Sequence alignment for CL0199

PF00967

Q84565_PBCV1/23-145---------------SKKDVRMTYHYYAP...NYETS....SLACADRFWADKDNGRKLLKYPWAAYCLDGRNFKQ----
HEVL_ARATH/73-191---------------SASNVRATYHFYNPAQNNWDLR..AVSAYCST..WDADKPYAWRSKYGWTAFCGPAGPRGQ----
K4B0B4_SOLLC/81-197---------------..AQVRATYHIYNPQNVGWDLN..AVSAYCST..WDANKPYSWRSKYGWTAFCGPVGPRGR----
K7UPV9_MAIZE/102-219---------------..SNVRATYHLYNPAQNGWDLN..RVSAYCAT..WDADKPLSWRQKHGWTAFCGPAGQKGQ----
M1BPP7_SOLTU/6-124---------------SATNVRATYHLYNPQNINWDLR..TASAYCAT..WDADKPLAWRQRYGWTAFCGPAGPRGQ----
WHW2_WHEAT/28-146---------------...NVRATYHYYRPAQNNWDLGAPAVSAYCAT..WDASKPLSWRSKYGWTAFCGPAGAHGQ----

PF03330

O51677_BORBU/31-121---------------ATVGLASWY......GEAFHGK----TTANGE---------------KFDMMALTAAHKEL....
EXP27_ORYSJ/62-150---------------NAALSTALF......NDG....----.AACGQ---------------CYLIVCDT.DKAG.....
EXPA2_ARATH/67-152---------------TAALSTALF......NSG....----.QKCGA---------------CFELQC...EDDP.....
EXPA3_ORYSJ/63-151---------------NAALSSALF......NDG....----.AMCGA---------------CYTITC..DTSQT.....
EXB10_ORYSJ/78-157---------------NSCGNDPIF......KDG....----.KGCGS---------------CFEVKC..SKPEA.....
RLPA_HELPY/115-205---------------KFDGVASWY.....GPNFHA.K----KTSNGE---------------IYNMYAHTAAHKTL....
EXLB1_ARATH/62-139---------------VSGVSWRLW......NNG....----.TGCGA---------------CYQVRC..KIPPH.....
Q87WR7_PSESM/28-118---------------DETGTAAYY.....GTRHHG.N----RTASGE---------------PFNQNALTAAHRQL....
A9CKF5_AGRT5/29-116---------------NGCGGASWY........ALS.S----KTASGE---------------RMNAANLTAAHRSL....
EXPA4_ORYSJ/59-144---------------TAALSTALF......NDG....----.AACGS---------------CYELRC...DNAG.....
EXP24_ARATH/125-208---------------TAALSTALF......NNG....----.SRCGA---------------CYEIMC...EHAP.....
Q87VW3_PSESM/103-193---------------VASGTASWY.....GTKFHG.Q----NTANGE---------------VYDLYGMSAAHKTL....
RLPA_SYNY3/227-317---------------IKGGIASWY.....GPGFHG.R----RTANGE---------------RFNQNALTAAHRTL....
EXPB4_ORYSJ/92-171---------------TSCGNQPLF......KDG....----.KGCGS---------------CYKIRC..TKDQS.....
YDJM_BACSU/30-121---------------HVNGNITWY.......NGVG.K----KGSSGK---------------KLGHWDCATKIGFDV...
RLPA_CAMJE/77-167---------------TADGIASWY.....GPGFHG.K----KTSNGE---------------TYNQNALTAAHKTL....
EXP30_ORYSJ/72-160---------------TAALSTTLF......KDG....----.YGCGT---------------CYQMRCVGTAS.......
Q7V582_PROMM/105-195---------------VSTGEASWY.....GPGFFG.N----RTASGE---------------VFRPGTMTAAHRSL....
EXPA5_ARATH/73-151---------------TAALSTALF......DQG....----.LSCGA---------------CFELMC...VNDP.....
Q89QY0_BRADU/43-149---------------AIVGAASMYNPFKPGKEEGG.P----STASGE---------------RYDPSLWTAAIKTSLRQK
Y3177_SYNY3/1-87---------------MMAQSATFY.....GNQFVG.R----KMANGQ---------------VYNHGRMVAAHPSL....
Q8F9X6_LEPIN/103-193---------------DEVGMSSWY.....GAKFHG.K----PTASGE---------------KFDKTKLTAAHPTL....
Q89G77_BRADU/82-168---------------ASHGVASFY.....SDTE....----.TASGE---------------RFDKNELTAAHPSL....
Q7MN13_VIBVY/80-170---------------KESGIASWY.....GKKFQG.H----LTSNGE---------------IYDMYSMTAAHKTL....
Q84V44_PHYPA/67-150---------------TTALSSALF......NAG....----.LSCGA---------------CFELKCDSANSKY.....
Q7U4N9_SYNPX/113-203---------------VITGEASWY.....GPGFYG.N----HTANGE---------------IYRQGTMTAAHRTL....
Q84V41_PHYPA/70-157---------------IVAGSRSIY......ANG....----.QGCGQ---------------CYQIRCVDPNGGP.....
Q39802_SOYBN/84-165---------------ISAGSPLIY......DSG....----.KGCGS---------------CYEVKC..TGNSA.....
Q7NPV8_CHRVO/99-189---------------HAVGRASWY.....GKQFHG.R----KTSSGE---------------RYDMFAMTAAHPTL....
RLPA_AQUAE/129-219---------------YIRGYASWY.....GGKFHG.R----KTASGI---------------RFNQHEYYAAHRYL....
RLPA_NOSS1/274-366---------------SFQGIASFYG...RGDGFAG.R----PTATGE---------------RFNPEAMTAAHRSL....
Q9ZR84_WHEAT/77-158---------------GACGNEPIF......AGG....----.EGCGM---------------CYEIKCEYSNNPS.....
Q8DLZ3_THEEB/217-307---------------QFTGLASWY.....GPGFHG.A----RTANGE---------------RFDQDALTAAHRTL....
EXLA2_ORYSJ/68-146---------------LAAASPALF......RGG....----.VGCGA---------------CFQVRC..KDGKL.....
Q7U7N8_SYNPX/60-150---------------VVNGAASWY.....GPGFYG.R----QTASGE---------------RLRKGTFTAAHRTL....
Q7VKA6_HAEDU/76-166---------------YQSGIASYY.....GDQFNG.R----LTANGE---------------LFSNNEMTAAHKTL....
Q82T62_NITEU/105-195---------------KARGHASWY.....GKRYHG.K----RTASGE---------------IYDMYSMTAAHPTL....
EXP10_ORYSJ/67-153---------------TVGLSTALF......ERG....----.AACGG---------------CYEVKC...VDDL.....
RLPA_TREPA/27-117---------------VPEGYASYY.....AESFNG.R----PTASGE---------------IFDMNAYTAAHRTL....
Q98DT8_RHILO/32-119---------------GQCGRASWY........ALH.S----RTASGE---------------RMNPSALTAAHRTL....
EXPB2_ARATH/83-163---------------VSAGGPSLF......KSG....----.KGCGA---------------CYQVKC..TSKSA.....
EXPB5_ARATH/70-149---------------VSAGGPSLF......KDG....----.KGCGA---------------CYRLKC...DHPL.....
Q84V43_PHYPA/66-153---------------TAALSAPLF......QGG....----.AACGG---------------CYQLKCAPVRETRT....
EXP18_ARATH/66-152---------------TTALSTALF......NEG....----.YACGQ---------------CFQLKC..VSSPN.....
Q89LM2_BRADU/151-241---------------RAEGMASWY.....GDDFHG.R----LTANGE---------------VFDMASLTAAHPTL....
Q9A7A1_CAUCR/66-156---------------NVVGIGSWY.....GEQFHN.R----KTSNGE---------------IFDMNLPSAAHKTL....
RLPA_YERPE/75-165---------------SQIGLASSY.....GEEARG.N----TTATGE---------------IFDPNALTAAHPTL....
EXP12_ARATH/62-146---------------TAALSGELF......RSG....----.ESCGG---------------CYQVRC...DFPAD....
Q7W015_BORPE/84-174---------------RQQGLASWY.....GKKFHG.N----STSNGE---------------SYDMYAMTAAHPTM....
EXPA8_ORYSJ/60-147---------------TAALSTALF......NGG....----.ASCGA---------------CFTIACD..TRKT.....
Q84V42_PHYPA/73-155---------------IAAGNAPIF......QEG....----.KGCGQ---------------CYEVKC...NYPS.....
O67382_AQUAE/55-145---------------YEVGYASWY.....GPKFHY.R----KTANGE---------------RFNMFKLTAASRTF....
Q7XJA1_PHYPA/86-171---------------TTALSSALF......KNG....----.MACGA---------------CFEVQC...GGKGK....
RLPA_ECOLI/78-166---------------SQAGLAAIY.....DAEPGS.N----LTASGE---------------AFDPTQLTAAHPTL....
EXPB1_ARATH/76-159---------------VGAVSPILF......KGG....----.EGCGA---------------CYKVRCLD..........
RLPA_HAEIN/69-159---------------IKEGLASYY.....HLKFDG.R----KTASGD---------------VYNSKQFTAAHKTL....
Q97TP0_CLOAB/118-201---------------EEQGYVSWYD...IWSGG....----.TASGD---------------QAS...DGAAHKTL....
EXP20_ARATH/65-152---------------SAGLSGKLF......NRG....----.SSCGA---------------CLEVRC...VNHI.....
Q89X70_BRADU/74-161---------------SFSGMASYY......GNESG.S----RTASGQ---------------RFNQNAMTAAHRSL....
EXPB2_ORYSJ/68-147---------------TSCGNEPLF......QDG....----.KGCGA---------------CYQIRC..TNNPS.....
Q7NLH5_GLOVI/257-347---------------VFQGVASWY.....GHTFLN.R----RTSSGT---------------VLREDSLIAAHPAL....
Q7N763_PHOLL/72-162---------------SETGYASWY.....GEESSG.K----MTAIGE---------------RFNPYALTAAHPTL....
EXPB5_ORYSJ/81-163---------------IAAGGPSLF......KNG....----.KGCGS---------------CYQIKC..TGNRA.....
Q7M7V1_WOLSU/75-165---------------KSMGIASWY.....GPNFHG.K----KTSNGE---------------TYSMYARTAAHKTF....
EXP17_ARATH/63-151---------------TAALSTALF......NDG....----.KSCGG---------------CYQILC...DATKV....
EXPA7_ARATH/72-157---------------TAALSTTLF......NDG....----.YGCGQ---------------CFQITC..SKSPH.....
Q9HVT6_PSEAE/31-121---------------ADTGEASYY.....GSRHAG.L----RTASGE---------------RYNPNAMTAAHRTL....
Q8XUC4_RALSO/94-184---------------EQRGLASWY.....GRGFHG.R----RTASGE---------------RFDMNAFTVAHPSL....
EGC1_ARATH/45-121---------------IAAASDTLW......DNG....----.RVCGK---------------MFTVKCSGPRNAV.....
Q8KA94_CHLTE/70-164---------------EETGLASWYGK.ETLDQHNG.Q----PTAYGE---------------IFDPDLPSAAHKYL....
RLPA_PASMU/68-158---------------ARDGIASFY.....HKKFNG.R----KTASGQ---------------IYNENLYTAAHKTL....
Q8KAS8_CHLTE/66-156---------------VAIGKASYY.....TNRFRG.Q----TTANGE---------------TFDMKEFTAAHRSL....
Q8LGS7_PHYPA/73-158---------------STALSTALF......NNG....----.AKCGA---------------CFAIQCY..RSQY.....
Q89JS4_BRADU/38-126---------------RLSGSATYYG...GSDRLCG.R----RTASGG---------------VLNCAAMTAAHRTL....
EXPB9_ORYSJ/80-159---------------ISCGNVPIF......KDG....----.RGCGS---------------CYEVKC..EQPAA.....
Q8EHQ2_SHEON/98-188---------------SETGRASWY.....GEKFHG.Y----ETSNGE---------------PYDMYGMSGAHKTL....
A9PI83_POPTR/61-146---------------TAALSTALF......NSG....----.LSCGS---------------CYEIRC...VNDP.....
A9S4R2_PHYPA/63-150---------------TAALSYPLF......QGG....----.KSCGA---------------CYQLKCKWLAPTRT....
G0FQ08_AMYMS/35-132---------------.VNGRATYY......NDAGF.G----ACGTQI---------------NAATQMLVAAPAAYWTTA
I1HSX2_BRADI/64-150---------------TAALSTALF......NDG....----.AACGS---------------CYELKCDNAGPSY.....
K4BL32_SOLLC/72-156---------------TTALSTALF......NKG....----.STCGA---------------CYQIKC.VNAPKA.....
M0RUM6_MUSAM/61-147---------------.TALSTALF......NNG....----.AACGA---------------CFQIVC..DSRKS.....
M0ZM03_SOLTU/59-136---------------TAALSTALF......NNG....----.LSCGS---------------CFQLMC.VNAGQY.....
Q2YQ81_BRUA2/105-195---------------TAVGRASWY......GEAFHGR----LTANGE---------------VYDMTHLTAAHPTM....
Q2YQU4_BRUA2/29-114---------------.QCGGASWYA....LTSR....----.TASGE---------------RMNPAGLTAAHRTL....
Q7XJA4_PHYPA/67-149---------------TAALSSSLF......NSG....----.LSCGA---------------CYELTCDPSGSQY.....
Q83CW5_COXBU/77-164---------------..RGIASWY.....GTKFHG.Q----LTSTRE---------------PYNMLAMTGASPVL....
RLPA_NEIMB/59-149---------------TQTGNASWY.....GG.RFHGR----KTSGGE---------------RYDMNAFTAAHKTL....
EXP11_ARATH/61-148---------------TAALSTALF......NDG....----.ASCGE---------------CYRITCDHAADS......
EXP13_ARATH/76-161---------------.VGLSETLF......ERG....----.QICGA---------------CFELRC...VDDL.....
Q9PBF9_XYLFA/128-216---------------..RGVASYY.....GTKFHG.R----LTSNRE---------------VYDMYAFTAAHKTLPL..
RLPA_RICPR/166-258---------------TETGYASWYG...GRKDGFHGK----TTANGD---------------RFNRNLLTAAHKTL....
EGC2_ARATH/54-127---------------...VKNNLW......QNG....----.RACGR---------------RYRVRCIGATYNF.....

PF02015

GUN1_USTMA/26-235AGMATRYWDCCLASASWEGKAPVYAPVDACKADGVTLIDSKKDPSGQ--SGCN.GGNKFMCSCMQPFDDETDPTLAFGFG
S0E2L1_GIBF5/21-220SGHSTRYWDCCKPSCSWSGKAAVNAPALTCDKNDNPISN....TNAV--NGCEGGGSAYACTNYSPW..AVNDELAYGFA

PF07249

AL15_ASPFU/33-152---------------VSVSYDPRY-----DNAGTSMN----DVSCSN------GVNGLVTK..WPTFGSVPGFARIGGAP
SNP1_PHANO/17-136---------------ISVSYDQGY-----DDAGRSLT----SVSCSD------GNNGLITKYGWQNQGAVAGFPRIGGYS
E5A1B5_LEPMJ/20-136---------------MSVSYDTGY-----DDPNRSMG----VVSCSD------GPNGLMHRF..PTQGAIPNFPRIGGLS
G4UFE8_NEUT9/20-138---------------.TVSYDTGY-----DDPNRSLT----VVSCSD------GSNGLITKYHWNFQNQVKNFPYIGGVE

PF06725

A9CKT8_AGRT5/283-360---------------RALAVDRLI------------------HTFGL---------------PFFIHAP.TLTHLDDG.-
J7JYQ4_BACIU/124-186---------------STVAADPSV------------------FPIGT---------------ILFIPN...........-
G4EV18_BACIU/226-287---------------KVIAVDPNV------------------IPLGS---------------KVYVEG...........-
A0A017JC06_ECOLX/276-354---------------ASVASDRSI------------------IPPGT---------------TLLAEV..PLLDNNGKF-
D4G3C6_BACNB/376-437---------------KVIAVDPNV------------------IPLGS---------------KVHVEG...........-
B8D7Y7_BUCAT/279-357---------------TSVAADNSI------------------IKKGS---------------VILLKI..PILDQNGVF-
Q46212_CLOPF/19-80---------------STIAVDPSV------------------IPLGT---------------KLYVEG...........-
F7US57_SYNYG/304-381---------------RSIATDKFL------------------MPPGA---------------IAVLAAPIPD....CQG-
A0A011RSC9_VIBPH/271-349---------------AAVAGDRSI------------------LPMGT---------------PILAEV..PLLNADGTW-
Q888J9_PSESM/307-380---------------YSVAIDRKV------------------IPLGS---------------LLWLSTTRP.....DG.-
Q895T3_CLOTE/294-355---------------STIAVDPRV------------------IPLGT---------------KLYVEG...........-
Q899D7_CLOTE/307-368---------------STIAVDPRV------------------IPLGT---------------KVYVEG...........-
Q89WN5_BRADU/328-406---------------RSIAVDKSL------------------HVYGT---------------PFFIEGELPIDSERSK.-
G7QMA1_LEPII/289-361---------------RSVAMDPG.------------------IPLGI---------------PVLISFESSVLTEK...-
Q8DK97_THEEB/307-387---------------RSIATDKSL------------------MPPGA---------------LAVITTQIPLKAQ.GQW-
Q8EM05_OCEIH/197-258---------------KVVAVDPNV------------------IPLGS---------------EVYVEG...........-
Q8ENX7_OCEIH/134-196---------------STIAADLSV------------------YPIGT---------------ILFIPD...........-
A0A024ETR5_BRUCA/286-362---------------RSMAVDRLL------------------HTFGT---------------PFYVSAP.TLCAF.GG.-
MLTA_BUCAP/287-365---------------AAIAVDKSV------------------IKIGS---------------VVLVKI..PVLDKNGIF-
Q8KYU5_9PROT/259-330---------------RTLAVDPKY------------------ITLGA---------------PVWLEKG.......GS.-
Q8RDC9_THETN/277-338---------------GVVAVDPRV------------------IPLGT---------------RLYVEG...........-
B1RFP2_CLOPF/274-335---------------STIAVDPRV------------------IPLGT---------------KVYVEG...........-
B1R5P6_CLOPF/344-405---------------STIAVDPSV------------------IPLGS---------------KVYIPG...........-
Q8XVF5_RALSO/295-369---------------RSIAVDPGY------------------IPLGA---------------PVFLSTTKPL....ST.-
C8KEG0_LISMN/216-277---------------RVIAVDPSV------------------IPLGS---------------KVYVEG...........-
Q8YSZ6_NOSS1/326-407---------------RSIATDKSL------------------MPPGA---------------LALVHTSIPFPVAGGRM-
Q8YZB5_NOSS1/314-395---------------RSIATDKSL------------------MPPGA---------------LAVINATFPYPGQRNQL-
H1GEV0_LISIO/344-405---------------KVIAVDPNV------------------IPLGS---------------KVWVEG...........-
F6BPL1_SINMB/280-357---------------RSLAVDRLI------------------HTFGV---------------PFYVASE.TLTHLDGG.-
F0K6R7_CLOAE/290-351---------------STVAVDPRV------------------IRPGA---------------RLYVDG...........-
F7ZXH7_CLOAT/316-377---------------SSIAVDPTV------------------IPLGT---------------KLYVPG...........-
F0K8L5_CLOAE/546-621---------------RVIAVDPSV------------------IKLGT---------------RVYLQFPDNKRYQTKNG-
Q98DU5_RHILO/281-357---------------RSVAVDRLL------------------HTFGT---------------PFYIDAP.TLTAF.EK.-
B8GW18_CAUCN/315-392---------------RAIAVDPGY------------------HAYGG---------------FYWLDAAAPKLV..GA.-
Q9CEB6_LACLA/273-334---------------ICIAVDPSV------------------IPLNS---------------LVEVPG...........-
K0Y8P3_PASMD/296-374---------------ASLAADRNV------------------VPLGS---------------LLLVEV..PQMDKHGNW-
Q9EZ95_ZYMMB/374-450---------------ISLAVDPSY------------------TPLGA---------------PVFLMLDSKHGG..NA.-
L5P0D6_NEIME/357-431---------------YAGAVDRHY------------------ITLGA---------------PLFVATAHPV....TR.-
Q9K7F7_BACHD/143-205---------------STIAADPRV------------------FPIGT---------------VLFIPG...........-
Q9K7N9_BACHD/250-311---------------KVVAVDPSV------------------IPLGT---------------RVHVEG...........-
Q9KGK6_BACHD/355-416---------------KVIAVDPNV------------------IPLGS---------------RVHVEG...........-

PF00967

Q84565_PBCV1/23-145-------STCGKCFRATN---------RAN-NNSVIFRAVDFGGCSDP--------------KDQT-GIDAD.PCLFNAL
HEVL_ARATH/73-191-------ASCGKCLRVKN---------TRT-NAAVTVRIVDQ..CSNG--------------....-GLDLD.VAMFNQI
K4B0B4_SOLLC/81-197-------DSCGKCLRVTN---------TRT-GAQTTVRIVDQ..CSNG--------------....-GLDLD.INVFRQI
K7UPV9_MAIZE/102-219-------AACGKCIRVKN---------RAT-GASIVARIVDQ..CSNG--------------....-GLDLDYETVFKKI
M1BPP7_SOLTU/6-124-------ASCGRCLRVTN---------TGT-GTQETVRIVDQ..CSNG--------------....-GLDLD.VNVFNRL
WHW2_WHEAT/28-146-------AACGKCLRVTN---------PAT-GAQITARIVDQ..CANG--------------....-GLDLDWDTVFTKI

PF03330

O51677_BORBU/31-121.......PFNTTVKVTNL---------LN..NRSVVVRINDR--GPF...............RKDR-IIDLS-KYAAEKL
EXP27_ORYSJ/62-150.........RW.CKP...---------R....GAVTVTATNL--CPPNWALPS..DGGGWCNPPRR-HFDMS-QPAWERI
EXPA2_ARATH/67-152.........EW.CIP...---------.....GSIIVSATNF--CPPNFALAN..DNGGWCNPPLK-HFDLA-EPAFLQI
EXPA3_ORYSJ/63-151.........KW.CKP...---------..G.GNSITITATNL--CPPNWALPS..NSGGWCNPPRQ-HFDMS-QPAWENI
EXB10_ORYSJ/78-157............CSD...---------.....KPVIIHITDM--NTE..............PIAAY-HFDLS-GHAFGAM
RLPA_HELPY/115-205.......PMNTVVKVI.N---------VDN.NLSTIVRINDR--GPF...............VSDR-IIDLS-NAAARDI
EXLB1_ARATH/62-139............CSE...---------.....EGVYVVATDS--GE................GDGT-DFILS-PKAYGRM
Q87WR7_PSESM/28-118.......PFGTRVKVT.N---------LNN.DKSVIVRVNDR--GPH...............TRGR-LIDVS-REAAEQL
A9CKF5_AGRT5/29-116.......RFGTKVKVT.N---------ARN.GKAVVVRINDR--GPF...............IKGR-VLDLS-KAAAKNI
EXPA4_ORYSJ/59-144.........SS.CLP...---------.....GSITVTATNF--CPPNYGLPS..DDGGWCNPPRP-HFDMA-EPAFLHI
EXP24_ARATH/125-208.........QW.CLP...---------.....GSIKITATNF--CPPDFTKP....NDNWCNPPQK-HFDLS-QPMFLKI
Q87VW3_PSESM/103-193.......PLPSYVKVT.N---------LDN.NRTVILRVNDR--GPF...............YSDR-IIDLS-YAAAKKL
RLPA_SYNY3/227-317.......PFGTRVKVT.N---------LRN.GQSVVVRINDR--GPF...............TGGR-VIDLS-AGAARAI
EXPB4_ORYSJ/92-171............CSG...---------.....RSETVIITDM--NYY..............PVAPF-HFDLS-GTAFGRL
YDJM_BACSU/30-121......PRNGTKIRAY.A---------KAKPKKVITVYKNDV--GR................MPNA-VLDVS-PKAFKAL
RLPA_CAMJE/77-167.......PMNTILKVT.N---------LNN.NRQVTVRVNDR--GPF...............VNNR-IIDLS-KGAASQI
EXP30_ORYSJ/72-160............CYR...---------GS...PAITVTATNL--CPPNWAEDPDRGGGGWCNPPRA-HFDLS-KPAFMRM
Q7V582_PROMM/105-195.......PFGTKVRVT.N---------LWN.DRSAVVTINDR--GPF...............IAHR-VIDLA-HGAAHEL
EXPA5_ARATH/73-151.........QW.CIK...---------G....RSIVVTATNF--CPPGG..........ACDPPNH-HFDLS-QPIYEKI
Q89QY0_BRADU/43-149FGGVQFGARPKYALV...---------EAA.GKKVIVKINDV--GPL...............RPGR-IIDLN-ERTMRHF
Y3177_SYNY3/1-87.......PLGTRVRVT.N---------RRT.GKSVVVTVSDR--CNC...................-SIDLS-RSAFQQI
Q8F9X6_LEPIN/103-193.......PLGSIIRVQ.N---------LEN.QKEVIVRVNDR--GPF...............VKDR-IIDLS-EKAADTL
Q89G77_BRADU/82-168.......PFGTKLRVT.D---------VSS.GRFVTVRVNDR--GPY...............VRGR-VVDIS-PSAAEAL
Q7MN13_VIBVY/80-170.......PLPSYVKVT.N---------KDN.GKSTIVRVNDR--GPF...............HEGR-IIDLS-YAAAYKL
Q84V44_PHYPA/67-150............CLP...---------GD...KSITVTATNY--CPQGSDG.......GWCDSPKQ-HFDLS-HPMFTSL
Q7U4N9_SYNPX/113-203.......PFGTKVRVT.N---------IRN.GRSAVIRINDR--GPF...............VDHR-VIDLG-HGAASTL
Q84V41_PHYPA/70-157.........RL.CNP...---------.....QGTNVVVTDF--CPGGT..........YCSTGEN-AFDMS-GAAINAM
Q39802_SOYBN/84-165............CSG...---------.....NPVKVVITDE--CAGC............GSDAQY-HFDLS-GNAFGAM
Q7NPV8_CHRVO/99-189.......PIPSYARVT.N---------LTN.GKSVVVRVNDC--GPF...............HKKR-LMDLS-YAAAYKL
RLPA_AQUAE/129-219.......PFGTLLEVK.N---------LKN.GRKVIVKVVDR--GPY...............VRGR-HLDLS-YAAAKKL
RLPA_NOSS1/274-366.......PFGTRVRVT.N---------TRN.GRSVVVRINDR--GPF...............TRGR-VIDLS-TGAARVL
Q9ZR84_WHEAT/77-158............CSG...---------.....QPRRIVITDM--NYY..............PVARY-HLDLS-GTAFGSM
Q8DLZ3_THEEB/217-307.......PFGKRVRVT.N---------LQN.GRSVVVRINDR--GPF...............TGGR-EIDLS-RGAAAAI
EXLA2_ORYSJ/68-146............CST...---------.....AGAKVVVTDE--ARS...............TNRT-DLVLS-AAAYAAM
Q7U7N8_SYNPX/60-150.......PFGTRVRVT.N---------LDN.NRSVVVRINDR--GPF...............RYHR-VIDLA-HGAAREL
Q7VKA6_HAEDU/76-166.......PFGTLLEVT.N---------VRN.GRSVIVRVNDR--GPY...............YGSR-IVDLS-KAAAIEL
Q82T62_NITEU/105-195.......PIPSYVRVT.N---------LQN.GNSAVVRINDR--GPF...............LENR-LIDLS-YVAAYKL
EXP10_ORYSJ/67-153.........KY.CLP...---------G....TSIVVTATNF--CAPNFGLPA..DAGGVCNPPNH-HFLLP-IQSFEKI
RLPA_TREPA/27-117.......PFGTVVELT.N---------LDN.GKKVIVRINDR--GPY...............AANR-EIDVS-KAAAVAL
Q98DT8_RHILO/32-119.......PFGTKLRVT.N---------QNN.GRSVIVRINDR--GPF...............IRGR-VLDLS-KGAAGQL
EXPB2_ARATH/83-163............CSK...---------.....NPVTVVITDE--CPGC.............VKESV-HFDLS-GTAFGAM
EXPB5_ARATH/70-149............CTK...---------.....KPIKVMISDE--CPGC.............TKESV-HFDLS-GKAFGAL
Q84V43_PHYPA/66-153.......VHNW.CWS...---------YS...RSIVVTATNL--CPPGSHG.......GWCAW.RP-HFDLP-MPAFTSL
EXP18_ARATH/66-152............CYY...---------GS...PATVVTATNI--CPPNYGQAS..NNGGWCNPPRV-HFDLT-KPAFMKI
Q89LM2_BRADU/151-241.......PMPSYARVT.N---------ISN.GKSLIVRVNDR--GPY...............HGNR-LIDVS-NKAAELL
Q9A7A1_CAUCR/66-156.......PLPSLVEVT.N---------LDN.GRKMILRVNDR--GPF...............VGDR-IIDLS-KAAADEL
RLPA_YERPE/75-165.......PIPSYVRVT.N---------VSN.GRQIVVRVNDR--GPY...............TPGR-VIDLS-RAAADRL
EXP12_ARATH/62-146........PKW.CLR...---------G....AAVTVTATNF--CPTNNNN.......GWCNLPRH-HFDMS-SPAFFRI
Q7W015_BORPE/84-174.......PIPSYARVT.S---------KIN.GRTVIVRVNDR--GPF...............HSDR-IMDLS-YVAAHKL
EXPA8_ORYSJ/60-147.........QW.CKP...---------G....TSITVTATNF--CPPNYALSG..DAGGWCNPPRR-HFDMS-QPAWETI
Q84V42_PHYPA/73-155............CSP...---------.....QGTRIVITDL--CPGGQ..........YCSTDQP-AFDFS-GAAITAM
O67382_AQUAE/55-145.......SLGTYVLVY.N---------LEN.GKFTVVRINDR--GPY...............VDGR-IIDLS-MAAADEI
Q7XJA1_PHYPA/86-171........P...CKP...---------.....GSVVVTATNF--CPPNPGQSA..NNGGWCNPPNE-HFDLS-YPAFVKI
RLPA_ECOLI/78-166.......PIPSYARIT.N---------LAN.GRMIVVRINDR--GPY...............GNDR-VISLS-RAAADRL
EXPB1_ARATH/76-159.........KTICSK...---------.....RAVTIIATDQ--SPSGP..........SAKAKHT-HFDLS-GAAFGHM
RLPA_HAEIN/69-159.......PINSYALVT.N---------LHN.NRKVIVRINDR--GPF...............SDKR-LIDLS-HAAAKEI
Q97TP0_CLOAB/118-201.......PFYTQVSVY.N---------ENNNWASTSVRILDR--GPY...............VSGR-ILDMS-QESFSKV
EXP20_ARATH/65-152.........RW.CLQ...---------GS...PSVVVTATDF--CPPNSGLSS..DYGGWCNFPKE-HLELS-HAAFTGI
Q89X70_BRADU/74-161.......PFGTKLRVT.H---------GG...SSVIVTINDR--GPF...............IRGR-VLDLS-TGAARAI
EXPB2_ORYSJ/68-147............CSG...---------.....QPRTVIITDM--NYY..............PVARY-HFDLS-GTAFGAM
Q7NLH5_GLOVI/257-347.......PFGTQLRVT.N---------LGN.GRQVTVKVQDR--GPF...............IRGR-VIDLS-PRAAQLL
Q7N763_PHOLL/72-162.......PIPSYVRVT.N---------LSN.GRMMIVRVNDR--GPY...............KPGR-IIDLS-KASAERL
EXPB5_ORYSJ/81-163............CSG...---------.....RPVTVVITDS--CPGGV...........CLNEAA-HFDMS-GTAFGAM
Q7M7V1_WOLSU/75-165.......PMNTIVKVT.N---------REN.GKSTIVRINDR--GPF...............VEGR-IIDLS-NTAAKEI
EXP17_ARATH/63-151........PQW.CLK...---------G....KSITITATNF--CPPNFAQAS..DNGGWCNPPRP-HFDMA-QPAFLTI
EXPA7_ARATH/72-157............CYS...---------G....KSTVVTATNL--CPPNWYQDS..NAGGWCNPPRT-HFDMA-KPAFMKL
Q9HVT6_PSEAE/31-121.......PFGARVRVT.N---------LDN.RRSVVVRINDR--GPF...............RRGR-IIDVS-RKAAEGL
Q8XUC4_RALSO/94-184.......PLSSWVLVR.N---------LSN.DRVVVAKVTDR--GPY...............HGKR-IIDLS-YAAAKRL
EGC1_ARATH/45-121.........PHPCTG...---------.....KSVKVKIVDH--CPS...............GCAS-TLDLS-REAFAQI
Q8KA94_CHLTE/70-164.......PLPMIVRVT.N---------LEN.NTSIIVRVNDR--GPF...............VDGR-VIDLS-AAAAKAL
RLPA_PASMU/68-158.......PLNSYVLVT.N---------LRN.QRKVIVRINDR--GPF...............VKGR-IIDLS-RAAAREI
Q8KAS8_CHLTE/66-156.......PFGTIVRVT.N---------LNN.GKMVFVKINDR--GPY...............VKNR-IIDLS-KAAAKQL
Q8LGS7_PHYPA/73-158............CVP...---------GS...PVITVTATNF--CPPNHKGDG...TPGWCNPPMR-HFDLA-QPSFTKI
Q89JS4_BRADU/38-126.......PFGTVLMV...---------QSG.GRSVQVTVTDR--GPF...............T.GA-FLDLS-PAAASAL
EXPB9_ORYSJ/80-159............CSK...---------.....QPVTVFITDM--NYE..............PISAY-HFDFS-GKAFGAM
Q8EHQ2_SHEON/98-188.......PLPSYARVT.N---------LDN.NKQVIIRINDR--GPF...............HSER-ILDLS-YAAAYKL
A9PI83_POPTR/61-146.........KW.CLP...---------.....GSIVITATNF--CPPNNALPN..NAGGWCNPPQH-HFDLS-QPVFQHI
A9S4R2_PHYPA/63-150.......VHNW.CWS...---------YS...RTITITATNS--CPPGSH........GGWCDWKP-HFDLP-MPAFMTL
G0FQ08_AMYMS/35-132NPNNDPLCRGVSIRV...---------SYN.GRTITVPVVDK--CPS...............CDSA-HIDLS-APAFAQL
I1HSX2_BRADI/64-150............CRP...---------.....GSITITATNL--CPPNYALPN..DDGGWCNPPRA-HFDMA-EPAYLQI
K4BL32_SOLLC/72-156............CHP...---------.D...QVIIVTATNL--CPPNSKKT....NDDWCNPPQK-HFDLT-MPMFIKI
M0RUM6_MUSAM/61-147.........TW.CKK...---------G....THITVTATNY--CPPNYDLPS..DNGGWCNPPRQ-HFDMS-QPAWETI
M0ZM03_SOLTU/59-136............CLP...---------.....GIITVTATNF--CPPGG..........WCDPPRP-HFDLS-QPIFLRI
Q2YQ81_BRUA2/105-195.......PLPSYARVT.N---------LDT.GSSVIVRVNDR--GPY...............EYDR-VIDLS-WKAAEML
Q2YQU4_BRUA2/29-114.......PLGSKVKVTNQ---------KN..GKSLVVRINDR--GPF...............IKGR-VLDLS-KGAASRL
Q7XJA4_PHYPA/67-149............CLP...---------G....GSAIITATNF--CPTGSNG.......GWCNPPKQ-HFDLA-QPVFSKI
Q83CW5_COXBU/77-164.......PIPCFVRVT.N---------LSN.GRSVVVKINDR--GPF...............APHR-ILDLS-YAAAKKL
RLPA_NEIMB/59-149.......PIPSYVRVTNT---------KN..GKSVIVRVNDR--GPF...............HGNR-IIDVS-KAAAQKL
EXP11_ARATH/61-148.........RW.CLK...---------G....ASVVITATNF--CPPNFALPN..NNGGWCNPPLK-HFDMA-QPAWEKI
EXP13_ARATH/76-161.........RW.CIP...---------G....TSIILTATNF--CAPNYGFDP..DGGGHCNPPNK-HFVLP-IEAFEKI
Q9PBF9_XYLFA/128-216......PSFA...LIT.N---------LDN.GKSVVVRVNDR--GPF...............HDDR-LIDLS-YAAAVKL
RLPA_RICPR/166-258.......PLPCLVKV..T---------NKVNNKSVILMVNDR--GPF...............KKNR-IIDVS-QKAAEIL
EGC2_ARATH/54-127.........DRACTG...---------.....RTVDVKVVDF--CRE...............PCNG-DLNLS-RDAFRVI

PF02015

GUN1_USTMA/26-235AFT.TG.QESDTDCACFYAEFEHDAQGKAMKRNKLIFQVTNV--GGD---------------VQSQ-NFDFQ-IPGGGLG
S0E2L1_GIBF5/21-220ATKISGGSEASWCCACYALTFTT....GPVKGKKMIVQSTNT--GGD---------------LGDN-HFDLM-MPGGGVG

PF07249

AL15_ASPFU/33-152TIPGWNSPNCGKCYK------------LQYEQNTIYVTAIDA--APGGFNI-----------ATSA-MDQLT-NGMAVEL
SNP1_PHANO/17-136GIAGWNSAQCGTCYG------------ITYNGNTIYVLAVDH--AGDGFNI-----------AKQA-MDQLT-NGQAAGL
E5A1B5_LEPMJ/20-136GIA.WNSAQCGSCHK------------ITYNGKSIFVVAIDS--SSTGFNI-----------GLTA-MNELT-NNQATSL
G4UFE8_NEUT9/20-138AVAGWNSPNCGTCWS------------VTYNGKTINILAIDH--AGAGVNL-----------SKKA-MNELT-GGNAEQF

PF06725

A9CKT8_AGRT5/283-360---------------------------..KPF.ARLMLALDT--GSA---------------IVGPARGDIF-TGSGFEA
J7JYQ4_BACIU/124-186---------------------------......YGLGVVADT--GSA---------------IKGN.RLDLY-FETVKDV
G4EV18_BACIU/226-287---------------------------......YGEATAADT--GGA---------------IKGN.KIDVF-VPSKSDA
A0A017JC06_ECOLX/276-354---------------------------NGQYE.LRLMVALDV--GGA---------------IKGQ.HFDIY-QGIGPEA
D4G3C6_BACNB/376-437---------------------------......YGYAIAADT--GSA---------------IKGN.KIDVF-FPEKSSA
B8D7Y7_BUCAT/279-357---------------------------LNKYE.MRLVIALDV--GGA---------------IKGH.HFDIY-EGIGTKA
Q46212_CLOPF/19-80---------------------------......YGYAIAADT--GGA---------------IKGN.RVDLF-FNTEAEA
F7US57_SYNYG/304-381---------------------------QKVNV.SRFVVDQDT--GSA---------------IKGPGRVDIF-MGTGQTP
A0A011RSC9_VIBPH/271-349---------------------------SGAHQ.LRMLIVLDT--GGA---------------VKQN.HLDLY-HGIGARA
Q888J9_PSESM/307-380---------------------------..SSV.VRPVAAQDT--GGA---------------IAGEVRADLF-WGTGDEA
Q895T3_CLOTE/294-355---------------------------......YGYAIAADT--GTS---------------VKGN.FIDVY-FDTHKEA
Q899D7_CLOTE/307-368---------------------------......YGYAIAEDT--GGA---------------IKGN.RIDVY-LSSNSEA
Q89WN5_BRADU/328-406---------------------------..TPF.HRLMIAQDT--GSA---------------IIGPARADLY-FGAGADA
G7QMA1_LEPII/289-361---------------------------......NRIVFVHDR--GSQ---------------ITGHGRLDYF-LGTGETA
Q8DK97_THEEB/307-387---------------------------RQTPV.SRFVLDQDT--GSA---------------IRGPGRVDIF-MGTGDVA
Q8EM05_OCEIH/197-258---------------------------......YGYATAADI--GSA---------------INGN.KIDLH-VPTKEEA
Q8ENX7_OCEIH/134-196---------------------------......YGFGVVADK--GSA---------------ITGN.KIDLY-YHTVDDV
A0A024ETR5_BRUCA/286-362---------------------------..EPF.ARLMIAQDT--GTA---------------IVGPARGDLF-TGSGDEA
MLTA_BUCAP/287-365---------------------------IHKYE.MHLLIALDV--GGV---------------IKGQ.HFDVY-QGIGEKA
Q8KYU5_9PROT/259-330---------------------------..RPL.NRLMIAQDT--GSA---------------ITGPQRADVF-FGTGSQA
Q8RDC9_THETN/277-338---------------------------......YGFCIAADT--GGA---------------IKGN.RIDVY-FPTREEV
B1RFP2_CLOPF/274-335---------------------------......YGYAVAEDT--GGA---------------IKNN.IIDLF-LNSAPEC
B1R5P6_CLOPF/344-405---------------------------......YGYAIASDT--GGV---------------IKGN.IIDLY-MNSHDEC
Q8XVF5_RALSO/295-369---------------------------..EPI.QKLVFAQDV--GSA---------------IRGAVRADYY-FGHGDAA
C8KEG0_LISMN/216-277---------------------------......YGQAIAADT--GGA---------------IKGN.KIDVH-LNSVQEA
Q8YSZ6_NOSS1/326-407---------------------------EYRTV.SRYVLDQDT--GNA---------------IKGPGRVDYF-MGTGKQA
Q8YZB5_NOSS1/314-395---------------------------INRRV.SRFVLDQDT--GSA---------------IKGPGRVDYF-LGYGDLA
H1GEV0_LISIO/344-405---------------------------......YGEAIAGDT--GGV---------------IKGN.IVDVY-FPNESQC
F6BPL1_SINMB/280-357---------------------------..HPF.GRLMLALDT--GSA---------------IVGPARGDIF-TGSGDQA
F0K6R7_CLOAE/290-351---------------------------......YGYAVADDT--GGD---------------IIGN.RIDLF-FSSKQDA
F7ZXH7_CLOAT/316-377---------------------------......YGYGVAEDT--GGA---------------IKGN.RLDLF-FTSEREC
F0K8L5_CLOAE/546-621---------------------------QRYDL.NGWYTAHDT--GGA---------------IKGN.HIDLF-MGFGGAE
Q98DU5_RHILO/281-357---------------------------..RPF.RRLMIAQDT--GSA---------------ITGPARGDLF-AGSGDAA
B8GW18_CAUCN/315-392---------------------------..FPVYRRAVTALDT--GGA---------------IKGEVRADLY-MGSGAVA
Q9CEB6_LACLA/273-334---------------------------......YGIAIAGDT--GGA---------------IIGN.IIDVH-FPTNDQA
K0Y8P3_PASMD/296-374---------------------------TGEHQ.MHLMVALDV--GGA---------------VKGH.HFDLY-RGIGDDA
Q9EZ95_ZYMMB/374-450---------------------------..AFA.NGLWIAQDK--GGA---------------IKGANRFDSY-WGYGDKA
L5P0D6_NEIME/357-431---------------------------..KAL.NRLIMAQDT--GSA---------------IKGAVRVDYF-WGYGDEA
Q9K7F7_BACHD/143-205---------------------------......YGYGVVTDT--GSA---------------IKGN.KIDLY-YETVEDV
Q9K7N9_BACHD/250-311---------------------------......YGEAVAADV--GGS---------------IQGN.KIDLH-MATKEDA
Q9KGK6_BACHD/355-416---------------------------......YGTAIAGDT--GGA---------------IVGN.KIDVH-MPSTAEA

PF00967

Q84565_PBCV1/23-145DAG--SGAGIRD-GAMR-VDVIEVDC-------------------------------------------------
HEVL_ARATH/73-191DT.--DGFGYQQ-GHLI-VDYQFVDC-------------------------------------------------
K4B0B4_SOLLC/81-197DT.--DGVGNQQ-GHLI-VNYQFVNC-------------------------------------------------
K7UPV9_MAIZE/102-219DT.--NGQGYQM-GHLN-VDYQFVAC-------------------------------------------------
M1BPP7_SOLTU/6-124DT.--NGLGYQR-GNLN-VNYEFVNC-------------------------------------------------
WHW2_WHEAT/28-146DT.--NGIGYQQ-GHLN-VNYQFVDC-------------------------------------------------

PF03330

O51677_BORBU/31-121DFL.......GI.GVAP.VKI------------------------------------------------------
EXP27_ORYSJ/62-150GVY.......RA.GIVP.VLY------------------------------------------------------
EXPA2_ARATH/67-152AQY.......RA.GIVP.VAF------------------------------------------------------
EXPA3_ORYSJ/63-151AVY.......QA.GIVP.VNY------------------------------------------------------
EXB10_ORYSJ/78-157AKEGKDEELRKA.GIID.MQF------------------------------------------------------
RLPA_HELPY/115-205DMV.......KK.GTAS.VRL------------------------------------------------------
EXLB1_ARATH/62-139ARPGTENQLYSF.GVVN.VEY------------------------------------------------------
Q87WR7_PSESM/28-118GML.......RS.GTAP.VRV------------------------------------------------------
A9CKF5_AGRT5/29-116GMI.......SS.GTAK.VCY------------------------------------------------------
EXPA4_ORYSJ/59-144AQY.......RA.GIVP.VSF------------------------------------------------------
EXP24_ARATH/125-208AKY.......KA.GVVP.VKF------------------------------------------------------
Q87VW3_PSESM/103-193GYA.......ES.GTAR.VKV------------------------------------------------------
RLPA_SYNY3/227-317GIH.......SS.GVGN.VAL------------------------------------------------------
EXPB4_ORYSJ/92-171AKPGLNDKLRHS.GIID.IEF------------------------------------------------------
YDJM_BACSU/30-121GYP......LSK.GKVA.GHY------------------------------------------------------
RLPA_CAMJE/77-167DMI.......AS.GTAP.VRL------------------------------------------------------
EXP30_ORYSJ/72-160ADW.......RA.GIVP.VMY------------------------------------------------------
Q7V582_PROMM/105-195GLI.......SS.GIAQ.VRL------------------------------------------------------
EXPA5_ARATH/73-151ALY.......KS.GIIP.VMY------------------------------------------------------
Q89QY0_BRADU/43-149DPS......LEL.GVIPDVTV------------------------------------------------------
Y3177_SYNY3/1-87ANP.......RK.GRVP.VSI------------------------------------------------------
Q8F9X6_LEPIN/103-193DFK.......DV.GIAK.VGI------------------------------------------------------
Q89G77_BRADU/82-168GMV.......DK.GIAN.VRL------------------------------------------------------
Q7MN13_VIBVY/80-170DVL.......KT.GTAN.VEI------------------------------------------------------
Q84V44_PHYPA/67-150AQE.......VG.GVIP.VTY------------------------------------------------------
Q7U4N9_SYNPX/113-203GLI.......SS.GIAQ.VKL------------------------------------------------------
Q84V41_PHYPA/70-157ALRGREGQLRNR.GLYN.LLY------------------------------------------------------
Q39802_SOYBN/84-165AISGQDENLRNA.GKIN.IQH------------------------------------------------------
Q7NPV8_CHRVO/99-189GFV.......QQ.GSAK.IAI------------------------------------------------------
RLPA_AQUAE/129-219GMI.......RD.GVIP.FEA------------------------------------------------------
RLPA_NOSS1/274-366GMI.......GS.GVAP.VRI------------------------------------------------------
Q9ZR84_WHEAT/77-158AKYGLNDRLRHA.GIID.MQF------------------------------------------------------
Q8DLZ3_THEEB/217-307GLI.......GA.GVGY.VRI------------------------------------------------------
EXLA2_ORYSJ/68-146ARPGMAAQLRTR.RAVD.VEY------------------------------------------------------
Q7U7N8_SYNPX/60-150RMM.......RA.GEIP.VRL------------------------------------------------------
Q7VKA6_HAEDU/76-166GMK.......RA.GLAK.VKL------------------------------------------------------
Q82T62_NITEU/105-195GVL.......AN.GSAR.VEV------------------------------------------------------
EXP10_ORYSJ/67-153ALW.......KA.GVMP.IQY------------------------------------------------------
RLPA_TREPA/27-117DML.......NA.GVAR.VSI------------------------------------------------------
Q98DT8_RHILO/32-119GFI.......GS.GHTS.VCM------------------------------------------------------
EXPB2_ARATH/83-163AISGQDSQLRNV.GELQ.ILY------------------------------------------------------
EXPB5_ARATH/70-149AKRGKGDQLRNL.GELK.VSY------------------------------------------------------
Q84V43_PHYPA/66-153AKQ.......VG.GVAP.VFY------------------------------------------------------
EXP18_ARATH/66-152ANW.......KA.GIIP.VSY------------------------------------------------------
Q89LM2_BRADU/151-241EFK.......GN.GVAK.VRV------------------------------------------------------
Q9A7A1_CAUCR/66-156GYR.......RQ.GVAR.VRV------------------------------------------------------
RLPA_YERPE/75-165NIS.......NN.TKVK.IDF------------------------------------------------------
EXP12_ARATH/62-146ARR.......GNEGIVP.VFY------------------------------------------------------
Q7W015_BORPE/84-174GII.......GP.GSGP.VTV------------------------------------------------------
EXPA8_ORYSJ/60-147AVY.......RA.GIVP.VNY------------------------------------------------------
Q84V42_PHYPA/73-155ALPGRDGELRNI.GLYD.IQY------------------------------------------------------
O67382_AQUAE/55-145GML.......KK.GVAK.VLV------------------------------------------------------
Q7XJA1_PHYPA/86-171ADP.......KA.GAVP.LQY------------------------------------------------------
RLPA_ECOLI/78-166NTS.......NN...TK.VRI------------------------------------------------------
EXPB1_ARATH/76-159AIPGHNGVIRNR.GLLN.ILY------------------------------------------------------
RLPA_HAEIN/69-159GLI.......SR.GIGQ.VRI------------------------------------------------------
Q97TP0_CLOAB/118-201ANT.......DD.G....VFY------------------------------------------------------
EXP20_ARATH/65-152AET.......RA.EMIP.IQY------------------------------------------------------
Q89X70_BRADU/74-161GLT.......GA.GVGR.VTA------------------------------------------------------
EXPB2_ORYSJ/68-147ARPGLNDQLRHA.GIID.IQF------------------------------------------------------
Q7NLH5_GLOVI/257-347GMV.......SS.GLAR.VKV------------------------------------------------------
Q7N763_PHOLL/72-162NLT.......QS.TKVK.VDF------------------------------------------------------
EXPB5_ORYSJ/81-163ANRGMGDRLRSA.GVLK.IQY------------------------------------------------------
Q7M7V1_WOLSU/75-165DMV.......TK.GTAP.VVV------------------------------------------------------
EXP17_ARATH/63-151AKY.......KA.GIVP.ILY------------------------------------------------------
EXPA7_ARATH/72-157AYW.......RA.GIIP.VAY------------------------------------------------------
Q9HVT6_PSEAE/31-121GMI.......RS.GVAP.VRI------------------------------------------------------
Q8XUC4_RALSO/94-184DFV.......RR.GSTQ.VEI------------------------------------------------------
EGC1_ARATH/45-121ANP.......VA.GIIN.IDY------------------------------------------------------
Q8KA94_CHLTE/70-164GFY.......GK.GTAR.VKI------------------------------------------------------
RLPA_PASMU/68-158GLI.......GS.GVGH.VRV------------------------------------------------------
Q8KAS8_CHLTE/66-156DLV.......DS.GVGR.VKI------------------------------------------------------
Q8LGS7_PHYPA/73-158AKY.......RA.GIVP.VLF------------------------------------------------------
Q89JS4_BRADU/38-126GC........RC.THRN.VTA------------------------------------------------------
EXPB9_ORYSJ/80-159ACPGKETELRKA.GIID.MQF------------------------------------------------------
Q8EHQ2_SHEON/98-188GML.......GT.GTAR.IKL------------------------------------------------------
A9PI83_POPTR/61-146AQF.......RA.GIVP.VSY------------------------------------------------------
A9S4R2_PHYPA/63-150ARR.......EG.GVAP.VYY------------------------------------------------------
G0FQ08_AMYMS/35-132ADP.......GL.GNIP.VTW------------------------------------------------------
I1HSX2_BRADI/64-150GVY.......RA.GIVP.VSY------------------------------------------------------
K4BL32_SOLLC/72-156AEQ.......TA.GVVP.VVY------------------------------------------------------
M0RUM6_MUSAM/61-147AVY.......RG.GIVP.VYY------------------------------------------------------
M0ZM03_SOLTU/59-136AQY.......RA.GIVP.VAY------------------------------------------------------
Q2YQ81_BRUA2/105-195DYQ.......HH.GTAN.VKV------------------------------------------------------
Q2YQU4_BRUA2/29-114GFI.......GA.GHTK.VC.------------------------------------------------------
Q7XJA4_PHYPA/67-149ART.......VG.GVIP.INY------------------------------------------------------
Q83CW5_COXBU/77-164GYV.......NR.GTAL.VE.------------------------------------------------------
RLPA_NEIMB/59-149GFV.......NQ.GTAH.VKI------------------------------------------------------
EXP11_ARATH/61-148GIY.......RG.GIVP.VV.------------------------------------------------------
EXP13_ARATH/76-161AIW.......KA.GNMP.VQY------------------------------------------------------
Q9PBF9_XYLFA/128-216GFT.......EN.GLAN.VEV------------------------------------------------------
RLPA_RICPR/166-258AFK.......NQ.GVTK.VR.------------------------------------------------------
EGC2_ARATH/54-127ANT.......DA.GNIR.VVY------------------------------------------------------

PF02015

GUN1_USTMA/26-235AFPKGCPAQWGVEASLWGDQYGGVKSATECSKLPKPLQEGCKWRFSEWGDNPVLK.GSPKRVKCPKSLIDRSGCQ
S0E2L1_GIBF5/21-220IFD.GCTSEFGK..ALGGAQYGGISSRSECDSFPELLKDGCHWRF.DWFENADNPDFTFEQVQCPKALLDISGCK

PF07249

AL15_ASPFU/33-152GRVQATYEEADP-SHCA-SGV------------------------------------------------------
SNP1_PHANO/17-136GRIDANYQQVAT-SNC.-.GL------------------------------------------------------
E5A1B5_LEPMJ/20-136GRIEAEVTNASP-SDC.-.RI------------------------------------------------------
G4UFE8_NEUT9/20-138GRVDAQVQQVAL-SAC.-.GL------------------------------------------------------

PF06725

A9CKT8_AGRT5/283-360GEL--AGTVRNE-ADFY-ILL------------------------------------------------------
J7JYQ4_BACIU/124-186YNE--WG..KKT-LDVY-VIK------------------------------------------------------
G4EV18_BACIU/226-287SN.--WG..VKT-VSVK-VLN------------------------------------------------------
A0A017JC06_ECOLX/276-354GHR--AGWYNHY-GRVW-VLK------------------------------------------------------
D4G3C6_BACNB/376-437YR.--WG..NKT-VKIK-ILN------------------------------------------------------
B8D7Y7_BUCAT/279-357SIL--SGYYNHY-GYAW-ILN------------------------------------------------------
Q46212_CLOPF/19-80SN.--WG..VRN-LDVY-ILN------------------------------------------------------
F7US57_SYNYG/304-381GDR--AGLMSDD-GQIY-YLL------------------------------------------------------
A0A011RSC9_VIBPH/271-349GTE--AGHYKHF-GRVW-KLG------------------------------------------------------
Q888J9_PSESM/307-380GKL--AGDMKQK-GNIW-LLW------------------------------------------------------
Q895T3_CLOTE/294-355CN.--WG..LKY-VNVY-IQN------------------------------------------------------
Q899D7_CLOTE/307-368NN.--WG..VKW-VNVY-ILK------------------------------------------------------
Q89WN5_BRADU/328-406GRV--SGRLRHP-MHFV-MLV------------------------------------------------------
G7QMA1_LEPII/289-361EYQ--AGKINTQ-GKIF-LIL------------------------------------------------------
Q8DK97_THEEB/307-387KAR--AGLINTP-GQLY-YLL------------------------------------------------------
Q8EM05_OCEIH/197-258NN.--YG..VQQ-VDVT-IVE------------------------------------------------------
Q8ENX7_OCEIH/134-196YEQ--WG..KKE-VDVY-VIE------------------------------------------------------
A0A024ETR5_BRUCA/286-362DKI--AGGIKDE-ADFY-VLV------------------------------------------------------
MLTA_BUCAP/287-365GKL--AGFYNHY-GYAW-VLK------------------------------------------------------
Q8KYU5_9PROT/259-330GVA--AGLTKDS-GRMI-LFL------------------------------------------------------
Q8RDC9_THETN/277-338RN.--WG..RRY-VKVY-ILQ------------------------------------------------------
B1RFP2_CLOPF/274-335KQ.--WG..RRN-VNLY-IIA------------------------------------------------------
B1R5P6_CLOPF/344-405IS.--WG..RRQ-VTLH-IVA------------------------------------------------------
Q8XVF5_RALSO/295-369GDL--AGRMKQA-GRLW-VLV------------------------------------------------------
C8KEG0_LISMN/216-277NN.--WG..VKQ-VKVQ-ILD------------------------------------------------------
Q8YSZ6_NOSS1/326-407GDR--AGVTGGH-GSLY-YLL------------------------------------------------------
Q8YZB5_NOSS1/314-395GDR--AGITVTT-GSIY-YLL------------------------------------------------------
H1GEV0_LISIO/344-405YS.--WG..RRM-VTVK-VLN------------------------------------------------------
F6BPL1_SINMB/280-357GEL--AGCVRND-AEFF-IFV------------------------------------------------------
F0K6R7_CLOAE/290-351LN.--WG..RRT-VTVH-ILN------------------------------------------------------
F7ZXH7_CLOAT/316-377YD.--WG..AKN-VTVY-ILK------------------------------------------------------
F0K8L5_CLOAE/546-621DT.--....ARC-DNFG-TVN------------------------------------------------------
Q98DU5_RHILO/281-357GEI--AGVVRNA-ADFY-ALV------------------------------------------------------
B8GW18_CAUCN/315-392GVE--AGRVRHT-LRLY-RLT------------------------------------------------------
Q9CEB6_LACLA/273-334IA.--WG..RKN-IQIT-VLS------------------------------------------------------
K0Y8P3_PASMD/296-374GHI--AGLSKHY-GRVW-VLQ------------------------------------------------------
Q9EZ95_ZYMMB/374-450EHI--AGGLASH-GSAW-LLL------------------------------------------------------
L5P0D6_NEIME/357-431GEL--AGKQKTT-GYVW-QLL------------------------------------------------------
Q9K7F7_BACHD/143-205FNQ--WG..RKE-VEVY-IVE------------------------------------------------------
Q9K7N9_BACHD/250-311IN.--FG..RQN-VTVT-ILD------------------------------------------------------
Q9KGK6_BACHD/355-416QR.--WG..RKT-VKVT-ILD------------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window