEMDIDALAVNTLLQLNRM-------NEAE..GISS.SLAFDSAPQVV
G8BQ26_TETPH/1521-1912---------IM.ND..LKFLEINNPDVYDNVTLELSINNLTVNTVLTSAVI-------SSID..GSDL..........AE
G0T1H4_RHOG2/1536-1927---------LG.DE..LINPELGKPGCYSNACLEVEVRNLAVDAVLQSALV-------YELE..GGEGGGID......EA
J0M8E9_LOALO/1625-2027---------...NK..QSVCVVNESSFETDVCIELELGAVDVTAIVQSASI-------ADAE..GGAD.SVGFLTGSVLS
B0WNF0_CULQU/1523-1926---------...ED..NISVVQNRSGFYGTVCVELSIESLAVSALLQAGKV-------QEME..GASS.AITFDVIPQAS
M5E7V9_MALS4/1436-1836---------TV.DE..LDMLEITNPGAYSSICLEVQVADLALNCVLQNANV-------HAME..GIGA.ASMAFD...SA
E3S8N6_PYRTT/1524-1919---------PL.ET..VEMPSINNPGTYSSVCIDINVRNLAINTILSSSLV-------NELE..GA.D.SVSFNP....A
W1Q6U0_OGAPD/1501-1875---------AVDES..FEFPVINQSEVYESVCLELELKNLTINTVLTSSLI-------NEAE..GV..............
I1G2M3_AMPQE/1495-1895---------...DD..GRSLELNNPGLYPSTCIELSIEGLAVTAVLQASHI-------NDYE..GASSTSISFDYAPQAS
Q9VCN1_DROME/1529-1930---------...EE..SISVVQNKAGFYPDVCVELALDSLAVSALLQSTRI-------QEME..GASS.AITFDVMPQVS
DPOE_CANGA/1526-1915---------IM.ND..LDFPNINVPDVYDNVVLEVSIENLVVNTILCSTLI-------NEAE..GSDL..........VD
E2B8B2_HARSA/1525-1925---------...EE..SSSCAANNPGTYSSVCVQLDVESLAVNALLQYHHI-------HDID..GTST.FVAFHNQQRPS
J7RME7_KAZNA/1518-1909---------IM.QE..LSFPDVNTPDIYDKTVLEIQIRNLTINTVLASTLI-------NEAE..GSDL..........TN
F4S3B6_MELLP/1559-1958---------VL.ET..LSSPEISVMGAYSNASIELSIVDLAIDAVLQSATV-------YE....GDKGESTIGFQ...NA
DPOE_ASHGO/1493-1878---------LA.TD..LTSPVINNPEFYDSAVLEIEVNNLLVNTILTSTLI-------NEAE..GGDV............
B6K1H9_SCHJY/1420-1808---------LT.SP..SDNFELNYSGAYANASVDIHISNLAMCSILNSAIV-------NDAE..GVED.FSALDD.....
A0BZJ9_PARTE/1454-1836---------...TE..FTKTYFDNPGIYIGYTCEIDILHFSINTIAQSEEI-------KNLD..................
C5DK88_LACTC/1505-1895---------LM.SD..LDISITNSPSVYDTVVLEIEMSNLTINTVLTSAVI-------NEAE..GSDL..........AE
H2YP37_CIOSA/1434-1828---------...HA..NTCIEINNSAFHQTVCVQVDISSLAINTILQSHHV-------NDVE..GASS.GVCFEG.....
M2NL61_BAUCO/1525-1921---------SM.EV..VDTPAVNNPGTYSSVCIDLSIKNLAINTILSAAVL-------NDVE..DS.D.PIGISG...AS
U1M0G7_ASCSU/1468-1870---------...SE..QPAAIVNHSRLCTEVCVELELGALAVSALVHGARI-------AEAE..GGSG.SVGFLSSASLS
B0DWP2_LACBS/1522-1912---------PT.ED..LPKTDFLSAGVYSNVCLEITVRNLAVNSILQSVMV-------NELE..GSG..GATAFD...SV
R4X9Y3_TAPDE/1534-1914---------AL.ET..VEPVKMNNPGAYNTVCIELEVRNIIISTILNSALI-------NELE..GSAA..........AD
R1GQ63_BOTPV/1519-1912---------PL.ET..VEMPSINNPGTYSSVCIDLEIKNLAISTVLSSSII-------NEAE..GS.D.SVSFNP...AA
K1VVE5_TRIAC/1494-1883---------GG.EE..PTPPQISTKGVYSTVVLEMEIADMAINAVLQSALV-------NEME..GSGS.GSMAFG...SA
B3S6C7_TRIAD/1510-1905---------...EE..LPSIELNNPGCYPSVSAEISMHGLAVSSVLQSLRL-------GDFE..T....DLTFDAAPQAS
N1JGF4_BLUG1/1511-1904---------TL.EP..IKMPSTNNPGTYSSVCVELDVRNLVINTILTSSLI-------KELE..GS.D.SSCLNP...AN
W4ZAF4_STRPU/37-438---------...DE..SGGVELNHSGCYQTVCVDLDMANLAVNTLLQSHQV-------SELE..GAAG.SIAFDAIQQTS
M5BQD5_THACB/1537-1929---------TE.DP..NSSVDLANPGCYTNVCLAINIRNLALNSVLQSGIV-------NELE..GTA..GATAFD...ST
M3ALS7_MYCFI/1503-1901---------GM.EV..VEMPAINTPGTYSSVCIDLSVKNLAINTILSSAVL-------NDAEGAGA.D.PLGISG...AG
I2GW49_TETBL/1546-1937---------TM.NN..LQFPRINVPDVYDNVILEIDIKNLVVNTVLGITLF-------NDAE..GSDM..........AN
F6GW32_VITVI/1705-2088---------...DE..VHQPVLTYPGAYRKVSVELKIHHLAVNALLKSNQV-------NEME..GGAL..........FG
S7ZMV2_PENO1/1499-1887---------PL.EK..VNMPSVNTPGAYSTVCIELDIRNLAINTILTSSIV-------HDMD..GG.D.TL.LAP...S.
DPOE_SCHPO/1498-1886---------IA.SP..KDPLEVNNPGAYSNACVDISLSNLALCSILNSALI-------NDIE..GIGD.MAALND.....
H9J5N5_BOMMO/1546-1951---------...EE..AGAWSGGAVGAHGGVCVELGLDALSVCALLQAHLV-------LQAE..GTSA.ATAFGHAP.TS
H2AUI7_KAZAF/1512-1900---------II.NG..SNFSEINTPDIYDNVVLDISVGNLTVNTILGSTLI-------NEAE..GSDL..........AN
I1BIP1_RHIO9/1528-1924---------IT.GG..LVNPELNFQGAYETVCADFDLSRLCLNTLLVSPVI-------NELE..GTA..GNNSFD...NA
DPOE_CRYNJ/1529-1917---------SS.ED..LVSPHISNRGCYSSTVLEMEVSDLAINAVLQSALV-------NEME..GSGT.GSLAFD...SA
F8QB37_SERL3/1530-1921---------PV.EE..LQNTEFMSPGCYSNVCLDVAVRNLAVNSVLHSVVV-------NELE..GSG..GTTAFD...SV
G7E3T0_MIXOS/1542-1933---------SA.SE..TSEPEISRPGCYTNAVVDLDLRDLAVNAVMQAAFV-------YELE..GAEG.TSMGFG...EA
R9P7N8_PSEHS/1532-1932---------RW.DE..QESLEISHAGAYSTVCLEVGLVDLAVDSVLQSGSV-------NEME..GST..SGLAFE...GA
C1FJ68_MICSR/1644-2054---------...DTLQTTRAEVNNPGAYRCVCVELKAHHLAVCAIANAHLL-------NDLE..................
A5DEB2_PICGU/1518-1900---------DY.EN..FDFPQFNNPEVYDTTSLEIELGTLTINTILTSALI-------NGAE..GTDL............
L8G4R0_PSED2/1520-1914---------PL.ET..VQMPTVNNPGTYSSVCIEIDVRNLAINTILTSSLI-------NDLE..GSMD.SVTFNP...AA
C4QV66_PICPG/1520-1895---------NIEKS..LEFPTINKPEIYETVCLELNLSNLTINTILTSALI-------NEAE..G...............
K1XY13_MARBU/1520-1913---------PL.ET..VQMPSVNNPGTYPSVCIEIDVRNLAINTILTSSLI-------NELE..GS.D.SISFNP...AA
A7TF62_VANPO/1518-1909---------IM.NN..LDFPEINNPDVYDNVTLEVSINNLTVNTVLTSALI-------NDAE..GSDL..........AD
A5E0L0_LODEL/484-866---------NS.ES..LKFPVINNPEVYETACLEVEIGTLTINTILTSSII-------NEAE..GTDL............
Q7Q7P3_ANOGA/1541-1943---------...ED..NISVVQNRSGFYRSVCVELTVESLAVSALLQASKV-------QELE..GTSS.AITFDVMPQAS
G8BGB3_CANPC/1514-1896---------NL.ES..LEFPTINNSEVYETTCLEVEIGTLTINTILTSSLI-------NEAE..GTDL............
H9K9J3_APIME/1527-1928---------...EE..SSQCAANNFGTYSSVCIELEIENLAVNTLLQYHHI-------HDID..GTSN.FVAFHNQQQTS
T1HUW2_RHOPR/1490-1890---------...EE..NTNVISNNLGCYSTICVELDIDSLAVNTLLQSHHV-------HDIE..GTSS.SVGFDTMPQLS
V5I1Z1_BYSSN/1523-1915---------PL.ER..VDMPSINVPGAYSTVCIELDIRNLAFNTILTSSLI-------NELE..GS.D.AL.LAP...SA
A7SIT9_NEMVE/1502-1904---------...DE..VESVEFNSSGCYPTVCVELSIDGLAVNTILQSAHI-------NDFE..GGAGTGISFDNLPQAS
DPOE_YARLI/1514-1873---------....Q..AEVPVANNPGLYTNICFEIKIEHLVLNALLQSAVI-------QDTE..GDIH............
R9AMW8_WALI9/1475-1880---------AD.EG..GGPEEFSNPGTFSNVVLEVELRDIAVNSILQSSLV-------NEME..GAGS.AATVFD...ST
D8SJG5_SELML/1443-1816---------...DV..VQQPSLCYPGAYRSVTIELKINHLAVNALLKSTQV-------NELE..GGALLGF.........
S8FUF8_FOMPI/1617-2006---------PT.EE..LPKTDFMSPGCYSNVCLEITVRNLAVNSVLHSLMV-------NELE..GAG..GATAFD...S.
G1X6W6_ARTOA/1520-1907---------SL.EH..VNMPDINNRGSYSSVCIELDVRNLAINTLLTSSLI-------NELE..GA.D.AMGFNP.....
Q17H50_AEDAE/1518-1917---------...ED..NISVVQNRQGFYGDVCVELTIDSLAVSALLQASRV-------QEME..GAAS.AITFDVIPQAS
G1RBL5_NOMLE/1514-1911---------...DD..QATVEINSSGCYSTVCVELDLQNLAVNTILQSHHV-------NDME..GADSMGISFDVIQQAS
D5GGS6_TUBMM/1460-1851---------SM.ET..VDMPAINNPGSYSSVCIEIEVRNLAINTILTSSLI-------NELE..GS.D.SVAMNP...AA
H2UTB8_TAKRU/1527-1926---------...DD..KGSVEINAQGCYSTACVELDLQSLAVNTILQSQHV-------NDME..GGASVGVSFDVIQQAS
G8ZQL0_TORDC/1514-1906---------LM.ND..LAFPEVNNPAVYDQVVLEIGVGNLTINAVLGSALI-------NEAE..GGDP..........MG
S3BV94_OPHP1/1618-2007---------PL.ET..VSLPKINNPGTFASVCIDIDVRNLAINTILTSSLI-------NELE..GA.DAAVSFNP...AA
G0V590_NAUCC/1533-1922---------MM.ND..LSFPELNQPNIYDNAVLEIEIGNLTVNTVLGSTLI-------NEAE..GSDL..........AN
K5XRW0_AGABU/1528-1917---------LS.ED..FPETEFSSPGVYSNVCLEITLRNLAVNSVLQSQLV-------NELE..GSG..GSTAFD...SI
E9H7I0_DAPPU/1517-1917---------...ED.ATTTLVVNNPGVYTNVCVEMDVDALAVTTLLQSHQV-------LDVE..GTSS.STAFD.VPQVS
G3B805_CANTC/1530-1912---------DY.EN..LDFPVINNPEIYETACLEIDIGTLSINTILTSSII-------NEAE..GADL............
D6WSX8_TRICA/1501-1896---------...QE..GSSEVCNVPGWYSSVCIELDVDCLAINTLLQSHHV-------TDIE..GTSS.ATAFDGVGATS
A8NMZ4_COPC7/1518-1909---------AL.ED..WPRTDFLSPGVYSNVCLEVTVRNLAVNSVLQSVVI-------NELE..GSG..GTTAFD...SV
G0WD71_NAUDC/1559-1949---------LM.ND..SSYIEMNNPNVYDNAVLEIEISNLTVNTVLGSALI-------NDAE..GSDL..........AD
S2J5L9_MUCC1/1535-1930---------MT.SE..IVNTELSFPGAYETVCVEIDVVRLCLNTIIEANVI-------NELE..GATG.GLGGFD...TS
C5GX57_AJEDR/1519-1912---------PM.QK..VDMPSRNTPGAYSSVCIELEIRNLAINTILTSSLI-------NELE..GS.E.STLLNP...VT
E9D9U9_COCPS/1514-1907---------LI.QK..VDMPTINNPGAYSSVCIDLDVRNLAINTILTSSLI-------NDLE..GS.E.SVLLNP...SA
K7J3X8_NASVI/1487-1888---------...EE..SSGCLKNNPGVYSNVCFELDVISLAVTALVQANHI-------NDID..GTSS.YVAFHNAQQTS
O62218_CAEEL/1468-1869---------...DD....TVLLNRETFCETACVELQLSAVAVTALVQRSRV-------LEAE..GADD.VVTFDS...MN
V2XXQ2_MONRO/1528-1918---------PT.DE..LPNTEFLVSGIYPNVCLELTVRNLAVNSVIHSVVV-------NELE..GSG..GTTAFD...SV
R7YYU2_CONA1/1520-1913---------PL.EI..VEMPSINNPGTYSSVCIDLEVRNLAINTVLSSSLI-------NEVE..GS.D.SASFNP...AA
B6QRD6_PENMQ/1519-1904---------SL.DT..VEMPSVNVPGTYTTVSIELEVRNLAINTILTSSII-------NDLE..GS.D.TL.LAS...TK
G6CJ62_DANPL/1482-1880---------...DE..WSSCRVCSRGSYGGVCVALTGDALAVSALLQAHTI-------LQTE..GTSV.ATSFG.AQHAN
G8YP31_PICSO/1529-1911---------SF.HS..IDFPTINNPEIYETTCLEIEIGTLTINTILTSSLI-------NEME..GTDL............
S9XA99_SCHCR/1491-1879---------VA.SP..NDSLEINRSGAYSNACVDVSFSNLAVCSILNSALI-------NEIE..GASD.LAALND.....
N1PFE7_MYCP1/1521-1915---------SM.ET..VEMPAVNNPGTYSSVCIDLSVRNLAINTILSAAML-------NEAE..GS.D.PMGISG...AG
J4I9U6_FIBRA/1520-1910---------PS.EE..LSKTEFCSPGCYSNVCLEITVRNLAVNAVLHSVIV-------NELE..GSG..GATAFD...S.
M7NNI3_PNEMU/1489-1876---------IQ.EG..LDIPLVNNPGSYENVCIELDVKSLTISAILNFALV-------NAFD..S.............VS
DPOE_YEAST/1528-1919---------IM.ND..SEFPKINNSGVYDNVVLDVGVDNLTVNTILTSALI-------NDAE..GSDL..........VN
M2QWE4_CERS8/1506-1894---------PS.DE..LPKTEFQSSGCFSNVCLELTVRNLAVNSVLHSVIV-------NELE..GSG..GATAFD...S.
G2X166_VERDV/1512-1902---------PL.ET..VSMPNVNKPGTFASVCIDLEVRNLAINTILTSSLI-------NDLE..GA.D.SVSFNP...AA
U4LW68_PYROM/1510-1903---------SM.ET..VEMPIINNPGSYSSVCIEIDVRNLAINTILTSSLI-------NELE..GS.D.SVTLNP...AA
Q7RWE3_NEUCR/1534-1926---------PL.DQ..VQMPSVNNPGTYASVCIDLEVRNLAINTILTSSLI-------NELE..GA.D.NISFNP...AA
G4TAK9_PIRID/1551-1940---------LS.ED..VTSPETSRPGCYTNVCLLIEMRNLAVDAVLQSSLV-------NELE..GSG..GTTSFE...AI
H6BPG7_EXODN/1517-1908---------PLTEV..VDMPSINNPGAYTTVCVDVAVQNLTINTILTSSII-------NDLE..GSAE.SVAFNP...AG
C4XXS2_CLAL4/253-635---------DF.DN..FDFITINSPEIYETACLEVEIGNLTINTILTSSLI-------NEAE..GTDL............
DPOE_KLULA/1498-1882---------LM.TD..LVFPIMNNPDIYDDVIFEISVYNSVVNTVLSSTML-------NEAE..GTDL............
G8JME6_ERECY/1494-1883---------LS.MS..LDSPVINNPEIYDSAVLELEINNLTVNTVLTSTLI-------NEAE..GSDF..........GN
E3L3C9_PUCGT/1547-1947---------VM.DV..LSNPEISVMGAYSDASVELTIQHLAMNSVLQSSWV-------YEIS..GGTG.GSLGFQ...DA
DPOE_EMENI/1496-1885---------PL.ER..VGMPCVNVPGSYTTVCVELEVRNLAINTILTSSII-------NEAE..GA.D.SL.LAP...SD
DPOE_DEBHA/1534-1916---------DF.EN..LEFPTINNPEIYETACLEVEIGTLTINTILTSALI-------NEAE..GTDL............
F4NWW9_BATDJ/1562-1979---------.......PTNPEINKPGSFSSMCIEMDIWDLALNTILQTDLL-------HDME..NPIS.STSYNQHQVVT
E5RYM0_TRISP/1442-1827---------...DD..AVDSQINRAGFYKNITFELNIVSLPIAAVLSTSRI-------LDFD..NSEAFFKASSTTKKTG
F4PWS2_DICFS/1559-1964---------...EE..LPKIEINQPDSYSTVCFELDLANLAVNTILESAHL-------ADIE..GIIGGELNNGDPTIFT
K0KG22_WICCF/1507-1890---------DN.EN..YEFPIINNPEIYETVALEVDVSNLTINTVLTSALI-------NEAE..GTDL............
J5JYN7_BEAB2/1524-1910---------PL.DV..VKMPNVNKPGTYSSVCIDLDVRNLAINTILTSSLV-------NELE..GA.D.SVSFNP...SA
U1GF87_ENDPU/1518-1911---------PLTDM..VEMPNINNAGAYSSVCVDLEVRNLAINTILTSSLI-------NELE..GSNG.SISFNP...AA
C5DYX0_ZYGRC/1500-1892---------LQ.ND..LEFPVINNVGVYDKAVLEIEMSNLTVNTVLGSALI-------TEAE..GCDL..........AE
F2PJ05_TRIEC/1466-1860---------PL.NS..VEMTSVNIAGAYSTVCIELEVRNLAINTVLTSSLI-------SDLE..NN.E.PALLNP...TA
F6WUQ7_CIOIN/1486-1883---------...NQRRNASIEINNSGFYQTVCIQLDISSLAVNTVLQSHNI-------NDTE..GASS.GVCFEG.....
J9M470_ACYPI/1505-1904---------...EE..SSSMLVNNEGCYTSYCIELEIDALPVTTLLQSHHI-------HDFE..GTSA.GVAFDQIPQAS
Q59SM7_CANAL/1519-1901---------DF.DS..LAFPTINNPEIYETACLEVEIGTLTINTILTSALI-------NEAE..GTDL............

PF03175

DPOL_ADEG1/239-749IKPSILKIE..AYPPPPEMLDP.LPPICSR-----------------R-------------------------GGRLVWT
Q9QM79_9ADEN/239-780IKPCILKVE..AYPPPAEHLDT.LPPICSR-----------------R-------------------------GGRLVWT
Q9YUR6_9ADEN/339-828IKPMVVMID..AIPPPPEHLDP.LPPLCSR-----------------Q-------------------------SGKLCWT
DPOL_ADEB3/263-744LLPAIFTID..ADPPPEAFLDV.IPPFCSR-----------------K-------------------------GGRLCWT
DPOL_ADECT/392-875LLPGIFTID..ADPPAEEFLDV.LPPFCSR-----------------K-------------------------GGRLCWT
DPOL_ADEB2/268-751LLPGIFTID..ADPPDELFLDE.LPPFCSR-----------------K-------------------------GGRLCWA
DPOL_ADE40/434-918LLPGIFTID..ADPPPENLLDV.LPPLCSR-----------------K-------------------------GGRLCWT
DPOL_ADE12/307-791LCPGIFTID..ADPPDENQLDV.LPPFCSR-----------------K-------------------------GGRLAWT
DPOL_ADE02/443-927LLPGVFTVD..ADPPDETQLDP.LPPFCSR-----------------K-------------------------GGRLCWT
Q9WF13_ADE17/336-820LCPGIFTID..ADPPDEHLLDV.LPPFCSR-----------------K-------------------------GGRLCWT
DPOL_ADE04/438-922LLPGIFTID..ADPPDELMLDP.LPPFCSR-----------------K-------------------------GGRLCWT
Q83895_ADEO7/319-798IKPMIVVAD..CEPPSLDYLDV.LPPLCSK-----------------K-------------------------SGKLCWS
O11414_9ADEN/324-802IKPMIVYAD..CYPPPLEHVDV.LPPLCSR-----------------K-------------------------SGRLCWT
DPO2_KLULA/409-871LLNKHDQEPKNYLNFVPRRIN.........-----------------.-------------------------.RKLTWE
Q09038_LACKL/414-876LIHKSNSKPNHYLEFVPRRID.........-----------------.-------------------------.KKLIWS
DPO1_KLULA/416-866VTPN..RNN..KSNFFPIR.........SH-----------------N-------------------------KITYNNF
O74719_DEBHN/419-870VIPH..TKI..NSNFFPVR.........YN-----------------N-------------------------KITYNNY
DPOL_BPCP1/57-480HIKADFDLKRGYLPTIQIKKKLDALRIGVR-----------------T-------------------------SDYVTTS
Q96206_BPGA1/50-479FEL...KKD..KIPCIQIKGN.....ARFG-----------------Q-------------------------NEYLSTS
DPOL_BPM2/50-474FEL...KEG..YIPTIQIKKN.....PFFK-----------------G-------------------------NEYLKNS
DPOL_BPPZA/50-474FEL...KEG..YIPTIQIKRS.....RFYK-----------------G-------------------------NEYLKSS
DPOL_BPPRD/2-433TKTGLDFNQ.....................-----------------R-------------------------SGIFHTS
O21376_PICKL/474-939VETPKNLVT....GVLPVK..........D-----------------I-------------------------NKGVMYP
Q35599_PHYPO/8-446ITIEK.TNN..NIPVLPYRMG.....IKNN-----------------V-------------------------EVGIIYA
O99973_PORPU/80-478VNI...GKQ..YIPSIPFR.......DKDN-----------------T-------------------------...LKFP
Q9XNK1_PLEOS/738-1218VTAPSEKEL..RVAILPIK..........G-----------------P-------------------------NGELITF
E6ZE21_BETVM/147-562VECPESIVR....PFLPYH.........KV-----------------K-------------------------DPTLLFP
DPOM_MAIZE/299-724IICPKHIKK....PLLPYK..........K-----------------D-------------------------DGTIIFP
Q9TEH5_9PEZI/309-758IK....TIGNTKYPFIPFR...........-----------------S-------------------------ETGLLFP
DPOM_NEUCS/366-859IITPAI.....NIPVLPCR.......VKVN-----------------G-------------------------VQKLIFP
O78938_AGRAE/67-512IITPEYLEH....PILQTH.......LKTS-----------------D-------------------------GIRTLAP
DPOM_NEUIN/401-859VKTPLNLDK....PFLPTRLN.......TP-----------------A-------------------------GTRTAFP
DPOM_ASCIM/589-1039VTAP...DL..KVPIIQTR.......VQTS-----------------G-------------------------GVRTVAP
DPOM_CLAPU/432-888IKSP..DNL..YLGLLPKR...........-----------------T-------------------------ETSLIFP
DPOM_PODAS/450-889VTT...NNQ..YLGLLPVH...........-----------------.-------------------------NQGLIMP

PF03337

Q98188_MCV1/6-651VCAQQELLRRVMPTCDFAHFPDLSSMAIANAALLGACAHDARLFDPVQ-------------------------PDAVAFV
Q9Q8S1_MYXVL/6-624TCTQLITLNDVLSPWNALYFTRLDDAVWTASIYEASK...SNVYYPSG-------------------------HEAMSFI
Q070L3_CPRVZ/15-682ALAQSAALAEAFGRPDPLRCPSLFDAFYEHLIARAAQVPALAPTRCSH-------------------------PDLADLL
Q6TUY6_YMTV5/10-640VVNHISYLNSELYPMCFFSFFCLEDMIILKAMYLSAEEDNKQIYVPAG-------------------------NTTTDII
Q08FW7_DPV83/7-651INNHFTAINVLIQPWFMLSFNKLEDMVITKVLHMAAGKVGNNMYYPTG-------------------------NDSINFI
Q6TVW0_ORFSA/6-637ALAHQAALARIFPSCDMAAFRGLREMVLANAARGCAAC.......PVH-------------------------FSALNMV
F12_VACCW/6-635FETQSGALEVLMSPCRMFSFSRIEDMFLTSVINRVSENTGMGMYYPTN-------------------------DIPSLFI
Q8V3R9_SWPV1/5-644IITQSVALNTLLSPWNVSLFNRIEDIIIVKSNYSAATHIGNSVYYPSG-------------------------YDAFNFI

PF00136

DPOD_YEAST/555-991MNKVLKKILIERNVDGA.......L--------------AFV-----R.........................ETINDIL
DPOD1_CAEEL/520-978LGVCLEKLLIERDQQSA.......L--------------DFA-----K.........................RTISDLL
DPOL_FOWPN/483-977IQRYKDMLMKLLMESKG.......Q--------------QEI-----T.........................RLILQSL
DPOL_IIV6/578-1226YANVIDKIFDEQSENEILN..GVVE--------------KML-----NLYTRQ..............IEFTSCEKDENYL
DPOL_MUHVS/543-1050VSDVLHMVFNDETVSEG.......T--------------MKL-----S.........................RMTFDDL
DPOLA_ORYSJ/834-1303GDFCLNQILSGGSCDDV.......I--------------ESI-----H.............................SSL
DPOL_BPT4/383-855KRYALNVYDMEDKRFAE........--------------PHL-----K.........................IMGMETQ
Q98207_MCV1/494-994ISRYKAQLVALLAEAR........L--------------SSR-----Q..........................VCIEML
DPOL_EHV2/530-1004TKAILDLVMGDEAVRAA.......A--------------ERL-----C.........................AMRVEEV
DPOLA_DROME/805-1258GKAVLDEVLSEKPLEEK........--------------...-----.........................LDAVHAQL
DPOL_VZVD/597-1136ARKLVELLLYDDTVSRA.......A--------------AE