Sequence alignment for CL0197

PF04371

AGUA2_LISMO/13-362FRM-PGEYEPH--IGCFMIWPERP-------DNW..RLGGKPAQQNYKEVAVAISNF.........EPVTMFVSPNQ...
AGUA_ARATH/13-372YYM-PAEWDSH--AQTWIGWPERQ-------DNW..RHNALPAQRVFADVAKAISKF.........EPVTVCASPAQ...
AGUA_STRCO/3-337FRM-PPEWAPH--ERTWMAWPGPN-------ATFTDAEELAGARAAWASVARAVRRF.........EPVTMVHGPGQ...
AGUA_LACSS/13-362YRM-PGEFEAH--KDVYLLWPERP-------DNW..REGAKPAQATFAKVAETIAQF.........ESVTVGVSDRQ...
Q8DMK5_THEEB/4-341FFR-PAEWLPH--RACWLAFPSHE-------DLW..GELLPQVRFEFAALCRAIADPDPVTGQCRGEQLKILVLDET..G
AGUA_PSESM/13-363FHM-PAEWAPQ--TQVWMVWPERP-------DNW..RLGGKPAQAAHVAIAKAIARF.........EPVTVAVSAAQ...
PAD_PORGI/55-357VRA-IAEYERS--AAVLVRYPFG.-------..............IPMELIKELAKN.........DKVITIVASES...
Q8A9D9_BACTN/34-366PHL-PAEWHLQ--SGIQLTWPHAG-------TDW..AYMLKEVQECFVNIAREIAKR.........ELLLIVTPEPE...
Q9RRX3_DEIRA/19-349FAM-PPEWAPH--EATWMGYPADD-------ELW..FGHLAGVRDEYAGLVRTIARF.........ERVELLVRDEE..S
AGUA_LACLA/15-363FRM-PGEFEAQ--DQIFMIWPERP-------DNW..RDGAKPVQIAFTNVAKAISRF.........TPVTMLVSQSQ...
O24890_HELPY/2-330KRM-LAEFEKI--QAILMAFPHEF-------SDW..AYCIKEARESFLNIIQTIAKH.........AKVLVCVHTNDIIG
AGUA_VIBPA/12-359FYF-PAEFQPV--SEVWLAWPERK-------DNW..RDDALPAQETFARIANLIAEV.........TKVCVAVCSHN...
Q8KCB6_CHLTE/6-345YFM-PPEWAPH--ASTWLSWPHKL-------ESW..PGKFEPVPAVFAELAYQLSRS.........ETVNINVLDDA..M
Q8PK74_XANAC/5-338LRF-PAEWEPQ--SAVLVAWPHAG-------TDW..AERLADVEETYIALVTAISRF.........EPVVICVADDDLQI
Q87BJ3_XYLFT/23-357FRF-PAEWEPQ--SAILIAWPHAN-------TDW..SAHLADVEETYITLVAAITRF.........QMVIICVLDDDLQT
AGUA_STRMU/15-367FRM-PGEFEKQ--KQIWMLWPWRN-------DNW..RLGAKPAQKAFLEVAEAISEF.........EPVSLCVPPLQ...
AGUA_STRR6/10-360YHM-PAEYEPH--HGTLMIWPIRP-------GSW..PFQGKAAKRAFTQIIETIAEG.........ERVYLLVEQAY...
AGUA_PSEAE/13-363FRM-PAEWEPH--EQTWMVWPERP-------DNW..RNGGKPAQAAFAAVAKAIARF.........EPVTVCASAGQ...
AGUA_YERPE/16-363FFM-PAEWAPQ--DAVWMLWPYRQ-------DNW..RGKAIPAQQTFAKVAEAISRA.........TPVFMGVPAEF...
Q9ABL6_CAUCR/38-367VTV-PAEWAPH--RAMWVGFPSHA-------ELW..QEDLEQAQQEVADLARALAGPG.......AERVRLMVVGDE..A
AGUA1_LISMO/13-362FRM-PGEFEKH--AGCYIIWPERP-------DNW..RLGAKPAQKAFVDVATAISHF.........EPVTVVASSSQ...
Q9Z5U6_ZYMMB/3-325YHQ-PAEWMPH--DAVWIGFPSDA-------SLW..LEDLEPAQAEVVAFAKAVAAQG......EGEKVYLVAAHKE...

PF02274

A3HWB9_9BACT/1-298MVR.PANFGFN.TETAANNFYQQM.......DDRSGKEIQELARKEFDGFVALLRDQ---------.RVNVEVVEDTEN.
A1ZS16_9BACT/10-302MVR.PVSFGHN.PQTAENNAFQTK........KANDAEVLQQAQAEFDGMVAMLREA---------.GVNVLVFDDTPH.
Q1ICB4_PSEE4/71-363MIR.PARFTFN.PDTALNNRFQQA........PLDPATASEKALEEFDGYVETLRRH---------.GVEVLVVQDTPE.
B9Z4I4_9NEIS/9-301MIR.PARFLSN.PQTSPSNAFQKS........DIDHQEAQQNALAEFDAYVGELRRC---------.GVDVLVIDDTVE.
A8GKY3_SERP5/9-301MIR.PSGFTAN.PETRHSNFFQKI........TEKNEDHKAGAVIAFNGYVAALRQA---------.GVDVRVIDEIDG.
E6WKH2_PANSA/9-303MVR.PGRFCLN.PETASSNAFQHAD......ASLLPAQLQQQAELAFDRYVSALRAA---------.GIEVLVLHDHPD.
ARCA_STRCO/26-415VCS.PGLAHRRLTPTNSDELLF............DDVMWVENAQRDHAAFVGELRRR---------.GVEVVELHDLLAQ
ARCA_RHILO/19-407VCA.PGRAHQRLTPSNCDALLF............DDVLWVDNAKRDHFDFMTKMRDR---------.GVEVVEMHNLLAE
ARCA_PSEAE/22-413VCS.PGLAHQRLTPSNCDELLF............DDVIWVNQAKRDHFDFVTKMRER---------.GIDVLEMHNLLTE
ARCA_RHIET/18-405VCR.PSLAHQRLTPANCHDLLF............DDVLWVHEAQKDHFDFVLKMQER---------.GVEVLELHDLLGQ
ARCA_VIBCH/18-404LNR.PERALTHLTPSNCHELLF............DDVLAVEAAGVEHDAFANTLRTQ---------.DVEVLLLHDLLEE
ARCA_MYCTU/19-399LHR.PGAELRRLTPRNTDQLLF............DGLPWVSRAQDEHDEFAELLASR---------.GAEVLLLSDLLTE
ARCA_BACLD/21-409LKR.PGRELENLTPEYLERLLF............DDIPFLPAVQKEHDQFAETLKQQ---------.GAEVLYLEKLTAE
ARCA_STAAN/20-408LKR.PGKELENLVPDYLDGLLF............DDIPYLEVAQKEHDHFAQVLREE---------.GVEVLYLEKLAAE
ARCA_LACLA/19-407LHR.PGAEVENITPDTMKQLLF............DDIPYLKIAQKEHDFFAQTLRDN---------.GAETVYIENLATE
ARCA_LACSK/19-406LKR.PGKEVENITPDIMYRLLF............DDIPYLPTIQKEHDQFAQTLRDN---------.GVEVLYLENLAAE
ARCA_STRPY/21-408LHR.PGKEIENLMPDYLERLLF............DDIPFLEDAQKEHDAFAQALRDE---------.GIEVLYLETLAAE
ARCA_BORAF/22-406LHR.PGEELENLTPFIMKNFLF............DDIPYLEVARQEHEVFASILKNN---------.LVEIEYIEDLISE
ARCA_MYCAR/25-405VHE.PGREIDYITPARLDELLF............SAILESHDARKEHKQFVAELKAN---------.DINVVELIDLVAE
ARCA_MYCPN/19-401VHT.PGNEIRRISPRRLDDLLF............SAVIEPDTAIQEHQTFCQLLQEQ---------.NIEVVQLTDLTAT
ARCX_MYCPN/48-437AHH.PGIETERVIDNQTF................GSAMYLERAQKEHQLFIKILRQH---------.GTKVHYLQDLLLE
Q9KBZ5_BACHD/25-283VCE.PKHMTLRNMINETQKKFK............NEDIHIEIAMEQHHEFVRVLQKH---------.GVNVHLLPVN...
Q97M24_CLOAB/28-292LCR.PDYIEIEPIDEISKSWYE...........KEYEINKEECIKEHEELVQAYQQN---------.GIEVILIDGK...
Q985H6_RHILO/43-307LGS.PNFLRHLSTSSLSRKHLR............EAPCNVQIAQAQHKDLVAAYEHF---------.GVNIHWHEPT...
Q97TX4_SULSO/13-340MHK.PGLEVMLGLLDPSSFLY.............ERQFNWSKARREHDNLRRVLKEE---------.GVKIYRLRQTIVN
Q98CC8_RHILO/18-289MRS.AANAMRDADRAAWHY...............GPGFNPAKAASQHAALAELVAAS---------.GAEIEWIEDKA..
DDAH2_HUMAN/16-281IRGVPESLASGEGAGAG.................LPALDLAKAQREHGVLGGKLRQR---------LGLQLLELPPE...
DDAH1_HUMAN/18-281VRALPESLGQHALRSAK.................GEEVDVARAERQHQLYVGVLGSK---------LGLQVVELPAD...
Y2601_AERPE/14-268TRR.PPQSMSRCISDPGYRA..............AARFSYEEASAQYKVYVERLHSA---------.GITVKELGPL...
Q53797_9ACTO/35-318MNA.PFSYSCDVANNVWMEDLTD..........EERVPDPSRAFAQFLDLYNYVAAE---------ALVALLPTPRT...
P71889_MYCTU/46-302MTP.PAFFAVAYAINPWMDV..............TAPVDVQVAQAQWEHLHQTYLRL---------.GHSVDLIEPI...
Q27657_GIAIN/28-431VHL.PQGTSFLTSLNPEGNLL.............EEPICPDELRRDHEGFQAVLKEK---------.GCRVYMPYDVLSE
A4RXL6_OSTLU/1-301MIV.PSAFGTN.AQAARDNHFMAST.....SDGLSVLEIRERAVAEHKALYRGLRAL---------.GIEINLFTHDEK.
A0Y739_9GAMM/13-300MVR.PHHFTSN.PQTMLDNAFQS.........ECEVKNESEQAFKEVTHAVELLQNE---------.GVTVHLFEDEQ..
B5S3Y7_RALSL/12-303MVR.PHRFTPN.PETAADNAFQQA.......ATGASARVAQVAYDEVTAAARRLEAE---------.GVRVHLFDDTGE.
A1SI98_NOCSJ/27-324LVR.AERFVPN.PATAADNAFQRDI.....PAGQSEDATSSKALAEMDALAQALRDV---------.GVRVHVFRDED..
A3SNQ0_9RHOB/11-301MIR.PDRFRPN.PQTAGDNVFQTA.......SDLSDEDTAARAQSEFDAAVTRLRAA---------.GITVHEFQDSG..
B6QYQ6_9RHOB/14-303MVR.PHHFSVN.AETAVDNAFQAE........ITTDADHAKQAYDEHSDMIAQLEAH---------.GVRVHVFEGDN..
A6FA66_9GAMM/12-310MVR.PWKFFSN.PETAVDNAFQKTGLDEQDSLELNRSGISLQAKNEFDIVVAGLNEN---------.GINVHVFDDFGD.
B6R176_9RHOB/1-293MIR.PLFFSTS.KDAGQSSSRSLIG......EAQADIDFAEQAYMEISTAADELIRH---------.GVDVHLFEDKS..
C7R733_KANKD/14-313MVP.PTDFAFN.EQTGADNEFQNK.......PQQPNEHLREDALCEFNEMVNLLRDE---------.HIEVLLLNKHAQS
A3Y5Y8_9GAMM/25-321MVR.PVDFGFN.EETALDNEFQQK........LDDSAKVTEQALVEFESMVKRIRAA---------.GIEVLVLEKADT.
D0II89_9VIBR/24-319MVP.PKEFGFN.AQTAQDNAFQNP.......LALSAETILQRAMAEFNAMVNGLRQA---------.GVEVVVFDYPQG.
A7JFU5_FRANO/11-306MVD.PEYFALNTQKTDSDDAFRRA.......VRLNEKAIQALARDEFYEMVNYIRSK---------.DIKVIIMKSP...
B2SEN0_FRATM/11-304MVE.PKYFCFN.QETSVNNAFQNQ.......LDISNDELQNRVIHEFENMVAKIRAN---------.GIEVIVLESK...
C6JL70_FUSVA/11-306MVR.PIAFAYN.AETAKDNLYQKD.......DHKDEKELQEKAVAEFDILVEKLREK---------.TIEVLVIQDTKE.
A5TT52_FUSNP/15-310MVR.PILFAFN.EQTAVNNHYQKR.......DNKPVQEIQNKALIEFDNMVEKLKKV---------.GIDVKVMQDTKE.
C1DBM8_LARHH/11-310MVR.PVSFYFD.TETAANDFFQKN.......LGEKRDVVQAKALIEFDAMVDLLRSK---------.GITVHVLQDSNQ.
C3J844_9PORP/12-304MVR.PASFGFN.SETAANNYFQKA........EAQSNDTAVRARREFDDYVDLLRRN---------.GVDVWVIQDTPQ.
C2M8A5_CAPGI/11-307MVR.PVRFRTN.EETIVNNYFQKG.......INITQEEINRKAQQEFDMLVQKLKEV---------.GVHVIQVEDIYE.
D7VIR4_9SPHI/41-339MIR.PASFRKN.EQTSINNYFQHTI......PGWSDERINTCAQQEFDNFVSLLKQH---------.DIRLIVIQDDGQ.
D7VW83_9FLAO/9-304MIE.PIAFGYN.AETAKNNYFQV.........EQTGSDIQSKALAEFNTFVGKLRGK---------.GINVITIKDTPD.
C3Q1R5_9BACE/11-308MVE.PVAFGFN.EETAANNYFQQR.......TVAAGETVQACALKEFRGMVDKLRAN---------.GIEVIVVQDTPI.
A6EJW5_9SPHI/1-292MIR.PVDFKFN.AQTAGNNKFQQ.........ASAQNDVQDQALKEFDDFVTVLRDN---------.GIDVTVINDTLD.
D2QCE7_SPILD/11-306MIR.PVNFGFN.TETAESNAFQNSQ.....LAAQTKDTAQETAQREFDEMARQLRAM---------.GVDVIVYDDTTE.

PF04996

ASTB2_CAUCR/1-446MIS-AFEANCDGLVGPTHSYVGLSPGNLASTRNAGEVSNPRGAALEGLAKMRRLADL----------GLPQFVLPPHERP
ASTB1_CAUCR/1-426M..-TLEINFDGLIGPTHNYAGLSLGNIASHSNAGAVSSPRAAALQGLTKMRTLLDL----------GLTQGFLPPPPRP
ASTB_PSEAE/1-448M.N-AHEVNFDGLVGPTHNYGGLSYGNVASQSNSQAVSNPKEAAKQGLAKMKALMEM----------GFKQGVLAPQARP
ASTB_ECOLI/1-447M.N-AWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKALADA----------GFPQAVIPPHERP

PF03068

PADI2_MOUSE/287-673GIP-LTPIFTDTVMFRIAPWIMTPNILPPVSVFVCCMKD....NYLFLKEVKNLVEK---------TNCELKVCFQ----
PADI4_HUMAN/278-663ELP-EAVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFE....NEDFLKSVTTLAMK---------AKCKLTICPE----
O57400_CHICK/289-672GLL-ETPIFTDTVVFRMAPWIMTPNTLAPLEVFVCSVKD....NEDFVAAVSALAEE---------AKCPVTICPL----
PADI1_RAT/275-662PLS-EVLVFTDSVTFRVAPWIMTPNTQPPLELYVCSVTDMHGSNDKFLEDMSHLATK---------ANCKLVVCPR----
PADI1_HUMAN/276-663TLP-EVTLFTDTVGFRMAPWIMTPNTQPPEELYVCRVMDTHGSNEKFLEDMSYLTLK---------ANCKLTICPQ----
PADI3_RAT/278-664DYS-ETPIFTDTVVFRVAPWIMTPSTLPPLEVYVCQVRN....NTCFVEAVEELARK---------AGCKLTICPQ----
PADI4_RAT/278-666ELP-EALVFQDTVMFRVAPWIMTPNTQPPQEVYVCRFSD....NEDFLKSLATFTKK---------AKCKLTVCPE----

PF04371

AGUA2_LISMO/13-362YKNARKELPD.........TIRVI--------------------------------------------------------
AGUA_ARATH/13-372WENARKQLPE.........DIRVV--------------------------------------------------------
AGUA_STRCO/3-337AATARELLGP.........DVDLV--------------------------------------------------------
AGUA_LACSS/13-362YTNARHMLAD.........NIQVV--------------------------------------------------------
Q8DMK5_THEEB/4-341KATAHSYLSD........LNPQFY--------------------------------------------------------
AGUA_PSESM/13-363YDNARARLDM........PNIRVV--------------------------------------------------------
PAD_PORGI/55-357..QKNTVITQYTQSGVNLSNCDFI--------------------------------------------------------
Q8A9D9_BACTN/34-366.EVKKQIVATVN.....MDNVRFL--------------------------------------------------------
Q9RRX3_DEIRA/19-349ERDARARLTG........HNVRFH--------------------------------------------------------
AGUA_LACLA/15-363YQNARYQLPA.........DVRVL--------------------------------------------------------
O24890_HELPY/2-330YETLK......N.....LPGVEIA--------------------------------------------------------
AGUA_VIBPA/12-359FDRARQMLHS.........DVRLV--------------------------------------------------------
Q8KCB6_CHLTE/6-345EAQARELLKERDPEGKYAERIVFH--------------------------------------------------------
Q8PK74_XANAC/5-338YAEARLRSARVD.....MTRVRFV--------------------------------------------------------
Q87BJ3_XYLFT/23-357YTEARLRSASVA.....MQQVRFT--------------------------------------------------------
AGUA_STRMU/15-367YENALARVSELG.....SHNIRII--------------------------------------------------------
AGUA_STRR6/10-360LSEAQSYLGD.........KVVYL--------------------------------------------------------
AGUA_PSEAE/13-363YENARARLDD........GNIRVV--------------------------------------------------------
AGUA_YERPE/16-363MAQAKATMPA.........NVTLV--------------------------------------------------------
Q9ABL6_CAUCR/38-367EAAARALLSD........TTVEIV--------------------------------------------------------
AGUA1_LISMO/13-362YVNARYMLSD.........EIRVV--------------------------------------------------------
Q9Z5U6_ZYMMB/3-325AADQAVKMAG........SDIEVI--------------------------------------------------------

PF02274

A3HWB9_9BACT/1-298................................................................................
A1ZS16_9BACT/10-302................................................................................
Q1ICB4_PSEE4/71-363................................................................................
B9Z4I4_9NEIS/9-301................................................................................
A8GKY3_SERP5/9-301................................................................................
E6WKH2_PANSA/9-303................................................................................
ARCA_STRCO/26-415IMALPEARAWLLDRKITANQVGIGLIDAARAYLETLSP....RELAEYLVGGLATSDLPEDFRSPHLALARESTGAREYL
ARCA_RHILO/19-407TVAVPEGKKWILDNQVVPNQIGLGLVDEVRSYLEGLSN....RDLAETLIGGLSTHEFPESIGGEQLELIRDAAGVNEYL
ARCA_PSEAE/22-413TIQNPEALKWILDRKITADSVGLGLTSELRSWLESLEP....RKLAEYLIGGVAADDLPASEGANILKMYREYLGHSSFL
ARCA_RHIET/18-405TLANQQARDFLLDRRITPNVLGSQIAEAMRPWLDEM.......PAAQLAAFMIGGIAISDLPEVKAKSLMLSALPETDFV
ARCA_VIBCH/18-404TLAIPEARQWLLNTQISDFRFGPTFARELRHALNHL........DDHHLTTLLLGGLAFSELHLESDSMLPKMRQPLDFV
ARCA_MYCTU/19-399ALHHSGAARMQGIAAAVDAPRLGLPLAQELSAYLRSLD....PGRLAHVLTAGMTFNELPSDTRTDVSLVLRMHHGGDFV
ARCA_BACLD/21-409ALDDALVREQFIDELLTESKADINGAYDRLKEFLLTF......DADSMVEQVMSGIRKNELEREKKSHLHELMEDHYPFY
ARCA_STAAN/20-408SIENPQVRSEFIDDVLAESKKTILGHEEEIKTLFAT.......LSNQELVDKIMSGVRKEEINPKCTHLVEYMDDKYPFY
ARCA_LACLA/19-407VFEKSSETKEEFLSHLLHEAGYRPGRTYDGLTEYLTSM....STKDMVEKIYAGVRKNELDIKRTALSDMAGSDAENYFY
ARCA_LACSK/19-406AIDAGDVKEAFLDKMLNESHIKSPQVQAALKDYLISM......ATLDMVEKIMAGVRTNEIDIKSKALIDVSADDDYPFY
ARCA_STRPY/21-408SLVTPEIREAFIDEYLSEANIRGRATKKAIRELLMAIE...DNQELIEKTMAGVQKSELPEIPASEKGLTDLVESNYPFA
ARCA_BORAF/22-406VLVSSVALENKFISQFILEAEIKTDFTINLLKDYFSS......LTIDNMISKMISGVVTEELKNYTSSLDDLVNGANLFI
ARCA_MYCAR/25-405TYDLASQEAKDKLIEEFLEDSEPVLSEEHKVVVR............NFLKAKKTSRELVEIMMAGITKYDLGIEADHELI
ARCA_MYCPN/19-401TFDKANATAQNQFIETWLDQAEPKLTPEHRKVAKQY........LLEQKAKSTLSMVRSMMGGIDKRKVAAANTINGDFL
ARCX_MYCPN/48-437ALSAADPNVRQDFIKNFLLESGIKSVSTFEACLNFFRS...LDSLVDVIKVMFGGIKVSDVPPITPQRFADIHVSNSPFL
Q9KBZ5_BACHD/25-283................................................................................
Q97M24_CLOAB/28-292................................................................................
Q985H6_RHILO/43-307................................................................................
Q97TX4_SULSO/13-340KIRRDDRFREKVIEKVGVNNDDPEF.............................LVELLILRPILGYEKRDKGTHLEVKL
Q98CC8_RHILO/18-289................................................................................
DDAH2_HUMAN/16-281................................................................................
DDAH1_HUMAN/18-281................................................................................
Y2601_AERPE/14-268................................................................................
Q53797_9ACTO/35-318................................................................................
P71889_MYCTU/46-302................................................................................
Q27657_GIAIN/28-431ASPAEREVLMDQAMASLKYELHATGARITPKMKYCVSDEYKRKVLSALSTRNLVDVILSEPVIHLAPGVRNTALVTNSVE
A4RXL6_OSTLU/1-301................................................................................
A0Y739_9GAMM/13-300................................................................................
B5S3Y7_RALSL/12-303................................................................................
A1SI98_NOCSJ/27-324................................................................................
A3SNQ0_9RHOB/11-301................................................................................
B6QYQ6_9RHOB/14-303................................................................................
A6FA66_9GAMM/12-310................................................................................
B6R176_9RHOB/1-293................................................................................
C7R733_KANKD/14-313H.............................................................................QE
A3Y5Y8_9GAMM/25-321................................................................................
D0II89_9VIBR/24-319................................................................................
A7JFU5_FRANO/11-306................................................................................
B2SEN0_FRATM/11-304................................................................................
C6JL70_FUSVA/11-306................................................................................
A5TT52_FUSNP/15-310................................................................................
C1DBM8_LARHH/11-310................................................................................
C3J844_9PORP/12-304................................................................................
C2M8A5_CAPGI/11-307................................................................................
D7VIR4_9SPHI/41-339................................................................................
D7VW83_9FLAO/9-304................................................................................
C3Q1R5_9BACE/11-308................................................................................
A6EJW5_9SPHI/1-292................................................................................
D2QCE7_SPILD/11-306................................................................................

PF04996

ASTB2_CAUCR/1-446AVSLLRQLGFSGPDEIVLTSAWRDAPALAAA-------------------------------------------------
ASTB1_CAUCR/1-426AAHVLRRLGFKGSDQAVLAQVADEDLDLLRA-------------------------------------------------
ASTB_PSEAE/1-448DTAALRSLGFSGSDEEVIRRAAKEAMPLLAA-------------------------------------------------
ASTB_ECOLI/1-447FIPVLRQLGFSGSDEQVLEKVARQAPHWLSS-------------------------------------------------

PF03068

PADI2_MOUSE/287-673--------------------------------------------------------------------------------
PADI4_HUMAN/278-663--------------------------------------------------------------------------------
O57400_CHICK/289-672--------------------------------------------------------------------------------
PADI1_RAT/275-662--------------------------------------------------------------------------------
PADI1_HUMAN/276-663--------------------------------------------------------------------------------
PADI3_RAT/278-664--------------------------------------------------------------------------------
PADI4_RAT/278-666--------------------------------------------------------------------------------

PF04371

AGUA2_LISMO/13-362-EMSNDDAWIRDYGPSFLVDDK.......G.DMR..GVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCELERIDYYSQK..
AGUA_ARATH/13-372-EMSMNDSWFRDSGPTFIVRKRPVKLSSLNRNIA..GIDWNFNAWGGANDGCYNDWSHDLLVSRKILALERIPRFQHS..
AGUA_STRCO/3-337-ERELDDAWMRDIGPTFVTDGR.......G.GLA..AVDWVFNGWGAQD...WARWEHDAEIARHVADLAAAPVLSSP..
AGUA_LACSS/13-362-EMSNNDSWIRDCGPTFVVNDK.......G.DSR..GVDWTFNAWGGLVDGLYFPWDKDDRVAQKVCEIEGRDRYRLD..
Q8DMK5_THEEB/4-341-QLTFGDIWLRDTAPVGLINEA.......G.ERR..LLCLPFNGWGKKY.....QLAGDSDLAIRLALLMGIPYGSVP..
AGUA_PSESM/13-363-EMSSNDAWVRDSGPTFVINDR.......G.ELR..GVNWEFNAWGGFDGGLYAPWNLDSQVGSKVLEIERCPRYATQ..
PAD_PORGI/55-357-IAKTDSYWTRDYTGWFAMYDT.......N.KVG..LVDFIYNR..........PRPNDDEFPKYEAQYLGIEMFGMK..
Q8A9D9_BACTN/34-366-RCETNDTWARDHGAITM.IDT.......G.NPS..LLDFTFNGWGLKF.....ASELDNLI...TGQAVKAGALKGQYI
Q9RRX3_DEIRA/19-349-RVPLDDSWLRDSGPLFVTRGE.......K.DPEVALVNWRFNAWGGKF.....EWENDNRVPEYVAQFLGMGHWDRP..
AGUA_LACLA/15-363-EVSNNDSWVRDCGPSFVINDK.......G.ELR..ANDWTFNAWGGLVDGLYFPWDQDDLVAQKVCELERVDSYRTD..
O24890_HELPY/2-330-RIDTNDTWARDFGAISV.ENH.......G.VLE..CLDFGFNGWGLKY.....PSNLDNQV...NFKLKSLGFLKHP.L
AGUA_VIBPA/12-359-EIPFNDAWMRDIGPTVLVNQA.......G.ERR..GISWQFNAWGGEYNGLYDNWQQDDLVAGSVCDIIGIDYYRAP..
Q8KCB6_CHLTE/6-345-RIPTNDAWCRDHGPNYVIRTQ.......DGRRDKVIMNWEYNAWGGKYE....PYDDDNAVPERVAKAQGLPMVSTG..
Q8PK74_XANAC/5-338-IAAYNDTWLRDSGPITL.RQE.......A.GFR..LMDFRFTGWGGKF.....EASLDDQL...VSSLDAAQVFVPAQV
Q87BJ3_XYLFT/23-357-VASYNDTWLRDSGPIILIGIN.......G.DFR..LLDFRFTGWGGKF.....EAKADDQL...VSSLHANGLFKNTQM
AGUA_STRMU/15-367-EMTNDDAWIRDCGPTFLVNDK.......G.DLR..AVDWEFNAWGGLVDGLYFPWDQDALVARKVCEIEGVDSYKTK..
AGUA_STRR6/10-360-DIPTNDAWARDTGPTILVNDK.......G.KKL..AVDWAFNAWGGTYDGLYQDYEEDDQVASRFAEALERPVYDAK..
AGUA_PSEAE/13-363-EISSDDAWVRDTGPTFVIDDK.......G.DVR..GVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTD..
AGUA_YERPE/16-363-EMASDDAWMRDTGPTMVINGA.......A.ERR..AVDWQFNAWGGLNGGLYADWQQDEKVAVQVSDFLKNAHYSAP..
Q9ABL6_CAUCR/38-367-RGQFGDIWLRDTGPIFVDDAG.........KAV..AAGFKFNGWGGKY.....SLEGDDIVAEQIAAASGAPLVRND..
AGUA1_LISMO/13-362-EMDNDDAWVRDSGPTFVVNDS.......G.DVR..GVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLA..
Q9Z5U6_ZYMMB/3-325-CHPFGDIWLRDNAPLFVKEGD.........KKA..LALFRFNGWGGKY.....NLDGDQTIGRDLAKDTALPVLEKN..

PF02274

A3HWB9_9BACT/1-298.PVKTDAVFPNNWFST...HSD-------.-.GK--LIMYPMFSPNRRL-----ERRKDLIEMLMHK...GYQVSDIL--
A1ZS16_9BACT/10-302.PPKPSAIFPNNWVSF...HEE-------.-.GV--VILYPLYAPNRRE-----ERQEEILIALEQQ....FDKQILL--
Q1ICB4_PSEE4/71-363.PHTPDSIFPNNWWSS...HAD-------.-.GS--LVLYPMEGHNRRL-----ERDKGALRVLEER....FAIQRTV--
B9Z4I4_9NEIS/9-301.PHTPDSIFPNNWISL...HAD-------.-.GK--VLLYPMEAPNRRL-----ERNNKVLEKIKHV....FAVEEVI--
A8GKY3_SERP5/9-301.QETPDALFPNNWIAL...LGD-------.-.GT--LFTFPMEAVNRRR-----ERRQDIIAQLAND....FVVERCV--
E6WKH2_PANSA/9-303.NNTPDALFPNNWITL...QHD-------.-.GS--LTLFPMEAPNRRR-----ERHPAIIAALAQR....FHLLPTL--
ARCA_STRCO/26-415MPPLPNTLYTRDTTCW....LY-------.-.GG--LTLNPLYWSARHD-----ETLLMKAIYTFHPDFKGSK..VWW--
ARCA_RHILO/19-407LPPLPNTLYTRDTTCW....IY-------.-.GG--VTQNPLYWPARHE-----ETILTTSIYKFHPD.FAGKVNVWW--
ARCA_PSEAE/22-413LPPLPNTQFTRDTTCW....IY-------.-.GG--VTLNPMYWPARRQ-----ETLLTTAIYKFHPEFANAEFEIWY--
ARCA_RHIET/18-405IPPIPNTLFQRDPSCW....IY-------.-.GG--VTCNPMFWPARRA-----ETLIQRAIYKFHPIFLGGDFQIWW--
ARCA_VIBCH/18-404IEPLPNHLFTRDTSCW....VY-------.-.GG--VSLNPMMKPARQR-----ETNHLRAIYRWHPIFAQHPFIHYF--
ARCA_MYCTU/19-399IEPLPNLVFTRDSSIW....IG-------.-.PR--VVIPSLALRARVR-----EASLTDLIYAHHPRFTGVR.....--
ARCA_BACLD/21-409LDPMPNLYFTRDPAAA....IG-------.-.SG--LTINKMKEPARRR-----ESLFMRYIINHHPRFKGHEIPVWL--
ARCA_STAAN/20-408LDPMPNLYFTRDPQAS....IG-------.-.HG--ITINRMFWRARRR-----ESIFIQYIVKHHPRFKDANIPIWL--
ARCA_LACLA/19-407LNPLPNAYFTRDPQAS....MG-------.-.VG--MTINKMTFPARQP-----ESLITEYVMANHPRFKD..TPIWR--
ARCA_LACSK/19-406MDPMPNLYFTRDPAAS....MG-------.-.DG--LTINKMTFEARQR-----ESMFMEVIMQHHPRFANQGAQVWR--
ARCA_STRPY/21-408IDPMPNLYFTRDPFAT....IG-------.-.TG--VSLNHMFSETRNR-----ETLYGKYIFTHHPIYGGGKVPMVY--
ARCA_BORAF/22-406IDPMPNVLFTRDPFAS....IG-------.-.NG--VTINKMFTKVRQR-----ETIFAEYIFKYHPVYKE.NVPIWL--
ARCA_MYCAR/25-405VDPMPNLYFTRDPFAS....VG-------.-.NG--VTIHYMRYKVRQR-----ETLFSRFVFSNHPKLIN..TPWYY--
ARCA_MYCPN/19-401VDPMPNLYFTRDPFAS....IG-------.-.HG--ISINRMKYLTRRR-----ETLFASFIFANHPIIAARKFYF..--
ARCX_MYCPN/48-437IKPLSFSLYPHKFFNT....LG-------.-.TG--VALFVTNDSELKR-----HSLVYEYIMRFHPRFDGVKLYTNR--
Q9KBZ5_BACHD/25-283.EKYPEQVFTRDIGFT....LG-------.-.QT--TFVADMAHDVRKG-----EENTLKEWLEL............K--
Q97M24_CLOAB/28-292.PKLKNQVFSRDFGAT....IK-------.-.EG--YILGNFKETVRKE-----ETKEYEDKLKE............L--
Q985H6_RHILO/43-307.PELPMQVYSRDSSVM....TP-------.-.YG--AIITAMANWWRRG-----ENYAAIRTYEK............L--
Q97TX4_SULSO/13-340TDPLSNLYFMRDQQIT....TE-------.-.KG--IIMGRMATHQREK-----EVEVMKLFWEA............L--
Q98CC8_RHILO/18-289.DGLSDSVFTHDPSLM....TD-------.-.RG--ALILSMGKPLRAS-----EPSLHEETYRR..........LGI--
DDAH2_HUMAN/16-281.ESLPLGPLLGDTAVI....QG-------.-.DT--ALITRPWSPARRP-----EVDGVRKALQD..........LGL--
DDAH1_HUMAN/18-281.ESLPDCVFVEDVAVV....CE-------.-.ET--ALITRPGAPSRRK-----EVDMMKEALEK..........LQL--
Y2601_AERPE/14-268.EDYPDSVFIQDTAVI....GG-------G-SRV--AVLARFGAPSRRG-----EEGHVVSILSS............M--
Q53797_9ACTO/35-318.TGLQDLVFTANLGIVLEHLPD-------.-RNT--VVISRYTSPPRQA-----ETPVGERFFEA.............--
P71889_MYCTU/46-302.SGLPDMVYTANGGFI....AH-------.-.DI--AVVARFRFPERAG-----ESRAYASWMSS.............--
Q27657_GIAIN/28-431IHDSNNMVFMRDQQIT....TR-------.-.RG--IVMGQFQAPQRRR-----EQVLALIFWKR.......LGARVV--
A4RXL6_OSTLU/1-301.HATPDACFPNNWHTL....RD-------.-.GK--LKLFPMKDENRRL-----ERREDIIEFLKHKHPNLVVDDSLL--
A0Y739_9GAMM/13-300.THTPDSVFPNNWFST...HQN-------.-.GQ--LIIYPMFVENRRL-----EYRKDIIDFLTDH....YKVAVVT--
B5S3Y7_RALSL/12-303.RDTPDSVFPNNWFST...HPG-------.-.GH--VALYPMYSPSRRR-----ERRADVIEMLKAH....YRVQDVI--
A1SI98_NOCSJ/27-324.HTRPDSVFPNNWLST...HAG-------.-.GY--VAVYPMYASNRRH-----ERRADVLEMLKSD....YRTQTIV--
A3SNQ0_9RHOB/11-301.ADTPDAVFPNNWFST...HSG-------.-.GY--VALYPMYAENRRA-----ERRWDVIELLKAR....YRVQEVA--
B6QYQ6_9RHOB/14-303.PGLPDCVFPNNWFST...HAG-------.-.GH--VAIFPMKAENRRL-----ERRQDILEMLKSN....YRVQDVI--
A6FA66_9GAMM/12-310.RDTPDSVFPNNWFST...HSG-------.-.GH--VALYPMFSQNRRR-----ERRSDIIEMLKAQ....YRVQDVI--
B6R176_9RHOB/1-293.RETPQSVFLNNWLST...HAG-------.-.GY--VTIYPMHAENRRK-----ERREDVIDLLKAE....YRVQDVV--
C7R733_KANKD/14-313LPELPDAVFPNNWFST...SSD-------.-.GT--LTLYPMKTPNRRA-----EVRPDELALLLHRN..GYRVNKTE--
A3Y5Y8_9GAMM/25-321DYVTPDAVFPNNWFST...SQD-------.-.GT--LTIYPMFAENRRQ-----ERRIDDLTALLKRE..GYQVGSVE--
D0II89_9VIBR/24-319HGETPDAVFPNNWFST...TDA-------.-.GE--LFLFPMACANRRL-----EVRPEALIQTLQQQ..GFVVKEQH--
A7JFU5_FRANO/11-306.KNAADAVFTNDWLSTHIINGQ-------.-.GY--IFIYPMYSESRRC-----EVQPQQLLQTLESE..LKIKYKLK--
B2SEN0_FRATM/11-304.PNTPDAVFPNNWFSTHLIDNQ-------.-.PY--VFIYPMYTQNRRN-----EVQVDKLLEQLNKL..TTTNYKVI--
C6JL70_FUSVA/11-306.PHTPDSIFPNNWFST...HKN-------.-.GT--LVLYPMYAENRRL-----ERTPKILDFVKNR.....ENLKII--
A5TT52_FUSNP/15-310.PHTPDSIFPNNWFST...HYS-------.-.NT--VVLYPMFAENRRL-----ERTDNLYDFFDKT.....DDLNVV--
C1DBM8_LARHH/11-310VMDTPDSIFPNNWFVS...MEG-------.-.GH--LMLCPMWAPNRRH-----ERLKFLGQLVDLI...GHDKLKVS--
C3J844_9PORP/12-304.PYTPDSIFPNNWFST...HIT-------.-.GE--LILYPMFAPNRQK-----ERKLSALATVGML....EGVTKIV--
C2M8A5_CAPGI/11-307.QDTPDSIFPNNWISF...HNN-------.-.GD--VAIYPMFAENRRR-----ERREDILDIVEEA...GFEIENVF--
D7VIR4_9SPHI/41-339.HDTPDSIFPNNWISF...HEN-------.-.GE--VVLYPMFAENRRN-----ERKIDIFAPLKEA...GYAVTDRR--
D7VW83_9FLAO/9-304.PHTPDSIFPNNWVSF...HKD-------.-.GK--VVLYPMFASNRRV-----ERREDIIESIKDQ...GFEVTEID--
C3Q1R5_9BACE/11-308.PHTPDSIFPNNWVSF...HDD-------.-.GT--VVLYPMFAENRRA-----ERRADILQRIESE...GFSIRRKV--
A6EJW5_9SPHI/1-292.PETPDSIFPNNWVSF...HEN-------.-.GD--IFLYPMFSENRRQ-----ERRDDILEQLGKR....FNIERIN--
D2QCE7_SPILD/11-306.PYTPDSIFPNNWISF...HAS-------.-.GT--VVLYPMQAENRRL-----ERRQDIVDDLRKN....YHVAKVV--

PF04996

ASTB2_CAUCR/1-446-ACSASPMWAANAATVTPSADA--------ADGRVHFTPANLLTNLHRSLEGRQTARSLRRLFADETRFAVHDPLPAQ--
ASTB1_CAUCR/1-426-ASSASSMWTANAATVLAAPDT--------ADGRVHLVTANLGTMLHRSLEADDTYATLRRVFSGEA.FAVHAPLPFA--
ASTB_PSEAE/1-448-CSSASSMWTANAATVSPSADT--------ADGRVHFTAANLNCKFHRSIEHPTTSRVLAAMFNDERHFAHHAALPAV--
ASTB_ECOLI/1-447-VSSASPMWVANAATIAPSADT--------LDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQV--

PF03068

PADI2_MOUSE/287-673-YMNRGDRWIQDEIEFGYIEAP----------HK--GFPVVLDSPRDGNLKDFPIKQLLGPDFGYVTREPLFETVTSL--
PADI4_HUMAN/278-663-EENMDDQWMQDEMEIGYIQAP----------HK--TLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGL--
O57400_CHICK/289-672-PENRNDRWIQDEVEFGYVQAP----------HK--MFPVVLDSPRDRGLKDFPVRSILGPDFGYVAQETPEN.TSSL--
PADI1_RAT/275-662-LENRNDRWIQDEMEFGYIDAP----------HK--SFPVVFDSPRNRGLRDFALKKILGPDFGYVTREIQFAGASGL--
PADI1_HUMAN/276-663-VENRNDRWIQDEMEFGYIEAP----------HK--SFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSL--
PADI3_RAT/278-664-AENRNDRWIQDEMELGYTQAP----------HK--TLPVVFDSPRNGELQGFPYKRILGLDFGYVTREPPDSSVSGL--
PADI4_RAT/278-666-EENQDDQWMQDEMEIGYIQAP----------HK--TLPVVFDSPRDRGLKDFPVKRVMGPNFGYVTRGLYRAEVTGL--

PF04371

AGUA2_LISMO/13-362...DFILEGCSIHVDGEGTLVTTEECLLSEGR------------NPNLTKIEIEQTLKKYFHAQKVIWLKHGFYLD...E
AGUA_ARATH/13-372....MILEGGSIHVDGEGTCLVTEECLLNKNR------------NPHMSKEQIEEELKKYLGVQSFIWLPRGLYGD...E
AGUA_STRCO/3-337....LVNEGGAIHVDGEGTVLLTDTVQLGSGR------------NPGWSREEVEAEIHAKLGTTTAIWLPHGLAGDYGRY
AGUA_LACSS/13-362...DLVLEGGSTHVDGEGTLLVTEECLLSDGR------------NPQLSKEQIESILKEYLNVEKIIWLKKGIYLD...E
Q8DMK5_THEEB/4-341....LFLEGGAIEVDGEGTCLTTRQCLLNPNR------------NPYLSSAEVEARLKPALGVSKILWIESG.LVN...D
AGUA_PSESM/13-363...GFVLEGGSIHVDGEGTLITTEECLLNRNR------------NPHLTREQIEAVLSDYLAVDKIIWLPDGLFND...E
PAD_PORGI/55-357....LKQTGGNYMTDGYGSAV...QSHIAYTE------------NSSLSQAQVNQKMKDYLGITHHDVVQ...DPN...G
Q8A9D9_BACTN/34-366DCLDFVLEGGSIESDGMGTLLTTTECLLSPHR------------NGKLNQVEIEEYLKSTFHLQKVLWLDHGYLAG...D
Q9RRX3_DEIRA/19-349....EVLEGGGLEIAGDGAALTTRSCFLTDTR------------NPGLSEEGYTFLLSDQLGVKKLHWLDGG.LEN...D
AGUA_LACLA/15-363...DFVLEGGSFHVDGQGTVLTTEMCLLSEGR------------NPHMSKEDIENKLKEHLNAEKILWLGDGIDPE...E
O24890_HELPY/2-330KTMPYILEGGSIESDGAGSVLTNTQCLLEKNR------------NPHLNQNGIENMLKKELGAKQVLWYSYGYLKG...D
AGUA_VIBPA/12-359....FVLEGGAIHTDGEGTLYTTEECLLSPGR------------NPQLSKAQIEEQLKVYLGIEKIIWLPNGLFND...E
Q8KCB6_CHLTE/6-345....MVLEGGAIDVNGAGLLLTTTACLLNPNR------------NPSLGKAEIEAQLRRYLGIEKVLWLGDG.IAG...D
Q8PK74_XANAC/5-338ETVDFALEGGAIETDGAGTLLTTWKCL..HER------------HPQRTRESLSSDLATWLAQERVLWLDHGYLEG...D
Q87BJ3_XYLFT/23-357HSINFALEGGAIETDGAGTLLTTWRCL..HER------------HPQRTRTTLDANLTAWLAQNRVLWLEHGYLEG...D
AGUA_STRMU/15-367...DFVLEGGSIHVDGEGTVLVTEMCLLHPSR------------NPHLTKEDIEDKLKDYLNCVKVLWVKDGIDPY...E
AGUA_STRR6/10-360...PFVLEGGAIHSDGQGTILVTESCLLSPGR------------NPNLTKEEIENTLLESLGAEKVIWLPYGIYQD...E
AGUA_PSEAE/13-363...DFVLEGGSIHVDGEGTLITTEECLLNHNR------------NPHLSQAEIERTLRDYLAVESIIWLPNGLYND...E
AGUA_YERPE/16-363....LILEGGSIHTDGEGTLLTTAECLLNPNR------------NPHLNQAQIEQLLCDYLGVTHFIWLQDGVYND...E
Q9ABL6_CAUCR/38-367....FILEGGALDHDGNGTILTTRQCLLNDNR------------NPGWDEATANAALTEALGAKKVLWLGKG.LKN...D
AGUA1_LISMO/13-362...DFVLEGGSIHVDGEGTLVTTEECLLSEGR------------NPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLD...E
Q9Z5U6_ZYMMB/3-325....WVLEGGSIDGDGHGLVVTTEECLLNPNR------------NPELSRGDIARHLRNDLGYDRVLWLRKG.LHN...D

PF02274

A3HWB9_9BACT/1-298-DLS.FFENDGQYLEGTGSMVMDHESKTIFAC------------YSERTHPFPLQYVAELLDYK..VVGFHSVQEIEGVQ
A1ZS16_9BACT/10-302-DFS.PYESSGKYLESTGSMIIDRPHKVIYAC------------RSERTHEQVLQVVAEKLSYE..YLLFDA...VDEQK
Q1ICB4_PSEE4/71-363-DLS.PLEQQNLFLEGTGSMVLDREHRISYAC------------HSGRTHEHALRQFAEQLDYR..LCLFHA...VDRQH
B9Z4I4_9NEIS/9-301-DLS.GFERVGQYHEGTGTMIFDHDQKMTYVC------------FSSRSSENVMKAVSETIGYQ..SFWFHS...VDRHG
A8GKY3_SERP5/9-301-DLS.AHELAGRFLEGTGSLILDRQHQLAYCC------------QSSRSSPEVGGEFERHSGYQ..IVWFDA...VDANN
E6WKH2_PANSA/9-303-DLS.GWEQQGEYLEGTGSLVCDHQHRIAWVC------------RSSRSSARVLQAWQQQSGYR..VIEFTA...QDAQG
ARCA_STRCO/26-415-GDP.ERDWGQATFEG.GDIMPVGNGVVLMGM------------SE.RTSRQAITQVAAALFRS..GAAEHVVVAGMPKL
ARCA_RHILO/19-407-GDP.TKDWGLATLEG.GDVMPIGKGNVLIGM------------SE.RTSRQAISQLAATLFEK..GAAERVIVAAMPKL
ARCA_PSEAE/22-413-GDP.DKDHGSSTLEG.GDVMPIGNGVVLIGM------------GE.RSSRQAIGQVAQSLFAK..GAAERVIVAGLPKS
ARCA_RHIET/18-405-GDS.DQPFANASMEG.GDVMPIGNGTVLIGM------------GE.RTTYQAVGQVAQALFRS..KAAKRVVGCLMPKS
ARCA_VIBCH/18-404-GID.DLHYDNANIEG.GDVLVIGKGAVLIGM------------SE.RTSPQGVENLAAALFKH..GQASKVIAINLPKH
ARCA_MYCTU/19-399-..R.AYESRTAPVEG.GDVLLLAPGVVAVGV------------GE.RTTPAGAEALARSLFDD..DLAHTVLAVPIAQQ
ARCA_BACLD/21-409-DRD.F....KFNIEG.GDELVLNEETVAIGV------------SE.RTTAQAIERLVRNLFQR.QSRIRRVLAVEIPKS
ARCA_STAAN/20-408-DRD.C....PFNIEG.GDELVLSKDVLAIGV------------SE.RTSAQAIEKLARRIFENPQATFKKVVAIEIPTS
ARCA_LACLA/19-407-DRN.H....TTRIEG.GDELILNKTTVAIGV------------SE.RTSSKTIQNLAKELFANPLSTFDTVLAVEIPHN
ARCA_LACSK/19-406-DRD.H....IDRMEG.GDELILSDKVLAIGI------------SQ.RTSAQSIEELAKVLFAN.HSGFEKILAIKIPHK
ARCA_STRPY/21-408-DRN.E....TTRIEG.GDELVLSKDVLAVGI------------SQ.RTDAASIEKLLVNIFKQ.NLGFKKVLAFEFANN
ARCA_BORAF/22-406-NRW.E....EASLEG.GDELVLNKGLLVIGI------------SE.RTEAKSVEKLAISLFKN.KTSFDTILAFQIPKN
ARCA_MYCAR/25-405-DPS.L....KLSIEG.GDVFIYNNDTLVVGV------------SE.RTDLQTVTLLAKNIVANKECEFKRIVAINVPKW
ARCA_MYCPN/19-401-.....KPIDMGTIEG.GDIFVYDQQTVVMGL------------SE.RTTEAAINVLAKKIQQDSSTSFKRIFVINVPQL
ARCX_MYCPN/48-437-DFK......NCLINS.SDIIQISNEILLIGI------------SH.DTDVLGIESLARNLLSDHTNPIKQIIAINIHKF
Q9KBZ5_BACHD/25-283-GIS.YYNLVSDEIEG.GDVI.IDRHSIYIGI------------SN.RTNMAAIEHIQRLLPEY........EVIPVPFH
Q97M24_CLOAB/28-292-EIPCVAKCEKGVFEG.GDFWFLDDKTIAIGT------------VD.RTNLEGIEEIRRQIERF......GYEVIAARAE
Q985H6_RHILO/43-307-GIPIYDMVTAGTFEG.GDFNVIEDGVVLIGC------------GGARTQEEGARQVQAWFEKE......GWETRIAFID
Q97TX4_SULSO/13-340-NIK.YKEIGRGKFEG.GDFFPMGDFNLV.GV------------GV.RTDLEGVSELFNILNGG.......EIGIIHWNR
Q98CC8_RHILO/18-289-PIL.GRVEAPGQVEG.GDCVWLDARTLVIGR------------GV.RSNQEGIQQVSNLLTPL.GISVYGFDLPLWQGE
DDAH2_HUMAN/16-281-RIV.EIGDENATLDG.TDVLFTGREFFV.GL------------SK.WTNHRGAEIVADTFRDF.........AVSTVPV
DDAH1_HUMAN/18-281-NIV.EMKDENATLDG.GDVLFTGREFFV.GL------------SK.RTNQRGAEILADTFKDY.........AVSTVPV
Y2601_AERPE/14-268-GLEIHPVKPPGTLEG.GDVLVTGEGVVFAGL------------SS.RTNREGVETLKTAFPNV..........NVETLN
Q53797_9ACTO/35-318-.MGYETHVPETHFEGEAELKHLHGNVYAGGY------------GQ.RSDRETYDWMERAFGME........VVKLRMTD
P71889_MYCTU/46-302-.VGYRPVTTRHVNEGQGDLLMVGERVLA.GY------------GF.RTDQRAHAEIAAVLGLP........VVSLELVD
Q27657_GIAIN/28-431-GDC.REGGPHCMLEG.GDFVPVSPGLAMMGV------------GL.RSTYVGAQYLMSKDLLG..TRRFAVVKDCFDQH
A4RXL6_OSTLU/1-301-RYE..RQDPPKFLEGTGSLVVDHEERVAYVA------------LSERAHEEVVAEHCAAENLT..PITFKA...LDARG
A0Y739_9GAMM/13-300-DYA.HLAKENSFLEGTGSLVLDHQYKLAYAV------------ESKRTTRSVVNTVCNLLSFK..PVVFNA...TDEQG
B5S3Y7_RALSL/12-303-DYT.GLEPDGLFLEGTGAMVFDHMARIAYVA------------RSNRADPVLLERFCTHFNFE..PMVFGT...ADEAG
A1SI98_NOCSJ/27-324-DYS.GLEPDGIFLEGTGAMVLDHVSRVAYMA------------VSHRADTHVLERFCSDFNYE..PMAFEA...VDSEG
A3SNQ0_9RHOB/11-301-DFS.GLEPDGLFLEGTGAMVIDHISRVAYVA------------RSHRADPILLERVCTRLGYE..PIVFDA...RDASG
B6QYQ6_9RHOB/14-303-DYS.GLEQDGLYLEGTGAMVLDHIDRVAYAV------------ASDRTNPIALERFCTHFNFE..PMVFAA...EDDKG
A6FA66_9GAMM/12-310-DFS.GLEWDNLFLEGTGAMVLDNVNRIAYTA------------KSNRSSEVILERFCTTFQYE..PMAFET...ADATG
B6R176_9RHOB/1-293-DYS.ELEEEQQFLEGTGAMVFDNVERVVYAV------------PSNHADRQALEQFCNHFKYE..PVIFEA...QDAEG
C7R733_KANKD/14-313-HVD...KNHQQILEGTGSIIFDHNHQIAYAA------------ISERCDKTLFEDFCQQRGYK..PITFNS...QSSSS
A3Y5Y8_9GAMM/25-321-HLA.DMDEKFEILEGTGALVIDHKNSVLYAS------------QSERCHEMQFKRFAEQKGYQ.ASYLFDT...ASDNG
D0II89_9VIBR/24-319-SLL.AFTDQQAFLESTGVMVMDHPNRTIYAG------------LSQRCDREVLEVYAEQIGYS.RVVSFQT...RLPSG
A7JFU5_FRANO/11-306-DFR...GDHSEALEGNAALVFDNSTKKVFLS------------KSPRADEKLAKKVADELGYE..LITFTS...YDHKD
B2SEN0_FRATM/11-304-DLR...GDYSKALEGTGVFIFDHEFKTAYMS------------LSPRADAQLAQQVCDKIGYK..LVTFTS...YDKKG
C6JL70_FUSVA/11-306-DLT.ENEKKGRILEGTGSMCLDRKNKIAYAS------------LSKRTNKELFEEFCRLMDYK..PVSFSGKQTVDGKQ
A5TT52_FUSNP/15-310-DYS.SLENENIFLEGTGSLVLDRKNKKAYCS------------LSERADEKLLDIFCEDAGYK..KIAFHSYQTVDEKR
C1DBM8_LARHH/11-310-NYGPAHEAQSKFLEGTGAMILDRVNMKAYAC------------LSPRCDEDVFKKFCKEFGFK..PVAFHGFQTYEGKR
C3J844_9PORP/12-304-NLS.GFEKEHLYLEGTGSMCLDRVHKKVYYC------------ASERSSEKVVEEYCSELDYT..SLFFHS...YDSQG
C2M8A5_CAPGI/11-307-DYT.EAEDEGIFLEGTGAMVLDRIHRKAYCA------------LSPRASEELFIEFCEDFEYT..PVIFRAFQKTDGEL
D7VIR4_9SPHI/41-339-DFT.SSENQHLFLEGTGSLILDRVNRKAYCS------------LSPRADSDLVHRFCLTMDYT..PVLFESFQSVGDLR
D7VW83_9FLAO/9-304-DWS.FPETQGHFLEGTGSMIFDHDNKIAYGS------------VSLRLDEKLFREFCAKYGFT..PVVFHSFQTVGTER
C3Q1R5_9BACE/11-308-DYT.GFEEENRFLEGTGGIILDRVNRYAYAA------------LSQRVDEALLGRFCKEQNFI..PVPFRAYQTVNGQR
A6EJW5_9SPHI/1-292-DLS.GYELEEIYLEGTGSMVLDRKNKICYAC------------LSLRTDEQVLNDWCEKAGYQ..PVSFIA...NDAEG
D2QCE7_SPILD/11-306-DLT.HFEQEGKFLEGTGSMILDRMNKVAFAS------------LSPRTHPDVLAEFSRQTNYR..VVSFHS...ADANG

PF04996

ASTB2_CAUCR/1-446--PHFADEGAANHVRLCAEHGGPGVNLFVWGR...EAWSHWDGRFPARQTKEAFEAIQRRHGA..ARAVFPQ-QGKAAIE
ASTB1_CAUCR/1-426--AHLGDEGAANHMRLAANHGARGVNVFVHGA.......PRGGRFPERQALRASQAAARLAGV.QPTALFAM-QSAEAIK
ASTB_PSEAE/1-448--SQFGDEGAANHTRFCKDYGDAGVEFFVFGRSAFDSRFPAPQRYPARQTLEACQAVARLHGLSEAGVVYAQ-QNPAVID
ASTB_ECOLI/1-447--ALLGDEGAANHNRLGGHYGEPGMQLFVYGRE..EGNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQ-QNPDVID

PF03068

PADI2_MOUSE/287-673--DSFGNLEVSPPVTVNGKEYPLGRILIGSS.------------FPLSGGRRMTKVVRDFLQAQ----QVQAPVELYSDW
PADI4_HUMAN/278-663--DSFGNLEVSPPVTVRGKEYPLGRILFGDSC------------YPSNDSRQMHQALQDFLSAQ----QVQAPVKLYSDW
O57400_CHICK/289-672--DSFGNLEVSPPVTVRSKEYPLGRILIGSS.------------FPRFGGRRMAKAVRNFLAAQ----RVQAPVELFSDW
PADI1_RAT/275-662--DSFGNLDVSPPVRVGNTEYPLGRILIGGN.------------FPKSSGRRMARVVRDFLHAQ----QVQAPVELYSDW
PADI1_HUMAN/276-663--DSFGNLDVSPPVTVGGTEYPLGRILIGSS.------------FPKSGGRQMARAVRNFLKAQ----QVQAPVELYSDW
PADI3_RAT/278-664--DSFGNLEVSPPVVANGKEYPLGRILIGGN.------------LPGSRGRRVTQVVRDFLHAQ----KVQPLVELFVDW
PADI4_RAT/278-666--DAFGNLEVSPPVTVRGKEYPLGRILIGSSG------------YSSSESRDMHQILQDFLGAQ----QVQAPVRLFSDW

PF04371

AGUA2_LISMO/13-362.TNGHVDNIFNFV----------------------------APGEVVLSWTDNKSD-------------------PQYEI
AGUA_ARATH/13-372DTNGHIDNMCCFA----------------------------RPGVVLLSWTDDETD-------------------PQYER
AGUA_STRCO/3-337GTQGHVDIVAAFA----------------------------RPGTVVVHSQRDPRH-------------------PDHER
AGUA_LACSS/13-362.TNGHVDNIANFV----------------------------KPGQVVLAWTDDQSD-------------------PQYAI
Q8DMK5_THEEB/4-341HTDGHIDTLVRFV----------------------------APATVVCMLAESPED-------------------PNCDV
AGUA_PSESM/13-363.TDGHVDNFCCYI----------------------------RPGEVLLAWTDDPED-------------------PNYPR
PAD_PORGI/55-357EYINHVDCWGKYL----------------------------APNKILIRKVPD.NH-------------------PQHQA
Q8A9D9_BACTN/34-366DTDSHIDTLARFC----------------------------STDTIAYVKCDNTED-------------------EHYEA
Q9RRX3_DEIRA/19-349HTDGHIDTITRFA----------------------------AENVIVTSVEADPND-------------------ANHAV
AGUA_LACLA/15-363.TNGHVDDVACFV----------------------------APGEVACIYTEDEKS-------------------PFYEA
O24890_HELPY/2-330DTDSHTDTLARFL----------------------------DKDTIVYSTCEDEND-------------------EHYTA
AGUA_VIBPA/12-359.TDGHVDNLMHVI----------------------------APGKVVLSWTDDPSD-------------------PQYAL
Q8KCB6_CHLTE/6-345DTDGHVDDMARFV----------------------------NENTVVIAVEEDPED-------------------ENYKP
Q8PK74_XANAC/5-338DTDAHIDTLARFA----------------------------GPDAIVYQGCDVASD-------------------SHYVE
Q87BJ3_XYLFT/23-357DTDAHIDTLARFA----------------------------STDSIVYQSCDNTTD-------------------SHYAE
AGUA_STRMU/15-367.TNGHIDDVACFI----------------------------RPGEVACIYTDDKEH-------------------PFYQE
AGUA_STRR6/10-360.TNEHVDNVVAFV----------------------------GPAEVVLAWTDDEND-------------------PQYAM
AGUA_PSEAE/13-363.TDGHVDNFCCYA----------------------------RPGEVLLAWTDDQDD-------------------PNYLR
AGUA_YERPE/16-363.TDGHIDNMCCFV----------------------------RPGEVALHWTDDQQD-------------------PQYAR
Q9ABL6_CAUCR/38-367HTDGHVDNLARFV----------------------------APGVVACPMGYGLDD-------------------PNADI
AGUA1_LISMO/13-362.TNGHVDNIFNYV----------------------------RPGVVALAWTDDETD-------------------PQYEI
Q9Z5U6_ZYMMB/3-325HTDGHVDNLARFV----------------------------GENHLVVPIATDQDD-------------------PNREV

PF02274

A3HWB9_9BACT/1-298SPIYHTNVMMHIG----------------------------RDLAVVCLDSIPKAS...--...................
A1ZS16_9BACT/10-302QAIYHTNVMMCLG----------------------------QDFAVICLDLLPNAA...--...................
Q1ICB4_PSEE4/71-363APIYHSNVMMNVG----------------------------RQLAAVCLDALPHAT...--...................
B9Z4I4_9NEIS/9-301KPIYHTNVMMCVG----------------------------KTLAVVCLESIRDWN...--...................
A8GKY3_SERP5/9-301QPIYHTNVMMSVG----------------------------VQYAIICLESIRNEA...--...................
E6WKH2_PANSA/9-303RAIYHTNVMMSVG----------------------------IRYAVVCLEAVVDPE...--...................
ARCA_STRCO/26-415RSAMHLDTVFTFA----------------------------DRDVVTLYPRIM.DAVHT--FSLRPGDRA...PGFDVVD
ARCA_RHILO/19-407RAAMHLDTVFTFA----------------------------DRDCVLLYPDIV.NGIEA--FSYRPDGK.....GGVELH
ARCA_PSEAE/22-413RAAMHLDTVFSFC----------------------------DRDLVTVFPEVV.KEIVP--FSLRPDPSS...PYGMNIR
ARCA_RHIET/18-405RAAMHLDTVFSFC----------------------------DRDVVTLFAEVV.DQVRC--YSMYPKDD....DGTFEIH
ARCA_VIBCH/18-404RSCMHLDTVMTHM----------------------------DVDTFSVYPEVMRKDLPT--WRLTPKGN.....NGDMRV
ARCA_MYCTU/19-399RAQMHLDTVCTMV----------------------------DTDTMVMYANVV.DTLEA--FTIQRTP.......DGVTI
ARCA_BACLD/21-409RAFMHLDTVFTMV----------------------------DRDQFTIHPAIQGPEGDM--RIFVLERGK...TADEIHT
ARCA_STAAN/20-408RTFMHLDTVFTMI----------------------------DYDKFTMHSAILKAEGNM--NIFIIEYDD...VNKDIAI
ARCA_LACLA/19-407HAMMHLDTVFTMI----------------------------NHDQFTVFPGIMDGAGNI--NVFILRPG....KDDEVEI
ARCA_LACSK/19-406HAMMHLDTVFTMI----------------------------DYDKFTIHPGIQGAGGMV--DTYILEPG....NNDEIKI
ARCA_STRPY/21-408RKFMHLDTVFTMV----------------------------DYDKFTIHPEI...EGDL--RVYSVTYD....NEELHIV
ARCA_BORAF/22-406RSYMHLDTVFTQI----------------------------DYSVFT...SFTSDDMYF--SIYVLTYNP..SSSKIHIK
ARCA_MYCAR/25-405TNLMHLDTWLTML----------------------------DKDKFLYSPIANDV.FKF--WDYDLVNG....GAEPQPV
ARCA_MYCPN/19-401PNLMHLDTWLTML----------------------------DRNKFLYSPNMLAV.LKA--WRIDFTD......PALKWN
ARCX_MYCPN/48-437GAKTNLNKLIAMV----------------------------DVDKFIIARKVLQATEIF--ELTATAQRDVDGLAQIKFK
Q9KBZ5_BACHD/25-283PKYLHLDCVFNIV----------------------------SPHEALIYPGVMNRK...--...................
Q97M24_CLOAB/28-292KGNLHLDMCFNVV----------------------------AERLAVACVEVLSQD...--...................
Q985H6_RHILO/43-307EYYVHIDLMVVPI----------------------------AEKLTAVCLACTEPG...--...................
Q97TX4_SULSO/13-340EEFIHLDTFFNVG----------------------------SSSSVVSVRSFMEESRV.--...................
Q98CC8_RHILO/18-289EACLHLMSVISPL----------------------------ADDLALVYSPLLPAP...--...................
DDAH2_HUMAN/16-281SGPSHLRGLCGMG----------------------------GPRTVVAGSSDAAQK...--...................
DDAH1_HUMAN/18-281ADGLHLKSFCSMA----------------------------GPNLIAIGSSESAQK...--...................
Y2601_AERPE/14-268AKGLHLLSHLGYL----------------------------GKATLISAEGLYDKS...--...................
Q53797_9ACTO/35-318PRMYHLDCTVFPL----------------------------TPQQTLVCTSLYDRA...--...................
P71889_MYCTU/46-302PRFYHLDTALAVL----------------------------DDHTIAYYPPAFSTA...--...................
Q27657_GIAIN/28-431QDRMHLDCTFSVL----------------------------HDKLVVLDDYICSGMGLR--YVDEWIDVGA.DAVKKAKS
A4RXL6_OSTLU/1-301RPIYHTNVMMSVC----------------------------SSVAIVCADSIADPA...--...................
A0Y739_9GAMM/13-300IAVYHTNVLMCVA----------------------------SKFVMIGLNMVPED....--...................
B5S3Y7_RALSL/12-303RPVYHTNVLMTVA----------------------------TEFAMVGFDLFDDPR...--...................
A1SI98_NOCSJ/27-324VPVYHTNVLACVG----------------------------TDIAMIALGMIPDEQ...--...................
A3SNQ0_9RHOB/11-301TPVYHTNVLMAVG----------------------------TGIALIGDGMIPDAA...--...................
B6QYQ6_9RHOB/14-303TSIYHTNVLMCVG----------------------------TNFALIGTEMITDTA...--...................
A6FA66_9GAMM/12-310TAIYHTNVMMCVA----------------------------SQYALICLDMIPNEA...--...................
B6R176_9RHOB/1-293NPVAHTNSILCIG----------------------------TGVALLGSDMITDPA...--...................
C7R733_KANKD/14-313KPFYHTNVMMSVG----------------------------EHFVVICLDSIADGQ...--...................
A3Y5Y8_9GAMM/25-321KSIYHTNVMMSVG----------------------------EGFAVICADCFVDEK...--...................
D0II89_9VIBR/24-319SPIYHTNVMMAIG----------------------------EHFCVICDEAIPEY....--...................
A7JFU5_FRANO/11-306RPIYQTTQMLSIG----------------------------EKLIFVCLESIKCDK...--...................
B2SEN0_FRATM/11-304.PIYHTNVMLSIG----------------------------EHLAIVCLESIKSAI...--...................
C6JL70_FUSVA/11-306MPIYHTNVLMTIG----------------------------EEYVLIFLDSIIDKE...--...................
A5TT52_FUSNP/15-310KPIYHTNVMMAMG----------------------------ENYAILCADSIDDLK...--...................
C1DBM8_LARHH/11-310AAIYHTNVMMALG----------------------------EAFAVVCLSAIDDLT...--...................
C3J844_9PORP/12-304QPIYHTNVMMTIA----------------------------TEYAVVCLESIRDGE...--...................
C2M8A5_CAPGI/11-307KPIYHTNVMMALG----------------------------RTFAIVCLDTIEDKK...--...................
D7VIR4_9SPHI/41-339KAIYHTNVMMAVG----------------------------DHFAVLCADAIDNKL...--...................
D7VW83_9FLAO/9-304LPIYHTNVMMCVA----------------------------DQFVVICLDCIDDEL...--...................
C3Q1R5_9BACE/11-308LPIYHTNVMMCVA----------------------------TDYAVVCLDSIDDVE...--...................
A6EJW5_9SPHI/1-292FPIYHTNVMMCIA----------------------------DKYAVICLDTITNPE...--...................
D2QCE7_SPILD/11-306QAIYHTNVLMCIA----------------------------DTFAVVCLSAITDPD...--...................

PF04996

ASTB2_CAUCR/1-446GGAFHNDVVCVGT----------------------------RECLFFHERAFEDRATMA--REVRAAASGLFE.PAFVEV
ASTB1_CAUCR/1-426AGAFHNDVVAVAN----------------------------ANVLLAHPQAFATRPDLL--AELSARLPG......LVVI
ASTB_PSEAE/1-448QGVFHNDVISVGN----------------------------GEVLFHHEDAFLDTEKVL--AELHDKLGRRGGRFRAICV
ASTB_ECOLI/1-447QGVFHNDVIAVSN----------------------------RQVLFCHQQAFARQSQLL--ANLRARVNG....FMAIEV

PF03068

PADI2_MOUSE/287-673LTVGHVDEFMTFIPIPGKKEFRLLMASTSACYQLFREKQKAGHGEAVMFKGLGGMSSKR.ITINKILSNESLTQENQYFQ
PADI4_HUMAN/278-663LSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQ...KIKNILSNKTLREHNSFVE
O57400_CHICK/289-672LQVGHVDEFLSFIPAPDRKGFRLLLASPSACYQLLREKQEMGYGEATMFQGLHGVPKP...SISEILGNEALRKFNAYAQ
PADI1_RAT/275-662LSVGHVDEFLSFVPTSDQKGFRLLLASPSACLQLFQEKKEEGYGEAKQFDGLKHKTKR...SINDILADRHLRRDSAHVQ
PADI1_HUMAN/276-663LSVGHVDEFLTFVPTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKR...SINEMLADRHLQRDNLHAQ
PADI3_RAT/278-664LAVGHVDEFLSFVPAPDGKGFRLLLASPGACFRLFQEKQKWGHGRSLLFEGVIGDRRVQTISINQVLSNQSLINFNKFAQ
PADI4_RAT/278-666LFVGHVDEFLSFVPARGKQGFRLLLSSPRACYQMFQELQTEGHGEASLFEGLKRKRQ....TISDILSSQKLRDQNAYVE

PF04371

AGUA2_LISMO/13-362SRECYDILANKTD-------AKGRT-FII-HKLHCPD.PVLITQTESEGVEAINGTFPRQAGDR-----LAASYVNYYTA
AGUA_ARATH/13-372SVEALSVLSNSID-------ARGRK-IQV-IKLYIPE.PLYMTEEESSGITQDGEAIPRLAGTR-----LAASYVNFYIA
AGUA_STRCO/3-337SQLYLEILRGRTD-------ARGRR-LEV-VEVPAPT..................VLKDEEGEW-----ADYSYINHYVC
AGUA_LACSS/13-362SKENYDMLINETD-------AKGRK-LQV-EKLYLPK.PILITEAESQGVDTVDGTLPRLAGDR-----LAASYVNYYTA
Q8DMK5_THEEB/4-341LRTIYEQLQTLTD-------AKGRS-LEV-IPVPSPG..................RVTSQKGEI-----LPASYVNFYIA
AGUA_PSESM/13-363CHAALSILENTRD-------AQGRA-FIV-HKMPIPG.PLFATEEECAGVDQVHGSQERNPSVR-----LAGSYVNFLIV
PAD_PORGI/55-357LEDMAAYFAAQTC-------AWGTK-YEV-YRALATN...........................-----.EQPYTNSLIL
Q8A9D9_BACTN/34-366LHAMEEQLKTFRT-------LAGEP-YRL-LALPMAD...................KVEEDGER-----LPATYANFLIM
Q9RRX3_DEIRA/19-349MQRNLATLRELRT-------PGGDF-YQI-VELPLPA..................HRLEGAEGR-----LPPTYANFYIG
AGUA_LACLA/15-363AQDAYKRLNQMTD-------AKGRQ-LKV-HKLTCPA.KNVTIKKQFR.IDTVEGTMPREDGDI-----CIASYMNFLIT
O24890_HELPY/2-330LKKMQEELKTFKK-------LDGTP-YKL-IPLEIPK..................AIFDENQQR-----LPATYVNFLLC
AGUA_VIBPA/12-359SRQAEQVLKSQHD-------AKGRE-IEI-VRLPLPG.PLHYSEREANGIDASS.GMSRQAGER-----LSASYANFLIV
Q8KCB6_CHLTE/6-345LRENYELLKTMTG-------LDGKP-LNI-VKLPMPE...................PVYYDGER-----LPASYANFYIA
Q8PK74_XANAC/5-338LQAMGAELAALRK-------ADGQP-YRL-FVLPWAQ...................PILDEGRR-----LAASYANFLIV
Q87BJ3_XYLFT/23-357LQAMANELTALRT-------TEGRP-YRL-FPLPWTK...................PILDQDRR-----LPASYANFLII
AGUA_STRMU/15-367AKAAYDFLSQQTD-------AKGRP-LKV-HKMCVTK.EPCYLQEAAT.IDYVEGSIPREEGEM-----AIASYLNFLIV
AGUA_STRR6/10-360SKADLELLEQETD-------AKGCH-FTI-HKLPIPAVRQVVTEEDLPGYIYEEGEEERYAGER-----LAASYVNFYIA
AGUA_PSEAE/13-363CQAALRVLEESRD-------AKGRK-LVV-HKMPIPG.PLYATQEECDGVDIVEGSQPRDPSIR-----LAGSYVNFLIV
AGUA_YERPE/16-363SVAAFEVLSNTVD-------AKGRK-LKI-WKLPAPG.PLYNTEEETFDVLTSD.AVPRTAGER-----LAGSYVNFLIS
Q9ABL6_CAUCR/38-367YGDTAKMLAGMTD-------SRGSP-LQV-VRIPSPG..................KLLDEDGEP-----IPASHMNFLIA
AGUA1_LISMO/13-362SKECFDILSNETD-------AKGRK-LEV-HKINVPK.PILITDEESKGVDAVEGTLPREEGDR-----LAASYINYYTA
Q9Z5U6_ZYMMB/3-325YDQAAQIATEFG.-------.....-VKV-TRIPSTG...................RITIDDEV-----VPASYMNFYIG

PF02274

A3HWB9_9BACT/1-298.....EKQLVQRT.......LTNNG.KKV.IPIT...-------------------....PKQK-----F.NFAGNMLEL
A1ZS16_9BACT/10-302.....ERKAVVDK.......LQQTH.KQI.VALS...-------------------....TEQI-----A.QFAGNMLEV
Q1ICB4_PSEE4/71-363.....ERRTLEHS.......LRDTG.KQV.LTLD...-------------------....FDQL-----E.NFAGNMLEV
B9Z4I4_9NEIS/9-301.....ERDALIQA.......LTDSG.KEI.IDIS...-------------------....YDQL-----E.HFAGNMIEL
A8GKY3_SERP5/9-301.....QKSRLIAT.......LERSG.KTI.IDVS...-------------------....FAQM-----E.AFACNVLEL
E6WKH2_PANSA/9-303.....TRDRLITS.......LQASG.KTL.IAIS...-------------------....QAQM-----Q.AFCGNILEL
ARCA_STRCO/26-415EGSTPFVDVVAKA.......LGLPK.LRV.VETGGDA-------------------.YASERQQ-----W.DSGNNAVAV
ARCA_RHILO/19-407KDKGTFVETVRDA.......LGLKK.MRV.VETGGNA-------------------.YMRERTQ-----W.DSGANLVCA
ARCA_PSEAE/22-413REEKTFLEVVAES.......LGLKK.LRV.VETGGNS-------------------.FAAEREQ-----W.DDGNNVVCL
ARCA_RHIET/18-405PDNRPMLDVVAEA.......LDLPQ.LRT.VETGGNS-------------------.YQAEREQ-----W.DDGNNVVAL
ARCA_VIBCH/18-404EQVPSYLHAIEQA.......LGVDY.LKI.ITTGGNS-------------------.YEAEREQ-----W.NDANNVLTV
ARCA_MYCTU/19-399GDAAPFAEAAAKA.......MGIDK.LRV.IHTGMDP-------------------.VVAEREQ-----W.DDGNNTLAL
ARCA_BACLD/21-409TEEHNLPEVLKRT.......LGLSD.VNL.IFCGGGD-------------------EIASAREQ-----W.NDGSNTLAI
ARCA_STAAN/20-408KQSSHLKDTLEDV.......LGIDD.IQF.IPTGNGD-------------------VIDGAREQ-----W.NDGSNTLCI
ARCA_LACLA/19-407EHLTDLKAALKKV.......LNLSE.LDL.IECGAGD-------------------PIAAPREQ-----W.NDGSNTLAI
ARCA_LACSK/19-406THQTDLEKVLRDA.......LEVPE.LTL.IPCGGGD-------------------AVVAPREQ-----W.NDGSNTLAI
ARCA_STRPY/21-408EEKGDLAELLAAN.......LGVEK.VDL.IRCGGDN-------------------LVAAGREQ-----W.NDGSNTLTI
ARCA_BORAF/22-406KEKARIKDVLSFY.......LG.RK.IDI.IKCAGGD-------------------LIHGAREQ-----W.NDGANVLAI
ARCA_MYCAR/25-405ENGLPLEGLLQSI.......INKKP.VLIPIAGEGAS-------------------QMEIERET-----H.FDGTNYLAI
ARCA_MYCPN/19-401EIAGDLSTILHTI.......IGQKP.MLIPIAGADAN-------------------QTEIDIET-----H.FDGTNYLTI
ARCX_MYCPN/48-437PLKFNFGEIIEAI.......IDKQP..RF.VIIGGGD-------------------EVAERKEL-----L.DCGMGVLNL
Q9KBZ5_BACHD/25-283.....EEKLIASR.............YDL.IEVT...-------------------....EEEQ-----F.TLGTNVLSI
Q97M24_CLOAB/28-292.........FLRV.......LKEKK.FQL.IDVP...-------------------....KEGI-----A.KHYCNIEAL
Q985H6_RHILO/43-307.........IVDW.......LKGKG.HEI.IDVP...-------------------....FQDT-----M.ALGCNFMSL
Q97TX4_SULSO/13-340..AVYYDRKIIRETTLYDYVVKEKG.FNL.IEVS...-------------------....VDEA-----K.KYVTNFLTI
Q98CC8_RHILO/18-289.........FYQM.......LKARG.IRL.VEGD...-------------------....AEE.-----..FAASNGLSL
DDAH2_HUMAN/16-281......AVRAMAV.......LTDHPYASL.TLPD...-------------------........-----..DAAADCLFL
DDAH1_HUMAN/18-281......ALKIMQQ.......MSDHRYDKL.TVPD...-------------------........-----..DIAANCIYL
Y2601_AERPE/14-268....................IFKRHGFDL.IEIP...-------------------....WEE.-----..RDAANLLYL
Q53797_9ACTO/35-318.....EIRELEKH.............TEI.IDVG...-------------------....EDET-----Y.TGICNSVRL
P71889_MYCTU/46-302......AQEQLSA.......LFPDA.....IVVG...-------------------....SADA-----F.VFGLNAV..
Q27657_GIAIN/28-431SAVTCGNYVLAKANVEFQQWLSENG.YTI.VRIP...-------------------....HEYQ-----L.AYGCNNLNL
A4RXL6_OSTLU/1-301.....DRRRVLDA.......LAAGGRREI.ITIT...-------------------....HAQV-----D.AFCGNVLEL
A0Y739_9GAMM/13-300.....QRSELVGH.......FLQSH.HEV.IDLS...-------------------....VEQI-----N.NFCGNAIEL
B5S3Y7_RALSL/12-303.....RAEAVRAR.......LEESG.REI.VALE...-------------------....NGQI-----A.AFAGNAIEL
A1SI98_NOCSJ/27-324.....RREQVRER.......LTVNG.RTV.IELT...-------------------....EQQI-----R.DFAGNAVEL
A3SNQ0_9RHOB/11-301.....RRAEILDR.......LAEPG.RDV.ISLS...-------------------....EAQI-----R.AFAGNAIEL
B6QYQ6_9RHOB/14-303.....RRAEVVSR.......LQSTG.RDV.IELS...-------------------....NAQV-----S.SFAGNAIEL
A6FA66_9GAMM/12-310.....RRAAVRQR.......LEESG.IEV.IELS...-------------------....FDQI-----D.NFAGNAIEL
B6R176_9RHOB/1-293.....KKAEIITR.......LEQSG.RQV.VHLT...-------------------....NDQI-----T.ASAGRAIEL
C7R733_KANKD/14-313.....QKQLLLDT.......FAETK.KEV.INIS...-------------------....LEQT-----EKSFCGNILQL
A3Y5Y8_9GAMM/25-321.....EYAEVKAS.......LSLAN..EV.IEIS...-------------------....KEQM-----EKHFCGNILHV
D0II89_9VIBR/24-319.....ERRFVVKS.......LAKD..KQV.ISIS...-------------------....LEQM-----N.HFCGNILQL
A7JFU5_FRANO/11-306.....DRDIVAQA.......LHQSN.KTI.VDVS...-------------------....QKQV-----H.LRCCNSLEV
B2SEN0_FRATM/11-304.....ERELVIKT.......LQQSN.KQI.IDIS...-------------------....LEQM-----Y.QMCGNVLEV
C6JL70_FUSVA/11-306.....EKERVKKS.......ILDSG.KVL.IEIT...-------------------....EEQT-----N.HFLGNALEL
A5TT52_FUSNP/15-310.....EREKVIRE.......LESDG.KEI.VYIS...-------------------....EYQV-----E.HFLGNAIEL
C1DBM8_LARHH/11-310.....ERAALVKE.......LQGDG.KEI.IDVT...-------------------....EDQI-----N.NFAGNEIEL
C3J844_9PORP/12-304.....ERQRVVES.......LEASG.HEI.VPIT...-------------------....LEQV-----Y.HFAGNMLEV
C2M8A5_CAPGI/11-307.....ERKNVLNH.......LKEDK.KEI.ITIS...-------------------....REQV-----D.YYAGNMLEV
D7VIR4_9SPHI/41-339.....QRQLVIDN.......LHQDN.KEI.VFIT...-------------------....EEQA-----G.RFAGNILQV
D7VW83_9FLAO/9-304.....EREKVVET.......IKGSG.KEI.IEIS...-------------------....EEQM-----Q.QFAGNMLQV
C3Q1R5_9BACE/11-308.....EREQVCHI.......LRQTG.KEI.IAIS...-------------------....EEQM-----H.HFAGNMLQV
A6EJW5_9SPHI/1-292.....EQKKVIQS.......LENTS.KEI.ITID...-------------------....LDQM-----N.HFAGNMLQV
D2QCE7_SPILD/11-306.....ERLMVRQE.......LEKLN.KRV.IDIS...-------------------....LEQM-----A.NFAGNMLMV

PF04996

ASTB2_CAUCR/1-446TEADLPMADLVASYLFNSQLLVVPGEDRLVLLAPVET-------RDNPRAYAVAESLATSNGPI-----GRVEYVDVRQS
ASTB1_CAUCR/1-426ETRDLSLEDAVASYLFNSQLVSLP.DGYMALIVPVEA-------RDNAAAWREIQTILAADNPV-----TKVKVVDLRQS
ASTB_PSEAE/1-448PRDQVAVEDAVKSYLFNSQLLSKA.DGSMLLVVPEEC-------RNNPRVWNYLDQLTGDDGPI-----REVKVFDLKQS
ASTB_ECOLI/1-447PATQVSVSDTVSTYLFNSQLLSRD.DGSMMLVLPQEC-------REHAGVWGYLNELLAADNPI-----SELKVFDLRES

PF03068

PADI2_MOUSE/287-673RCLDWNRDILKRE-------LALTE-KDI-IDLP---------------------ALFKMDENH....QARAFFPNMVNM
PADI4_HUMAN/278-663RCIDWNRELLKRE-------LGLAE-SDI-IDIP---------------------QLFKLKEFS....KAEAFFPNMVNM
O57400_CHICK/289-672SCISWNRDILKRE-------LGLAE-QDI-IDIP---------------------QLFQADHQA....RAVAYFPDMVNM
PADI1_RAT/275-662KCIDWNREVLKQE-------LGLSE-SDI-VDIP---------------------QLFFLKGAY.....AEAFFPDMVNM
PADI1_HUMAN/276-663KCIDWNRNVLKRE-------LGLAE-SDI-VDIP---------------------QLFFLKNFY.....AEAFFPDMVNM
PADI3_RAT/278-664SCIDWNREVLKRE-------LGLGE-SDI-IDIP---------------------QLFKSEKRK.....AVAFFPDLVNM
PADI4_RAT/278-666SCIDWNREVLKRE-------LGLTE-GDI-IDIP---------------------QLFRIVGNSRGNPKAEAFFPNMVNM

PF04371

AGUA2_LISMO/13-362------NGAIIFPLFDDP.KDKDAQELLEKLYP------------DRKIVGI.KA--REILL.GGGNIHCITQHLP----
AGUA_ARATH/13-372------NGGIIAPQFGDPIRDKEAIRVLSDTFP------------HHSVVGIENA--REIVL.AGGNIHCITQQQP----
AGUA_STRCO/3-337------NGGVVLCAFGDP.NDELAAGIFRRLFP------------ERTVTLV.DA--RTIFA.GGGGIHCITQQQP----
AGUA_LACSS/13-362------NGGIVFPLFNDP.MDEKAQEILQKLYP------------DRKIVGV.PA--REILL.GGGNIHCITQQIP----
Q8DMK5_THEEB/4-341------NTTVVVPTYGVE.ADAKAVEAIAKLFP------------SRRTIGL.PA--RTILE.GGGAFHCITQQEL----
AGUA_PSESM/13-363------NGGIIAPSFDDP.MDEKAREILQKLFP------------EHEVVMA.PG--RELLL.GGGNIHCLTQQQP----
PAD_PORGI/55-357------NNRVFVPVNGPASVDNDALNVYKTAMP------------GYEIIGVKGA--SGTPWLGTDALHCRTHEVA----
Q8A9D9_BACTN/34-366------NDAILYPTYQQPDNDRKAGEVLQQAFP------------KHQVIGI.DC--RALIK.QHGSLHCVTMQYP----
Q9RRX3_DEIRA/19-349------NGFVVVPQYGDP.NDKQALDVLRPLFP------------GREVIGV.PS--RKIIE.GGGSFHCLTQQQP----
AGUA_LACLA/15-363------NKGVIVPQYGDE.NDALALKQVQEMFP------------DREIVGV.NT--VEVVY.GGGNIHCITQQQP----
O24890_HELPY/2-330------NNALIVPTYNDP.KDALILETLKQHTP------------.LEVIGV.DC--NTLIK.QHGSLHCVTMQLY----
AGUA_VIBPA/12-359------NGHVFLPMLDED.TDAIAIDILQNAMP------------EYQIIAI.PS--REVLL.GGGNIHCITQQIP----
Q8KCB6_CHLTE/6-345------NTVVLVPTYRCP.RDQQAIDILQQCFP------------KREVVGI.DC--SDLIW.GLGAIHCVTHEEP----
Q8PK74_XANAC/5-338------NGAVLMPAYGDA.ADATAQAVLAQAFP------------HHEIVPV.PC--RALIW.QNGSLHCLTMQLP----
Q87BJ3_XYLFT/23-357------EGAVLMPTYDDP.ADTIAQSVLAEAFP------------TREIVPV.PC--RPLIW.QNGSLHCITMQIP----
AGUA_STRMU/15-367------NGGIILPQYGDE.NDQLAKQQVQEMFP------------DRKVVGV.RT--EEIAY.GGGNIHCITQQQP----
AGUA_STRR6/10-360------NKAVLVPQFEDV.NDQVALDILSKCFP------------DRKVVGI.PA--RDILL.GGGNIHCITQQIP----
AGUA_PSEAE/13-363------NGGIIAPSFDDP.KDAEARAILQRVFP------------EHEVVMV.PG--REILL.GGGNIHCITQQQP----
AGUA_YERPE/16-363------NQQIIFPLLDSR.TDGQANDLLQQMFP------------GYAIVGV.PA--REILL.GGGNIHCITQQIP----
Q9ABL6_CAUCR/38-367------NEAVIVPIYAEE.SGAFAVEVIKGLFP------------ERQVIGL.PS--TAILT.GGGSFHCISQQEP----
AGUA1_LISMO/13-362------NGGVIFPLFGDP.NDELAREKLQQLYP------------NCEVVGV.KA--REILL.GGGNIHCITQQVP----
Q9Z5U6_ZYMMB/3-325------NKVVVVPVYGAK.NDSAIVQAFEALFP------------SRKVVAL.PA--GHILT.GGGSFHCISQQWP----

PF02274

A3HWB9_9BACT/1-298S...NDGGEKFTI.MSQTAYDSLNPGQIQLIEK............YTTIISP-QI--PTIEKLGGGSARCMIAEIFL---
A1ZS16_9BACT/10-302QSTQGD....RLLVMSARALKSLTPDQRNALEQ............KVKIVAP-PL--YTIEDHEGGSARCMMAEVFL---
Q1ICB4_PSEE4/71-363HDRDGR....SLLVMSRSAWRSLAPRQRRQVEQ............HSHPVVV-NI--DHIERIGGGSARCMLAEVHL---
B9Z4I4_9NEIS/9-301SSRNGE....PVFALSRQAWSSLTPEQQTAISS............YARVALA-PI--DTIERLGGGGARCMVAEIFL---
A8GKY3_SERP5/9-301RAGDGS....PVYAMSTRAWASFTPQQQALIGD............YARLALG-SI--DIIEDLGGGGARCMLAEIFL---
E6WKH2_PANSA/9-303HDGDGH....PVIAMSEQAWDAFTPEQQQMLSA............YARIVRA-PI--AVIEQHGGGGARCMLAEIFA---
ARCA_STRCO/26-415.....EPGVV.......FTYDRNTLTNALLREA............RVEVVTI-VG--AELG.RGRGGGHCMTCPLVR---
ARCA_RHILO/19-407.....SPGVV.......YAYDRNTYTNTLLRKE............GIEVITI-IG--AELG.RGRGGGHCMTCPIIR---
ARCA_PSEAE/22-413.....EPGVV.......VGYDRNTYTNTLLRKA............GVEVITI-SA--SELG.RGRGGGHCMTCPIVR---
ARCA_RHIET/18-405.....EPGVV.......VAYDRNTYTNTLLRKA............GIEVITI-RG--SELG.RGRGGGHCMTCPIWR---
ARCA_VIBCH/18-404.....KPGVV.......IGYERNVYTNEKYDKA............GIKVLTI-PG--NELG.RGRGGARCMSCPIER---
ARCA_MYCTU/19-399.....APGVV.......VAYERNVQTNARLQDA............GIEVLTI-AG--SELG.TGRGGPRCMSCPAAR---
ARCA_BACLD/21-409.....APGVV.......VTYDRNYISNECLREQ............GIKVIEI-PS--GELS.RGRGGPRCMSMPLYR---
ARCA_STAAN/20-408.....RPGVV.......VTYDRNYVSNDLLRQK............GIKVIEI-SG--SELV.RGRGGPRCMSQPLFR---
ARCA_LACLA/19-407.....APGEI.......VTYDRNYVTVELLKEH............GIKVHEI-LS--SELG.RGRGGARCMSQPLWR---
ARCA_LACSK/19-406.....APGVV.......VTYDRNYVSNENLRQY............GIKVIEV-PS--SELS.RGRGGPRCMSMPLVR---
ARCA_STRPY/21-408.....APGVV.......VVYNRNTITNAILESK............GLKLIKI-HG--SELV.RGRGGPRCMSMPFER---
ARCA_BORAF/22-406.....APGEI.......IAYSRNHVTNKLFEEN............GIKVHRI-PS--SELS.RGRGGPRCMSMPLIR---
ARCA_MYCAR/25-405.....RPGVV.......IGYSRNEKTNAALEAA............GIKVLPF-HG--NQLS.LGMGNARCMSMPLSR---
ARCA_MYCPN/19-401.....APSVV.......VGYARNKLTHQTLEAA............GVKVIAF-KG--NQLS.LGMGSARCMSMPLVR---
ARCX_MYCPN/48-437.....SPGEI.......VVFDRNHYTNNLLNEL............GLIIHKI-PA--SELS.RGPSGPLEMVCSLWR---
Q9KBZ5_BACHD/25-283.....GHKRV.......ISLPVNTNVNEQLRKR............GFDVIEV-DI--TEII.KSGGSFRCCTMPLRR---
Q97M24_CLOAB/28-292.....GNNKV.......MSFYNNKKVNEKLEAY............GIEVIKI-SL--NELL.KSGGGIHCMTFPIIR---
Q985H6_RHILO/43-307.....GKDRV.......IAPTSSQTLIGQLKAR............GFEVAAV-DM--SEIS.KTGGGIHCMAQALKR---
Q97TX4_SULSO/13-340.....DDGKI.........VSPKISANRKLEKE.............YDVIEV-EV--SNLT.GGAGGIHCMTAVIRR---
Q98CC8_RHILO/18-289NVLPTNPLKV.......IAVAGFPKTKAAMEAA............GCTVEIF-EA--DALCIACEGGPTCLTRPILR---
DDAH2_HUMAN/16-281RPGLPGVPPFLLH.RGGGDLPNSQEALQKLSDV..............TLVPV-SC--SELE.KAGAGLSSLCLVLST---
DDAH1_HUMAN/18-281N..IPNKGHVLLH.RTPEEYPESAKVYEKLKDH..............MLIPV-SM--SELE.KVDGLLTCCSVLINK---
Y2601_AERPE/14-268.....GEGRV.......LLPAGYNQTRDLLEQH............GFRIVEA-EI--RQFM.ACMGGVTCLSLPIYN---
Q53797_9ACTO/35-318NNVLLNSSHIHDLKSGTEEYDSEVRKNRALEDIAS........RAAFEVTYF-NL--SEYH.KGGALLSCMVMHLNR---
P71889_MYCTU/46-302.....SDGLNVVLPVAAMGFAA......QLRAA............GFEPVGV-DL--SELL.KGGGSVKCCTLEIHP---
Q27657_GIAIN/28-431.....GNNCV.......LSVHQPTVDFIKADPAYISYCKSNNLPNGLDLVYV-PF--RGIT.RMYGSLHCASQVVYR---
A4RXL6_OSTLU/1-301RTASGE....PALACSARAFAAFDDAQRARLRAA..........FDDRVVAV-DF--STIERVGGGGVRCAVAEHFV---
A0Y739_9GAMM/13-300QGKNGR....ILA.LSQTAYNALTAEQIIAIQK............TAKLVPL-PI--PTIE.SAGGSVRCMIAGVHL---
B5S3Y7_RALSL/12-303SGRDGR....LLA.MSARAEASLTDAQRAIIER............SARIVAL-PV--PTIE.LAGGSVRCMIAGIHL---
A1SI98_NOCSJ/27-324CGRTETGKRRYVMAMSGRARRSLRPDQIAAIEE............SCEIVSV-DI--PTIE.LAGGSVRCMIAGVHL---
A3SNQ0_9RHOB/11-301STPTGP....VLA.LSETARAALTPDQLSRIEV............ATGLLPL-SI--PTLE.RAGGSVRCMLAGVHL---
B6QYQ6_9RHOB/14-303MGKDGP....LLA.LSQTAYDVLMEEQRERISA............SATLLPL-AI--PTLE.LAGGSVRCTIAGLHL---
A6FA66_9GAMM/12-310TGNGNS....HLV.MSQRAKDALTPDQIERIEK............HSNILGF-SV--PTIE.LAGGSIRCMIAGIHL---
B6R176_9RHOB/1-293HSKTEG....LLLAMSQGAYASLKQEQVDLIEQ............GAKIVQL-KL--DTIE.QAGGSARCAMAGIHL---
C7R733_KANKD/14-313HNSKGD....KIIVMSDSAYRGFTKEQKAKLEK............HGRLLPC-PI--PTIEQVGGGSTRCMLAENFM---
A3Y5Y8_9GAMM/25-321KNADQD....AFIIMSKSAFNGFTQAQKQQLEQ............YGQLLVN-DI--DTIEAVGGGSARCMVAEVFF---
D0II89_9VIBR/24-319ETHDGQ....KVIAMSQSAYEAFTPAQLNQLAT............HGKLLPF-AV--PTIETIGGGSVRCMLAELFL---
A7JFU5_FRANO/11-306KNKQGK....SYLILSATADMGFTDQQKQLIDL............HCTRLPC-HV--KTIEDVGGGTARCMLAEILK---
B2SEN0_FRATM/11-304KNKADK....SFLILSQTAYNGFSQSQLALISK............YATPIAC-DI--TNIEVVGGGSARCMLAEVFL---
C6JL70_FUSVA/11-306RKKDGS....KILVMSKSANDILREDQRKIIEK............SAEIVYS-DI--PTIERYGGGSVRCMLAEFFI---
A5TT52_FUSNP/15-310INNENV....KICVMSATAYSVLTDEQKNIIEK............YDVIVPV-DV--HTIEKYGGGSARCMIAELFI---
C1DBM8_LARHH/11-310CNADGK....RFTIMTKATYDCLTPEQRAVIEK............TSEIISP-DV--KTIETYGGGSVRCMISEIFL---
C3J844_9PORP/12-304LDDKGK....SLLLMSAAAKASLTPDQLRTLQR............YSRILAP-DL--TTIETIGGGSARCMVAEIFI---
C2M8A5_CAPGI/11-307KGKEHS....YLV.MSQTAYESLTPQQIEAIER............HTQILYS-DL--STIEICGGGSARCMLAEVFL---
D7VIR4_9SPHI/41-339HSVSGA....SFVVMSSQAYDCLLPIQRDMLSQ............YGTLLKS-PL--NVIETCGGGSARCMMAEVFL---
D7VW83_9FLAO/9-304QNKEGE....KFLVMSQTAYQSLTPEQVAAIEK............YCEIIYS-DL--NTIEVNGGGSARCMLAEVFL---
C3Q1R5_9BACE/11-308ENGKGA....LFLVMSQSAYDSLHEDQLQRLSK............YNALLSM-PI--PTIETLGGGSARCMMAEIFL---
A6EJW5_9SPHI/1-292KNKNGL....SLLVMSEQAYLSLSQDQVNRLEQ............YNKLVYS-PL--NTIETNGGGSARCMLAEIHL---
D2QCE7_SPILD/11-306TTNKGQ....KLLVMSTRAFESLTPKQIDLLDD............YTTLVHF-DL--SMIENNGGGSARCMMAEVHL---

PF04996

ASTB2_CAUCR/1-446MRNGGGPACLRLRVVLTEAELAAANPAQRFTADLQDALADWITRRYRDRLSPADLADAKLLTESREALDELTQILGLGDD
ASTB1_CAUCR/1-426MSNGGGPACLRLRVPVAAAARDQINPAFLLDHARLDRLTRLVETWWPRAIAPSDLTDPALWEAAMVAHAALETFLTAP..
ASTB_PSEAE/1-448MQNGGGPACLRLRVALQERELAAVNPGVIMSAGLYDTLVAWVDRHYRDRLSETDLADPQLLLECRTALDELTQILKLG.S
ASTB_ECOLI/1-447MANGGGPACLRLRVVLTEEERRAVNPAVMMNDTLFNALNDWVDRYYRDRLTAADLADPQLLREGREALDVLSQLLNLG.S

PF03068

PADI2_MOUSE/287-673IVLDKDLGIPKPFGPQVEEECCLETHVRGLLEPL-----------GLACTFIDDI--SAYH-KFLGEVHCGTNVRRKPFT
PADI4_HUMAN/278-663LVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPL-----------GLQCTFINDF--FTYH-IRHGEVHCGTNVRRKPFS
O57400_CHICK/289-672LVLGRHLGIPKPFGPLVDGQCCLEERVRALLQPL-----------GLSCTFINDY--FSYH-KLAGEVHCGTNVRRKPFA
PADI1_RAT/275-662VVLGKYLGIPKPFGPIINGRCCLEEKVRSLLEPL-----------GLRCVFIDDF--LFYH-QLLGEIHCGTNVRRKPFA
PADI1_HUMAN/276-663VVLGKYLGIPKPYGPIINGRCCLEEKVQSLLEPL-----------GLHCIFIDDY--LSYH-ELQGEIHCGTNVRRKPFP
PADI3_RAT/278-664LVLGKHLGIPKPFGPIINGRCCLEEKVRSLLEPL-----------GLHCTFIDDF--TPYH-MLHGEVHCGTNVRREPFA
PADI4_RAT/278-666LVLGKHLGIPKPFGPIINGRCCLEEKVCSLLEPL-----------GLHCTFINDF--YSYH-MYHGEVHCGTNVRRKPFA

PF04371

AGUA2_LISMO/13-362------------
AGUA_ARATH/13-372------------
AGUA_STRCO/3-337------------
AGUA_LACSS/13-362------------
Q8DMK5_THEEB/4-341------------
AGUA_PSESM/13-363------------
PAD_PORGI/55-357------------
Q8A9D9_BACTN/34-366------------
Q9RRX3_DEIRA/19-349------------
AGUA_LACLA/15-363------------
O24890_HELPY/2-330------------
AGUA_VIBPA/12-359------------
Q8KCB6_CHLTE/6-345------------
Q8PK74_XANAC/5-338------------
Q87BJ3_XYLFT/23-357------------
AGUA_STRMU/15-367------------
AGUA_STRR6/10-360------------
AGUA_PSEAE/13-363------------
AGUA_YERPE/16-363------------
Q9ABL6_CAUCR/38-367------------
AGUA1_LISMO/13-362------------
Q9Z5U6_ZYMMB/3-325------------

PF02274

A3HWB9_9BACT/1-298------------
A1ZS16_9BACT/10-302------------
Q1ICB4_PSEE4/71-363------------
B9Z4I4_9NEIS/9-301------------
A8GKY3_SERP5/9-301------------
E6WKH2_PANSA/9-303------------
ARCA_STRCO/26-415------------
ARCA_RHILO/19-407------------
ARCA_PSEAE/22-413------------
ARCA_RHIET/18-405------------
ARCA_VIBCH/18-404------------
ARCA_MYCTU/19-399------------
ARCA_BACLD/21-409------------
ARCA_STAAN/20-408------------
ARCA_LACLA/19-407------------
ARCA_LACSK/19-406------------
ARCA_STRPY/21-408------------
ARCA_BORAF/22-406------------
ARCA_MYCAR/25-405------------
ARCA_MYCPN/19-401------------
ARCX_MYCPN/48-437------------
Q9KBZ5_BACHD/25-283------------
Q97M24_CLOAB/28-292------------
Q985H6_RHILO/43-307------------
Q97TX4_SULSO/13-340------------
Q98CC8_RHILO/18-289------------
DDAH2_HUMAN/16-281------------
DDAH1_HUMAN/18-281------------
Y2601_AERPE/14-268------------
Q53797_9ACTO/35-318------------
P71889_MYCTU/46-302------------
Q27657_GIAIN/28-431------------
A4RXL6_OSTLU/1-301------------
A0Y739_9GAMM/13-300------------
B5S3Y7_RALSL/12-303------------
A1SI98_NOCSJ/27-324------------
A3SNQ0_9RHOB/11-301------------
B6QYQ6_9RHOB/14-303------------
A6FA66_9GAMM/12-310------------
B6R176_9RHOB/1-293------------
C7R733_KANKD/14-313------------
A3Y5Y8_9GAMM/25-321------------
D0II89_9VIBR/24-319------------
A7JFU5_FRANO/11-306------------
B2SEN0_FRATM/11-304------------
C6JL70_FUSVA/11-306------------
A5TT52_FUSNP/15-310------------
C1DBM8_LARHH/11-310------------
C3J844_9PORP/12-304------------
C2M8A5_CAPGI/11-307------------
D7VIR4_9SPHI/41-339------------
D7VW83_9FLAO/9-304------------
C3Q1R5_9BACE/11-308------------
A6EJW5_9SPHI/1-292------------
D2QCE7_SPILD/11-306------------

PF04996

ASTB2_CAUCR/1-446FYPFQR....TA
ASTB1_CAUCR/1-426..........TV
ASTB_PSEAE/1-448VYSFQ.....LD
ASTB_ECOLI/1-447VYPFQREGGGNG

PF03068

PADI2_MOUSE/287-673FKWWHMVP----
PADI4_HUMAN/278-663FKWWNMVP----
O57400_CHICK/289-672FKWWRMVP----
PADI1_RAT/275-662FRWWNSVP----
PADI1_HUMAN/276-663FKWWNMVP----
PADI3_RAT/278-664FKWWHMVP----
PADI4_RAT/278-666FKWWHMVP----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window