Sequence alignment for CL0195

PF03011

O96296_PLAF7/1525-1663LLKRWLEYFLEDYNKIK.HKISHCTKNGKG.SK.CIKG..C......VDKWVQQKKEEWKQIKERFNEQYKSKT......
O96296_PLAF7/659-826FFYFWIGRFLNDSMYWR.GKVNSCINNPKR.KK.CRNE..CKDDCGCFKEWIGKKKEEWENIKKHFKTQEAFKNKRENSG
O97324_PLAF7/1459-1607LFKRWLEYFFEDYNRIQ.KKLKPCIENGKGKEQ..KCFKGCKENCDCVKKWVEEKEKEWPKIRKRYLEQYKNAGG.....
Q9U0G5_PLAF7/1554-1700LVTHWVQNFLEDYKKIK.HKISHCTKTDQG....STCQNKCQNKCKCVGEWIKLKQQEWEEIKKRFLNQYKMDS......
O97312_PLAF7/1471-1611LIKRWLEYFLEDYNKIK.KKLKSCTEKGEG..SPCIKE..C......VDTWITEKRKEWKTIKERYVDKYTKE.......
Q9U0G6_PLAF7/1479-1628LVTHWVQNFLDDYKKIK.HKISHCTKTDQG....STCQNKCQNKCKCVGEWIPKKREEWQQIKDRFLKQYKNDK......
O96108_PLAF7/594-741FFYGSIIDMLNESIEWR.ERLKSCINDAKLGKC..RKG..CKNPCECYKRWVEKKKDEWDKIKEFFRKQKDLLK.DIA..
O97312_PLAF7/590-735FFWSWVSRMLNDSIKWR.NQHSKCINNKKE....TKCIEGCKKTCECFEKWVGQKKTEWRKIKHHFDQQENLKG.RDR..
O97324_PLAF7/586-729LFWRWVTEMLKDSIDWR.KEYKNCINNGD.KST.CKNV..CKKPCDCFQKWGVRKTKEWQQVKAHYEKEDFGKG.LTP..
Q9U0G6_PLAF7/661-824FFYYWVAHMLKDSIYWRTKKLDKCLQNGN.KKC.GKKI..CNGDCECFQRWVEKKKTEWTNIKDHFVKQKGIPEGCYFT.
Q9U0G5_PLAF7/675-823FFNFWVAHMLKDSIHWRTKKIKGCLKNGKAIKC.TDK...CKGDCKCFERWVEQKREEWTNIKEHFGKQTDIPTGLT...

PF03011

O96296_PLAF7/1525-1663........SDEYFNVKSFLETWIPKIAVVNDQDN...VIKLSKFGNSCGCSASAIST..N.......GNEEDAIDCMIKK
O96296_PLAF7/659-826IDMFSGLMDSADVVLELALELEQLFQDIKDGYGDVKELKGIKELLDEEKKKKQAEEAV.VVV..VADNQKKTTIDKLLQH
O97324_PLAF7/1459-1607........SDDYK.VKSFLEDPQFYNEVNKAVKPCDDLNAFERSIHCNGPNSSQKK...D.......VERRDVVVCLLDK
Q9U0G5_PLAF7/1554-1700........DEYYP.VRSVLETFLVQIGAANANNDVKKLIKLSEFYKSCGCSAKTNSE..N.......NKNEDAIDCMLDK
O97312_PLAF7/1471-1611........NDGSNDLTTFLQQGPFYSLVEEAKKVVKCKDEQEKLWGCTGNTTGHAQDK.C........ENGDFITNLISK
Q9U0G6_PLAF7/1479-1628........LDEDFNLRSCLETFLVQIGAAYGEDKFKKVIKLSVFDQSCGCSAIASSQKKN.......GEYKDAIECMLKK
O96108_PLAF7/594-741.....GMDAGELLEFYLEN.IFLE..DMKNANGDPKVIEKFKEILGK...........ENEEV.QDPLKTKKTIDDFLEK
O97312_PLAF7/590-735.....NITLKYYLDILFKE.......KIKEAYGDERESKELEEKLNN..........IEGSQQAGDTEHSEFAVDVLLKH
O97324_PLAF7/586-729.....YKTLEWVLDLSYFP.......IIKEAHPKEKPVQKMEEIIKK............NQENISRVTKQNNSITKFLQQ
Q9U0G6_PLAF7/661-824...TLEGVLQIEFLN....EGSAQDKQNSLDAKEIQHLKQIKKILDEEKQKNQEETAGGCGPGVASDNKKETIMDKLIDY
Q9U0G5_PLAF7/675-823.....PDALLEGVL.....EKGVLLTSIKEAYGDAKETEHIKQLLDETAVAGGVVVGA..........KDNTTIDKLLEQ

PF03011

O96296_PLAF7/1525-1663LEKKIDECKRKPGENS
O96296_PLAF7/659-826EGDDANNCLKTHKEKC
O97324_PLAF7/1459-1607LEKEAKKCEQKHQNSG
Q9U0G5_PLAF7/1554-1700LGKKAEKCHDQHSDNP
O97312_PLAF7/1471-1611LQEKISECTSQSSGSD
Q9U0G6_PLAF7/1479-1628LEEKANKCKEDHSSGE
O96108_PLAF7/594-741ELNEAKNCVEKNPDNE
O97312_PLAF7/590-735EEEIAENCIKYNPEDT
O97324_PLAF7/586-729ELQEANNCLQKRKQDC
Q9U0G6_PLAF7/661-824EKKIATECIEKHKCPD
Q9U0G5_PLAF7/675-823ELKDANRCKNCEQRKP

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window