Sequence alignment for CL0199

PF00967

Q84565_PBCV1/23-145---------------SKKDVRMTYHYYAP---NYETS----SLACADRFWADKDNGRKLLKYPWAAYCLDGRNFKQ----
HEVL_ARATH/73-191---------------SASNVRATYHFYNPAQNNWDLR--AVSAYCST--WDADKPYAWRSKYGWTAFCGPAGPRGQ----
K4B0B4_SOLLC/81-197-----------------AQVRATYHIYNPQNVGWDLN--AVSAYCST--WDANKPYSWRSKYGWTAFCGPVGPRGR----
M1BPP7_SOLTU/6-124---------------SATNVRATYHLYNPQNINWDLR--TASAYCAT--WDADKPLAWRQRYGWTAFCGPAGPRGQ----
WHW2_WHEAT/28-146------------------NVRATYHYYRPAQNNWDLGAPAVSAYCAT--WDASKPLSWRSKYGWTAFCGPAGAHGQ----

PF03330

O51677_BORBU/31-121---------------ATVGLASWY------GEAFHGK----TTANGE---------------KFDMMALTAAHKEL----
EXP27_ORYSJ/62-150---------------NAALSTALF------NDG---------AACGQ---------------CYLIVCDT-DKAG-----
EXPA2_ARATH/67-152---------------TAALSTALF------NSG---------QKCGA---------------CFELQC---EDDP-----
EXPA3_ORYSJ/63-151---------------NAALSSALF------NDG---------AMCGA---------------CYTITC--DTSQT-----
EXB10_ORYSJ/78-157---------------NSCGNDPIF------KDG---------KGCGS---------------CFEVKC--SKPEA-----
RLPA_HELPY/115-205---------------KFDGVASWY-----GPNFHA-K----KTSNGE---------------IYNMYAHTAAHKTL----
EXLB1_ARATH/62-139---------------VSGVSWRLW------NNG---------TGCGA---------------CYQVRC--KIPPH-----
Q87WR7_PSESM/28-118---------------DETGTAAYY-----GTRHHG-N----RTASGE---------------PFNQNALTAAHRQL----
A9CKF5_AGRFC/29-116---------------NGCGGASWY--------ALS-S----KTASGE---------------RMNAANLTAAHRSL----
EXPA4_ORYSJ/59-144---------------TAALSTALF------NDG---------AACGS---------------CYELRC---DNAG-----
EXP24_ARATH/125-208---------------TAALSTALF------NNG---------SRCGA---------------CYEIMC---EHAP-----
Q87VW3_PSESM/103-193---------------VASGTASWY-----GTKFHG-Q----NTANGE---------------VYDLYGMSAAHKTL----
RLPA_SYNY3/227-317---------------IKGGIASWY-----GPGFHG-R----RTANGE---------------RFNQNALTAAHRTL----
EXPB4_ORYSJ/92-171---------------TSCGNQPLF------KDG---------KGCGS---------------CYKIRC--TKDQS-----
YDJM_BACSU/30-121---------------HVNGNITWY-------NGVG-K----KGSSGK---------------KLGHWDCATKIGFDV---
RLPA_CAMJE/77-167---------------TADGIASWY-----GPGFHG-K----KTSNGE---------------TYNQNALTAAHKTL----
EXP30_ORYSJ/72-160---------------TAALSTTLF------KDG---------YGCGT---------------CYQMRCVGTAS-------
Q7V582_PROMM/105-195---------------VSTGEASWY-----GPGFFG-N----RTASGE---------------VFRPGTMTAAHRSL----
EXPA5_ARATH/73-151---------------TAALSTALF------DQG---------LSCGA---------------CFELMC---VNDP-----
Q89QY0_BRADU/43-149---------------AIVGAASMYNPFKPGKEEGG-P----STASGE---------------RYDPSLWTAAIKTSLRQK
Y3177_SYNY3/1-87---------------MMAQSATFY-----GNQFVG-R----KMANGQ---------------VYNHGRMVAAHPSL----
Q8F9X6_LEPIN/103-193---------------DEVGMSSWY-----GAKFHG-K----PTASGE---------------KFDKTKLTAAHPTL----
Q89G77_BRADU/82-168---------------ASHGVASFY-----SDTE---------TASGE---------------RFDKNELTAAHPSL----
Q7MN13_VIBVY/80-170---------------KESGIASWY-----GKKFQG-H----LTSNGE---------------IYDMYSMTAAHKTL----
Q84V44_PHYPA/67-150---------------TTALSSALF------NAG---------LSCGA---------------CFELKCDSANSKY-----
Q7U4N9_SYNPX/113-203---------------VITGEASWY-----GPGFYG-N----HTANGE---------------IYRQGTMTAAHRTL----
Q84V41_PHYPA/70-157---------------IVAGSRSIY------ANG---------QGCGQ---------------CYQIRCVDPNGGP-----
Q39802_SOYBN/84-165---------------ISAGSPLIY------DSG---------KGCGS---------------CYEVKC--TGNSA-----
Q7NPV8_CHRVO/99-189---------------HAVGRASWY-----GKQFHG-R----KTSSGE---------------RYDMFAMTAAHPTL----
RLPA_AQUAE/129-219---------------YIRGYASWY-----GGKFHG-R----KTASGI---------------RFNQHEYYAAHRYL----
RLPA_NOSS1/274-366---------------SFQGIASFYG---RGDGFAG-R----PTATGE---------------RFNPEAMTAAHRSL----
Q9ZR84_WHEAT/77-158---------------GACGNEPIF------AGG---------EGCGM---------------CYEIKCEYSNNPS-----
Q8DLZ3_THEEB/217-307---------------QFTGLASWY-----GPGFHG-A----RTANGE---------------RFDQDALTAAHRTL----
EXLA2_ORYSJ/68-146---------------LAAASPALF------RGG---------VGCGA---------------CFQVRC--KDGKL-----
Q7U7N8_SYNPX/60-150---------------VVNGAASWY-----GPGFYG-R----QTASGE---------------RLRKGTFTAAHRTL----
Q7VKA6_HAEDU/76-166---------------YQSGIASYY-----GDQFNG-R----LTANGE---------------LFSNNEMTAAHKTL----
Q82T62_NITEU/105-195---------------KARGHASWY-----GKRYHG-K----RTASGE---------------IYDMYSMTAAHPTL----
EXP10_ORYSJ/67-153---------------TVGLSTALF------ERG---------AACGG---------------CYEVKC---VDDL-----
RLPA_TREPA/27-117---------------VPEGYASYY-----AESFNG-R----PTASGE---------------IFDMNAYTAAHRTL----
Q98DT8_RHILO/32-119---------------GQCGRASWY--------ALH-S----RTASGE---------------RMNPSALTAAHRTL----
EXPB2_ARATH/83-163---------------VSAGGPSLF------KSG---------KGCGA---------------CYQVKC--TSKSA-----
EXPB5_ARATH/70-149---------------VSAGGPSLF------KDG---------KGCGA---------------CYRLKC---DHPL-----
Q84V43_PHYPA/66-153---------------TAALSAPLF------QGG---------AACGG---------------CYQLKCAPVRETRT----
EXP18_ARATH/66-152---------------TTALSTALF------NEG---------YACGQ---------------CFQLKC--VSSPN-----
Q89LM2_BRADU/151-241---------------RAEGMASWY-----GDDFHG-R----LTANGE---------------VFDMASLTAAHPTL----
Q9A7A1_CAUVC/66-156---------------NVVGIGSWY-----GEQFHN-R----KTSNGE---------------IFDMNLPSAAHKTL----
RLPA_YERPE/75-165---------------SQIGLASSY-----GEEARG-N----TTATGE---------------IFDPNALTAAHPTL----
EXP12_ARATH/62-146---------------TAALSGELF------RSG---------ESCGG---------------CYQVRC---DFPAD----
Q7W015_BORPE/84-174---------------RQQGLASWY-----GKKFHG-N----STSNGE---------------SYDMYAMTAAHPTM----
EXPA8_ORYSJ/60-147---------------TAALSTALF------NGG---------ASCGA---------------CFTIACD--TRKT-----
Q84V42_PHYPA/73-155---------------IAAGNAPIF------QEG---------KGCGQ---------------CYEVKC---NYPS-----
O67382_AQUAE/55-145---------------YEVGYASWY-----GPKFHY-R----KTANGE---------------RFNMFKLTAASRTF----
RLPA_ECOLI/78-166---------------SQAGLAAIY-----DAEPGS-N----LTASGE---------------AFDPTQLTAAHPTL----
EXPB1_ARATH/76-159---------------VGAVSPILF------KGG---------EGCGA---------------CYKVRCLD----------
RLPA_HAEIN/69-159---------------IKEGLASYY-----HLKFDG-R----KTASGD---------------VYNSKQFTAAHKTL----
Q97TP0_CLOAB/118-201---------------EEQGYVSWYD---IWSGG---------TASGD---------------QAS---DGAAHKTL----
EXP20_ARATH/65-152---------------SAGLSGKLF------NRG---------SSCGA---------------CLEVRC---VNHI-----
Q89X70_BRADU/74-161---------------SFSGMASYY------GNESG-S----RTASGQ---------------RFNQNAMTAAHRSL----
EXPB2_ORYSJ/68-147---------------TSCGNEPLF------QDG---------KGCGA---------------CYQIRC--TNNPS-----
Q7NLH5_GLOVI/257-347---------------VFQGVASWY-----GHTFLN-R----RTSSGT---------------VLREDSLIAAHPAL----
Q7N763_PHOLL/72-162---------------SETGYASWY-----GEESSG-K----MTAIGE---------------RFNPYALTAAHPTL----
EXPB5_ORYSJ/81-163---------------IAAGGPSLF------KNG---------KGCGS---------------CYQIKC--TGNRA-----
Q7M7V1_WOLSU/75-165---------------KSMGIASWY-----GPNFHG-K----KTSNGE---------------TYSMYARTAAHKTF----
EXP17_ARATH/63-151---------------TAALSTALF------NDG---------KSCGG---------------CYQILC---DATKV----
EXPA7_ARATH/72-157---------------TAALSTTLF------NDG---------YGCGQ---------------CFQITC--SKSPH-----
Q9HVT6_PSEAE/31-121---------------ADTGEASYY-----GSRHAG-L----RTASGE---------------RYNPNAMTAAHRTL----
Q8XUC4_RALSO/94-184---------------EQRGLASWY-----GRGFHG-R----RTASGE---------------RFDMNAFTVAHPSL----
EGC1_ARATH/45-121---------------IAAASDTLW------DNG---------RVCGK---------------MFTVKCSGPRNAV-----
Q8KA94_CHLTE/70-164---------------EETGLASWYGK-ETLDQHNG-Q----PTAYGE---------------IFDPDLPSAAHKYL----
RLPA_PASMU/68-158---------------ARDGIASFY-----HKKFNG-R----KTASGQ---------------IYNENLYTAAHKTL----
Q8KAS8_CHLTE/66-156---------------VAIGKASYY-----TNRFRG-Q----TTANGE---------------TFDMKEFTAAHRSL----
Q8LGS7_PHYPA/73-158---------------STALSTALF------NNG---------AKCGA---------------CFAIQCY--RSQY-----
Q89JS4_BRADU/38-126---------------RLSGSATYYG---GSDRLCG-R----RTASGG---------------VLNCAAMTAAHRTL----
EXPB9_ORYSJ/80-159---------------ISCGNVPIF------KDG---------RGCGS---------------CYEVKC--EQPAA-----
Q8EHQ2_SHEON/98-188---------------SETGRASWY-----GEKFHG-Y----ETSNGE---------------PYDMYGMSGAHKTL----
A9PI83_POPTR/61-146---------------TAALSTALF------NSG---------LSCGS---------------CYEIRC---VNDP-----
G0FQ08_AMYMS/35-132----------------VNGRATYY------NDAGF-G----ACGTQI---------------NAATQMLVAAPAAYWTTA
I1HSX2_BRADI/64-150---------------TAALSTALF------NDG---------AACGS---------------CYELKCDNAGPSY-----
K4BL32_SOLLC/72-156---------------TTALSTALF------NKG---------STCGA---------------CYQIKC-VNAPKA-----
M0RUM6_MUSAM/61-147----------------TALSTALF------NNG---------AACGA---------------CFQIVC--DSRKS-----
M0ZM03_SOLTU/59-136---------------TAALSTALF------NNG---------LSCGS---------------CFQLMC-VNAGQY-----
Q2YQ81_BRUA2/105-195---------------TAVGRASWY------GEAFHGR----LTANGE---------------VYDMTHLTAAHPTM----
Q2YQU4_BRUA2/29-114----------------QCGGASWYA----LTSR---------TASGE---------------RMNPAGLTAAHRTL----
Q7XJA4_PHYPA/67-149---------------TAALSSSLF------NSG---------LSCGA---------------CYELTCDPSGSQY-----
Q83CW5_COXBU/77-164-----------------RGIASWY-----GTKFHG-Q----LTSTRE---------------PYNMLAMTGASPVL----
RLPA_NEIMB/59-149---------------TQTGNASWY-----GG-RFHGR----KTSGGE---------------RYDMNAFTAAHKTL----
EXP11_ARATH/61-148---------------TAALSTALF------NDG---------ASCGE---------------CYRITCDHAADS------
EXP13_ARATH/76-161----------------VGLSETLF------ERG---------QICGA---------------CFELRC---VDDL-----
Q9PBF9_XYLFA/128-216-----------------RGVASYY-----GTKFHG-R----LTSNRE---------------VYDMYAFTAAHKTLPL--
RLPA_RICPR/166-258---------------TETGYASWYG---GRKDGFHGK----TTANGD---------------RFNRNLLTAAHKTL----
EGC2_ARATH/54-127------------------VKNNLW------QNG---------RACGR---------------RYRVRCIGATYNF-----

PF02015

GUN1_USTMA/26-235AGMATRYWDCCLASASWEGKAPVYAPVDACKADGVTLIDSKKDPSGQ--SGCN-GGNKFMCSCMQPFDDETDPTLAFGFG
S0E2L1_GIBF5/21-220SGHSTRYWDCCKPSCSWSGKAAVNAPALTCDKNDNPISN----TNAV--NGCEGGGSAYACTNYSPW--AVNDELAYGFA

PF07249

AL15_ASPFU/33-152---------------VSVSYDPRY-----DNAGTSMN----DVSCSN------GVNGLVTK--WPTFGSVPGFARIGGAP
SNP1_PHANO/17-136---------------ISVSYDQGY-----DDAGRSLT----SVSCSD------GNNGLITKYGWQNQGAVAGFPRIGGYS
E5A1B5_LEPMJ/20-136---------------MSVSYDTGY-----DDPNRSMG----VVSCSD------GPNGLMHRF--PTQGAIPNFPRIGGLS
G4UFE8_NEUT9/20-138----------------TVSYDTGY-----DDPNRSLT----VVSCSD------GSNGLITKYHWNFQNQVKNFPYIGGVE

PF06725

A9CKT8_AGRFC/283-360---------------RALAVDRLI------------------HTFGL---------------PFFIHAP-TLTHLDDG--
YUIC_BACSU/124-186---------------STVAADPSV------------------FPIGT---------------ILFIPN------------
YOCH_BACSU/226-287---------------KVIAVDPNV------------------IPLGS---------------KVYVEG------------
MLTA_ECOLI/276-354---------------ASVASDRSI------------------IPPGT---------------TLLAEV--PLLDNNGKF-
YABE_BACSU/376-437---------------KVIAVDPNV------------------IPLGS---------------KVHVEG------------
MLTA_BUCAI/279-357---------------TSVAADNSI------------------IKKGS---------------VILLKI--PILDQNGVF-
Q46212_CLOPF/19-80---------------STIAVDPSV------------------IPLGT---------------KLYVEG------------
Q55666_SYNY3/304-381---------------RSIATDKFL------------------MPPGA---------------IAVLAAPIPD----CQG-
Q87M89_VIBPA/271-349---------------AAVAGDRSI------------------LPMGT---------------PILAEV--PLLNADGTW-
Q888J9_PSESM/307-380---------------YSVAIDRKV------------------IPLGS---------------LLWLSTTRP-----DG--
Q895T3_CLOTE/294-355---------------STIAVDPRV------------------IPLGT---------------KLYVEG------------
Q899D7_CLOTE/307-368---------------STIAVDPRV------------------IPLGT---------------KVYVEG------------
Q89WN5_BRADU/328-406---------------RSIAVDKSL------------------HVYGT---------------PFFIEGELPIDSERSK--
Q8CVE1_LEPIN/289-361---------------RSVAMDPG-------------------IPLGI---------------PVLISFESSVLTEK----
Q8DK97_THEEB/307-387---------------RSIATDKSL------------------MPPGA---------------LAVITTQIPLKAQ-GQW-
Q8EM05_OCEIH/197-258---------------KVVAVDPNV------------------IPLGS---------------EVYVEG------------
Q8ENX7_OCEIH/134-196---------------STIAADLSV------------------YPIGT---------------ILFIPD------------
A0A0H3G944_BRUSU/286-362---------------RSMAVDRLL------------------HTFGT---------------PFYVSAP-TLCAF-GG--
MLTA_BUCAP/287-365---------------AAIAVDKSV------------------IKIGS---------------VVLVKI--PVLDKNGIF-
Q8KYU5_9PROT/259-330---------------RTLAVDPKY------------------ITLGA---------------PVWLEKG-------GS--
Q8RDC9_CALS4/277-338---------------GVVAVDPRV------------------IPLGT---------------RLYVEG------------
Q8XHG6_CLOPE/274-335---------------STIAVDPRV------------------IPLGT---------------KVYVEG------------
Q8XL13_CLOPE/344-405---------------STIAVDPSV------------------IPLGS---------------KVYIPG------------
Q8XVF5_RALSO/295-369---------------RSIAVDPGY------------------IPLGA---------------PVFLSTTKPL----ST--
Q8Y4C8_LISMO/216-277---------------RVIAVDPSV------------------IPLGS---------------KVYVEG------------
Q8YSZ6_NOSS1/326-407---------------RSIATDKSL------------------MPPGA---------------LALVHTSIPFPVAGGRM-
Q8YZB5_NOSS1/314-395---------------RSIATDKSL------------------MPPGA---------------LAVINATFPYPGQRNQL-
H1GEV0_LISIO/344-405---------------KVIAVDPNV------------------IPLGS---------------KVWVEG------------
Q92TE5_RHIME/280-357---------------RSLAVDRLI------------------HTFGV---------------PFYVASE-TLTHLDGG--
Q97ES4_CLOAB/290-351---------------STVAVDPRV------------------IRPGA---------------RLYVDG------------
Q97EW8_CLOAB/316-377---------------SSIAVDPTV------------------IPLGT---------------KLYVPG------------
Q97HG6_CLOAB/546-621---------------RVIAVDPSV------------------IKLGT---------------RVYLQFPDNKRYQTKNG-
Q98DU5_RHILO/281-357---------------RSVAVDRLL------------------HTFGT---------------PFYIDAP-TLTAF-EK--
Q9A226_CAUVC/315-392---------------RAIAVDPGY------------------HAYGG---------------FYWLDAAAPKLV--GA--
Q9CEB6_LACLA/273-334---------------ICIAVDPSV------------------IPLNS---------------LVEVPG------------
Q9CMA6_PASMU/296-374---------------ASLAADRNV------------------VPLGS---------------LLLVEV--PQMDKHGNW-
Q9EZ95_ZYMMB/374-450---------------ISLAVDPSY------------------TPLGA---------------PVFLMLDSKHGG--NA--
Q9JPH9_NEIME/357-431---------------YAGAVDRHY------------------ITLGA---------------PLFVATAHPV----TR--
Q9K7F7_BACHD/143-205---------------STIAADPRV------------------FPIGT---------------VLFIPG------------
Q9K7N9_BACHD/250-311---------------KVVAVDPSV------------------IPLGT---------------RVHVEG------------
Q9KGK6_BACHD/355-416---------------KVIAVDPNV------------------IPLGS---------------RVHVEG------------

PF00967

Q84565_PBCV1/23-145-------STCGKCFRATN---------RAN-NNSVIFRAVDFGGCSDP--------------KDQT-GIDAD-P------
HEVL_ARATH/73-191-------ASCGKCLRVKN---------TRT-NAAVTVRIVDQ--CSNG-------------------GLDLD-V------
K4B0B4_SOLLC/81-197-------DSCGKCLRVTN---------TRT-GAQTTVRIVDQ--CSNG-------------------GLDLD-I------
M1BPP7_SOLTU/6-124-------ASCGRCLRVTN---------TGT-GTQETVRIVDQ--CSNG-------------------GLDLD-V------
WHW2_WHEAT/28-146-------AACGKCLRVTN---------PAT-GAQITARIVDQ--CANG-------------------GLDLDWD------

PF03330

O51677_BORBU/31-121-------PFNTTVKVTNL---------LN--NRSVVVRINDR--GPF---------------RKDR-IIDLS-K------
EXP27_ORYSJ/62-150---------RW-CKP------------R----GAVTVTATNL--CPPNWALPS--DGGGWCNPPRR-HFDMS-Q------
EXPA2_ARATH/67-152---------EW-CIP-----------------GSIIVSATNF--CPPNFALAN--DNGGWCNPPLK-HFDLA-E------
EXPA3_ORYSJ/63-151---------KW-CKP--------------G-GNSITITATNL--CPPNWALPS--NSGGWCNPPRQ-HFDMS-Q------
EXB10_ORYSJ/78-157------------CSD-----------------KPVIIHITDM--NTE--------------PIAAY-HFDLS-G------
RLPA_HELPY/115-205-------PMNTVVKVI-N---------VDN-NLSTIVRINDR--GPF---------------VSDR-IIDLS-N------
EXLB1_ARATH/62-139------------CSE-----------------EGVYVVATDS--GE----------------GDGT-DFILS-P------
Q87WR7_PSESM/28-118-------PFGTRVKVT-N---------LNN-DKSVIVRVNDR--GPH---------------TRGR-LIDVS-R------
A9CKF5_AGRFC/29-116-------RFGTKVKVT-N---------ARN-GKAVVVRINDR--GPF---------------IKGR-VLDLS-K------
EXPA4_ORYSJ/59-144---------SS-CLP-----------------GSITVTATNF--CPPNYGLPS--DDGGWCNPPRP-HFDMA-E------
EXP24_ARATH/125-208---------QW-CLP-----------------GSIKITATNF--CPPDFTKP----NDNWCNPPQK-HFDLS-Q------
Q87VW3_PSESM/103-193-------PLPSYVKVT-N---------LDN-NRTVILRVNDR--GPF---------------YSDR-IIDLS-Y------
RLPA_SYNY3/227-317-------PFGTRVKVT-N---------LRN-GQSVVVRINDR--GPF---------------TGGR-VIDLS-A------
EXPB4_ORYSJ/92-171------------CSG-----------------RSETVIITDM--NYY--------------PVAPF-HFDLS-G------
YDJM_BACSU/30-121------PRNGTKIRAY-A---------KAKPKKVITVYKNDV--GR----------------MPNA-VLDVS-P------
RLPA_CAMJE/77-167-------PMNTILKVT-N---------LNN-NRQVTVRVNDR--GPF---------------VNNR-IIDLS-K------
EXP30_ORYSJ/72-160------------CYR------------GS---PAITVTATNL--CPPNWAEDPDRGGGGWCNPPRA-HFDLS-K------
Q7V582_PROMM/105-195-------PFGTKVRVT-N---------LWN-DRSAVVTINDR--GPF---------------IAHR-VIDLA-H------
EXPA5_ARATH/73-151---------QW-CIK------------G----RSIVVTATNF--CPPGG----------ACDPPNH-HFDLS-Q------
Q89QY0_BRADU/43-149FGGVQFGARPKYALV------------EAA-GKKVIVKINDV--GPL---------------RPGR-IIDLN-E------
Y3177_SYNY3/1-87-------PLGTRVRVT-N---------RRT-GKSVVVTVSDR--CNC--------------------SIDLS-R------
Q8F9X6_LEPIN/103-193-------PLGSIIRVQ-N---------LEN-QKEVIVRVNDR--GPF---------------VKDR-IIDLS-E------
Q89G77_BRADU/82-168-------PFGTKLRVT-D---------VSS-GRFVTVRVNDR--GPY---------------VRGR-VVDIS-P------
Q7MN13_VIBVY/80-170-------PLPSYVKVT-N---------KDN-GKSTIVRVNDR--GPF---------------HEGR-IIDLS-Y------
Q84V44_PHYPA/67-150------------CLP------------GD---KSITVTATNY--CPQGSDG-------GWCDSPKQ-HFDLS-H------
Q7U4N9_SYNPX/113-203-------PFGTKVRVT-N---------IRN-GRSAVIRINDR--GPF---------------VDHR-VIDLG-H------
Q84V41_PHYPA/70-157---------RL-CNP-----------------QGTNVVVTDF--CPGGT----------YCSTGEN-AFDMS-G------
Q39802_SOYBN/84-165------------CSG-----------------NPVKVVITDE--CAGC------------GSDAQY-HFDLS-G------
Q7NPV8_CHRVO/99-189-------PIPSYARVT-N---------LTN-GKSVVVRVNDC--GPF---------------HKKR-LMDLS-Y------
RLPA_AQUAE/129-219-------PFGTLLEVK-N---------LKN-GRKVIVKVVDR--GPY---------------VRGR-HLDLS-Y------
RLPA_NOSS1/274-366-------PFGTRVRVT-N---------TRN-GRSVVVRINDR--GPF---------------TRGR-VIDLS-T------
Q9ZR84_WHEAT/77-158------------CSG-----------------QPRRIVITDM--NYY--------------PVARY-HLDLS-G------
Q8DLZ3_THEEB/217-307-------PFGKRVRVT-N---------LQN-GRSVVVRINDR--GPF---------------TGGR-EIDLS-R------
EXLA2_ORYSJ/68-146------------CST-----------------AGAKVVVTDE--ARS---------------TNRT-DLVLS-A------
Q7U7N8_SYNPX/60-150-------PFGTRVRVT-N---------LDN-NRSVVVRINDR--GPF---------------RYHR-VIDLA-H------
Q7VKA6_HAEDU/76-166-------PFGTLLEVT-N---------VRN-GRSVIVRVNDR--GPY---------------YGSR-IVDLS-K------
Q82T62_NITEU/105-195-------PIPSYVRVT-N---------LQN-GNSAVVRINDR--GPF---------------LENR-LIDLS-Y------
EXP10_ORYSJ/67-153---------KY-CLP------------G----TSIVVTATNF--CAPNFGLPA--DAGGVCNPPNH-HFLLP-I------
RLPA_TREPA/27-117-------PFGTVVELT-N---------LDN-GKKVIVRINDR--GPY---------------AANR-EIDVS-K------
Q98DT8_RHILO/32-119-------PFGTKLRVT-N---------QNN-GRSVIVRINDR--GPF---------------IRGR-VLDLS-K------
EXPB2_ARATH/83-163------------CSK-----------------NPVTVVITDE--CPGC-------------VKESV-HFDLS-G------
EXPB5_ARATH/70-149------------CTK-----------------KPIKVMISDE--CPGC-------------TKESV-HFDLS-G------
Q84V43_PHYPA/66-153-------VHNW-CWS------------YS---RSIVVTATNL--CPPGSHG-------GWCAW-RP-HFDLP-M------
EXP18_ARATH/66-152------------CYY------------GS---PATVVTATNI--CPPNYGQAS--NNGGWCNPPRV-HFDLT-K------
Q89LM2_BRADU/151-241-------PMPSYARVT-N---------ISN-GKSLIVRVNDR--GPY---------------HGNR-LIDVS-N------
Q9A7A1_CAUVC/66-156-------PLPSLVEVT-N---------LDN-GRKMILRVNDR--GPF---------------VGDR-IIDLS-K------
RLPA_YERPE/75-165-------PIPSYVRVT-N---------VSN-GRQIVVRVNDR--GPY---------------TPGR-VIDLS-R------
EXP12_ARATH/62-146--------PKW-CLR------------G----AAVTVTATNF--CPTNNNN-------GWCNLPRH-HFDMS-S------
Q7W015_BORPE/84-174-------PIPSYARVT-S---------KIN-GRTVIVRVNDR--GPF---------------HSDR-IMDLS-Y------
EXPA8_ORYSJ/60-147---------QW-CKP------------G----TSITVTATNF--CPPNYALSG--DAGGWCNPPRR-HFDMS-Q------
Q84V42_PHYPA/73-155------------CSP-----------------QGTRIVITDL--CPGGQ----------YCSTDQP-AFDFS-G------
O67382_AQUAE/55-145-------SLGTYVLVY-N---------LEN-GKFTVVRINDR--GPY---------------VDGR-IIDLS-M------
RLPA_ECOLI/78-166-------PIPSYARIT-N---------LAN-GRMIVVRINDR--GPY---------------GNDR-VISLS-R------
EXPB1_ARATH/76-159---------KTICSK-----------------RAVTIIATDQ--SPSGP----------SAKAKHT-HFDLS-G------
RLPA_HAEIN/69-159-------PINSYALVT-N---------LHN-NRKVIVRINDR--GPF---------------SDKR-LIDLS-H------
Q97TP0_CLOAB/118-201-------PFYTQVSVY-N---------ENNNWASTSVRILDR--GPY---------------VSGR-ILDMS-Q------
EXP20_ARATH/65-152---------RW-CLQ------------GS---PSVVVTATDF--CPPNSGLSS--DYGGWCNFPKE-HLELS-H------
Q89X70_BRADU/74-161-------PFGTKLRVT-H---------GG---SSVIVTINDR--GPF---------------IRGR-VLDLS-T------
EXPB2_ORYSJ/68-147------------CSG-----------------QPRTVIITDM--NYY--------------PVARY-HFDLS-G------
Q7NLH5_GLOVI/257-347-------PFGTQLRVT-N---------LGN-GRQVTVKVQDR--GPF---------------IRGR-VIDLS-P------
Q7N763_PHOLL/72-162-------PIPSYVRVT-N---------LSN-GRMMIVRVNDR--GPY---------------KPGR-IIDLS-K------
EXPB5_ORYSJ/81-163------------CSG-----------------RPVTVVITDS--CPGGV-----------CLNEAA-HFDMS-G------
Q7M7V1_WOLSU/75-165-------PMNTIVKVT-N---------REN-GKSTIVRINDR--GPF---------------VEGR-IIDLS-N------
EXP17_ARATH/63-151--------PQW-CLK------------G----KSITITATNF--CPPNFAQAS--DNGGWCNPPRP-HFDMA-Q------
EXPA7_ARATH/72-157------------CYS------------G----KSTVVTATNL--CPPNWYQDS--NAGGWCNPPRT-HFDMA-K------
Q9HVT6_PSEAE/31-121-------PFGARVRVT-N---------LDN-RRSVVVRINDR--GPF---------------RRGR-IIDVS-R------
Q8XUC4_RALSO/94-184-------PLSSWVLVR-N---------LSN-DRVVVAKVTDR--GPY---------------HGKR-IIDLS-Y------
EGC1_ARATH/45-121---------PHPCTG-----------------KSVKVKIVDH--CPS---------------GCAS-TLDLS-R------
Q8KA94_CHLTE/70-164-------PLPMIVRVT-N---------LEN-NTSIIVRVNDR--GPF---------------VDGR-VIDLS-A------
RLPA_PASMU/68-158-------PLNSYVLVT-N---------LRN-QRKVIVRINDR--GPF---------------VKGR-IIDLS-R------
Q8KAS8_CHLTE/66-156-------PFGTIVRVT-N---------LNN-GKMVFVKINDR--GPY---------------VKNR-IIDLS-K------
Q8LGS7_PHYPA/73-158------------CVP------------GS---PVITVTATNF--CPPNHKGDG---TPGWCNPPMR-HFDLA-Q------
Q89JS4_BRADU/38-126-------PFGTVLMV------------QSG-GRSVQVTVTDR--GPF---------------T-GA-FLDLS-P------
EXPB9_ORYSJ/80-159------------CSK-----------------QPVTVFITDM--NYE--------------PISAY-HFDFS-G------
Q8EHQ2_SHEON/98-188-------PLPSYARVT-N---------LDN-NKQVIIRINDR--GPF---------------HSER-ILDLS-Y------
A9PI83_POPTR/61-146---------KW-CLP-----------------GSIVITATNF--CPPNNALPN--NAGGWCNPPQH-HFDLS-Q------
G0FQ08_AMYMS/35-132NPNNDPLCRGVSIRV------------SYN-GRTITVPVVDK--CPS---------------CDSA-HIDLS-A------
I1HSX2_BRADI/64-150------------CRP-----------------GSITITATNL--CPPNYALPN--DDGGWCNPPRA-HFDMA-E------
K4BL32_SOLLC/72-156------------CHP-------------D---QVIIVTATNL--CPPNSKKT----NDDWCNPPQK-HFDLT-M------
M0RUM6_MUSAM/61-147---------TW-CKK------------G----THITVTATNY--CPPNYDLPS--DNGGWCNPPRQ-HFDMS-Q------
M0ZM03_SOLTU/59-136------------CLP-----------------GIITVTATNF--CPPGG----------WCDPPRP-HFDLS-Q------
Q2YQ81_BRUA2/105-195-------PLPSYARVT-N---------LDT-GSSVIVRVNDR--GPY---------------EYDR-VIDLS-W------
Q2YQU4_BRUA2/29-114-------PLGSKVKVTNQ---------KN--GKSLVVRINDR--GPF---------------IKGR-VLDLS-K------
Q7XJA4_PHYPA/67-149------------CLP------------G----GSAIITATNF--CPTGSNG-------GWCNPPKQ-HFDLA-Q------
Q83CW5_COXBU/77-164-------PIPCFVRVT-N---------LSN-GRSVVVKINDR--GPF---------------APHR-ILDLS-Y------
RLPA_NEIMB/59-149-------PIPSYVRVTNT---------KN--GKSVIVRVNDR--GPF---------------HGNR-IIDVS-K------
EXP11_ARATH/61-148---------RW-CLK------------G----ASVVITATNF--CPPNFALPN--NNGGWCNPPLK-HFDMA-Q------
EXP13_ARATH/76-161---------RW-CIP------------G----TSIILTATNF--CAPNYGFDP--DGGGHCNPPNK-HFVLP-I------
Q9PBF9_XYLFA/128-216------PSFA---LIT-N---------LDN-GKSVVVRVNDR--GPF---------------HDDR-LIDLS-Y------
RLPA_RICPR/166-258-------PLPCLVKV--T---------NKVNNKSVILMVNDR--GPF---------------KKNR-IIDVS-Q------
EGC2_ARATH/54-127---------DRACTG-----------------RTVDVKVVDF--CRE---------------PCNG-DLNLS-R------

PF02015

GUN1_USTMA/26-235AFT-TG-QESDTDCACFYAEFEHDAQGKAMKRNKLIFQVTNV--GGD---------------VQSQ-NFDFQIPGGGLGA
S0E2L1_GIBF5/21-220ATKISGGSEASWCCACYALTFTT----GPVKGKKMIVQSTNT--GGD---------------LGDN-HFDLMMPGGGVGI

PF07249

AL15_ASPFU/33-152TIPGWNSPNCGKCYK------------LQYEQNTIYVTAIDAAPGGFN--------------IATS-AMDQLTN------
SNP1_PHANO/17-136GIAGWNSAQCGTCYG------------ITYNGNTIYVLAVDHAGDGFN--------------IAKQ-AMDQLTN------
E5A1B5_LEPMJ/20-136GIA-WNSAQCGSCHK------------ITYNGKSIFVVAIDSSSTGFN--------------IGLT-AMNELTN------
G4UFE8_NEUT9/20-138AVAGWNSPNCGTCWS------------VTYNGKTINILAIDHAGAGVN--------------LSKK-AMNELTG------

PF06725

A9CKT8_AGRFC/283-360-----------------------------KPF-ARLMLALDT--GSA---------------IVGPARGDIFTGSGF---
YUIC_BACSU/124-186---------------------------------YGLGVVADT--GSA---------------IKGN-RLDLYFETVK---
YOCH_BACSU/226-287---------------------------------YGEATAADT--GGA---------------IKGN-KIDVFVPSKS---
MLTA_ECOLI/276-354---------------------------NGQYE-LRLMVALDV--GGA---------------IKGQ-HFDIYQGIGP---
YABE_BACSU/376-437---------------------------------YGYAIAADT--GSA---------------IKGN-KIDVFFPEKS---
MLTA_BUCAI/279-357---------------------------LNKYE-MRLVIALDV--GGA---------------IKGH-HFDIYEGIGT---
Q46212_CLOPF/19-80---------------------------------YGYAIAADT--GGA---------------IKGN-RVDLFFNTEA---
Q55666_SYNY3/304-381---------------------------QKVNV-SRFVVDQDT--GSA---------------IKGPGRVDIFMGTGQ---
Q87M89_VIBPA/271-349---------------------------SGAHQ-LRMLIVLDT--GGA---------------VKQN-HLDLYHGIGA---
Q888J9_PSESM/307-380-----------------------------SSV-VRPVAAQDT--GGA---------------IAGEVRADLFWGTGD---
Q895T3_CLOTE/294-355---------------------------------YGYAIAADT--GTS---------------VKGN-FIDVYFDTHK---
Q899D7_CLOTE/307-368---------------------------------YGYAIAEDT--GGA---------------IKGN-RIDVYLSSNS---
Q89WN5_BRADU/328-406-----------------------------TPF-HRLMIAQDT--GSA---------------IIGPARADLYFGAGA---
Q8CVE1_LEPIN/289-361---------------------------------NRIVFVHDR--GSQ---------------ITGHGRLDYFLGTGE---
Q8DK97_THEEB/307-387---------------------------RQTPV-SRFVLDQDT--GSA---------------IRGPGRVDIFMGTGD---
Q8EM05_OCEIH/197-258---------------------------------YGYATAADI--GSA---------------INGN-KIDLHVPTKE---
Q8ENX7_OCEIH/134-196---------------------------------YGFGVVADK--GSA---------------ITGN-KIDLYYHTVD---
A0A0H3G944_BRUSU/286-362-----------------------------EPF-ARLMIAQDT--GTA---------------IVGPARGDLFTGSGD---
MLTA_BUCAP/287-365---------------------------IHKYE-MHLLIALDV--GGV---------------IKGQ-HFDVYQGIGE---
Q8KYU5_9PROT/259-330-----------------------------RPL-NRLMIAQDT--GSA---------------ITGPQRADVFFGTGS---
Q8RDC9_CALS4/277-338---------------------------------YGFCIAADT--GGA---------------IKGN-RIDVYFPTRE---
Q8XHG6_CLOPE/274-335---------------------------------YGYAVAEDT--GGA---------------IKNN-IIDLFLNSAP---
Q8XL13_CLOPE/344-405---------------------------------YGYAIASDT--GGV---------------IKGN-IIDLYMNSHD---
Q8XVF5_RALSO/295-369-----------------------------EPI-QKLVFAQDV--GSA---------------IRGAVRADYYFGHGD---
Q8Y4C8_LISMO/216-277---------------------------------YGQAIAADT--GGA---------------IKGN-KIDVHLNSVQ---
Q8YSZ6_NOSS1/326-407---------------------------EYRTV-SRYVLDQDT--GNA---------------IKGPGRVDYFMGTGK---
Q8YZB5_NOSS1/314-395---------------------------INRRV-SRFVLDQDT--GSA---------------IKGPGRVDYFLGYGD---
H1GEV0_LISIO/344-405---------------------------------YGEAIAGDT--GGV---------------IKGN-IVDVYFPNES---
Q92TE5_RHIME/280-357-----------------------------HPF-GRLMLALDT--GSA---------------IVGPARGDIFTGSGD---
Q97ES4_CLOAB/290-351---------------------------------YGYAVADDT--GGD---------------IIGN-RIDLFFSSKQ---
Q97EW8_CLOAB/316-377---------------------------------YGYGVAEDT--GGA---------------IKGN-RLDLFFTSER---
Q97HG6_CLOAB/546-621---------------------------QRYDL-NGWYTAHDT--GGA---------------IKGN-HIDLFMGFGG---
Q98DU5_RHILO/281-357-----------------------------RPF-RRLMIAQDT--GSA---------------ITGPARGDLFAGSGD---
Q9A226_CAUVC/315-392-----------------------------FPVYRRAVTALDT--GGA---------------IKGEVRADLYMGSGA---
Q9CEB6_LACLA/273-334---------------------------------YGIAIAGDT--GGA---------------IIGN-IIDVHFPTND---
Q9CMA6_PASMU/296-374---------------------------TGEHQ-MHLMVALDV--GGA---------------VKGH-HFDLYRGIGD---
Q9EZ95_ZYMMB/374-450-----------------------------AFA-NGLWIAQDK--GGA---------------IKGANRFDSYWGYGD---
Q9JPH9_NEIME/357-431-----------------------------KAL-NRLIMAQDT--GSA---------------IKGAVRVDYFWGYGD---
Q9K7F7_BACHD/143-205---------------------------------YGYGVVTDT--GSA---------------IKGN-KIDLYYETVE---
Q9K7N9_BACHD/250-311---------------------------------YGEAVAADV--GGS---------------IQGN-KIDLHMATKE---
Q9KGK6_BACHD/355-416---------------------------------YGTAIAGDT--GGA---------------IVGN-KIDVHMPSTA---

PF00967

Q84565_PBCV1/23-145---CLFNALDAG--SGAGIRD-GAMR-VDVIEVDC----------------------------------------
HEVL_ARATH/73-191---AMFNQIDT---DGFGYQQ-GHLI-VDYQFVDC----------------------------------------
K4B0B4_SOLLC/81-197---NVFRQIDT---DGVGNQQ-GHLI-VNYQFVNC----------------------------------------
M1BPP7_SOLTU/6-124---NVFNRLDT---NGLGYQR-GNLN-VNYEFVNC----------------------------------------
WHW2_WHEAT/28-146---TVFTKIDT---NGIGYQQ-GHLN-VNYQFVDC----------------------------------------

PF03330

O51677_BORBU/31-121---YAAEKLDFL-------GI-GVAP-VKI---------------------------------------------
EXP27_ORYSJ/62-150---PAWERIGVY-------RA-GIVP-VLY---------------------------------------------
EXPA2_ARATH/67-152---PAFLQIAQY-------RA-GIVP-VAF---------------------------------------------
EXPA3_ORYSJ/63-151---PAWENIAVY-------QA-GIVP-VNY---------------------------------------------
EXB10_ORYSJ/78-157---HAFGAMAKEGKDEELRKA-GIID-MQF---------------------------------------------
RLPA_HELPY/115-205---AAARDIDMV-------KK-GTAS-VRL---------------------------------------------
EXLB1_ARATH/62-139---KAYGRMARPGTENQLYSF-GVVN-VEY---------------------------------------------
Q87WR7_PSESM/28-118---EAAEQLGML-------RS-GTAP-VRV---------------------------------------------
A9CKF5_AGRFC/29-116---AAAKNIGMI-------SS-GTAK-VCY---------------------------------------------
EXPA4_ORYSJ/59-144---PAFLHIAQY-------RA-GIVP-VSF---------------------------------------------
EXP24_ARATH/125-208---PMFLKIAKY-------KA-GVVP-VKF---------------------------------------------
Q87VW3_PSESM/103-193---AAAKKLGYA-------ES-GTAR-VKV---------------------------------------------
RLPA_SYNY3/227-317---GAARAIGIH-------SS-GVGN-VAL---------------------------------------------
EXPB4_ORYSJ/92-171---TAFGRLAKPGLNDKLRHS-GIID-IEF---------------------------------------------
YDJM_BACSU/30-121---KAFKALGYP------LSK-GKVA-GHY---------------------------------------------
RLPA_CAMJE/77-167---GAASQIDMI-------AS-GTAP-VRL---------------------------------------------
EXP30_ORYSJ/72-160---PAFMRMADW-------RA-GIVP-VMY---------------------------------------------
Q7V582_PROMM/105-195---GAAHELGLI-------SS-GIAQ-VRL---------------------------------------------
EXPA5_ARATH/73-151---PIYEKIALY-------KS-GIIP-VMY---------------------------------------------
Q89QY0_BRADU/43-149---RTMRHFDPS------LEL-GVIPDVTV---------------------------------------------
Y3177_SYNY3/1-87---SAFQQIANP-------RK-GRVP-VSI---------------------------------------------
Q8F9X6_LEPIN/103-193---KAADTLDFK-------DV-GIAK-VGI---------------------------------------------
Q89G77_BRADU/82-168---SAAEALGMV-------DK-GIAN-VRL---------------------------------------------
Q7MN13_VIBVY/80-170---AAAYKLDVL-------KT-GTAN-VEI---------------------------------------------
Q84V44_PHYPA/67-150---PMFTSLAQE-------VG-GVIP-VTY---------------------------------------------
Q7U4N9_SYNPX/113-203---GAASTLGLI-------SS-GIAQ-VKL---------------------------------------------
Q84V41_PHYPA/70-157---AAINAMALRGREGQLRNR-GLYN-LLY---------------------------------------------
Q39802_SOYBN/84-165---NAFGAMAISGQDENLRNA-GKIN-IQH---------------------------------------------
Q7NPV8_CHRVO/99-189---AAAYKLGFV-------QQ-GSAK-IAI---------------------------------------------
RLPA_AQUAE/129-219---AAAKKLGMI-------RD-GVIP-FEA---------------------------------------------
RLPA_NOSS1/274-366---GAARVLGMI-------GS-GVAP-VRI---------------------------------------------
Q9ZR84_WHEAT/77-158---TAFGSMAKYGLNDRLRHA-GIID-MQF---------------------------------------------
Q8DLZ3_THEEB/217-307---GAAAAIGLI-------GA-GVGY-VRI---------------------------------------------
EXLA2_ORYSJ/68-146---AAYAAMARPGMAAQLRTR-RAVD-VEY---------------------------------------------
Q7U7N8_SYNPX/60-150---GAARELRMM-------RA-GEIP-VRL---------------------------------------------
Q7VKA6_HAEDU/76-166---AAAIELGMK-------RA-GLAK-VKL---------------------------------------------
Q82T62_NITEU/105-195---VAAYKLGVL-------AN-GSAR-VEV---------------------------------------------
EXP10_ORYSJ/67-153---QSFEKIALW-------KA-GVMP-IQY---------------------------------------------
RLPA_TREPA/27-117---AAAVALDML-------NA-GVAR-VSI---------------------------------------------
Q98DT8_RHILO/32-119---GAAGQLGFI-------GS-GHTS-VCM---------------------------------------------
EXPB2_ARATH/83-163---TAFGAMAISGQDSQLRNV-GELQ-ILY---------------------------------------------
EXPB5_ARATH/70-149---KAFGALAKRGKGDQLRNL-GELK-VSY---------------------------------------------
Q84V43_PHYPA/66-153---PAFTSLAKQ-------VG-GVAP-VFY---------------------------------------------
EXP18_ARATH/66-152---PAFMKIANW-------KA-GIIP-VSY---------------------------------------------
Q89LM2_BRADU/151-241---KAAELLEFK-------GN-GVAK-VRV---------------------------------------------
Q9A7A1_CAUVC/66-156---AAADELGYR-------RQ-GVAR-VRV---------------------------------------------
RLPA_YERPE/75-165---AAADRLNIS-------NN-TKVK-IDF---------------------------------------------
EXP12_ARATH/62-146---PAFFRIARR-------GNEGIVP-VFY---------------------------------------------
Q7W015_BORPE/84-174---VAAHKLGII-------GP-GSGP-VTV---------------------------------------------
EXPA8_ORYSJ/60-147---PAWETIAVY-------RA-GIVP-VNY---------------------------------------------
Q84V42_PHYPA/73-155---AAITAMALPGRDGELRNI-GLYD-IQY---------------------------------------------
O67382_AQUAE/55-145---AAADEIGML-------KK-GVAK-VLV---------------------------------------------
RLPA_ECOLI/78-166---AAADRLNTS-------NN---TK-VRI---------------------------------------------
EXPB1_ARATH/76-159---AAFGHMAIPGHNGVIRNR-GLLN-ILY---------------------------------------------
RLPA_HAEIN/69-159---AAAKEIGLI-------SR-GIGQ-VRI---------------------------------------------
Q97TP0_CLOAB/118-201---ESFSKVANT-------DD-G----VFY---------------------------------------------
EXP20_ARATH/65-152---AAFTGIAET-------RA-EMIP-IQY---------------------------------------------
Q89X70_BRADU/74-161---GAARAIGLT-------GA-GVGR-VTA---------------------------------------------
EXPB2_ORYSJ/68-147---TAFGAMARPGLNDQLRHA-GIID-IQF---------------------------------------------
Q7NLH5_GLOVI/257-347---RAAQLLGMV-------SS-GLAR-VKV---------------------------------------------
Q7N763_PHOLL/72-162---ASAERLNLT-------QS-TKVK-VDF---------------------------------------------
EXPB5_ORYSJ/81-163---TAFGAMANRGMGDRLRSA-GVLK-IQY---------------------------------------------
Q7M7V1_WOLSU/75-165---TAAKEIDMV-------TK-GTAP-VVV---------------------------------------------
EXP17_ARATH/63-151---PAFLTIAKY-------KA-GIVP-ILY---------------------------------------------
EXPA7_ARATH/72-157---PAFMKLAYW-------RA-GIIP-VAY---------------------------------------------
Q9HVT6_PSEAE/31-121---KAAEGLGMI-------RS-GVAP-VRI---------------------------------------------
Q8XUC4_RALSO/94-184---AAAKRLDFV-------RR-GSTQ-VEI---------------------------------------------
EGC1_ARATH/45-121---EAFAQIANP-------VA-GIIN-IDY---------------------------------------------
Q8KA94_CHLTE/70-164---AAAKALGFY-------GK-GTAR-VKI---------------------------------------------
RLPA_PASMU/68-158---AAAREIGLI-------GS-GVGH-VRV---------------------------------------------
Q8KAS8_CHLTE/66-156---AAAKQLDLV-------DS-GVGR-VKI---------------------------------------------
Q8LGS7_PHYPA/73-158---PSFTKIAKY-------RA-GIVP-VLF---------------------------------------------
Q89JS4_BRADU/38-126---AAASALGC--------RC-THRN-VTA---------------------------------------------
EXPB9_ORYSJ/80-159---KAFGAMACPGKETELRKA-GIID-MQF---------------------------------------------
Q8EHQ2_SHEON/98-188---AAAYKLGML-------GT-GTAR-IKL---------------------------------------------
A9PI83_POPTR/61-146---PVFQHIAQF-------RA-GIVP-VSY---------------------------------------------
G0FQ08_AMYMS/35-132---PAFAQLADP-------GL-GNIP-VTW---------------------------------------------
I1HSX2_BRADI/64-150---PAYLQIGVY-------RA-GIVP-VSY---------------------------------------------
K4BL32_SOLLC/72-156---PMFIKIAEQ-------TA-GVVP-VVY---------------------------------------------
M0RUM6_MUSAM/61-147---PAWETIAVY-------RG-GIVP-VYY---------------------------------------------
M0ZM03_SOLTU/59-136---PIFLRIAQY-------RA-GIVP-VAY---------------------------------------------
Q2YQ81_BRUA2/105-195---KAAEMLDYQ-------HH-GTAN-VKV---------------------------------------------
Q2YQU4_BRUA2/29-114---GAASRLGFI-------GA-GHTK-VC----------------------------------------------
Q7XJA4_PHYPA/67-149---PVFSKIART-------VG-GVIP-INY---------------------------------------------
Q83CW5_COXBU/77-164---AAAKKLGYV-------NR-GTAL-VE----------------------------------------------
RLPA_NEIMB/59-149---AAAQKLGFV-------NQ-GTAH-VKI---------------------------------------------
EXP11_ARATH/61-148---PAWEKIGIY-------RG-GIVP-VV----------------------------------------------
EXP13_ARATH/76-161---EAFEKIAIW-------KA-GNMP-VQY---------------------------------------------
Q9PBF9_XYLFA/128-216---AAAVKLGFT-------EN-GLAN-VEV---------------------------------------------
RLPA_RICPR/166-258---KAAEILAFK-------NQ-GVTK-VR----------------------------------------------
EGC2_ARATH/54-127---DAFRVIANT-------DA-GNIR-VVY---------------------------------------------

PF02015

GUN1_USTMA/26-235FPKGCPAQWGVEASLWGDQYG-GVKSATECSKLPKPLQEGCKWRFSEWGDNPVLK-GSPKRVKCPKSLIDRSGCQ
S0E2L1_GIBF5/21-220FD-GCTSEFGK--ALGGAQYG-GISSRSECDSFPELLKDGCHWRF-DWFENADNPDFTFEQVQCPKALLDISGCK

PF07249

AL15_ASPFU/33-152---GMAVELGRVQATYEEADP-SHCA-SGV---------------------------------------------
SNP1_PHANO/17-136---GQAAGLGRIDANYQQVAT-SNC---GL---------------------------------------------
E5A1B5_LEPMJ/20-136---NQATSLGRIEAEVTNASP-SDC---RI---------------------------------------------
G4UFE8_NEUT9/20-138---GNAEQFGRVDAQVQQVAL-SAC---GL---------------------------------------------

PF06725

A9CKT8_AGRFC/283-360---EAGELAGTV-------RNEADFY-ILL---------------------------------------------
YUIC_BACSU/124-186---DVYNEWG---------KKTLDVY-VIK---------------------------------------------
YOCH_BACSU/226-287---DASN-WG---------VKTVSVK-VLN---------------------------------------------
MLTA_ECOLI/276-354---EAGHRAGWY-------NHYGRVW-VLK---------------------------------------------
YABE_BACSU/376-437---SAYR-WG---------NKTVKIK-ILN---------------------------------------------
MLTA_BUCAI/279-357---KASILSGYY-------NHYGYAW-ILN---------------------------------------------
Q46212_CLOPF/19-80---EASN-WG---------VRNLDVY-ILN---------------------------------------------
Q55666_SYNY3/304-381---TPGDRAGLM-------SDDGQIY-YLL---------------------------------------------
Q87M89_VIBPA/271-349---RAGTEAGHY-------KHFGRVW-KLG---------------------------------------------
Q888J9_PSESM/307-380---EAGKLAGDM-------KQKGNIW-LLW---------------------------------------------
Q895T3_CLOTE/294-355---EACN-WG---------LKYVNVY-IQN---------------------------------------------
Q899D7_CLOTE/307-368---EANN-WG---------VKWVNVY-ILK---------------------------------------------
Q89WN5_BRADU/328-406---DAGRVSGRL-------RHPMHFV-MLV---------------------------------------------
Q8CVE1_LEPIN/289-361---TAEYQAGKI-------NTQGKIF-LIL---------------------------------------------
Q8DK97_THEEB/307-387---VAKARAGLI-------NTPGQLY-YLL---------------------------------------------
Q8EM05_OCEIH/197-258---EANN-YG---------VQQVDVT-IVE---------------------------------------------
Q8ENX7_OCEIH/134-196---DVYEQWG---------KKEVDVY-VIE---------------------------------------------
A0A0H3G944_BRUSU/286-362---EADKIAGGI-------KDEADFY-VLV---------------------------------------------
MLTA_BUCAP/287-365---KAGKLAGFY-------NHYGYAW-VLK---------------------------------------------
Q8KYU5_9PROT/259-330---QAGVAAGLT-------KDSGRMI-LFL---------------------------------------------
Q8RDC9_CALS4/277-338---EVRN-WG---------RRYVKVY-ILQ---------------------------------------------
Q8XHG6_CLOPE/274-335---ECKQ-WG---------RRNVNLY-IIA---------------------------------------------
Q8XL13_CLOPE/344-405---ECIS-WG---------RRQVTLH-IVA---------------------------------------------
Q8XVF5_RALSO/295-369---AAGDLAGRM-------KQAGRLW-VLV---------------------------------------------
Q8Y4C8_LISMO/216-277---EANN-WG---------VKQVKVQ-ILD---------------------------------------------
Q8YSZ6_NOSS1/326-407---QAGDRAGVT-------GGHGSLY-YLL---------------------------------------------
Q8YZB5_NOSS1/314-395---LAGDRAGIT-------VTTGSIY-YLL---------------------------------------------
H1GEV0_LISIO/344-405---QCYS-WG---------RRMVTVK-VLN---------------------------------------------
Q92TE5_RHIME/280-357---QAGELAGCV-------RNDAEFF-IFV---------------------------------------------
Q97ES4_CLOAB/290-351---DALN-WG---------RRTVTVH-ILN---------------------------------------------
Q97EW8_CLOAB/316-377---ECYD-WG---------AKNVTVY-ILK---------------------------------------------
Q97HG6_CLOAB/546-621---AEDT------------ARCDNFG-TVN---------------------------------------------
Q98DU5_RHILO/281-357---AAGEIAGVV-------RNAADFY-ALV---------------------------------------------
Q9A226_CAUVC/315-392---VAGVEAGRV-------RHTLRLY-RLT---------------------------------------------
Q9CEB6_LACLA/273-334---QAIA-WG---------RKNIQIT-VLS---------------------------------------------
Q9CMA6_PASMU/296-374---DAGHIAGLS-------KHYGRVW-VLQ---------------------------------------------
Q9EZ95_ZYMMB/374-450---KAEHIAGGL-------ASHGSAW-LLL---------------------------------------------
Q9JPH9_NEIME/357-431---EAGELAGKQ-------KTTGYVW-QLL---------------------------------------------
Q9K7F7_BACHD/143-205---DVFNQWG---------RKEVEVY-IVE---------------------------------------------
Q9K7N9_BACHD/250-311---DAIN-FG---------RQNVTVT-ILD---------------------------------------------
Q9KGK6_BACHD/355-416---EAQR-WG---------RKTVKVT-ILD---------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window