Sequence alignment for CL0195

PF03011

O96296_PLAF7/1525-1663LLKRWLEYFLEDYNKIK.HKISHCTKNGKG.SK.CIKG..C......VDK.WVQQKKEE.WKQIKERFNEQYKSKT....
O96296_PLAF7/659-826FFYFWIGRFLNDSMYWR.GKVNSCINNPKR.KK.CRNE..CKDDCGCFKE.WIGKKKEE.WENIKKHFKTQEAFKNKREN
O15652_PLAFA/10-162FFWKWVTEMLDDSIEWR.RELKSCIDKDKSGQC..IKL..CHWKCDCFAK.WVKQKKNE.FIERKEHFKKQKDIGQKGVP
Q26033_PLAFA/593-740FFYFWIRHLLNDSIEWR.DKINNCIEKAKEGKC..KNE..CKTDCGCFQR.WIGKKKEE.WGEIKKHFKTQ......DGF
Q25989_PLAFA/162-308LLKRWVEYFLEDYNKIN.AKISHCTKKDN.EST.CTND..CPNKCTCVEE.WINQKRTE.WKNIKKHYKTQNENGDN...
Q25766_PLAFA/465-610FFWKWVSEMLDDSIKWR.AELDKCLKNDK.KTC.GKKN...YKNCLNFLKNGLNKKKK.RNGRQKKHFKNKKIDRKLV..
O15870_PLAFA/568-717LFQRWLRYFVRDHNRLK.EKIDVCIKKEN.INE.NICIKRCKTNCECVGK.WLEKKEAE.WDKINQHYNQKNHIM..FIL
Q9XZB8_PLAFA/663-808FFNFWVAHMLKDSIYWK.KKLERCLENGT.KKC.GKN...CNNDCGCFEK.WVKQKKEEEWDKIKEHFRKQTDLGEWEP.
O15663_PLAFA/10-169FFWDWVYHMLHDSLDWR.KQLGNCINKDNG....NKCKSGCNTKCKCFEK.WVEQKGKE.WKAIKEHFDKQKDIPDG...
O60991_PLAFA/1483-1626LFKRWVENFLEDYNKIN.DKISHCIKKGEG....SKCINGCEKNSKCLEK.WIEKKIAE.WENIKKRFNDQYENKD....
Q25734_PLAFA/1466-1603LVAHWVQNFLDDYNKIK.HKISHCKNSSEG.YT.CIKN..C......VEQ.WISTKRTE.WTNIKILLNEQYKDN.....
O61077_PLAFA/635-791FFWDWVHDMLIDSIKWR.NEHGKCINKDNG.KT.CIKG..CKSKCDCFLK.WVQQKEKE.WKLILEHFNTQGGFDKGEHQ
Q9U4A2_PLAFA/563-705FFTYWVAHMLKDSEDWK.TKLSKCLKNKEQ..L.CINN..CNRNCKCYEK.WIEKKEEE.WEKIKVHYEKQ.KLPEG...
Q25766_PLAFA/1297-1436LLKRWVEYFLEDYNKIK.HKISHCMRKGEK....TICINDC......VEK.WINIKKK.DWETIRERYVKQYTTGH....
O61077_PLAFA/1970-2115LFERWIIDFIQYYNKSK.ERITRCTNDVNS....CKEG..CKGNCDCVEE.WLKKKSAE.WEKIKDYYNQHFQDVDE...
Q26033_PLAFA/1916-2061LLKRWVEYFLEDYKKIK.KKLKPCIENGNG....STCINGCNKKCNRVGE.WIKLKKDE.WTKIKNHYLEKNKEGDK...
Q26032_PLAFA/2321-2465LFKRWLESFLEDYNKIN.DKISHCMKNDKK....SPCINGCQNKCNCVEK.WIEKKKSE.WGKVRERYINQYRDKN....
O97324_PLAF7/1459-1607LFKRWLEYFFEDYNRIQ.KKLKPCIENGKGKEQ..KCFKGCKENCDCVKK.WVEEKEKE.WPKIRKRYLEQYKNAGG...
Q9U0G5_PLAF7/1554-1700LVTHWVQNFLEDYKKIK.HKISHCTKTDQG....STCQNKCQNKCKCVGE.WIKLKQQE.WEEIKKRFLNQYKMDS....
Q9U5M2_PLAFA/591-736FFELWVTYLLRDTIKWN.DKLKTCINNTTT..H.CIDE..CNRNCLCFDR.WVKQKEEE.WNSIKKLFTKKKNIQQ....
Q26030_PLAFA/615-758FFNFWVAHVLKDSIDWR.TQLTKCLSEDKL..K..KCEKGCKSNCECFKK.WIEKKEKE.WIKVKDQFNKQTDFLEW...
O97312_PLAF7/1471-1611LIKRWLEYFLEDYNKIK.KKLKSCTEKGEG..SPCIKE..C......VDT.WITEKRKE.WKTIKERYVDKYTKE.....
Q26030_PLAFA/1774-1924FFQRWLRYFVHDYNILK.DKIKPCIKTKD.EKS.NKCINGCKGKLECVKK.WLKQKQDE.WKNIKDHYEKNKSLYGY...
Q26032_PLAFA/577-723CFHSWAKNLLIDTIKWE.HQLKNCINNTNV....TYCESKCIKNCECYEK.WIKRKEHE.WEKVKNVFGNNNRMS.....
Q9XZB8_PLAFA/1922-2070LLHRWVEYFLEDYNRIR.KKLNPCIKKDNG....STCINGCEKKCKCVGQ.WITKKREE.WGKIKDRFNDQYKNKD....
Q26031_PLAFA/654-825FFYYWVAHMLKDSIHWK.KKLQRCLQNGNRIKC.GNNK..CNNDCECFKR.WITQKKDE.WGKIVQHFKTQNIKGRGGSD
O60991_PLAFA/671-826FFYYWVAHMLKDSIHWRTKRLKSCISDGKT.MK.CRNG..CNKKCDCFEK.WVKQKETE.WKPIKDHFKTQEGIPEGYYF
Q9U0G6_PLAF7/1479-1628LVTHWVQNFLDDYKKIK.HKISHCTKTDQG....STCQNKCQNKCKCVGE.WIPKKREE.WQQIKDRFLKQYKNDK....
O15870_PLAFA/2198-2343LLRRWVENFLEDYKKIK.HKISHCTNSTEEKKS..TCD..CGKKCKCVGQ.WIKLKKEE.WKKIKEHYVGENKSED....
O96108_PLAF7/594-741FFYGSIIDMLNESIEWR.ERLKSCINDAKLGKC..RKG..CKNPCECYKR.WVEKKKDE.WDKIKEFFRKQKDLLK.DIA
Q26031_PLAFA/2329-2468LVKRWVEYFFEDYNKIK.HKISHRIKNGE.ISP.CIKN..C......VEK.WVDQKRKE.WKEITERFKDQYKNDN....
Q9TVM8_PLAFA/10-167FFWMWVHDMLIDSIKWR.DEHGRCINKDKG.KT.CIKG..CNKKCICFQK.WVEQKKTE.WGKIKDHFRKQKDIPKDWTH
P90580_PLAFA/577-722FLMFWVAHMLKDSIEWR.SKLSNCLKSDKK..T.CITT..CNDNCQCYDK.WIGKKKV.HWTQIKKHFDKQTDFQGW...
O97312_PLAF7/590-735FFWSWVSRMLNDSIKWR.NQHSKCINNKKE....TKCIEGCKKTCECFEK.WVGQKKTE.WRKIKHHFDQQENLKG.RDR
Q25733_PLAFA/1460-1612FFQRWLRYFVHDYNILK.HKIDPCIKKEKQDKTEHKCINGCNIKCECVRK.WLEIKGNE.WGNIKKHYNINSNDDKE...
O97324_PLAF7/586-729LFWRWVTEMLKDSIDWR.KEYKNCINNGD.KST.CKNV..CKKPCDCFQK.WGVRKTKE.WQQVKAHYEKEDFGKG.LTP
Q26034_PLAFA/1453-1588LLKRWLEYFLEDYNRIR.KKIKLCTKKEDG....CKCIKGC......IEK.WVQEKTKE.WQKINDTYLEQYKNDDG...
Q9U0G6_PLAF7/661-824FFYYWVAHMLKDSIYWRTKKLDKCLQNGN.KKC.GKKI..CNGDCECFQR.WVEKKKTE.WTNIKDHFVKQKGIPEGCYF
Q9U0G5_PLAF7/675-823FFNFWVAHMLKDSIHWRTKKIKGCLKNGKAIKC.TDK...CKGDCKCFER.WVEQKREE.WTNIKEHFGKQTDIPTGLT.
Q26034_PLAFA/614-768FFWDWVHDMLHDSVEWK.TELSKCINNNTNGNT.CRNNNKCKTDCGCFQK.WVEKKQQE.WMAIKDHFGKQTDIVQQKGL
Q94657_PLAFA/1872-2011LFKRWLEYFLDDYNKIR.KKLNPCINNGEK....AICTNGC......VEQ.WINQKRTE.WTNIKNRFNEQYNGDD....

PF03011

O96296_PLAF7/1525-1663....................SDEYFNVKSFLETWIPKIAVVNDQDN...VIKLSKFGNSCGCSASA...IST..N.....
O96296_PLAF7/659-826SGI..........DMFSGLMDSADVVLELALELEQLFQDIKDGYGDVKELKGIKELLDEEKKKKQA...EEAV.VVV..V
O15652_PLAFA/10-162.................IVFTHDDV.LEGVLQSGELFKNIEKDYGNAEEIKHIKEIMDN...KNRQ...ETTGGG.....
Q26033_PLAFA/593-740................SIFGNNYDFVLENVLNIDELFQDITEAYGNSQKIQGIKDTL.AKKKTQAA...DDA........
Q25989_PLAFA/162-308....................NMKSL.VTDILGALQPQSDVNKAIKPCSGLTAFESFCGLNGADNSE...KKE........
Q25766_PLAFA/465-610..................CLLKWHL.KVLLN..DVFLQDMEKAQGDPQHIAKIKELLKKNDEKVNN...LS.........
O15870_PLAFA/568-717IPYWITGFYEKITFPNDFFKALEDVDTINVL.DTLK..ECQDTHCK...IEKIRSID.................V.....
Q9XZB8_PLAFA/663-808..................NDLLEQVL.....EKGVLLTSIKEGYGNAKGHRRIEALLKDEEEAVAA...PDG........
O15663_PLAFA/10-169.....................RYFLTLEGVLEKGVLLTSIKEGYGNERDIEHIKQLLDEEEAAGALGGGGAALGGLYTHG
O60991_PLAFA/1483-1626....................QPDYN.VKSILEELIPKIAVVNDQDN...VIKLCVFENSKGCTLIS...NTQ..N.....
Q25734_PLAFA/1466-1603.....................PDYN.VKTILQDLQSQIDFNKAIKPCGTLTKFEDSCGINGAESSE...KK...N.....
O61077_PLAFA/635-791................RLGFTHDVV.LNYLLDKKELLKIIEGTYGNTEETKHIKEMLDK.....EE...KDA..GGTGVA
Q9U4A2_PLAFA/563-705....................AHYVI.LEGVL.ELQFIKGITNAYGEQKEVQRIAELL.RNKTKEGP...DDA........
Q25766_PLAFA/1297-1436....................SDIYK.VTSFLEDPQFHNEVLKAIKPCGDLDKFQNSTDC...TVVR...SSENGV.....
O61077_PLAFA/1970-2115....................RIASRTKSFFE.QGTFPSYAKKAQEVVEGKEEQEKLWGCTGSNTDG...QTE.EC.....
Q26033_PLAFA/1916-2061....................NVTSL.VTNVLETLVTQIAAANDKREQTSLDKLKTSLGCNCPENSR...KN...D.....
Q26032_PLAFA/2321-2465....................SNEAFEVKSFLETLIPQIPVVTDKGKHDSLTQLKKLLKCNCSEKSE...NS.........
O97324_PLAF7/1459-1607....................SDDYK.VKSFLEDPQFYNEVNKAVKPCDDLNAFERSIHCNGPNSSQ...KK...D.....
Q9U0G5_PLAF7/1554-1700....................DEYYP.VRSVLETFLVQIGAANANNDVKKLIKLSEFYKSCGCSAKT...NSE..N.....
Q9U5M2_PLAFA/591-736....................SYYSNINNLFE..GYFFKVMDKLDKDEAKWKELMENIKRKKNEFSN...LENNRD.....
Q26030_PLAFA/615-758.....................KHYLVLETIL.ENYYFENIQKAYGDLKSIQEMKKMIKENKQNKNR...TK...D.....
O97312_PLAF7/1471-1611....................NDGSNDLTTFLQQGPFYSLVEEAKKVVKCKDEQEKLWGCTGNTTGH...AQDK.C.....
Q26030_PLAFA/1774-1924....................GIPHWVKSYFVEQLYFDKDYKKAQDVIEDENERKKIWGCTDGVECT...NEET.K.....
Q26032_PLAFA/577-723....................YIYYNNLSRVFDSFLFQVMFALDQDEKGKWDQFTEDLKKKFEPSKT...NTPT.......
Q9XZB8_PLAFA/1922-2070....................SGDYP.VKTILEELIPQIAAATDKGNHKRLQKLVKSLKCNCTDNSE...KEGEID.....
Q26031_PLAFA/654-825NTAELIP...FDHDYVLQYNLQEEFLKGDSEDASEEKSENSLDAEEAEELKHLREIIESEDNNQEA...SVGGGV.....
O60991_PLAFA/671-826T..............TLELILKLQFLK....EDTEENTENSLDAEEAEELKHLQKILKLENENNLA...VVNA.G.....
Q9U0G6_PLAF7/1479-1628....................LDEDFNLRSCLETFLVQIGAAYGEDKFKKVIKLSVFDQSCGCSAIA...SSQKKN.....
O15870_PLAFA/2198-2343....................DFSDN.LNSFLETLITQIPVADVQGN...VIKLSNFDTPCGCSADA...NSQKKD.....
O96108_PLAF7/594-741.................GMDAGELLEFYLEN.IFLE..DMKNANGDPKVIEKFKEILGK..............ENEEV.Q
Q26031_PLAFA/2329-2468....................SDDDN.VRSFLETLIP..QITDANAK.NKVIKLSKFGNSCGCSASA...NEQNKN.....
Q9TVM8_PLAFA/10-167................DDFLQTLLMKDLLLE.......IIQDTYGDANEIKRIEALLEQAGVGGID...FAALAGLYTKG
P90580_PLAFA/577-722.....................GHYFVLETVLEGDQFFTDITKAYGDAREIVHIQEMLQKKKEQVLH...EDAS.......
O97312_PLAF7/590-735.................NITLKYYLDILFKE.......KIKEAYGDERESKELEEKLNN.............IEGSQQAG
Q25733_PLAFA/1460-1612....................TIAYNVKSYFVDQGLFDTDYKKAQKVVEDEKERKKIWGCTGHDECS...EKEK.......
O97324_PLAF7/586-729.................YKTLEWVLDLSYFP.......IIKEAHPKEKPVQKMEEIIKK...............NQENIS
Q26034_PLAFA/1453-1588........................NTLTNFLEQFQYRTEFKNAIKPCDGLDQFKTSCGL...NSTD...NSQ..N.....
Q9U0G6_PLAF7/661-824T..............TLEGVLQIEFLN....EGSAQDKQNSLDAKEIQHLKQIKKILDEEKQKNQE...ETAGGCGPGVA
Q9U0G5_PLAF7/675-823.................PDALLEGVL.....EKGVLLTSIKEAYGDAKETEHIKQLLDETAVAGGV...VVGA.......
Q26034_PLAFA/614-768................IVFSPYGVLDLVLKGGNLLQ..NIKDVHGDTDDIKHIKKLLDE..............EDAVAVV
Q94657_PLAFA/1872-2011....................TEMKSSFRSFLVDLIRQIAATIDKGNHNGLVKLVKSVKC.NCGNNS...QNGKEG.....

PF03011

O96296_PLAF7/1525-1663..GNEEDAIDCMIKKLEKKIDECKRKPGENS
O96296_PLAF7/659-826ADNQKKTTIDKLLQHEGDDANNCLKTHKEKC
O15652_PLAFA/10-162..TQNKTTIDKLLNHEEGIAKECQQKQNDCN
Q26033_PLAFA/593-740..TEQKNTIDLLFEYDSEEAEKCKKIQEECQ
Q25989_PLAFA/162-308..GEDYDLVLCMLKNLEKQIQECKKKHGETS
Q25766_PLAFA/465-610...NMETIFDFLLQEEEQDAQKCVSNNPEKC
O15870_PLAFA/568-717......DLIKEIISWLQNKIEVCKSHHDEDK
Q9XZB8_PLAFA/663-808...KKKTIMDKLIEHEDKDAKGCIEKHNEEK
O15663_PLAFA/10-169PVAGQDTTIDKILQHEDKDATKCKNCKPPED
O60991_PLAFA/1483-1626..NKENDAIDCMLKKLGVKAKNCPGKPSGEK
Q25734_PLAFA/1466-1603..GHEYDAIDCMLNRLQDKIDDCNKNHAQNG
O61077_PLAFA/635-791SGTGPKNIMDKLIEHELQEAKKCKDCQEPQQ
Q9U4A2_PLAFA/563-705..TQRKTIIDELLDHELEEAHECRENNPEEK
Q25766_PLAFA/1297-1436..TNKKDIVECLLENLKTKAKTCPNQVNGEN
O61077_PLAFA/1970-2115...ENGDFITNLIDRLQTKIQYCQTQHNKTQ
Q26033_PLAFA/1916-2061..GNENDAIDCMLNKLETKIHEC.KTQHENS
Q26032_PLAFA/2321-2465...NEKDVVLCLLKKLEDKAKNCKDQASGEP
O97324_PLAF7/1459-1607..VERRDVVVCLLDKLEKEAKKCEQKHQNSG
Q9U0G5_PLAF7/1554-1700..NKNEDAIDCMLDKLGKKAEKCHDQHSDNP
Q9U5M2_PLAFA/591-736...YLENAIELLLDHLKETATICKDNNTNEA
Q26030_PLAFA/615-758....DEDALDVLFDHEKEEAEDCLDIHEDDD
O97312_PLAF7/1471-1611...ENGDFITNLISKLQEKISECTSQSSGSD
Q26030_PLAFA/1774-1924...ENKDFITNLIKKLQEKIESCQTQHNPNG
Q26032_PLAFA/577-723..GKSQDAIEFLLDHLKDNALTCRDNNSNES
Q9XZB8_PLAFA/1922-2070..ANKKDIIDCLLDKLKKKTESCPTPTSDHT
Q26031_PLAFA/654-825..TEQKNIMDKLLNYEKDEADLCLEIHEDEE
O60991_PLAFA/671-826..TEQKTLMDKLLNHELNDATKCKDCPLPEE
Q9U0G6_PLAF7/1479-1628..GEYKDAIECMLKKLEEKANKCKEDHSSGE
O15870_PLAFA/2198-2343..GNENDAIDCMINRLQQKAKNCETQPSGSK
O96108_PLAF7/594-741DPLKTKKTIDDFLEKELNEAKNCVEKNPDNE
Q26031_PLAFA/2329-2468..GEYKDAIDCMLKKLKDKIGECEKKHHQTS
Q9TVM8_PLAFA/10-167FVAEKDTTIDKLLQHEQKEADKCLKTHTDDT
P90580_PLAFA/577-722...NMKTIIDELLDHELKEAKQCIVNHKDNN
O97312_PLAF7/590-735DTEHSEFAVDVLLKHEEEIAENCIKYNPEDT
Q25733_PLAFA/1460-1612..EENKNFITNLISELQDKITSCQNKHNPNG
O97324_PLAF7/586-729RVTKQNNSITKFLQQELQEANNCLQKRKQDC
Q26034_PLAFA/1453-1588..GNNNDLVLCLLNKLQKKISECKEQHSGQT
Q9U0G6_PLAF7/661-824SDNKKETIMDKLIDYEKKIATECIEKHKCPD
Q9U0G5_PLAF7/675-823...KDNTTIDKLLEQELKDANRCKNCEQRKP
Q26034_PLAFA/614-768LGGKDNTTIDKLLQHEKEQAEQCKQKQEECE
Q94657_PLAFA/1872-2011...EENDLVLCLLQKLEKKAEKC..KDNPET

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window