Sequence alignment for CL0195

PF05424

C6KSK8_PLAF7/1742-1925------------.ICLPPRRQYMC...........LRKIERM...................................ITK
Q8IBW9_PLAF7/122-329------------GACAPFRRLNLC...........NKNFPNM...................................NSN
Q9U0G5_PLAF7/121-326------------GACAPYRRLFLC...........NKNMEKM...................................GRT
Q8I643_PLAF7/120-309------------GACAPYRRLYMC...........DRNLEHI...................................EPT
C6KTF9_PLAF7/118-306------------GACAPYRRLHLC...........DQHLEKI...................................NRY
Q8I1V6_PLAF7/115-326------------GACAPYRRLSLC...........NKNFQKI...................................NNY
Q8IEU9_PLAF7/2383-2561------------DVYLPPRREHIC...........TSNLEYL................................LKGNSD
C6KSK8_PLAF7/109-287------------GACAPFRRLHLC...........DYNLEKM...................................GST
Q8I3E5_PLAF7/117-318------------GACAPYRRLHVC...........DKNMEKI...................................PTS
Q8IIZ4_PLAF7/1260-1475------------GLCIPPRRKRLY...........VKDLETF......................................
Q8I3E6_PLAF7/2552-2733------------.VCIPPRRENMC...........ISNLDEI...................................EIA
Q8IEU9_PLAF7/131-312------------.ACVPPRRRHIC...........DQNLEFL...................................DNP
Q8IFQ6_PLAF7/934-1170------------.ICVPPRRRRLY...........VGKLHDW......................................
Q8I218_PLAF7/1242-1426------------GACVPPRREKFC...........VSLLAKE......................................
O97312_PLAF7/904-1147------------.VCVPPRRRKLY...........VGELTKW.....................AEEARKSSTSPQPGESG
Q8IEV1_PLAF7/910-1147------------.ICVPPRRRRLY...........VTPLTKW.................................ATNME
Q8IBX3_PLAF7/952-1178------------.ICVPPRRRRLY...........VGRLTKW......................AESKQVTQPQEDGKAP
Q8IBX3_PLAF7/116-314------------GACAPYRRLNLC...........NKNLENI...................................NKY
Q9NFB6_PLAF7/125-323------------GACAPYRRLHLC...........SHNLESI...................................QTN
Q8I495_PLAF7/910-1175------------.ICVPPRRRRLY...........VTPLTTW........ASGGTTQVETQASGGNTETSQVSGETTPQG
Q8I2E4_PLAF7/119-300------------.VCVPPRRQHIC...........DHNLEYL...................................NNN
Q8IFK7_PLAF7/116-318------------GACAPYRRLSLC...........NKNFPNM...................................NSK
Q8IAK1_PLAF7/116-313------------DACAPFRRLHVC...........DRNLEQI...................................DPA
Q8I218_PLAF7/2168-2413------------.ICVPPRRRRLY...........VGKLTQW..............................ASQRTQGG
Q8IAS4_PLAF7/118-313------------GACAPFRRLHVC...........DKNIQQI...................................KTE
C6KTF9_PLAF7/934-1177------------.ICVPPRRRRLY...........VGGLTKW.........................AEKQSSQGGGAPQ
Q8IEU9_PLAF7/856-1028------------GIYMPPRRQHFC...........TSNLEKL......................................
Q8I3E6_PLAF7/842-1024------------DVYLPPRREHMC...........TSNLEHL................................VTDNKP
Q8I640_PLAF7/123-310------------GSCAPYRKLQLC...........DYNLEKI...................................TDA
C0H510_PLAF7/113-322------------GACAPYRRLSLC...........NKNMEKK...................................GTT
Q8I521_PLAF7/853-1030------------DVYMPPRRQHMC...........TSNLEKL......................................
Q8IBX1_PLAF7/111-315------------GACAPYRRLSLC...........NKNFQNN...................................NND
O96296_PLAF7/120-322------------GACAPYRRLHLC...........SHNLESI...................................DTT
C6KSL0_PLAF7/129-310------------GACAPFRRQNLC...........DKNLEYL...................................INE
Q8I218_PLAF7/129-308------------GACAPFRRQNMC...........DKNLEYL...................................DNT
Q8I3E6_PLAF7/2108-2290------------GTCMPPRRKKLC...........INNIQYL......................................
Q8I640_PLAF7/1284-1472------------GACMPPRRIKLC...........IYYLENH......................................
Q8IBW7_PLAF7/123-318------------GACAPYRRLHVC...........DKNMEKM...................................GRT
O97324_PLAF7/115-303------------GACAPFRRLNLC...........VRNLENI...................................NNY
Q8IIZ5_PLAF7/116-320------------GACAPYRRLHLC...........NKNMVKM...................................DTN
Q8I640_PLAF7/1732-1913------------.LYIPPRRQHMC...........INHLKQI...................................IKY
Q8I519_PLAF7/120-316------------GACAPYRRLSLC...........NKNMEKM...................................GRT
Q8I2E3_PLAF7/124-323------------GACASFRRLNLC...........KKNMEKI...................................PTS
Q8IAK3_PLAF7/1753-1975------------GLCIPPRRRKLY...........VTPLTKW.................................ATTAV
Q8IBW8_PLAF7/116-303------------GACAPFRRLHLC...........VRNLENI...................................NIK
O96296_PLAF7/974-1223------------.ICVPPRRRRLY...........VGGLTKL...............................TSAGTSS
Q8I520_PLAF7/119-315------------GACAPLRRLHVC...........NKNMEKM...................................DST
Q8IBW8_PLAF7/915-1170------------.ICVPPRRRRLY...........VTPLTRL............................AGGDGNTQAG
Q8IFQ2_PLAF7/123-317------------GACASFRRLNLC...........NKNMENM...................................DTN
Q8IHM0_PLAF7/121-304------------GACAPYRRRHLC...........DYIFHQV...................................NDN
C0H4I1_PLAF7/111-311------------GACAPYRRLHVC...........DKNMVKM...................................DTN
Q8IFQ4_PLAF7/118-307------------GACAPYRRLHVC...........DQNLELI....................................KP
Q8I639_PLAF7/580-759------------...LPPRTQSLCLVVCLDEKGKKTQELKNI......................................
Q8IBX2_PLAF7/125-327------------GACPPYRRLSLC...........NKNLENI...................................KTN
Q8I4N5_PLAF7/122-316------------GACAPYRRLHLC...........HHNLESI...................................QTK
Q8I521_PLAF7/1364-1616------------.ICVPPRRRKLY...........LGGFKRL..............................TDGTAVSS
Q8IAK2_PLAF7/126-305------------GACAPYRRIQLC...........DYNLEYI...................................NEY
Q8I2C4_PLAF7/113-306------------GACAPYRRLHLC...........HHNLENI...................................KDV
C6S3L1_PLAF7/120-316------------GACAPYRRLHLC...........NKNFPNM...................................NSK
Q8IAK3_PLAF7/126-312------------GACAPYRRLHIC...........DHNLENI...................................NDY
Q9U0G6_PLAF7/120-328------------GACAPYRRLSLC...........NKNFQKI...................................NNY
Q8IEV1_PLAF7/111-324------------GACAPYRRLHLC...........DYNLEKM...................................GKT
Q8IK37_PLAF7/120-313------------GACAPYRRLSLC...........NKNFPNM...................................NSK
Q8I639_PLAF7/95-277------------.VFVPPRRQRMC...........INNLEKL...................................NVD
C6KTF7_PLAF7/114-310------------GFCAPYRRLHLC...........VQNLEQI...................................KPD
Q8I3E6_PLAF7/131-310------------GACAPPRRRHMC...........DKNLEAL...................................TVE
Q8IEU9_PLAF7/1256-1440------------GACMPPRRQKLC...........VYFFANP......................................
Q8IBD8_PLAF7/125-315------------GACAPYRRLHLC...........HHNLETI...................................ETT
C6KTF7_PLAF7/1360-1539------------GACMPPRRQSLC...........IHNLKES......................................
Q8IHM0_PLAF7/1930-2141------------.ICVPPRRRRLY...........VKDLEKI......................................
Q8I220_PLAF7/131-336------------GACAPYRRLHLC...........HHNLESI...................................ETT
Q8IAS7_PLAF7/113-309------------GACAPFRRLFLC...........DQHLSHM...................................KAE
O96108_PLAF7/112-313------------GACAPYRRLHVC...........VRNLENI...................................NDY
C6KT15_PLAF7/112-299------------GTCAPLRRLFLC...........DQHLSHM...................................KEG
Q8IBX0_PLAF7/105-299------------GACAPYRRLHVC...........DQNLEQI...................................RPE
Q8IIZ6_PLAF7/115-307------------GACAPYRRLNLC...........VRNLENI...................................SNY
C6KSK8_PLAF7/1300-1484------------GSCMPPRRIKLC...........VSGLTQT......................................
Q8IBX0_PLAF7/1251-1436------------GVCMPPRRQNLC...........VHYLTQL......................................
Q8IAK3_PLAF7/1246-1437------------GACMPPRRQKLC...........VSGLTQG......................................
Q8I098_PLAF7/123-313------------GACAPYRRRHIC...........DYNLHHI...................................NEN
Q8IIZ4_PLAF7/124-318------------GACAPYRRRNIC...........DYNLEHL...................................NER
Q8I098_PLAF7/1757-1937------------GACMPPRRIKLC...........VINLQYL......................................
Q8IIZ4_PLAF7/902-1079------------GVYMPPRRQKLC...........VINLEHF......................................
O97312_PLAF7/113-314------------GACAPFRRLHVC...........DRNLEQI...................................KPH
Q8IAS3_PLAF7/121-322------------.ECAPYRRLSLC...........NKNFQKI...................................NNI
Q8ID12_PLAF7/118-329------------GACAPYRRLYLC...........DKNLETI...................................SNY
Q8IFQ6_PLAF7/126-320------------GACAPLRRLHLC...........NKNMEKI......................................
Q8I5L5_PLAF7/114-314------------GACAPYRRLHLC...........HHNLESI...................................DTT
Q8IAK2_PLAF7/1289-1477------------.ECMPPRRQKLC...........LYFLAHK......................................
Q8IIZ6_PLAF7/906-1187------------.ICVPPRRRRLY...........IQKLHDWATAVSPQASGDKATQAAEPQASDKAAQVTEASASSSSS
Q8I218_PLAF7/1615-1795------------GACMPPRRQKLC...........VINLQYF......................................
Q8I521_PLAF7/119-309------------GACAPYRRSSLC...........DHHLSYM...................................NAG
Q9NFB4_PLAF7/120-307------------GACAPFRRQNMC...........DKNLEYL...................................INK
Q8IAK2_PLAF7/1732-1914------------.FCIPPRRKDMC...........LKQLEEI...................................NSA
Q8I220_PLAF7/902-1085------------KVCMPPRRQKLC...........LYYIAHE......................................

PF03011

O96296_PLAF7/1525-1663LLKRWLEYFLEDYNKIK.HKISHC-----------TKNGKG.-------------------------------------S
O96296_PLAF7/659-826FFYFWIGRFLNDSMYWR.GKVNSC-----------INNPKR.-------------------------------------K
O97324_PLAF7/1459-1607LFKRWLEYFFEDYNRIQ.KKLKPC-----------IENGKGK-------------------------------------E
Q9U0G5_PLAF7/1554-1700LVTHWVQNFLEDYKKIK.HKISHC-----------TKTDQG.-------------------------------------.
O97312_PLAF7/1471-1611LIKRWLEYFLEDYNKIK.KKLKSC-----------TEKGEG.-------------------------------------.
Q9U0G6_PLAF7/1479-1628LVTHWVQNFLDDYKKIK.HKISHC-----------TKTDQG.-------------------------------------.
O96108_PLAF7/594-741FFYGSIIDMLNESIEWR.ERLKSC-----------INDAKLG-------------------------------------K
O97312_PLAF7/590-735FFWSWVSRMLNDSIKWR.NQHSKC-----------INNKKE.-------------------------------------.
O97324_PLAF7/586-729LFWRWVTEMLKDSIDWR.KEYKNC-----------INNGD.K-------------------------------------S
Q9U0G6_PLAF7/661-824FFYYWVAHMLKDSIYWRTKKLDKC-----------LQNGN.K-------------------------------------K
Q9U0G5_PLAF7/675-823FFNFWVAHMLKDSIHWRTKKIKGC-----------LKNGKAI-------------------------------------K

PF05424

C6KSK8_PLAF7/1742-1925DVDD.......KDK...............FFQVVMKAAKEEGIRILKNYKEQN...........................
Q8IBW9_PLAF7/122-329DSSK......AKHD...............LLVDVCLAAKYEGDSLKHYSEKLN...........................
Q9U0G5_PLAF7/121-326STTK........HD...............LLLDVCMAANYEAQSLIRYHDKHQ...........................
Q8I643_PLAF7/120-309KITT........HN...............LLLDVCLAAQYEGQSISQNHGKHQ...........................
C6KTF9_PLAF7/118-306DKVN.......NHT...............LLTDVCLAAKFEAESLKTYRGQHQ...........................
Q8I1V6_PLAF7/115-326DSSK......AKHN...............LLVDVCMAANYEAQSLIPYHDQYD...........................
Q8IEU9_PLAF7/2383-2561QIMKVGNNK.INHS...............FLGEVLLAAKYEAEFIKTNYTRLN...........................
C6KSK8_PLAF7/109-287KIKD.......KNV...............LLAEVCMAAKYEGQSLLKQYEEHK...........................
Q8I3E5_PLAF7/117-318KTST........DT...............LLAEVCYAAKYEGDSISGRYRQHQ...........................
Q8IIZ4_PLAF7/1260-1475.......SDHTTVG...............LREAFIKCAAVETFFAWHEFTKEK..........EREYKEEKQRNGELGFI
Q8I3E6_PLAF7/2552-2733KVNQ.......SNY...............LLNMVRIAARNEGIDIIKNFNSQN...........................
Q8IEU9_PLAF7/131-312HTDD.......TDD...............LLGNVLVTAKYEGNYIVSNHPDKN...........................
Q8IFQ6_PLAF7/934-1170......ASGNTQEDGKAQPQGDTPSQPDPLLKAFVESAAVETFFLWDRYKKLN..............TKRQGVGAGAPQL
Q8I218_PLAF7/1242-1426.....GIFKNKGED...............IRETFVKSAALETYFAWKRYNDDN...........................
O97312_PLAF7/904-1147VANASASSTSSPTDATQL...........LRDAFIQSAAIETFFLWHKYKAEN..........TRDNKSPLGNGGVAQFF
Q8IEV1_PLAF7/910-1147ATEAQAGGDEATEASVPLGDGVSKNPKEALLKAFVESAAVETFFLWHRYKKIKDKEKKEKEERERENAGL.......DPF
Q8IBX3_PLAF7/952-1178LAPTPPTSSGSQSDP..............LLTAFVESAAIETFFLWHKYKVDKIREEKEQQELFTNTSTL..........
Q8IBX3_PLAF7/116-314DNTK......AKHD...............LLAEVCHAAKYEGASITLHYPQYQ...........................
Q9NFB6_PLAF7/125-323NYNS....GNAKHN...............LLVDVCMAAKYEGDSIKNYYPKYQ...........................
Q8I495_PLAF7/910-1175QTPSESEAQTASQDPSEK...........LRTAFIESAAVETFFLWDRYKKEN................TKRQSVLPLLE
Q8I2E4_PLAF7/119-300NTDD.......TDD...............LLGNVLVTAKYEGQSIVNNHPHKE...........................
Q8IFK7_PLAF7/116-318DSLK......AKND...............LLADVCLAAKHEGNSINTHYQKYQ...........................
Q8IAK1_PLAF7/116-313KITA.......THN...............LLVDVCQAAKFEGQSITQDYPKYL...........................
Q8I218_PLAF7/2168-2413TSSQIVGKTASQPNSHPTLSPSSNPRDDGLRDAFIQSAAVETFFLWDRYKKLN......TKKPDATLGGLPQIPLAMGAI
Q8IAS4_PLAF7/118-313NIT........THN...............LLLDVCLAAKYEGESLKGYHEQYE...........................
C6KTF9_PLAF7/934-1177VSPSATASSGSQSDPL.............LLTAFVESAAIETFFLWDRYKKIKEKEIEEKKKQENEKYNILGVK......
Q8IEU9_PLAF7/856-1028DVSRVIRNGNASNS...............LLGDVLLAAKYEAERTKNHYVSKK...........................
Q8I3E6_PLAF7/842-1024LDGTDGNPKLVNNS...............FLGDVLLSAKYEAQRTKEDYEPVS...........................
Q8I640_PLAF7/123-310NVTN.......THN...............LLVDVLLAAKHEGDSLSKYMKENP...........................
C0H510_PLAF7/113-322KIKD.......KND...............LLAEVCMAANYEAQSLIPYHDKYK...........................
Q8I521_PLAF7/853-1030NYASVIGSNNVNDK...............FLVEVLHAAKSEAEFIKKKYNEKQ...........................
Q8IBX1_PLAF7/111-315HSSN......AKHD...............LLLDVCMAANYEAQSLITYHDKHE...........................
O96296_PLAF7/120-322SM.........THK...............LLLEVCMAAKYEGNSIDTHYPQHQ...........................
C6KSL0_PLAF7/129-310NTKT.......THD...............LLGNVLVTAKYEGDYIVNNHPNRG...........................
Q8I218_PLAF7/129-308NTDD.......TDD...............LLGNVLVTAKYEGESIVAKHPHKE...........................
Q8I3E6_PLAF7/2108-2290...NYETVNKREKD...............IKEAFIKCAAIETHFAWHRYKEDN...........................
Q8I640_PLAF7/1284-1472...TQKGNIKKEFQ...............LREAFIKCAGAEIFLLWQKYKTDN...........................
Q8IBW7_PLAF7/123-318SMTT........HK...............LLAEVCYAAKYEGASITLHYPQYQ...........................
O97324_PLAF7/115-303GKIN.......NDT...............LLADVCLAALHEGDSIRGDHDKYK...........................
Q8IIZ5_PLAF7/116-320NDDS....SKAKHN...............LLLDVCMAAKYEGYSINTHYPKHQ...........................
Q8I640_PLAF7/1732-1913TDTD.......STT...............LLKKVQEVAKKEGDDIIKKLLPKY...........................
Q8I519_PLAF7/120-316STTK........HD...............LLLDVCMAANYEAESLIPYHDQYE...........................
Q8I2E3_PLAF7/124-323ST.........KHD...............LLADVCMAANYEAQSLIRDHPKYK...........................
Q8IAK3_PLAF7/1753-1975SSEATPAPSQSESDK..............LREAFIQSAAIETFFLWHKYKQEK.......KPPSEQNAGAALV.......
Q8IBW8_PLAF7/116-303KKID.......NDN...............LLADVCLAAKYEGDLIKTHYTPYE...........................
O96296_PLAF7/974-1223ESPQGGSESSRASDVSQGNGGDDITTTESLRKWFIETAAIETFFLWHRYKKEW....EAQKKAELQRNGLLLGTGASLNL
Q8I520_PLAF7/119-315KIKD.......KNV...............LLAEVCYAAKYEGKSLVEKYKEYK...........................
Q8IBW8_PLAF7/915-1170ETTQGNGASTETPEAS.............LRRAFVESAAVETFFLWHKYKEEK...............KTPATQNGALPL
Q8IFQ2_PLAF7/123-317NNDG.....KAKHN...............LLAEVCLAAKYEGDSLKHYSKKLN...........................
Q8IHM0_PLAF7/121-304YIKT.......SDD...............LLGNLLVTAKYEGESIVNSYANSG...........................
C0H4I1_PLAF7/111-311NDSK......AKHD...............LLLDVCLAAKYEGESLKTYRAQYD...........................
Q8IFQ4_PLAF7/118-307KNIT.......THN...............LLVDVCLAAKFEAESLKTYRGKYQ...........................
Q8I639_PLAF7/580-759.........RTNSE...............LLKEWIIAAFHEGKNLKPSHEKKN...........................
Q8IBX2_PLAF7/125-327IIDN.......KHD...............LLVDVCMAAKYEGESIKAHYPKYD...........................
Q8I4N5_PLAF7/122-316NYNS....SNAKHD...............LLAEVCMAAKYEGETLTTEHGKHQ...........................
Q8I521_PLAF7/1364-1616ETTSATSSHASNGDA..............LLTAFVESASVETFFAWHKYK.......MEKKQPAQEGAGL........GL
Q8IAK2_PLAF7/126-305NINS.......THD...............LLGNLLVMAKREGDSIVNSHGHTG...........................
Q8I2C4_PLAF7/113-306NNID.......NDT...............LLAEVCMAAYYEGESLTRYNPIYQ...........................
C6S3L1_PLAF7/120-316DSSK......AKHD...............LLVDVCMAAKYEGESLKVYHEQYE...........................
Q8IAK3_PLAF7/126-312KNIN.......NHT...............LLVDVCLSAKHEGEMIANKLKEYD...........................
Q9U0G6_PLAF7/120-328SSKA.......KHN...............LLLDVCLAANHEGQSIKTHLKQYD...........................
Q8IEV1_PLAF7/111-324STTK........HD...............LLAEVCMAAKYEGDSIKTHYTIHK...........................
Q8IK37_PLAF7/120-313DSLK......AKND...............LLVDVCYAAKYEAESLIPYHDQYK...........................
Q8I639_PLAF7/95-277KIRD.......KHA...............FLADVLLTARNEGERIVQNHPDTN...........................
C6KTF7_PLAF7/114-310QITS.......THN...............LLVDVLLAAKYEGQSITQDYPKYQ...........................
Q8I3E6_PLAF7/131-310NTQN.......CDD...............LLGNILVAAKYEGQSIVNNYPDKN...........................
Q8IEU9_PLAF7/1256-1440...SQIGSINKQDN...............LRKAFIISAAAETFRSWQYYKSKN...........................
Q8IBD8_PLAF7/125-315SKTS.......TDT...............LLAEVCMAAYYEGESLTRQHVKHK...........................
C6KTF7_PLAF7/1360-1539......NETGTEQQ...............LREAFINCAAIETFWLWYKYKKDK...........................
Q8IHM0_PLAF7/1930-2141.....GDGEVTQVQ...............LRDAFIKCAAIETFFSWHKFKKDK........EKKKKPQQQHALHPLFVQD
Q8I220_PLAF7/131-336SKTA.......SDT...............LLLEVCMAAKYEGQSINTHYTKHE...........................
Q8IAS7_PLAF7/113-309KINN.......KHN...............LLLEVCLAAKYEGESLKGYHDKYN...........................
O96108_PLAF7/112-313SKIN......NKHN...............LLVEVCLAAKYEGESITGRYPQHQ...........................
C6KT15_PLAF7/112-299NINN.......TDN...............LLLEVSLAAKYEGDSIINNYPDNR...........................
Q8IBX0_PLAF7/105-299QITS.......TDN...............LLADVCLAAKHEGESIIKNYPQDR...........................
Q8IIZ6_PLAF7/115-307GKIN.......NDT...............LLADVCLAALHEGAAISSDHGKYQ...........................
C6KSK8_PLAF7/1300-1484......NNIINKED...............IRTHFITCAAIETYFAWLRYKKIN...........................
Q8IBX0_PLAF7/1251-1436......DDKDDENK...............LREAFIKSAAAETFVLWQNYNSKN...........................
Q8IAK3_PLAF7/1246-1437......GKITTIED...............IRTQFITCAAIETHFAWHKYKKDN...........................
Q8I098_PLAF7/123-313NIRN.......THD...............LLGNLLVMARSEGESIVKSHEYTG...........................
Q8IIZ4_PLAF7/124-318NVLN.......THD...............LLGNVLVMAKREGESIVEKHPNRG...........................
Q8I098_PLAF7/1757-1937......NEKKSPEE...............LRKAFIQCAAIETYWLWQKYKKDK...........................
Q8IIZ4_PLAF7/902-1079.......KENTSDD...............LREAFIKCAAAETYLLWQKYKEDN...........................
O97312_PLAF7/113-314TITA.......THN...............LLVDVCYAAQFEGKSISGYYPRYQ...........................
Q8IAS3_PLAF7/121-322DSDK......ARHN...............LLVDVCLAAHYEGDSIKAHLEQYD...........................
Q8ID12_PLAF7/118-329NSNA.......RHK...............LLAEVCYAAKEEGDLIKTHYTEHK...........................
Q8IFQ6_PLAF7/126-320ATST......AKHD...............LLVDVCMAANYEAQSLIRDHPQHK...........................
Q8I5L5_PLAF7/114-314STTS........DT...............LLAEVCYAAKFEGETLTTQHGQHQ...........................
Q8IAK2_PLAF7/1289-1477...IETPNLNTQED...............LRKAFIKCAAAETFFSWYYFKKIN...........................
Q8IIZ6_PLAF7/906-1187ESNSVQTTPASTSSPSNSRDVD.......LVKAFVESAAVETFFLWDRYKKEN......TKRQGGGAGGLGGVPGV..EL
Q8I218_PLAF7/1615-1795.......KGKTTVD...............LREAFIKCAAVETFFLWHKYKEDN...........................
Q8I521_PLAF7/119-309KTNT.......TDN...............LLLEVCMAAQYEGQSIRGQHDKHK...........................
Q9NFB4_PLAF7/120-307NTEN.......THD...............LLGNVLVTAKYEGESIVNNHPDKD...........................
Q8IAK2_PLAF7/1732-1914DVNN.......SKK...............LLQKIQDVAKKEGDDIIKKLLPKY...........................
Q8I220_PLAF7/902-1085...SETKNIETQDD...............LRDAFIRTAAAETFLSWQYYKIKN...........................

PF03011

O96296_PLAF7/1525-1663K.CIKG..C.....---------------.VDKWVQQKKEEWKQIKERFNEQY---------------------------
O96296_PLAF7/659-826K.CRNE..CKDDCG---------------CFKEWIGKKKEEWENIKKHFKTQE---------------------------
O97324_PLAF7/1459-1607Q..KCFKGCKENCD---------------CVKKWVEEKEKEWPKIRKRYLEQY---------------------------
Q9U0G5_PLAF7/1554-1700..STCQNKCQNKCK---------------CVGEWIKLKQQEWEEIKKRFLNQY---------------------------
O97312_PLAF7/1471-1611SPCIKE..C.....---------------.VDTWITEKRKEWKTIKERYVDKY---------------------------
Q9U0G6_PLAF7/1479-1628..STCQNKCQNKCK---------------CVGEWIPKKREEWQQIKDRFLKQY---------------------------
O96108_PLAF7/594-741C..RKG..CKNPCE---------------CYKRWVEKKKDEWDKIKEFFRKQK---------------------------
O97312_PLAF7/590-735..TKCIEGCKKTCE---------------CFEKWVGQKKTEWRKIKHHFDQQE---------------------------
O97324_PLAF7/586-729T.CKNV..CKKPCD---------------CFQKWGVRKTKEWQQVKAHYEKED---------------------------
Q9U0G6_PLAF7/661-824C.GKKI..CNGDCE---------------CFQRWVEKKKTEWTNIKDHFVKQK---------------------------
Q9U0G5_PLAF7/675-823C.TDK...CKGDCK---------------CFERWVEQKREEWTNIKEHFGKQT---------------------------

PF05424

C6KSK8_PLAF7/1742-1925........................KTDFSEICDDMKYSFADLGDIIRGK.........DLWNTDKNY......K......
Q8IBW9_PLAF7/122-329............LTYT..D.....SPS..QLCTELARSFADIGDIIRGK.........DLYLGYNRK......E......
Q9U0G5_PLAF7/121-326............LTNE.........GS..QICTVLARSFADIGDIIRGK.........DLYLGKKKK......K......
Q8I643_PLAF7/120-309............LSYP..D.....SPS..QLCTELARSFADIGDIVRGR.........DLYRGNNRE......N......
C6KTF9_PLAF7/118-306............LTNE.........GS..QICTVLARSFADIGDIVRGK.........DLYLGNNKE......K......
Q8I1V6_PLAF7/115-326............ATYP.........GSDFSMCTMLARSFADIGDIIRGK.........DLYRGKKKK......K..QNGK
Q8IEU9_PLAF7/2383-2561.......................GQNDNGAKCRAMKYSFADIGDIVRGR.........DLWEHNDFK......K......
C6KSK8_PLAF7/109-287.....................NNYPHT..NICTVLARSFADIGDIVRGK.........DLFLGHQQR......K......
Q8I3E5_PLAF7/117-318............LTNK.........GS..QLCTVLARSFADIGDIVRGR.........DLYLGYDDK......E......
Q8IIZ4_PLAF7/1260-1475DENDQIPKDPDNPQNK..IRKNGEIHE..EFKSQMFYTLADYRDILFGN.........NI....................
Q8I3E6_PLAF7/2552-2733........................GCAMNPICDTMKYSFADLGDIVRGT.........DMLRIGGYL......P......
Q8IEU9_PLAF7/131-312.....................SNGNKS..GICTSLARSFADIGDIVRGR.........DMFKSN................
Q8IFQ6_PLAF7/934-1170QEEDDNDEEEENPQQE..L.EDGTIPD..DFLRQMFYTFGDYRDIFFGN.........NI....................
Q8I218_PLAF7/1242-1426..........KKAEEE..L.KSGTIPE..NFKRQMYYTFADYRDIFFGT.........DI....................
O97312_PLAF7/904-1147GSYSGSESEEKTPQQW..L.QSGTIPT..DFLRQMFYTLGDYRDLCVGV.......KEDVINALKAS......G...DNP
Q8IEV1_PLAF7/910-1147GGSVDDEASTPDPQTQ..L.QSGTIPP..DFLRQMFYTLGDYRDICIGG.......DRDIVGDTIVS......N......
Q8IBX3_PLAF7/952-1178.........GKELQDK..L.ERGNIPT..DFLRQMFYTLGDYRDILFSGSKDAKNGVNDIF...............SGDK
Q8IBX3_PLAF7/116-314............NKYD..D.....SGS..TMCTMLARSFADIGDIIRGK.........DLYLGKKKK......K....QN
Q9NFB6_PLAF7/125-323............RTYP..D.....TNS..QLCTVLARSFADIGDIVRGK.........DLYLGNPQE......S......
Q8I495_PLAF7/910-1175PINGDTISDDNNPEK...LLKVGKIPP..DFLRLMFYTLGDYRDILFSSSNTSDTTGKETPSSSNDNLKNIVIEAGGTDE
Q8I2E4_PLAF7/119-300.........................TS..DVCTALARSFADIGDIVRGI.........DMFKPNDQD......E......
Q8IFK7_PLAF7/116-318............AQYASSA.....SSS..QICTMLARSFADIGDIVRGK.........DLYSGNKKK......K......
Q8IAK1_PLAF7/116-313............ATYN..D.....SPS..QICTMLARSFADIGDIVRGK.........DLFRGYDDE......E......
Q8I218_PLAF7/2168-2413NGYVPS.GDDNNPQKK..L.EEGEIPE..EFKRQMFYTLGDYRDILFGK........NDIVIGNTGS......G..ASDK
Q8IAS4_PLAF7/118-313............VQYP..S.....SGS..TMCTELARSFADIGDIVRGR.........DLYGGSKKE......K......
C6KTF9_PLAF7/934-1177..QEDILSDQDHPQKK..LQKSGEIPN..DFLRQMFYTLGDYRDILVRG....GHKTNGVHTNSDKT......NIVLLAS
Q8IEU9_PLAF7/856-1028.........................EEHSEACRAVRYSFADLGDIIRGK.........DMWDKNHGE......K......
Q8I3E6_PLAF7/842-1024........................DEQ..SICRAVRYSFADLADIIRGR.........DMWDKDDGA......Q......
Q8I640_PLAF7/123-310.....................KIIPKS..NVCTVLARSFADIGDIIRGK.........DLYVGNRKE......K......
C0H510_PLAF7/113-322............LTYG.........DS..KICTALARSFADIGDIVRGK.........DLYRGGGRG......R......
Q8I521_PLAF7/853-1030.................NDGKNGLRKDQATTCRAIRYSFADIGDIIRGK.........DLWDDNNDA......K......
Q8IBX1_PLAF7/111-315............LTNV.........GS..QICTVLARSFADIGDIVRGK.........DLYLGKKKK......K....KT
O96296_PLAF7/120-322............RTNE..D.....SPS..QICTMLARSFADIGDIVRGK.........DLFYGNSKE......K......
C6KSL0_PLAF7/129-310.........................SS..EVCIALARSFADIGDIVRGK.........DMFKSNDN..............
Q8I218_PLAF7/129-308.........................NS..EVCTALARSFADIGDIVRGK.........DMFKRNEED......A......
Q8I3E6_PLAF7/2108-2290..........KKAEDE..L.KKGTIPD..EFKRIMYYTYGDYKDMFFGT.........DI....................
Q8I640_PLAF7/1284-1472.......NSDTKLQTQ..L.ESGQIPE..EFKRQMFYTFGDFRDLCLGN.........DI....................
Q8IBW7_PLAF7/123-318............EKYD..D.....SPS..EMCTMLARSFADIGDIVRGK.........DLFIGYNQK......D......
O97324_PLAF7/115-303............ETND.........SS..QLCTMLARSFADIGDIIRGK.........DLYRGNNGK......D......
Q8IIZ5_PLAF7/116-320............EKYKDTG.....TAS..QLCTVLARSFADIGDIVRGR.........DLFRGNKKK......S......
Q8I640_PLAF7/1732-1913........................PCNEDVICKAMKYSFADLGDIIRGR.........DIYIGNNN..............
Q8I519_PLAF7/120-316............ATYK.......DYGS..TMCTMLARSFADIGDIIRGR.........DLYSGNKVK......K......
Q8I2E3_PLAF7/124-323............LKYS.........DS..QLCTELARSFADIGDIVRGR.........DLYLGNPQE......K......
Q8IAK3_PLAF7/1753-1975..LLQGVTPQEDPQNK..L.KSGTIPE..EFKRQMFYTLGDYADIFFGK........NDILIGKTGT......G..SAKD
Q8IBW8_PLAF7/116-303............HKYG..D.....SPS..QLCTMLARSFADIGDIVRGK.........DLYLGNSRE......K......
O96296_PLAF7/974-1223G......GDDSNPQTQ..LQKSGTIPL..DFLRLMFYTLGDYRDILVRGVADDKNGGNNIILNA............SGNK
Q8I520_PLAF7/119-315............QPNN..D.....SDT..DICTALARSFADIGDIVRGK.........DLYLGYDDE......E......
Q8IBW8_PLAF7/915-1170PLAPDVSPPSENPQTK..L.EGGNIPE..EFLRQMFYTLGDYRDILVRG........GDVNSDSEKK......DGDSNSD
Q8IFQ2_PLAF7/123-317............LTYT..D.....SPS..QLCTELARSFADIGDIVRGK.........DLFLGHKQR......K......
Q8IHM0_PLAF7/121-304.........................MF..NVCTALARSFADIGDIIRGK.........DLYLGNGDY......K......
C0H4I1_PLAF7/111-311............EQYP..S.....SVSTFTMCTMLARSFADIGDIVRGR.........DLYRGNRKK......N......
Q8IFQ4_PLAF7/118-307............LTNH..G.....FHT..NICTELARSFADIGDIIRGK.........DLYRGNNKE......K......
Q8I639_PLAF7/580-759........................DDNGKKLCKALEYSFADYGDLIKGT.........SIWDNEYTK......D......
Q8IBX2_PLAF7/125-327............AEYS......SGSGSDFPMCTMLARSFADIGDIVRGK.........DLYSGNKKK......E......
Q8I4N5_PLAF7/122-316............QTNN.........DS..QICTVLARSFADIGDIVRGR.........DLFHGNPQE......S......
Q8I521_PLAF7/1364-1616SLLEQEVSPEDDPEKQ..L.QTGTIPP..DFLRLMFYTLGDYRDILDGK.........NMEVVNLLK......DGSPSDK
Q8IAK2_PLAF7/126-305.....................KGIYKS..GICTSLARSFADIGDIIRGK.........DLFLGHNHK......K......
Q8I2C4_PLAF7/113-306............TKYK..D.....SGS..TMCTELARSFADIGDIVRGR.........DLFRGNDEE......K..K...
C6S3L1_PLAF7/120-316............VQYP..S.....SGS..TMCTELARSFADIGDIVRGI.........DLYGGNNKR......R......
Q8IAK3_PLAF7/126-312.....................KSNYES..RICTVLARSFADIGDIVRGK.........DLYLGDQQE......K......
Q9U0G6_PLAF7/120-328............AEYP........SGSGHTTCTALARSFADIGDIIRGK.........DLYRRDKGE......K......
Q8IEV1_PLAF7/111-324............HTNN..D.....SAA..ELCTELARSFADIGDIIRGK.........DLYLGDIKK......K....QN
Q8IK37_PLAF7/120-313............LTYG.........DS..QICTVLARSFADIGDIVRGK.........DLFLGHNQR......K......
Q8I639_PLAF7/95-277.........................SS..NVCNALERSFADIADIIRGT.........DLWKGTNSN.............
C6KTF7_PLAF7/114-310............ATYD..D.....SPS..KMCTMLARSFADIGDIVRGK.........DLFLGTNEE......K......
Q8I3E6_PLAF7/131-310.....................NSNNKS..SICTALARSFADIGDIVRGK.........DLFLGAPNK......E......
Q8IEU9_PLAF7/1256-1440........GGENLQTQ..L.KDGTIPD..DFKRQMFYTYGDYRDFLFGT.........DI...................S
Q8IBD8_PLAF7/125-315............LTNS..D.....VNI..NICTVLARSFADIGDIVRGK.........DLFYGNTYE......S......
C6KTF7_PLAF7/1360-1539.........NVDAEKK..L.EQGEIPS..EFLRSMIYTFGDYRDLCLNT.........DI...................S
Q8IHM0_PLAF7/1930-2141DDEEEEEEEQENPQEQ..L.KRGKIPD..DFLHQMFYTFGDYKDILFGK.........DM....................
Q8I220_PLAF7/131-336............HSNK..D.....SPS..QLCTVLARSFADIGDIVRGK.........DLFYGNTYE......S......
Q8IAS7_PLAF7/113-309............ATYS..D.....SRS..QLCTVLARSFADIGDIIRGK.........DLFIGYDKK......D......
O96108_PLAF7/112-313............ETNP..D.....TKS..QLCTVLARSFADIGDIIRGK.........DLYRGGNTK......E......
C6KT15_PLAF7/112-299..................D.....KKE..GICTALARSFADIGDIIRGK.........DLFLGYTKK......D......
Q8IBX0_PLAF7/105-299.........................NNNEVICTALARSFADIGDIIRGK.........DLYRGDKGE......K......
Q8IIZ6_PLAF7/115-307............ETNN..D.....VNA..NICTMLARSFADIGDIIRGK.........DLYRGVNGN......D......
C6KSK8_PLAF7/1300-1484..........TEADKE..L.KEGKIPD..EFKRQMFYTFGDYRDIFFGT.........DI....................
Q8IBX0_PLAF7/1251-1436...........DNDAQ..LLDSGIIPP..EFLRSMFYTFGDYRDICLDT.........DI.................SAK
Q8IAK3_PLAF7/1246-1437..........VNAERE..L.NSGIIPH..EFKRQMYYTFGDYRDIFFGT.........DI....................
Q8I098_PLAF7/123-313.....................YGIYKS..GICTSLARSFADIGDIIRGK.........DLYRRDSRT......D......
Q8IIZ4_PLAF7/124-318.........................SS..EVCIALARSFADIGDILRGK.........DMYVGYDEK......E......
Q8I098_PLAF7/1757-1937........NGGVAQAK..L.NSGTIPD..DFKRQMFYTFGDYRDLCLDT.........DI................SSKA
Q8IIZ4_PLAF7/902-1079.......NGGEDLQNQ..L.KSGKIPE..DFKRQMFYTFGDYRDFLFGT.........DI...................S
O97312_PLAF7/113-314............TKYK..D.....SGS..TICTVLARSFADIGDIIRGK.........DLYEGYDQK......D......
Q8IAS3_PLAF7/121-322............ATYP..G.....SGS..TTCTALARSFADIGDIVRGR.........DLYRGNKKK......I......
Q8ID12_PLAF7/118-329............LTNL..D.....TKS..QLCTALARSFADIGDIVRGK.........DLFLGNSVE......S......
Q8IFQ6_PLAF7/126-320............RTNP.........DS..KICTELARSFADIGDIVRGR.........DLYRGNKKE......N......
Q8I5L5_PLAF7/114-314............QTNP..G.....TAS..QLCTVLARSFADIGDIVRGK.........DLFLGNDEE......K......
Q8IAK2_PLAF7/1289-1477.......DKLNKLDEK..L.KEGEIPP..QFLRSMFYTFGDYKDICLDT.........DI.................SLK
Q8IIZ6_PLAF7/906-1187PELPVSNSVEKTPQTQ..L.ASGDIPT..PFLRQMFYTLGDYRDILVRG...GNTSDSGNTNGSNNN......NIVLLAS
Q8I218_PLAF7/1615-1795.......NGGEDLQNQ..L.ESGIIPD..DFKRQMFYTFGDYRDFLFGT.........DI...................S
Q8I521_PLAF7/119-309............LDNN..N.....SSS..QLCTVLARSFADIGDIIRGR.........DLYRRDKGE......E......
Q9NFB4_PLAF7/120-307.....................IKGNKS..SICTSLARSFADIGDIIRGK.........DMFKRNKHD......N......
Q8IAK2_PLAF7/1732-1914........................PCNEDVICKAMKYSFADLADIVRGI.........DKYKGPNGT......N......
Q8I220_PLAF7/902-1085........GAD..AKQ..L.DNGTIPE..EFLRSMYFTYGDYRDICLNT.........DI...................S

PF03011

O96296_PLAF7/1525-1663-------KSKT..............SDEYFNVKSFLETWIPKIAVVNDQ-------------------------------
O96296_PLAF7/659-826-------AFKNKRENSGIDMFSGLMDSADVVLELALELEQLFQDIKDGY-------------------------------
O97324_PLAF7/1459-1607-------KNAGG.............SDDYK.VKSFLEDPQFYNEVNKAV-------------------------------
Q9U0G5_PLAF7/1554-1700-------KMDS..............DEYYP.VRSVLETFLVQIGAANAN-------------------------------
O97312_PLAF7/1471-1611-------TKE...............NDGSNDLTTFLQQGPFYSLVEEAK-------------------------------
Q9U0G6_PLAF7/1479-1628-------KNDK..............LDEDFNLRSCLETFLVQIGAAYGE-------------------------------
O96108_PLAF7/594-741-------DLLK.DIA.......GMDAGELLEFYLEN.IFLE..DMKNAN-------------------------------
O97312_PLAF7/590-735-------NLKG.RDR.......NITLKYYLDILFKE.......KIKEAY-------------------------------
O97324_PLAF7/586-729-------FGKG.LTP.......YKTLEWVLDLSYFP.......IIKEAH-------------------------------
Q9U0G6_PLAF7/661-824-------GIPEGCYFT....TLEGVLQIEFLN....EGSAQDKQNSLDA-------------------------------
Q9U0G5_PLAF7/675-823-------DIPTGLT........PDALLEGVL.....EKGVLLTSIKEAY-------------------------------

PF05424

C6KSK8_PLAF7/1742-1925...............NIQDKIRYV...FDYMHKKLNS.........DDQKRYKDLV..........NHYDLRSDWWDANR
Q8IBW9_PLAF7/122-329..........KAQKEKLEQNLKKF...FQNIDEKLPL.........KAKNYYTKEKDP........NFLKLREDWWTANR
Q9U0G5_PLAF7/121-326KT........ETERDQLESKLKKI...FGDIYNELTN......GRNGVKDHYQDDNGG........NYFQLREDWWTANR
Q8I643_PLAF7/120-309..............DKLEKKLKGY...FKKIYDNLVE.....KKKEEAETDYKDDAP.........DFYQLREDWWALNR
C6KTF9_PLAF7/118-306..............KQLEENLKKI...FKEIYDKLDG....KNGKKTLQERYKGDTT.........NYYQLREDWWNINR
Q8I1V6_PLAF7/115-326ET........ETERDQLESKLKEI...FGDIYNELTN......GRNGVKDHYQDTT..........DYFQLREDWWTANR
Q8IEU9_PLAF7/2383-2561................LERDLVKI...FGKIKEGITD........ETTKKQYEKDDT.........DNKQLRCDWWEANR
C6KSK8_PLAF7/109-287..............RKLEENLKQM...FENIKKNNDK.........................LDKISIEQVREYWWNANR
Q8I3E5_PLAF7/117-318..........KEKRDQLESKLKVI...FGNIYGNLDK...........NNRYNDDTP.........EYYKLREAWWDANR
Q8IIZ4_PLAF7/1260-1475GI........GNDMGKVKSNIDKV...FANSSGKTPT.............................AKKTTPKEWWEKNA
Q8I3E6_PLAF7/2552-2733...............PVEIKLYKA...FEYIYGKWRN.......KNKGRNKYN.............DVQTFRSAWWDANR
Q8IEU9_PLAF7/131-312..............EKVEIGLKKV...FEKINNGLKK.........IGINDYNDISG.........NYYKLREAWWTANR
Q8IFQ6_PLAF7/934-1170GS........GNDVEKVKPNIDKV...FENSEKPTSG...........................GHNSEQQRETWWEEYG
Q8I218_PLAF7/1242-1426TS........HDHILDVSKNAKNK...LKEKNGEQKS.........................VIIIDDEKLLADWWKEHG
O97312_PLAF7/904-1147TN........KLTIQQISEKIKNV...IEKSGDTPSR.......................TPPGQQPSDNDPKSWWKLHA
Q8IEV1_PLAF7/910-1147KE........GGTPTKISDKIKEI...LEKVDKKQPD...........................KQNSGTTPKTWWEENG
Q8IBX3_PLAF7/952-1178EM........KEKEEKIKGAIQTF...FENGASQPPS............................GKRNDKHEEWWKNHG
Q8IBX3_PLAF7/116-314GK........ETEREKLEDNLRKI...FENIKKENNS.........KLKSLTDD...............QIREYWWTENR
Q9NFB6_PLAF7/125-323...........TQRIILENNLKDI...FAKIHSDVMS..TSGSNGRALQKRYKDTD..........NYYELREDWWALNR
Q8I495_PLAF7/910-1175KD........KQKMKEIQQKIDKI...LKQSGTTPPT.......................PVTHSPSSGTTPSSWWENNA
Q8I2E4_PLAF7/119-300................VWNGLRSV...FKKIHDNLSS.........EVKNAYPDDGSG........NYFKLREDWWTANR
Q8IFK7_PLAF7/116-318..........QTEREKLENNLKTI...FGKIHSDVTK...SGNNKDALQERYQKDEKDG.......NFFQLREDWWYANR
Q8IAK1_PLAF7/116-313..........KNRRKKLEQKLKVI...FGHIYEELKK...HKKLKEEAEERYKKDGD.........NYYKLREDWWALNR
Q8I218_PLAF7/2168-2413EM........KAKEEKIKETIDKV...FPNSVSTPPP........................TPATKPSDEKRKTWWEANG
Q8IAS4_PLAF7/118-313E...........KRKQLDDKLKKI...FENIKKENNE.........KLKSLTDD...............QIREYWWTANR
C6KTF9_PLAF7/934-1177EN........RGEMEKIQQEIDKI...LKQSGTEATS........................GAQENSVTTPQQTLWKDFA
Q8IEU9_PLAF7/856-1028...............KTQENLERI...FAKIKEQLLN........SSIKDKYKDDDKA......TPKYKQLREDWWEANR
Q8I3E6_PLAF7/842-1024...............KMERILKSI...FKNIYETIGD..........KKGKYTNTDG.........KYLELREDWWEANR
Q8I640_PLAF7/123-310............EKEKLQKNLKNI...FAKIHSGLTK........KGAEARYKDNDE.........NYYQLREDWWEANR
C0H510_PLAF7/113-322..............KQLEENLQKI...FGNIYDKLLEENRRNGKNREIEKRYEGDKEN........YFFKLREDWWTANR
Q8I521_PLAF7/853-1030...............SLQTNLKAI...FKKIKEKHPG........IEGNDKYVKDN..........ENKQLRSDWWEANR
Q8IBX1_PLAF7/111-315ET........ERERDQLEQKLKGI...FKKIYEGLTG.........GVKDHYQDTD..........NYYELREDWWALNR
O96296_PLAF7/120-322...........EKRDELETNLKTI...FGKIHEKLKD.......KEGAETRYGSDTT.........NYYQLREDWWYANR
C6KSL0_PLAF7/129-310................VENGLREV...FKKIYEGFLD........KGAREHYKEVKNG........NYIKLREDWWTANR
Q8I218_PLAF7/129-308................VQKGLRAV...FKKINDNLKE.........KEISDYDNDP..........NYYKLREDWWTANR
Q8I3E6_PLAF7/2108-2290AN........DKKIITITNSVTTI...LNENNKKKQD...........................KKKDEELRKIFWEENK
Q8I640_PLAF7/1284-1472GK........ADNTKDISTTVNRI...LSVTNGETQT.................................TAENWWEKNA
Q8IBW7_PLAF7/123-318..........RKEKEQLQNKLKYI...FKKIHEKLDS.........EAQTRYNDATG.........NFYQLREDWWTANR
O97324_PLAF7/115-303...............KLEENLKTI...FGKIHEGLKN.....GKTNGIEERYGNDP..........DFFQLREDWWTANR
Q8IIZ5_PLAF7/116-320EN........KREKEKLEENFKKY...FQQIHEDVTS..TSGKNRKALRDRYHKDGP.........DYYQLREDWWNNNR
Q8I640_PLAF7/1732-1913...............QIENKLQQV...FKNIYDSNKH..........KLSNYNDNGDS........KYTKLREAWWDANR
Q8I519_PLAF7/120-316..............KKLDDSLKTI...FGKIYEGLTG.........GVKERYTNDGG.........DFFQLREDWWTANR
Q8I2E3_PLAF7/124-323...........GKRDELDKKLKDI...FKQIHDDVTT...NGKNKDALKTRYNDDAKGG.......HFYQLREDWWIANR
Q8IAK3_PLAF7/1753-1975EM........ADKESKIKEAIKKF...FQNGDSQPLS........................GKPVTQSSDKRTALWGDFA
Q8IBW8_PLAF7/116-303..............EKLQTNLKSI...FQNIYKNLKK.........PAQKHYSDPHA.........NFYKLREDWWYANR
O96296_PLAF7/974-1223DE........KQKMEKIQEKIEQI...LPTSGNKETR....................G......PQNSVNDRQSLWDRIA
Q8I520_PLAF7/119-315..........KKQRDELEENLKTI...FKNIYGNLDK...........KDRYEGDTK.........NYYQLREDWWYANR
Q8IBW8_PLAF7/915-1170RNIVLNAGGDKASMEKIQQEIDEI...IKQSGNNKGT...........SGTTSRGPQIGSHSPNPDKQQTEREKWWDKHA
Q8IFQ2_PLAF7/123-317..............KELEKRLVEM...FKNIQGNNSK.........................LRTLSLNHVREYWWALNR
Q8IHM0_PLAF7/121-304..............EKVSNNLRAI...FNKIYENLND........PKLKKHYQKDAP.........NYYKLRDDWWNANR
C0H4I1_PLAF7/111-311ET........KTEREKLDDKLKEI...FENIRKENNS.........KLKSLTDD...............QIREYWWTANR
Q8IFQ4_PLAF7/118-307..............DRLEDNLKKI...FKQLYEELTK....NNKNEAIKTHYQDDDP.........NYYKLRNAWWEANR
Q8I639_PLAF7/580-759................LELNLQKI...FGKLFRKYIK....KNNTAEQDTSYS.............SLDELRESWWNTNK
Q8IBX2_PLAF7/125-327...............KLEQNLQKI...FKEIYDKLNG..........AKDHYQKDGD.........KFFQLREDWWTANR
Q8I4N5_PLAF7/122-316...........AQRKVLDEKLKEI...FKEIHSGLTK........KDAQTYYDENGG.........NFFKLREDWWTANR
Q8I521_PLAF7/1364-1616EM........YTRENKINQAIDNH...FSKNENQATTGVNQSSSGGVPSSSGHSSSSTVTPPGPPQTSGTTPKTWWQKNG
Q8IAK2_PLAF7/126-305..............KPLLDNLEKIFNRFQKIYEDINN............................LPIDDIREYWWALNR
Q8I2C4_PLAF7/113-306............KRDELEKNLKTI...FGKIHSRLTK..........DAQNYYEDNDT......DKNYYQLREDWWKVNR
C6S3L1_PLAF7/120-316..............KQLDDKLKEI...FKKIHENLGT.........HEKKHYENDTA.........NYYKLREAWWALNR
Q8IAK3_PLAF7/126-312..............LYLENNLKKI...FAKIHENLND.........KIKSNYNDSEG.........NYFKLREDWWTANR
Q9U0G6_PLAF7/120-328..............KKLEEHLKTI...FGKIHSDVTS...SGSNKEALQERYNGDKE.........NYYKLREDWWTANR
Q8IEV1_PLAF7/111-324GK........KTEREKLEENLKRI...FGKIHEDVTN.....GKKEVLKTRYKDINDP........EFFKLREDWWTANR
Q8IK37_PLAF7/120-313..............KKLEERLEQM...FKNITHSNAA........................KLSVLSSKEIREYWWALNR
Q8I639_PLAF7/95-277................LEQNLKQM...FAKIRENDKV..........LQDKYPKDQ..........NYRKLREDWWNANR
C6KTF7_PLAF7/114-310..............KPLEENLKEI...FKKIYENLGI.........QEKNHYNDTP..........DYYKLREDWWIANR
Q8I3E6_PLAF7/131-310.............KIKLEENLKKI...FDNIKNENAE.........................LSKLSLEKVREYWWAIHR
Q8IEU9_PLAF7/1256-1440KG........LGEGTALEKQINIL...FPNGVRKIPN...............................EKTREKWWTDHG
Q8IBD8_PLAF7/125-315...........TQRKVLDDNLKTI...FENIKKSDTK...................LT......KLNDEQIREYWWEANR
C6KTF7_PLAF7/1360-1539AK........KDPIKIVKNNIQKV...FNRNNGPHKE.............................GDKEKRKKFWETNK
Q8IHM0_PLAF7/1930-2141..........GNDVGDVENNINKI...LPNNSAKSAN...............................GHSRQEWWKKYA
Q8I220_PLAF7/131-336...........ARREKLENKLKEV...FGKIHGGLSE.........EAKKKYQDGDG.........NYYQLREDWWTANR
Q8IAS7_PLAF7/113-309..........RVQKKKLQDSLKNI...FGNIYNELTT...SGKNVDKAKARYNDPKG.........DFFQLREDWWALNR
O96108_PLAF7/112-313..........KKKRKKLEENLKTI...FGHIYDELKN..GKTNGEEELQKRYRGDKDN........DFYQLREDWWDANR
C6KT15_PLAF7/112-299..........EKEKEKVQKNLKRI...FNEIYKKMQD.........PAKSHYSGDSS.........DFYKLREDWWALNR
Q8IBX0_PLAF7/105-299..............KKLEENLKNI...FANIYEELKN.GKTNGKKGEIETRYKKDDEDG.......NFFQLREDWWNANR
Q8IIZ6_PLAF7/115-307...............KLEKNLKKI...FGIIYEGLTK.ANGKKGQKPAKDHYGDDE..........NYYKLREDWWNNNR
C6KSK8_PLAF7/1300-1484ST........HNHIPEVSSKVITI...LEKENGTKSE.........................DKQKFNNVLLEDWWKEHG
Q8IBX0_PLAF7/1251-1436TP........DGDLEQAKENIGKV...FQKIGPKTAN..........................HKPPRGITREDWWKEYG
Q8IAK3_PLAF7/1246-1437ST........HNHIPEVSQKVITI...LEKENLTKSE.........................VKQKYKNELLDDWWNEHG
Q8I098_PLAF7/123-313...............KLEENLRKI...FANIYKELKN....GKKWAEAKEYYQDDGTG........NYYKLREAWWALNR
Q8IIZ4_PLAF7/124-318..........KNRRKQLENKLKDI...FDNIYKDLTKKKGRNGKKSALQERYNDPKG.........DFFQLREDWWALNR
Q8I098_PLAF7/1757-1937DT........STGVGKVKINIDSV...FQKIDITNVE.................................QRKPWWGKNA
Q8IIZ4_PLAF7/902-1079KL........NKHTEAVKTNIDRI...FPPTERTNDT.................................IRKEFWEKNA
O97312_PLAF7/113-314..........KEQKVKLENKLKDI...FKNIYNELTSTNGKKGKKQALQARYQDDGSG........NYYQLREDWWDANR
Q8IAS3_PLAF7/121-322KT........ETERDKLEQKLKEI...FKNIKKENNE.........KLKSLTDD...............QIREYWWTANR
Q8ID12_PLAF7/118-329...........AQRIILENNLKTI...FQQIHSEVTT.....TNGEAAEARYNDTK..........NYYQLREDWWDANR
Q8IFQ6_PLAF7/126-320...........KQREKLEENLRKI...FENIYEGLSN........NGVKARYEGDKE.........NFYQLREDWWALNR
Q8I5L5_PLAF7/114-314...........KKRDELEENLQKI...FAKIHSGLTS..TRGKQNGELQKRYKGDAKK........NFYQLREDWWDANR
Q8IAK2_PLAF7/1289-1477TE........NGDITKAKSNIDRI...IPKKSAKNPD................................EERKIWWDGIK
Q8IIZ6_PLAF7/906-1187EN........KQEMENIQEQLKVF...FSNSGNQSST.......................VGRNPSQSRVTPASLWGDFA
Q8I218_PLAF7/1615-1795KG........HGIGSELAKKIDSL...FKNIGGKNPG...............................DLSRKDWWNENG
Q8I521_PLAF7/119-309..............TKLEKNLKEI...FKNIYNELTT.......KNGTKERYNDTD..........NYFQLREDWWEENR
Q9NFB4_PLAF7/120-307................IEKGLREV...FKKIYEGLKN........NGAREHYKEVKNG........NYIKLREDWWTANR
Q8IAK2_PLAF7/1732-1914...............VLEKELKSV...FETIYTKWKS......ENTNNKSKYT.............DVASFRSAWWDANR
Q8I220_PLAF7/902-1085KT........VNDVAKAKDKIGKF...FSKDGSKSPS..............................GTTTPQDWWQTYG

PF03011

O96296_PLAF7/1525-1663------------DN...VIKLSKF---GNSCGCSASA---------------IST..N.......GNEEDAIDCMIKKLE
O96296_PLAF7/659-826------------GDVKELKGIKEL---LDEEKKKKQA---------------EEAV.VVV..VADNQKKTTIDKLLQHEG
O97324_PLAF7/1459-1607------------KPCDDLNAFERS---IHCNGPNSSQ---------------KK...D.......VERRDVVVCLLDKLE
Q9U0G5_PLAF7/1554-1700------------NDVKKLIKLSEF---YKSCGCSAKT---------------NSE..N.......NKNEDAIDCMLDKLG
O97312_PLAF7/1471-1611------------KVVKCKDEQEKL---WGCTGNTTGH---------------AQDK.C........ENGDFITNLISKLQ
Q9U0G6_PLAF7/1479-1628------------DKFKKVIKLSVF---DQSCGCSAIA---------------SSQKKN.......GEYKDAIECMLKKLE
O96108_PLAF7/594-741------------GDPKVIEKFKEI---LGK.......---------------....ENEEV.QDPLKTKKTIDDFLEKEL
O97312_PLAF7/590-735------------GDERESKELEEK---LNN.......---------------...IEGSQQAGDTEHSEFAVDVLLKHEE
O97324_PLAF7/586-729------------PKEKPVQKMEEI---IKK.......---------------.....NQENISRVTKQNNSITKFLQQEL
Q9U0G6_PLAF7/661-824------------KEIQHLKQIKKI---LDEEKQKNQE---------------ETAGGCGPGVASDNKKETIMDKLIDYEK
Q9U0G5_PLAF7/675-823------------GDAKETEHIKQL---LDETAVAGGV---------------VVGA..........KDNTTIDKLLEQEL

PF05424

C6KSK8_PLAF7/1742-1925RDIWKAMTCAAPR...NAYI............................................YKTT..ENSETKIRST
Q8IBW9_PLAF7/122-329ETVWEALTCDA.....HGTY............................................FHAT.CSDLNGDC..S
Q9U0G5_PLAF7/121-326ATVWKAITCKADT...GNAY............................................FRPT.CSDSDGKGSFS
Q8I643_PLAF7/120-309QDVWKAITCDAH....DSRY.............................................RKM....GADGSITE
C6KTF9_PLAF7/118-306KKVWDAITCGAA....GGTY............................................FRKRACSSY......Y
Q8I1V6_PLAF7/115-326HTVWKAITCGTHE...GDTY............................................FRPT.CSNRQGP...S
Q8IEU9_PLAF7/2383-2561DQVWEAMQCKTTI..................................................................P
C6KSK8_PLAF7/109-287DQVWEAITCHAAH...SDEY............................................FRKS......TDGVTL
Q8I3E5_PLAF7/117-318AKVWEAITCDAPD...NAKY............................................FRGT.CGGDDEKTG.T
Q8IIZ4_PLAF7/1260-1475KDIWEGMLCALSYDTKTKIKNEELRKKLIDPKNSNYMYEKVTF........SSDNN.TN..LSKFTER............
Q8I3E6_PLAF7/2552-2733KDIWKAMTCKAPE...DAKL............................................FRKG...RMDGFESIT
Q8IEU9_PLAF7/131-312DQVWKAITCRAPN...GANY............................................FRKG.....LDGKIIF
Q8IFQ6_PLAF7/934-1170PHIWDGMICALSYNTKDKEIIKL.AHHNLTSKEI.YKYNNVTFIGGFNSDKNSKTETSATKLEEFSRR............
Q8I218_PLAF7/1242-1426HEIWEGMLCALTHEI.DEEEKNK.IKS.......TYSYDQLKK........TTNGT.TP..LEKFAER............
O97312_PLAF7/904-1147PYIWNGMIYALTYDTNTASG...........EKKIEKDDAVY................KKLWDEANNK............
Q8IEV1_PLAF7/910-1147PHIWNAMVCALTYKDNGD.............KGKPQVDDTVH................SQLWDTTKNK............
Q8IBX3_PLAF7/952-1178EHIWNGMICALTYKDNDAK............GQTPTQIQEVR................DNLWDSGKNE............
Q8IBX3_PLAF7/116-314ETVWKAMTCSEDLK..NSSY............................................FHAT.CIDGKNQ...S
Q9NFB6_PLAF7/125-323DQVWKAITCNAGG...GNRY............................................FRQT.CGSG......E
Q8I495_PLAF7/910-1175KHIWKGMVCALTYKDNTN.............GGPPTQDNDLK................KALWDDKTNE............
Q8I2E4_PLAF7/119-300DQVWKAMTCVAP....ENAY............................................FRKT.EADGIGISSLI
Q8IFK7_PLAF7/116-318ATIWEALTCNAQ....GNTY............................................FRQTACAGR......S
Q8IAK1_PLAF7/116-313QEIWKAITCGHP....GGTY............................................FRQTACGGGT.....T
Q8I218_PLAF7/2168-2413EHIWKGMIYALTYKDNGEKK..............IVKDNEVY................KKLWDEANKK............
Q8IAS4_PLAF7/118-313ETVWKAITCDEENKLGGYLY............................................FRGT.CGDNEKSV..T
C6KTF9_PLAF7/934-1177PQIWNGMICALTYEDSGDK............GGKPTQNEQVK................GQLLESDGKK............
Q8IEU9_PLAF7/856-1028SQVWEAMQCPPKN...................................................................
Q8I3E6_PLAF7/842-1024AKVWEAMKCAIKGLNVTSSD...........................................................G
Q8I640_PLAF7/123-310AKVWEAMTCSVE....DAYY............................................FRQT.CGGEK.....T
C0H510_PLAF7/113-322ATVWEAITCSDRLG..GNAY............................................FHAT.CGESRRP...S
Q8I521_PLAF7/853-1030RQVWNAMTCETPN...................................................................
Q8IBX1_PLAF7/111-315DQVWKAITCKADN...SNRY............................................FRAT.CDSADGKGS.S
O96296_PLAF7/120-322ATVWEAITCDVH....GSDY............................................FRQT.CGDKETTA..T
C6KSL0_PLAF7/129-310DQVWKAMTCVAP....ENAY............................................FRKT.EADGIGISSLI
Q8I218_PLAF7/129-308DQVWRAITCYIPY...YVNY............................................FKKT.....SDDTIVF
Q8I3E6_PLAF7/2108-2290KFIWEGMIYGLTYHLKDENEKKK.IKD.......NYQYNDM...........TKLT.PS..LEEFVKR............
Q8I640_PLAF7/1284-1472ESIWQGMLCGLSHAVSARDKETV.QKTLTN.NPS.YKYDLVKF........SGSDNPPT..LEKFAQT............
Q8IBW7_PLAF7/123-318ATIWEAMTCSEDLK..NSSY............................................FRQT.CSDERGG...A
O97324_PLAF7/115-303ETVWKAIRCSAPR...DADY............................................FIKTVCSGGK.....T
Q8IIZ5_PLAF7/116-320KMVWIAMTCEAG....GSQY............................................FRRT.CSNGI.....S
Q8I640_PLAF7/1732-1913KDIWKAMTCAAPE...EAKI............................................YITK...EGGYISPLT
Q8I519_PLAF7/120-316ETVWKAMTCSEHLK..NSAY............................................FRVT.CSDKQGE...S
Q8I2E3_PLAF7/124-323HTVWEAITCDDDDKLGGYSY............................................FRAT.CGSGNNA...T
Q8IAK3_PLAF7/1753-1975QDIWHGMICALTYTDSGEK............GELPKEDDKVK................DKLWDDTKKQ............
Q8IBW8_PLAF7/116-303QQVWYAITCGAE....GYQY............................................FRKTACNGGK.....S
O96296_PLAF7/974-1223EHVWHGMVCALTYKDDDNGL...........KGVVKKPQKIE..............NPEKLWNETTKK............
Q8I520_PLAF7/119-315RQVWKAITCDAK....AFNY............................................FRNT.CNGE......S
Q8IBW8_PLAF7/915-1170PSIWNGMICALTYEEKTNSASGS........ESKIEQNQKLK................DKLWDNDGNK............
Q8IFQ2_PLAF7/123-317DQVWKAITCDADT...GNAY............................................FRTT.CSDSHRSGTFS
Q8IHM0_PLAF7/121-304EDVWKALTCNAPY...EAQY............................................FIKP......SDKEHS
C0H4I1_PLAF7/111-311NDVWKAITCSADK...GNTY............................................FRAT.CIDLNESP..S
Q8IFQ4_PLAF7/118-307QEVWKAITCGAG....GSKY............................................FRHT.CGTG......T
Q8I639_PLAF7/580-759KYIWLAMKHGAGM...................................................NSTTCCGDGSVTGSGS
Q8IBX2_PLAF7/125-327HTVWKALTCKA.....EGAY............................................FRPT.CSDGNSQ...S
Q8I4N5_PLAF7/122-316HTVWEAMTCHAGD...SDEY............................................FRKT.CGSGNNA...T
Q8I521_PLAF7/1364-1616EHIWNGMICALTYEDNGAKGT..........SNALQQNEEVK................KALWDETTKK............
Q8IAK2_PLAF7/126-305NDVWEALTCSAPY...YADY............................................FKKK.....SGNTYNF
Q8I2C4_PLAF7/113-306DQVWEAITCEAKS...DDKY.................................................NVIGPDGKITE
C6S3L1_PLAF7/120-316QDVWKALTCDA.....HGTY............................................FRAT.CSERNGGC..S
Q8IAK3_PLAF7/126-312DQVWKAITCNAPK...DANY............................................FEYN......SGKFFK
Q9U0G6_PLAF7/120-328ETVWEAITCDDDDKLANASY............................................FRAT.CSDSDGKGSFS
Q8IEV1_PLAF7/111-324ATVWKAITCHAGE...SDKY............................................FRNT.CNDSEHSGTFS
Q8IK37_PLAF7/120-313DQVWKALTCDEENKLGGNAY............................................FHAT.CSERNGGC..S
Q8I639_PLAF7/95-277QKVWEVITCGARSNDLLIKR............................................GWRT..SGKSNGDNKL
C6KTF7_PLAF7/114-310DQVWKAITCNAG....GYSY............................................FRKT.CGGDNEKNS.T
Q8I3E6_PLAF7/131-310KELWEALTCNAPK...GANY............................................FVYK.......LDGPK
Q8IEU9_PLAF7/1256-1440PEIWKGMLCALTNGLSESEKKT......KI.FDD.YSHDKVNQ........SKNGN.PS..LEDFAKK............
Q8IBD8_PLAF7/125-315ETVWKAITCSDDLK..NSSY............................................FRTTACAG.......T
C6KTF7_PLAF7/1360-1539NDIWQGMLCALEK..IANNK........KTLTET.YNYSLVKF........SGNNS.TT..LEDFAKT............
Q8IHM0_PLAF7/1930-2141EDIWKGMVCALSHSVSASDKDSM.QKNLTD....KYKYKEVKF........TSKSSKHNIPLSEFEKK............
Q8I220_PLAF7/131-336ETVWKAITCEVKS...GNNY............................................FRAT.CGDEKNP...S
Q8IAS7_PLAF7/113-309EKVWSAITCNAQ....GNKY............................................FRPT.CSGGE.....S
O96108_PLAF7/112-313ETVWKAITCNAG....SYQY............................................SQPT.CGRGEIP...Y
C6KT15_PLAF7/112-299KEVWKAITCKAKN...DAEY............................................FRKK.DSDGK.....H
Q8IBX0_PLAF7/105-299NDIWKALTCHAPP...DAQY.................................................TKKGPHNHITE
Q8IIZ6_PLAF7/115-307LMVWYAITCGAPK...EAQY............................................FRKT.CGSG......E
C6KSK8_PLAF7/1300-1484PEIWEGMLCALTNGLTDDEKKNE.IKT.......KYSYDELNN........AKKGD.SS..LEEFAQT............
Q8IBX0_PLAF7/1251-1436SQIWKGMLCALSY..DNETRIMN.ERVRKQLMDSIYNYHILK...............NH..LENFAER............
Q8IAK3_PLAF7/1246-1437KEIWDGMVCALCYDTKTKEFKNE.VRTQLTGPNSKYQYGTVSF........GDKQN.TI..LSKFAER............
Q8I098_PLAF7/123-313KDVWKALTCSAPR...DAQY............................................FIKS......SVRDQT
Q8IIZ4_PLAF7/124-318EDVWKALTCSADD...SEDY............................................FIQS......EGVTKS
Q8I098_PLAF7/1757-1937EAIWDGMLCALSY..NTTNKNMD.YNAHTKLNPT.YGYNAIK...............SE..LEDFVNR............
Q8IIZ4_PLAF7/902-1079ESIWQGMLCALSY..NSNDKKMD.PDVQKELNST.YNYDTIK...............NN..LEDFANR............
O97312_PLAF7/113-314AKVWYAITCGAGT...SDKY............................................FRKT.CSNDT.....S
Q8IAS3_PLAF7/121-322HTVWKAITCKADA...SSAY............................................FHAT.CSDSHRSGTFS
Q8ID12_PLAF7/118-329ETVWKAITCNAW....GNTY............................................FRTT.CSDGKSQ...S
Q8IFQ6_PLAF7/126-320DQVWKALTCSDDLK..DASY............................................FRPT.CSDRKGSC..S
Q8I5L5_PLAF7/114-314HTVWEAITCGAGE...SDKY............................................FRQTACGTG......T
Q8IAK2_PLAF7/1289-1477EDVWEGMLCGLSHAVSNNDKATV.QKTLTT.KTI.YDYDTV..........TFDGT.TK..LEDFSKR............
Q8IIZ6_PLAF7/906-1187QYIWNGMICALTYEEKTSGSDDK........GVKIEQNEGLK................EALLEDKTNE............
Q8I218_PLAF7/1615-1795PYIWKGMLCSL.......EKAWG.KDTIKN.KSN.YNYHNVKF........SDNRNGPD..LETFAKR............
Q8I521_PLAF7/119-309ETVWKAITCHVVS...GNNY............................................FRHT.CSDENHP...T
Q9NFB4_PLAF7/120-307DQVWKAITCEAP....ENAY............................................IIKR.RIDGGDIENLI
Q8IAK2_PLAF7/1732-1914KDIWNAMTCNAPY...DAKI............................................YITK...EGGYISPLT
Q8I220_PLAF7/902-1085KDIWKGMICALTHGVTNTEKKT......KI.KND.YSYDKVNQ........SQNGN.PS..LEDFAKK............

PF03011

O96296_PLAF7/1525-1663KKIDECKRKPGENS------------------------------------------------------------------
O96296_PLAF7/659-826DDANNCLKTHKEKC------------------------------------------------------------------
O97324_PLAF7/1459-1607KEAKKCEQKHQNSG------------------------------------------------------------------
Q9U0G5_PLAF7/1554-1700KKAEKCHDQHSDNP------------------------------------------------------------------
O97312_PLAF7/1471-1611EKISECTSQSSGSD------------------------------------------------------------------
Q9U0G6_PLAF7/1479-1628EKANKCKEDHSSGE------------------------------------------------------------------
O96108_PLAF7/594-741NEAKNCVEKNPDNE------------------------------------------------------------------
O97312_PLAF7/590-735EIAENCIKYNPEDT------------------------------------------------------------------
O97324_PLAF7/586-729QEANNCLQKRKQDC------------------------------------------------------------------
Q9U0G6_PLAF7/661-824KIATECIEKHKCPD------------------------------------------------------------------
Q9U0G5_PLAF7/675-823KDANRCKNCEQRKP------------------------------------------------------------------

PF05424

C6KSK8_PLAF7/1742-1925DMYYYCGHKDD...................PPDNDYIPQKLR
Q8IBW9_PLAF7/122-329QAHEKCRCPKTSGGKAIKAGGDVTIV....PTYFDYVPQYLR
Q9U0G5_PLAF7/121-326QANDKCRCKDKKGKNTDQV...........PTYFDYVPQYLR
Q8I643_PLAF7/120-309SAMRQCRNVADV..................PTNFDYVPQYLR
C6KTF9_PLAF7/118-306PTGEDCRCVANV..................PTYFDYVPQYLR
Q8I1V6_PLAF7/115-326QAHHYCRCNGDKPDDDKPNTDP........PTYFDYVPQYLR
Q8IEU9_PLAF7/2383-2561PVTTSCDTTTV...................TPLVDYIPQRLR
C6KSK8_PLAF7/109-287YFDGRCGRELSSV.................PTYLDYVPQFLR
Q8I3E5_PLAF7/117-318QAIHKCRCTKSSGGKPGKNETDQV......PTYFDYVPQFLR
Q8IIZ4_PLAF7/1260-1475.....................................PPFFR
Q8I3E6_PLAF7/2552-2733LIQDKCGHKDD...................PPVDDYIPQRFR
Q8IEU9_PLAF7/131-312SDNGPCGRKELIV.................PTYLDYVPQFLR
Q8IFQ6_PLAF7/934-1170.....................................PTFFR
Q8I218_PLAF7/1242-1426.....................................PQFLR
O97312_PLAF7/904-1147.....................................PKKD.
Q8IEV1_PLAF7/910-1147.....................................PKNRQ
Q8IBX3_PLAF7/952-1178.....................................PKKPQ
Q8IBX3_PLAF7/116-314QARNQCRCPKTSGNVNIV............PTYFDYVPQYLR
Q9NFB6_PLAF7/125-323WAKDKCRCKDDKV.................PTYFDYVPQYLR
Q8I495_PLAF7/910-1175.....................................PKKSE
Q8I2E4_PLAF7/119-300LPYSKCGRDTD...................PPVVDYIPQRLR
Q8IFK7_PLAF7/116-318ATRNQCRCDGANIV................PTYFDYVPQYLR
Q8IAK1_PLAF7/116-313PTPNKCRCATNDV.................PTYFDYVPQYLR
Q8I218_PLAF7/2168-2413.....................................PKETK
Q8IAS4_PLAF7/118-313QARDKCRCKKKDNTPDDQV...........PTYFDYVPQYLR
C6KTF9_PLAF7/934-1177.....................................PKK..
Q8IEU9_PLAF7/856-1028.GTFPCKSDH....................TPLHDYIPQRLR
Q8I3E6_PLAF7/842-1024KLSDHCGYSDH...................TPLDDYIPQKLR
Q8I640_PLAF7/123-310ASTNKCRCVNTDP.................PTYFDYVPQYLR
C0H510_PLAF7/113-322QAQNQCRCSDKPKAIKAGGNVSIV......PTYFDYVPQYLR
Q8I521_PLAF7/853-1030GDNIKCDVHD....................VPVDDYIPQRLR
Q8IBX1_PLAF7/111-315VARNKCRCKDEEGKNETNEV..........PTYFDYVPQYLR
O96296_PLAF7/120-322RVKDKCRCKDENGKKPGSNADQV.......PTYFDYVPQYLR
C6KSL0_PLAF7/129-310LPYSKCGRDTD...................PPVVDYIPQRLR
Q8I218_PLAF7/129-308TNDGKCGHYEGAP.................PTNLDYVPQFLR
Q8I3E6_PLAF7/2108-2290.....................................PQFLR
Q8I640_PLAF7/1284-1472.....................................PQFLR
Q8IBW7_PLAF7/123-318QANDKCRCPNGNNQV...............PTYFDYVPQYLR
O97324_PLAF7/115-303PTQGKCRCIDFSV.................PTYFDYVPQYLR
Q8IIZ5_PLAF7/116-320ETNNKCRCTIETV.................PTYFDYVPQYLR
Q8I640_PLAF7/1732-1913STKNHCGHKDD...................PPDYDYIPQPLR
Q8I519_PLAF7/120-316IANHKCRCPMTSDGKPNDQV..........PTYFDYVPQYLR
Q8I2E3_PLAF7/124-323LARDKCTCNNGDV.................PTYFDYVPQYLR
Q8IAK3_PLAF7/1753-1975.....................................PKKEE
Q8IBW8_PLAF7/116-303STPNKCRCTTHDV.................PTYFDYVPQYLR
O96296_PLAF7/974-1223.....................................PKDEK
Q8I520_PLAF7/119-315PTKGYCRCNDDQPNADKPNTDP........PTYFDYVPQYLR
Q8IBW8_PLAF7/915-1170.....................................PKNDN
Q8IFQ2_PLAF7/123-317QAKDKCRCKDENGKNETDQV..........PTYFDYVPQFLR
Q8IHM0_PLAF7/121-304FSSEYCGHYKNGDP................LTNLDYVPQFLR
C0H4I1_PLAF7/111-311MARDKCRCKDKSFTKETDQV..........PTYFDYVPQFLR
Q8IFQ4_PLAF7/118-307PTDDKCRCAINDV.................PTYFDYVPQYLR
Q8I639_PLAF7/580-759SCDD..........................IPTIDLIPQYLR
Q8IBX2_PLAF7/125-327QATKQCRCNDKPNAGKPKAGNGDVNIV...PTYFDYVPQYIR
Q8I4N5_PLAF7/122-316QAKDKCRCSDNQV.................PTYFDYVPQYLR
Q8I521_PLAF7/1364-1616.....................................PKDEK
Q8IAK2_PLAF7/126-305TTEGYCGRNEGAP.................PTNLDYVPQFLR
Q8I2C4_PLAF7/113-306SNKGQCRCFSGDP.................PTNMDYVPQFLR
C6S3L1_PLAF7/120-316QANDKCRCPKTSDGKANDQV..........PTYFDYVPQYLR
Q8IAK3_PLAF7/126-312FSNDQCGHNNGGAP................PTNLDYVPQFVR
Q9U0G6_PLAF7/120-328QANDKCRCKDKKGKNTDQV...........PTYFDYVPQYLR
Q8IEV1_PLAF7/111-324QPNKYCRCNGDKPGEDKANVDP........PTYFDYVPQYLR
Q8IK37_PLAF7/120-313QAHEKCRCPMTSDGKPNDQV..........PTYFDYVPQYLR
Q8I639_PLAF7/95-277ELCRKCGHYEEKV.................PTKLDYVPQFLR
C6KTF7_PLAF7/114-310LASNKCRCKDEKGEHDTDQV..........PTYFDYVPQYLR
Q8I3E6_PLAF7/131-310FSSDRCGHNYNGDP................LTNLDYVPQYLR
Q8IEU9_PLAF7/1256-1440.....................................PQFFR
Q8IBD8_PLAF7/125-315RTNDKCRCTKSSGAKVDDQV..........PTYFDYVPQYLR
C6KTF7_PLAF7/1360-1539.....................................PQFLR
Q8IHM0_PLAF7/1930-2141.....................................PQFIR
Q8I220_PLAF7/131-336LTSKQCRCDKDKAGKPIKGSGNVNIV....PTYFDYVPQYLR
Q8IAS7_PLAF7/113-309IAHNKCTCINGDP.................PTYFDYVPQYLR
O96108_PLAF7/112-313VTLSKCQCIAGEV.................PTYFDYVPQYLR
C6KT15_PLAF7/112-299CSVQNCKCVDGDP.................PTNLDYVPQHLR
Q8IBX0_PLAF7/105-299SNKGQCRCFSGDP.................PTNMDYVPQYLR
Q8IIZ6_PLAF7/115-307RTKDNCRCAIHGV.................PTYFDYVPQYLR
C6KSK8_PLAF7/1300-1484.....................................SQFLR
Q8IBX0_PLAF7/1251-1436.....................................HPFFR
Q8IAK3_PLAF7/1246-1437.....................................PPFLR
Q8I098_PLAF7/123-313FSNDYCGHGEHEV.................LTNLDYVPQFLR
Q8IIZ4_PLAF7/124-318FTNPKCGHGDNEV.................LTNLDYVPQFLR
Q8I098_PLAF7/1757-1937.....................................PQFLR
Q8IIZ4_PLAF7/902-1079.....................................PQFLR
O97312_PLAF7/113-314DTNEKCRCVSTDP.................PTYFDYVPQYLR
Q8IAS3_PLAF7/121-322QANNYCRCNGDQPGNDKENIDP........PTYFDYVPQYLR
Q8ID12_PLAF7/118-329QANKYCRCDGDQPGHDKSKAGKANDDVNIVPTYFDYVPQYLR
Q8IFQ6_PLAF7/126-320QAKDNCRCDGSNTDQV..............PTYFDYVPQFLR
Q8I5L5_PLAF7/114-314PTHKQCRCDDKANVDP..............PTYFDYVPQYLR
Q8IAK2_PLAF7/1289-1477.....................................PQFLR
Q8IIZ6_PLAF7/906-1187.....................................PKKPQ
Q8I218_PLAF7/1615-1795.....................................PQFLR
Q8I521_PLAF7/119-309ATQGNCRCIGATV.................PTYFDYVPQYLR
Q9NFB4_PLAF7/120-307LTHPKCGHDTD...................PPVVDYIPQRLR
Q8IAK2_PLAF7/1732-1914FTKNKCGHNDD...................PPDYDYIPQPFR
Q8I220_PLAF7/902-1085.....................................PQFLR

PF03011

O96296_PLAF7/1525-1663------------------------------------------
O96296_PLAF7/659-826------------------------------------------
O97324_PLAF7/1459-1607------------------------------------------
Q9U0G5_PLAF7/1554-1700------------------------------------------
O97312_PLAF7/1471-1611------------------------------------------
Q9U0G6_PLAF7/1479-1628------------------------------------------
O96108_PLAF7/594-741------------------------------------------
O97312_PLAF7/590-735------------------------------------------
O97324_PLAF7/586-729------------------------------------------
Q9U0G6_PLAF7/661-824------------------------------------------
Q9U0G5_PLAF7/675-823------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window