Sequence alignment for CL0199

PF00967

Q84565_PBCV1/23-145-----------------------------------------------------------SKKDVRMT---------YHYY
Q41802_MAIZE/27-145-----------------------------------------------------------EASNVQAT---------YHLY
HEVL_ARATH/73-191-----------------------------------------------------------SASNVRAT---------YHFY
O03994_SOLLC/68-186-----------------------------------------------------------GGAQVRAT---------YHIY
Q41360_SAMNI/20-138-----------------------------------------------------------SASNVRAT---------YHIY
BARW_HORVU/2-123-----------------------------------------------------------QANDVRAT---------YHYY
PR4A_TOBAC/27-145-----------------------------------------------------------SATNVRST---------YHLY
HEVE_HEVBR/69-187-----------------------------------------------------------SASNVLAT---------YHLY

PF03330

O51677_BORBU/31-121-----------------------------------------------------------ATVGLASW---------Y...
EXP27_ORYSJ/62-150-----------------------------------------------------------NAALSTAL---------F...
EXPA2_ARATH/67-152-----------------------------------------------------------TAALSTAL---------F...
EXPA3_ORYSJ/63-151-----------------------------------------------------------NAALSSAL---------F...
Q9ZP38_TOBAC/65-153-----------------------------------------------------------TAALSTAL---------F...
Q9FY30_FESPR/64-150-----------------------------------------------------------TAALSTAL---------F...
EXB10_ORYSJ/78-157-----------------------------------------------------------NSCGNDPI---------F...
RLPA_HELPY/115-205-----------------------------------------------------------KFDGVASW---------Y...
EXLB1_ARATH/62-139-----------------------------------------------------------VSGVSWRL---------W...
Q87WR7_PSESM/28-118-----------------------------------------------------------DETGTAAY---------Y...
Q9FY29_FESPR/64-151-----------------------------------------------------------NAALSPVL---------F...
A9CKF5_AGRT5/29-116-----------------------------------------------------------NGCGGASW---------Y...
EXPA4_ORYSJ/59-144-----------------------------------------------------------TAALSTAL---------F...
Q9X5U4_STRLA/36-135-----------------------------------------------------------SVNGKMTY---------Y...
EXP24_ARATH/125-208-----------------------------------------------------------TAALSTAL---------F...
Q7X9Q2_SAMNI/65-153-----------------------------------------------------------TAALSTAL---------F...
Q87VW3_PSESM/103-193-----------------------------------------------------------VASGTASW---------Y...
RLPA_SYNY3/227-317-----------------------------------------------------------IKGGIASW---------Y...
EXPB4_ORYSJ/92-171-----------------------------------------------------------TSCGNQPL---------F...
YDJM_BACSU/30-121-----------------------------------------------------------HVNGNITW---------Y...
RLPA_CAMJE/77-167-----------------------------------------------------------TADGIASW---------Y...
Q87C59_XYLFT/126-216-----------------------------------------------------------IKRGVASY---------Y...
EXP30_ORYSJ/72-160-----------------------------------------------------------TAALSTTL---------F...
Q7V582_PROMM/105-195-----------------------------------------------------------VSTGEASW---------Y...
EXPA5_ARATH/73-151-----------------------------------------------------------TAALSTAL---------F...
Q89QY0_BRAJA/43-149-----------------------------------------------------------AIVGAASM---------YNPF
Y3177_SYNY3/1-87-----------------------------------------------------------MMAQSATF---------Y...
Q8F9X6_LEPIN/103-193-----------------------------------------------------------DEVGMSSW---------Y...
Q89G77_BRAJA/82-168-----------------------------------------------------------ASHGVASF---------Y...
Q7MN13_VIBVY/80-170-----------------------------------------------------------KESGIASW---------Y...
Q84V44_9BRYO/67-150-----------------------------------------------------------TTALSSAL---------F...
Q7U4N9_SYNPX/113-203-----------------------------------------------------------VITGEASW---------Y...
Q8LBG2_ARATH/66-146-----------------------------------------------------------VGAVNPIL---------F...
Q94KT0_MAIZE/117-199-----------------------------------------------------------IAAGSTPL---------Y...
Q84V41_9BRYO/70-157-----------------------------------------------------------IVAGSRSI---------Y...
Q39802_SOYBN/84-165-----------------------------------------------------------ISAGSPLI---------Y...
Q9ZTG7_SOLLC/19-103-----------------------------------------------------------TTALSTAL---------F...
Q7NPV8_CHRVO/99-189-----------------------------------------------------------HAVGRASW---------Y...
RLPA_AQUAE/129-219-----------------------------------------------------------YIRGYASW---------Y...
RLPA_NOSS1/274-366-----------------------------------------------------------SFQGIASF---------YG..
Q8LC65_ARATH/58-137-----------------------------------------------------------IAAAIPSI---------Y...
Q87AG9_XYLFT/395-464-----------------------------------------------------------ITALNPTQ---------L...
Q84L77_PYRCO/65-150-----------------------------------------------------------TAALSTAL---------F...
MPAL1_LOLPR/78-157-----------------------------------------------------------TGCGNTPI---------F...
EXLA3_ORYSJ/71-148-----------------------------------------------------------LAAGGPRQ---------H...
Q9ZR84_WHEAT/77-158-----------------------------------------------------------GACGNEPI---------F...
Q8DLZ3_THEEB/217-307-----------------------------------------------------------QFTGLASW---------Y...
EXLA2_ORYSJ/68-146-----------------------------------------------------------LAAASPAL---------F...
Q7XJA2_9BRYO/67-149-----------------------------------------------------------TAALSSSL---------F...
Q7U7N8_SYNPX/60-150-----------------------------------------------------------VVNGAASW---------Y...
Q8LKJ9_GOSHI/67-151-----------------------------------------------------------TAALSGAL---------F...
Q9FY28_FESPR/60-147-----------------------------------------------------------NAALSTVL---------F...
Q7VKA6_HAEDU/76-166-----------------------------------------------------------YQSGIASY---------Y...
RLPA_NEIMA/59-149-----------------------------------------------------------TQTGNASW---------Y...
Q9FRU8_ATRLE/80-160-----------------------------------------------------------VTAAGSSL---------Y...
Q82T62_NITEU/105-195-----------------------------------------------------------KARGHASW---------Y...
EXP10_ORYSJ/67-153-----------------------------------------------------------TVGLSTAL---------F...
RLPA_TREPA/27-117-----------------------------------------------------------VPEGYASY---------Y...
Q93MF1_AMYMD/34-132-----------------------------------------------------------PVNGRATY---------Y...
YOAJ_BACSU/58-127-----------------------------------------------------------ITAINPAD---------L...
Q98DT8_RHILO/32-119-----------------------------------------------------------GQCGRASW---------Y...
EXPB2_ARATH/83-163-----------------------------------------------------------VSAGGPSL---------F...
EXPB5_ARATH/70-149-----------------------------------------------------------VSAGGPSL---------F...
MPAC1_CYNDA/56-135-----------------------------------------------------------TACGNEPI---------F...
O65013_PINRA/74-152-----------------------------------------------------------VATASTKI---------Y...
Q8FXW2_BRUSU/28-115-----------------------------------------------------------EQCGGASW---------Y...
Q84V62_HEDHE/26-102-----------------------------------------------------------VVGVKNNL---------W...
Q9FYS9_STRAF/22-113-----------------------------------------------------------TAALSMAL---------F...
Q84V43_9BRYO/66-153-----------------------------------------------------------TAALSAPL---------F...
EXP18_ARATH/66-152-----------------------------------------------------------TTALSTAL---------F...
Q89LM2_BRAJA/151-241-----------------------------------------------------------RAEGMASW---------Y...
Q9A7A1_CAUCR/66-156-----------------------------------------------------------NVVGIGSW---------Y...
Q9AXE4_TOBAC/81-163-----------------------------------------------------------VSAGNSNL---------F...
RLPA_YERPE/75-165-----------------------------------------------------------SQIGLASS---------Y...
EXP12_ARATH/62-146-----------------------------------------------------------TAALSGEL---------F...
Q7W015_BORPE/84-174-----------------------------------------------------------RQQGLASW---------Y...
EXPA8_ORYSJ/60-147-----------------------------------------------------------TAALSTAL---------F...
Q84V42_9BRYO/73-155-----------------------------------------------------------IAAGNAPI---------F...
O67382_AQUAE/55-145-----------------------------------------------------------YEVGYASW---------Y...
Q7XJA1_9BRYO/86-171-----------------------------------------------------------TTALSSAL---------F...
RLPA_ECOLI/78-166-----------------------------------------------------------SQAGLAAI---------Y...
EXPB1_ARATH/76-159-----------------------------------------------------------VGAVSPIL---------F...
Q8LG16_ARATH/61-149-----------------------------------------------------------TAALSTAL---------F...
RLPA_HAEIN/69-159-----------------------------------------------------------IKEGLASY---------Y...
Q97TP0_CLOAB/118-201-----------------------------------------------------------EEQGYVSW---------YD..
Q8G0U5_BRUSU/105-195-----------------------------------------------------------TAVGRASW---------Y...
EXP20_ARATH/65-152-----------------------------------------------------------SAGLSGKL---------F...
Q9SWD3_9CARY/17-94-----------------------------------------------------------TAALSTAL---------F...
Q89X70_BRAJA/74-161-----------------------------------------------------------SFSGMASY---------Y...
Q94KT1_MAIZE/22-101-----------------------------------------------------------TSCGNEPI---------F...
EXPB2_ORYSJ/68-147-----------------------------------------------------------TSCGNEPL---------F...
Q9SDZ3_9MONI/63-148-----------------------------------------------------------TAALSTAL---------F...
Q7NLH5_GLOVI/257-347-----------------------------------------------------------VFQGVASW---------Y...
Q84L47_MIRJA/44-123-----------------------------------------------------------FAAAGPSI---------F...
Q7N763_PHOLL/72-162-----------------------------------------------------------SETGYASW---------Y...
EXPB5_ORYSJ/81-163-----------------------------------------------------------IAAGGPSL---------F...
Q7M7V1_WOLSU/75-165-----------------------------------------------------------KSMGIASW---------Y...
EXP17_ARATH/63-151-----------------------------------------------------------TAALSTAL---------F...
Q7XHJ2_QUERO/61-138-----------------------------------------------------------LAAGVASL---------Y...
Q7XJA5_MARPO/33-124-----------------------------------------------------------TAALSDTL---------L...
Q9FY31_FESPR/62-149-----------------------------------------------------------TAALSPAL---------F...
Q84L40_MIRJA/67-154-----------------------------------------------------------TGALSTAL---------F...
EXPA7_ARATH/72-157-----------------------------------------------------------TAALSTTL---------F...
Q9HVT6_PSEAE/31-121-----------------------------------------------------------ADTGEASY---------Y...
Q8LAT2_ARATH/75-161-----------------------------------------------------------TVGLSETL---------F...
Q8H6F7_MUSAC/60-147-----------------------------------------------------------NTALSTAL---------F...
Q8P513_XANCP/417-486-----------------------------------------------------------ITALNPVQ---------L...
Q8XUC4_RALSO/94-184-----------------------------------------------------------EQRGLASW---------Y...
Q949I4_FESPR/69-150-----------------------------------------------------------TSCGNQAL---------F...
Q7PBP9_RICSI/166-259-----------------------------------------------------------TETGYASW---------YGG.
A9NCT5_COXBR/71-161-----------------------------------------------------------QRRGIASW---------Y...
Q7S4C4_NEUCR/73-147-----------------------------------------------------------VVALNHDQ---------FDP.
Q9P8A6_AGABI/167-239-----------------------------------------------------------IAAMDYRT---------Y...
Q84L49_MIRJA/65-150-----------------------------------------------------------TAALSTSL---------F...
Q8S347_CAPAN/59-136-----------------------------------------------------------TAALSTAL---------F...
EGC1_ARATH/45-121-----------------------------------------------------------IAAASDTL---------W...
Q8KA94_CHLTE/70-164-----------------------------------------------------------EETGLASW---------YGK.
Q9AF65_CLAMS/559-624-----------------------------------------------------------YVAVSSPE---------Y...
RLPA_PASMU/68-158-----------------------------------------------------------ARDGIASF---------Y...
Q8KAS8_CHLTE/66-156-----------------------------------------------------------VAIGKASY---------Y...
Q8LGS7_9BRYO/73-158-----------------------------------------------------------STALSTAL---------F...
Q89JS4_BRAJA/38-126-----------------------------------------------------------RLSGSATY---------YG..
Q9AYR1_EUSER/33-120-----------------------------------------------------------TAALSTAL---------F...
Q84V45_9BRYO/65-152-----------------------------------------------------------TAALSYPL---------F...
EXPB9_ORYSJ/80-159-----------------------------------------------------------ISCGNVPI---------F...
Q8EHQ2_SHEON/98-188-----------------------------------------------------------SETGRASW---------Y...
EGC_CITJA/51-128-----------------------------------------------------------IAAASYAI---------W...

PF07249

AL15_ASPFU/33-152-----------------------------------------------------------VSVSYDPR---------Y---
SNP1_PHANO/17-136-----------------------------------------------------------ISVSYDQG---------Y---
Q8J0U4_LEPMC/20-136-----------------------------------------------------------MSVSYDTG---------Y---
CEPL_CERFI/1-119-----------------------------------------------------------VSISYDPI---------Y---
Q9C2Q5_NEUCS/19-138-----------------------------------------------------------TTVSYDTG---------Y---

PF02015

GUN1_USTMA/26-235AGMATRYWDCCLASASWEG..KAPVYAPVDACKADGVTLIDSKKDPSGQSGCN.GGNKFMCSCMQPFDDETDPTLAF---
GUN_PHACE/39-241YGTTTRYWDCCKPSCAWKENINTPTMTPVQTCAIDGNTVVN....ASVQSGCI.GGSSYMCSNQQAF..VVNSTLAF---
GUNK_FUSOX/21-220SGHSTRYWDCCKPSCSWSG..KAAVNAPALTCDKNDNPISN....TNAVNGCEGGGSAYACTNYSPW..AVNDELAY---
O93783_HUMGT/22-220SGRTTRYWDCCKPSCAWPG..KGPA..PVRTCDRWDNPLFDG...GNTRSGCDAGGGAYMCSDQSPW..AVSDDLAY---
GUN5_HYPJE/19-166KATTTRYYDGQEGACGCGS...........SSGAFPWQLGI.............GNGVYTAAGSQAL.........F---
GUN5_HUMIN/2-200DGRSTRYWDCCKPSCGWAK..KAPVNQPVFSCNANFQRITD....FDAKSGCEPGGVAYSCADQTPW..AVNDDFAL---

PF06725

A9CKT8_AGRT5/283-360-----------------------------------------------------------RALAVDRL---------I---
YUIC_BACSU/124-186-----------------------------------------------------------STVAADPS---------V---
YOCH_BACSU/226-287-----------------------------------------------------------KVIAVDPN---------V---
MLTA_ECOLI/276-354-----------------------------------------------------------ASVASDRS---------I---
YABE_BACSU/376-437-----------------------------------------------------------KVIAVDPN---------V---
MLTA_BUCAI/279-357-----------------------------------------------------------TSVAADNS---------I---
Q46212_CLOPF/19-80-----------------------------------------------------------STIAVDPS---------V---
Q55666_SYNY3/304-381-----------------------------------------------------------RSIATDKF---------L---
Q87M89_VIBPA/271-349-----------------------------------------------------------AAVAGDRS---------I---
Q888J9_PSESM/307-380-----------------------------------------------------------YSVAIDRK---------V---
Q895T3_CLOTE/294-355-----------------------------------------------------------STIAVDPR---------V---
Q899D7_CLOTE/307-368-----------------------------------------------------------STIAVDPR---------V---
Q89WN5_BRAJA/328-406-----------------------------------------------------------RSIAVDKS---------L---
Q8CVE1_LEPIN/289-361-----------------------------------------------------------RSVAMDPG---------.---
Q8DK97_THEEB/307-387-----------------------------------------------------------RSIATDKS---------L---
Q8EM05_OCEIH/197-258-----------------------------------------------------------KVVAVDPN---------V---
Q8ENX7_OCEIH/134-196-----------------------------------------------------------STIAADLS---------V---
Q8FY16_BRUSU/286-362-----------------------------------------------------------RSMAVDRL---------L---
MLTA_BUCAP/287-365-----------------------------------------------------------AAIAVDKS---------V---
Q8KYU5_9PROT/259-330-----------------------------------------------------------RTLAVDPK---------Y---
Q8RDC9_THETN/277-338-----------------------------------------------------------GVVAVDPR---------V---
Q8XHG6_CLOPE/274-335-----------------------------------------------------------STIAVDPR---------V---
Q8XL13_CLOPE/344-405-----------------------------------------------------------STIAVDPS---------V---
Q8XVF5_RALSO/295-369-----------------------------------------------------------RSIAVDPG---------Y---
Q8Y4C8_LISMO/216-277-----------------------------------------------------------RVIAVDPS---------V---
Q8YSZ6_NOSS1/326-407-----------------------------------------------------------RSIATDKS---------L---
Q8YZB5_NOSS1/314-395-----------------------------------------------------------RSIATDKS---------L---
Q92F81_LISIN/344-405-----------------------------------------------------------KVIAVDPN---------V---
Q92TE5_RHIME/280-357-----------------------------------------------------------RSLAVDRL---------I---
Q97ES4_CLOAB/290-351-----------------------------------------------------------STVAVDPR---------V---
Q97EW8_CLOAB/316-377-----------------------------------------------------------SSIAVDPT---------V---
Q97HG6_CLOAB/546-621-----------------------------------------------------------RVIAVDPS---------V---
Q98DU5_RHILO/281-357-----------------------------------------------------------RSVAVDRL---------L---
Q9A226_CAUCR/315-392-----------------------------------------------------------RAIAVDPG---------Y---
Q9CEB6_LACLA/273-334-----------------------------------------------------------ICIAVDPS---------V---
Q9CMA6_PASMU/296-374-----------------------------------------------------------ASLAADRN---------V---
Q9EZ95_ZYMMB/374-450-----------------------------------------------------------ISLAVDPS---------Y---
Q9JPH9_NEIME/357-431-----------------------------------------------------------YAGAVDRH---------Y---
Q9K7F7_BACHD/143-205-----------------------------------------------------------STIAADPR---------V---
Q9K7N9_BACHD/250-311-----------------------------------------------------------KVVAVDPS---------V---
Q9KGK6_BACHD/355-416-----------------------------------------------------------KVIAVDPN---------V---

PF00967

Q84565_PBCV1/23-145AP...NYETS....SLACADRFWADKDNGRKLLKYPWAAYCLDGRNFKQ--------------STCGKCFRATNRAN-NN
Q41802_MAIZE/27-145NPAQNGWDLN...PGTYCAT..WDADKPLSWRQKHGWTAFCGPAGQKGP--------------GRCGKCIRVKNRAT-GA
HEVL_ARATH/73-191NPAQNNWDLR..AVSAYCST..WDADKPYAWRSKYGWTAFCGPAGPRGQ--------------ASCGKCLRVKNTRT-NA
O03994_SOLLC/68-186NPQNVGWDLN..AVSAYCST..WDANKPYSWRSKYGWTAFCGPVGPRGR--------------DSCGKCLRVTNTRT-GA
Q41360_SAMNI/20-138NPQQINWDYN..RASVYCAT..WDANRPLEWRRRYGWTAFCGPVGPRGR--------------DSCGRCLRVTNTGT-GT
BARW_HORVU/2-123RPAQNNWDLGAPAVSAYCAT..WDASKPLSWRSKYGWTAFCGPAGPRGQ--------------AACGKCLRVTNPAT-GA
PR4A_TOBAC/27-145NPQNINWDLR..AASAFCAT..WDADKPLAWRQKYGWTAFCGPAGPRGQ--------------DSCGRCLRVTNTGT-GT
HEVE_HEVBR/69-187NSQDHGWDLN..AASAYCST..WDANKPYSWRSKYGWTAFCGPVGAHGQ--------------SSCGKCLSVTNTGT-GA

PF03330

O51677_BORBU/31-121...GEAFHGK----TTANGE---------------KFDMMALTAAHKEL..............PFNTTVKVTNLLN..NR
EXP27_ORYSJ/62-150...NDG....----.AACGQ---------------CYLIVCDT.DKAG.................RW.CKP...R....G
EXPA2_ARATH/67-152...NSG....----.QKCGA---------------CFELQC...EDDP.................EW.CIP........G
EXPA3_ORYSJ/63-151...NDG....----.AMCGA---------------CYTITC..DTSQT.................KW.CKP.....G.GN
Q9ZP38_TOBAC/65-153...NDG....----.GSCGQ---------------CYKIMC...DYNQD...............PKW.CRK...G....T
Q9FY30_FESPR/64-150...NDG....----.AACGS---------------CYELKC...DAAV.................GTYCRA........G
EXB10_ORYSJ/78-157...KDG....----.KGCGS---------------CFEVKC..SKPEA....................CSD........K
RLPA_HELPY/115-205..GPNFHA.K----KTSNGE---------------IYNMYAHTAAHKTL..............PMNTVVKVI.NVDN.NL
EXLB1_ARATH/62-139...NNG....----.TGCGA---------------CYQVRC..KIPPH....................CSE........E
Q87WR7_PSESM/28-118..GTRHHG.N----RTASGE---------------PFNQNALTAAHRQL..............PFGTRVKVT.NLNN.DK
Q9FY29_FESPR/64-151...NDG....----.AMCGA---------------CYTITC...DTSK.................SSMCNA...G....K
A9CKF5_AGRT5/29-116.....ALS.S----KTASGE---------------RMNAANLTAAHRSL..............RFGTKVKVT.NARN.GK
EXPA4_ORYSJ/59-144...NDG....----.AACGS---------------CYELRC...DNAG.................SS.CLP........G
Q9X5U4_STRLA/36-135...TDQGY.G----ACGTPI---------------DANSQDLVAVPAAWWTSA......NPNNDQLCQGISV.EVSYNGR
EXP24_ARATH/125-208...NNG....----.SRCGA---------------CYEIMC...EHAP.................QW.CLP........G
Q7X9Q2_SAMNI/65-153...NDG....----.AACGQ---------------CYKIICDQKTDAT..................W.CKK...G....V
Q87VW3_PSESM/103-193..GTKFHG.Q----NTANGE---------------VYDLYGMSAAHKTL..............PLPSYVKVT.NLDN.NR
RLPA_SYNY3/227-317..GPGFHG.R----RTANGE---------------RFNQNALTAAHRTL..............PFGTRVKVT.NLRN.GQ
EXPB4_ORYSJ/92-171...KDG....----.KGCGS---------------CYKIRC..TKDQS....................CSG........R
YDJM_BACSU/30-121....NGVG.K----KGSSGK---------------KLGHWDCATKIGFDV............PRNGTKIRAY.AKAKPKK
RLPA_CAMJE/77-167..GPGFHG.K----KTSNGE---------------TYNQNALTAAHKTL..............PMNTILKVT.NLNN.NR
Q87C59_XYLFT/126-216..GTKFHG.R----LTSNRE---------------VYDMYAFTAAHKTL..............PLPSFALIT.NLDN.GK
EXP30_ORYSJ/72-160...KDG....----.YGCGT---------------CYQMRCVGTAS......................CYR...GS...P
Q7V582_PROMM/105-195..GPGFFG.N----RTASGE---------------VFRPGTMTAAHRSL..............PFGTKVRVT.NLWN.DR
EXPA5_ARATH/73-151...DQG....----.LSCGA---------------CFELMC...VNDP.................QW.CIK...G....R
Q89QY0_BRAJA/43-149KPGKEEGG.P----STASGE---------------RYDPSLWTAAIKTSLRQKFG...GVQFGARPKYALV...EAA.GK
Y3177_SYNY3/1-87..GNQFVG.R----KMANGQ---------------VYNHGRMVAAHPSL..............PLGTRVRVT.NRRT.GK
Q8F9X6_LEPIN/103-193..GAKFHG.K----PTASGE---------------KFDKTKLTAAHPTL..............PLGSIIRVQ.NLEN.QK
Q89G77_BRAJA/82-168..SDTE....----.TASGE---------------RFDKNELTAAHPSL..............PFGTKLRVT.DVSS.GR
Q7MN13_VIBVY/80-170..GKKFQG.H----LTSNGE---------------IYDMYSMTAAHKTL..............PLPSYVKVT.NKDN.GK
Q84V44_9BRYO/67-150...NAG....----.LSCGA---------------CFELKCDSANSKY....................CLP...GD...K
Q7U4N9_SYNPX/113-203..GPGFYG.N----HTANGE---------------IYRQGTMTAAHRTL..............PFGTKVRVT.NIRN.GR
Q8LBG2_ARATH/66-146...KNG....----.EGCGA---------------CYKVRCLD......................KSICSR........R
Q94KT0_MAIZE/117-199...RGG....----.EGCGA---------------CYEVKC..TTNAA....................CSG........Q
Q84V41_9BRYO/70-157...ANG....----.QGCGQ---------------CYQIRCVDPNGGP.................RL.CNP........Q
Q39802_SOYBN/84-165...DSG....----.KGCGS---------------CYEVKC..TGNSA....................CSG........N
Q9ZTG7_SOLLC/19-103...NKG....----.STCGA---------------CYQIKC.VNAPKA....................CHP...D....Q
Q7NPV8_CHRVO/99-189..GKQFHG.R----KTSSGE---------------RYDMFAMTAAHPTL..............PIPSYARVT.NLTN.GK
RLPA_AQUAE/129-219..GGKFHG.R----KTASGI---------------RFNQHEYYAAHRYL..............PFGTLLEVK.NLKN.GR
RLPA_NOSS1/274-366.RGDGFAG.R----PTATGE---------------RFNPEAMTAAHRSL..............PFGTRVRVT.NTRN.GR
Q8LC65_ARATH/58-137...KDG....----.AGCGA---------------CFQVRC..KNPKL....................CST........K
Q87AG9_XYLFT/395-464...NLGGI.P----AAMAGA---------------YLRVQG...........................PKG.........
Q84L77_PYRCO/65-150...NNG....----.LGCGS---------------CYEIRC...VNDP.................KW.CLP........G
MPAL1_LOLPR/78-157...KDG....----.RGCGS---------------CFEIKC..TKPES....................CSG........E
EXLA3_ORYSJ/71-148...RGG....----.LGCGR---------------CFQMRC...RNAE...................VCSN........A
Q9ZR84_WHEAT/77-158...AGG....----.EGCGM---------------CYEIKCEYSNNPS....................CSG........Q
Q8DLZ3_THEEB/217-307..GPGFHG.A----RTANGE---------------RFDQDALTAAHRTL..............PFGKRVRVT.NLQN.GR
EXLA2_ORYSJ/68-146...RGG....----.VGCGA---------------CFQVRC..KDGKL....................CST........A
Q7XJA2_9BRYO/67-149...NSG....----.LSCGA---------------CYELTCDPSCSQY....................CLP...G....G
Q7U7N8_SYNPX/60-150..GPGFYG.R----QTASGE---------------RLRKGTFTAAHRTL..............PFGTRVRVT.NLDN.NR
Q8LKJ9_GOSHI/67-151...RDG....----.EACGA---------------CYQLRC...DYPAD...............PKW.CLR...R....A
Q9FY28_FESPR/60-147...NDG....----.ASCGQ---------------CYLIIC...DQGK.................STMCKP...G....T
Q7VKA6_HAEDU/76-166..GDQFNG.R----LTANGE---------------LFSNNEMTAAHKTL..............PFGTLLEVT.NVRN.GR
RLPA_NEIMA/59-149..GGRFHG.R----KTSGGE---------------RYDMNAFTAAHKTL..............PIPSYVRVT.NTKN.GK
Q9FRU8_ATRLE/80-160...SFG....----.DGCGV---------------CYEVKC..TGNQA....................CSG........K
Q82T62_NITEU/105-195..GKRYHG.K----RTASGE---------------IYDMYSMTAAHPTL..............PIPSYVRVT.NLQN.GN
EXP10_ORYSJ/67-153...ERG....----.AACGG---------------CYEVKC...VDDL.................KY.CLP...G....T
RLPA_TREPA/27-117..AESFNG.R----PTASGE---------------IFDMNAYTAAHRTL..............PFGTVVELT.NLDN.GK
Q93MF1_AMYMD/34-132...NDAGF.G----ACGTQI---------------NAATQMLVAAPAAYWTTANPNNDPLCRGVS...IRV...SYN.GR
YOAJ_BACSU/58-127...NYGGV.K----AALAGS---------------YLEVEG...........................PKG.........
Q98DT8_RHILO/32-119.....ALH.S----RTASGE---------------RMNPSALTAAHRTL..............PFGTKLRVT.NQNN.GR
EXPB2_ARATH/83-163...KSG....----.KGCGA---------------CYQVKC..TSKSA....................CSK........N
EXPB5_ARATH/70-149...KDG....----.KGCGA---------------CYRLKC...DHPL....................CTK........K
MPAC1_CYNDA/56-135...KDG....----.LGCRA---------------CYEIKC..KEPVE....................CSG........E
O65013_PINRA/74-152...RDG....----.KGCGA---------------CYQIRC..TDPAL....................CTK........S
Q8FXW2_BRUSU/28-115.....ALT.S----RTASGE---------------RMNPAGLTAAHRTL..............PLGSKVKVT.NQKN.GK
Q84V62_HEDHE/26-102...QNG....----.RACGR---------------RYRVRCIGATYNF.................DRACTG........R
Q9FYS9_STRAF/22-113...DNG....----.LSCGA---------------CFEIKTREPEH......................CWQQ.YEVG.KT
Q84V43_9BRYO/66-153...QGG....----.AACGG---------------CYQLKCAPVRETRT..............VHNW.CWS...YS...R
EXP18_ARATH/66-152...NEG....----.YACGQ---------------CFQLKC..VSSPN....................CYY...GS...P
Q89LM2_BRAJA/151-241..GDDFHG.R----LTANGE---------------VFDMASLTAAHPTL..............PMPSYARVT.NISN.GK
Q9A7A1_CAUCR/66-156..GEQFHN.R----KTSNGE---------------IFDMNLPSAAHKTL..............PLPSLVEVT.NLDN.GR
Q9AXE4_TOBAC/81-163...KGG....----.KGCGA---------------CYQVIC..KEKVD....................CSE........I
RLPA_YERPE/75-165..GEEARG.N----TTATGE---------------IFDPNALTAAHPTL..............PIPSYVRVT.NVSN.GR
EXP12_ARATH/62-146...RSG....----.ESCGG---------------CYQVRC...DFPAD...............PKW.CLR...G....A
Q7W015_BORPE/84-174..GKKFHG.N----STSNGE---------------SYDMYAMTAAHPTM..............PIPSYARVT.SKIN.GR
EXPA8_ORYSJ/60-147...NGG....----.ASCGA---------------CFTIACD..TRKT.................QW.CKP...G....T
Q84V42_9BRYO/73-155...QEG....----.KGCGQ---------------CYEVKC...NYPS....................CSP........Q
O67382_AQUAE/55-145..GPKFHY.R----KTANGE---------------RFNMFKLTAASRTF..............SLGTYVLVY.NLEN.GK
Q7XJA1_9BRYO/86-171...KNG....----.MACGA---------------CFEVQC...GGKGK...............P...CKP........G
RLPA_ECOLI/78-166..DAEPGS.N----LTASGE---------------AFDPTQLTAAHPTL..............PIPSYARIT.NLAN.GR
EXPB1_ARATH/76-159...KGG....----.EGCGA---------------CYKVRCLD......................KTICSK........R
Q8LG16_ARATH/61-149...NDG....----.ASCGE---------------CYRITC...DHAAD...............SRW.CLK...G....A
RLPA_HAEIN/69-159..HLKFDG.R----KTASGD---------------VYNSKQFTAAHKTL..............PINSYALVT.NLHN.NR
Q97TP0_CLOAB/118-201.IWSGG....----.TASGD---------------QAS...DGAAHKTL..............PFYTQVSVY.NENNNWA
Q8G0U5_BRUSU/105-195..GEAFHG.R----LTANGE---------------VYDMTHLTAAHPTM..............PLPSYARVT.NLDT.GS
EXP20_ARATH/65-152...NRG....----.SSCGA---------------CLEVRC...VNHI.................RW.CLQ...GS...P
Q9SWD3_9CARY/17-94...NNG....----.LACGS---------------CYQIVC...VDDP.................QW.CLP........G
Q89X70_BRAJA/74-161...GNESG.S----RTASGQ---------------RFNQNAMTAAHRSL..............PFGTKLRVT.HGG...S
Q94KT1_MAIZE/22-101...KDG....----.KGCGS---------------CYQIRC..KAHPA....................CSG........V
EXPB2_ORYSJ/68-147...QDG....----.KGCGA---------------CYQIRC..TNNPS....................CSG........Q
Q9SDZ3_9MONI/63-148...NGG....----.LSCGA---------------CFAVKC...SGNT.................RW.CLP........G
Q7NLH5_GLOVI/257-347..GHTFLN.R----RTSSGT---------------VLREDSLIAAHPAL..............PFGTQLRVT.NLGN.GR
Q84L47_MIRJA/44-123...RSG....----.LGCGA---------------RFQIRC..KRIDL....................CSK........A
Q7N763_PHOLL/72-162..GEESSG.K----MTAIGE---------------RFNPYALTAAHPTL..............PIPSYVRVT.NLSN.GR
EXPB5_ORYSJ/81-163...KNG....----.KGCGS---------------CYQIKC..TGNRA....................CSG........R
Q7M7V1_WOLSU/75-165..GPNFHG.K----KTSNGE---------------TYSMYARTAAHKTF..............PMNTIVKVT.NREN.GK
EXP17_ARATH/63-151...NDG....----.KSCGG---------------CYQILC...DATKV...............PQW.CLK...G....K
Q7XHJ2_QUERO/61-138...KDG....----.AGCGA---------------CFQVRC..KNTSH....................CTK........E
Q7XJA5_MARPO/33-124...NNG....----.LTCGA---------------CFEIKCNITGGES.................GKWCIQS.N.....P
Q9FY31_FESPR/62-149...NDG....----.AACGE---------------CCQVTCDQSSSSS....................CKQ...G....V
Q84L40_MIRJA/67-154...NNG....----.QICGA---------------CFEIKC...DNDP.................EW.CRP...GN...P
EXPA7_ARATH/72-157...NDG....----.YGCGQ---------------CFQITC..SKSPH....................CYS...G....K
Q9HVT6_PSEAE/31-121..GSRHAG.L----RTASGE---------------RYNPNAMTAAHRTL..............PFGARVRVT.NLDN.RR
Q8LAT2_ARATH/75-161...ERG....----.QICGA---------------CFELRC...VDDL.................RW.CIP...G....T
Q8H6F7_MUSAC/60-147...NNG....----.AACGA---------------CFQIVCD..SRKS.................PW.CKK...G....T
Q8P513_XANCP/417-486...NFGGV.K----AALAGA---------------YLQVNG...........................PKG.........
Q8XUC4_RALSO/94-184..GRGFHG.R----RTASGE---------------RFDMNAFTVAHPSL..............PLSSWVLVR.NLSN.DR
Q949I4_FESPR/69-150...KDG....----.AGCGA---------------CLQIKCNKNNYPE....................CSN........V
Q7PBP9_RICSI/166-259.LKDGFHG.K----KTANGD---------------RFNRNLLTAAHKTL..............PLPCLVKVT.NKAN.NK
A9NCT5_COXBR/71-161..GTKFHG.Q----LTSTRE---------------PYNMLAMTGASPVL..............PIPCFVRVT.NLSN.GR
Q7S4C4_NEUCR/73-147STPNGNPN.R----NSLCGR---------------RIRVNA...................................N.GR
Q9P8A6_AGABI/167-239...GNTSR.K----SPLCGK---------------QVEITN.TKNH.................................K
Q84L49_MIRJA/65-150...NSE....----.LSCGS---------------CYEIKC...NDDP.................SW.CLP........G
Q8S347_CAPAN/59-136...NNG....----.LSCGQ---------------CFQLMC...VNAR.................QY.CLP........G
EGC1_ARATH/45-121...DNG....----.RVCGK---------------MFTVKCSGPRNAV.................PHPCTG........K
Q8KA94_CHLTE/70-164ETLDQHNG.Q----PTAYGE---------------IFDPDLPSAAHKYL..............PLPMIVRVT.NLEN.NT
Q9AF65_CLAMS/559-624...GGA....----.AACGS---------------HLLVTG...........................PKG.........
RLPA_PASMU/68-158..HKKFNG.R----KTASGQ---------------IYNENLYTAAHKTL..............PLNSYVLVT.NLRN.QR
Q8KAS8_CHLTE/66-156..TNRFRG.Q----TTANGE---------------TFDMKEFTAAHRSL..............PFGTIVRVT.NLNN.GK
Q8LGS7_9BRYO/73-158...NNG....----.AKCGA---------------CFAIQCY..RSQY....................CVP...GS...P
Q89JS4_BRAJA/38-126.GSDRLCG.R----RTASGG---------------VLNCAAMTAAHRTL..............PFGTVLMV...QSG.GR
Q9AYR1_EUSER/33-120...NNG....----.LSCGS---------------CYTIRCDS.SSAG.................KW.CLN........G
Q84V45_9BRYO/65-152...QGG....----.KSCGA---------------CYQLKCKWLAPTRT..............VHNW.CWS...YS...R
EXPB9_ORYSJ/80-159...KDG....----.RGCGS---------------CYEVKC..EQPAA....................CSK........Q
Q8EHQ2_SHEON/98-188..GEKFHG.Y----ETSNGE---------------PYDMYGMSGAHKTL..............PLPSYARVT.NLDN.NK
EGC_CITJA/51-128...NNG....----.AVCNK---------------SFRVKCTGATNQGT..............PHP..CRG........G

PF07249

AL15_ASPFU/33-152--DNAGTSMN----DVSCSNGVNGLVTK..WPTFGSVPGFARIGGAPTI---------PGWNSPNCGKCYK--LQY.EQN
SNP1_PHANO/17-136--DDAGRSLT----SVSCSDGNNGLITKYGWQNQGAVAGFPRIGGYSGI---------AGWNSAQCGTCYG--ITY.NGN
Q8J0U4_LEPMC/20-136--DDPNRSMG----VVSCSDGPNGLMHRF..PTQGAIPNFPRIGGLSGI---------A.WNSAQCGSCHK--ITY.NGK
CEPL_CERFI/1-119--.AADLSMG----SVACSNGDHGLMAQY..PTLGEVPGFPNVGGIPDI---------AGWDSPSCGTCWK--VTIPNGN
Q9C2Q5_NEUCS/19-138--DDPNRSLT----VVSCSDGSNGLITKYHWNFQNQVKNFPYIGGVEAV---------AGWNSPNCGTCWS--VTY.NGK

PF02015

GUN1_USTMA/26-235--GFGAFT.TG.QESDTDCA---------------CFYAEFEHDAQGKA------------MKRNKLIFQVTNVGGDVQS
GUN_PHACE/39-241--GFAAGSFTGGVDNNLCCS---------------CMLLTFQ.....GQ------------LAGKQFLVQITNTGGDLGS
GUNK_FUSOX/21-220--GFAATKISGGSEASWCCA---------------CYALTFTT....GP------------VKGKKMIVQSTNTGGDLGD
O93783_HUMGT/22-220--GWAAVNIAGSNERQWCCA---------------CYELTFTS....GP------------VAGKRMIVQASNTGGDLGN
GUN5_HYPJE/19-166--DTAGASWCG....AGCGK---------------CYQLTSTG......------------....QAPCSSCGTGGAAGQ
GUN5_HUMIN/2-200--GFAATSIAGSNEAGWCCA---------------CYELTFTS....GP------------VAGKKMVVQSTSTGGDLGS

PF06725

A9CKT8_AGRT5/283-360---------------HTFGL---------------PFFIHA----------------------P.TLTHLDDG...KPF.
YUIC_BACSU/124-186---------------FPIGT---------------ILFIPN----------------------.................
YOCH_BACSU/226-287---------------IPLGS---------------KVYVEG----------------------.................
MLTA_ECOLI/276-354---------------IPPGT---------------TLLAEV----------------------..PLLDNNGKFNGQYE.
YABE_BACSU/376-437---------------IPLGS---------------KVHVEG----------------------.................
MLTA_BUCAI/279-357---------------IKKGS---------------VILLKI----------------------..PILDQNGVFLNKYE.
Q46212_CLOPF/19-80---------------IPLGT---------------KLYVEG----------------------.................
Q55666_SYNY3/304-381---------------MPPGA---------------IAVLAA----------------------PIPD....CQGQKVNV.
Q87M89_VIBPA/271-349---------------LPMGT---------------PILAEV----------------------..PLLNADGTWSGAHQ.
Q888J9_PSESM/307-380---------------IPLGS---------------LLWLST----------------------TRP.....DG...SSV.
Q895T3_CLOTE/294-355---------------IPLGT---------------KLYVEG----------------------.................
Q899D7_CLOTE/307-368---------------IPLGT---------------KVYVEG----------------------.................
Q89WN5_BRAJA/328-406---------------HVYGT---------------PFFIEG----------------------ELPIDSERSK...TPF.
Q8CVE1_LEPIN/289-361---------------IPLGI---------------PVLISF----------------------ESSVLTEK.........
Q8DK97_THEEB/307-387---------------MPPGA---------------LAVITT----------------------QIPLKAQ.GQWRQTPV.
Q8EM05_OCEIH/197-258---------------IPLGS---------------EVYVEG----------------------.................
Q8ENX7_OCEIH/134-196---------------YPIGT---------------ILFIPD----------------------.................
Q8FY16_BRUSU/286-362---------------HTFGT---------------PFYVSA----------------------P.TLCAF.GG...EPF.
MLTA_BUCAP/287-365---------------IKIGS---------------VVLVKI----------------------..PVLDKNGIFIHKYE.
Q8KYU5_9PROT/259-330---------------ITLGA---------------PVWLEK----------------------G.......GS...RPL.
Q8RDC9_THETN/277-338---------------IPLGT---------------RLYVEG----------------------.................
Q8XHG6_CLOPE/274-335---------------IPLGT---------------KVYVEG----------------------.................
Q8XL13_CLOPE/344-405---------------IPLGS---------------KVYIPG----------------------.................
Q8XVF5_RALSO/295-369---------------IPLGA---------------PVFLST----------------------TKPL....ST...EPI.
Q8Y4C8_LISMO/216-277---------------IPLGS---------------KVYVEG----------------------.................
Q8YSZ6_NOSS1/326-407---------------MPPGA---------------LALVHT----------------------SIPFPVAGGRMEYRTV.
Q8YZB5_NOSS1/314-395---------------MPPGA---------------LAVINA----------------------TFPYPGQRNQLINRRV.
Q92F81_LISIN/344-405---------------IPLGS---------------KVWVEG----------------------.................
Q92TE5_RHIME/280-357---------------HTFGV---------------PFYVAS----------------------E.TLTHLDGG...HPF.
Q97ES4_CLOAB/290-351---------------IRPGA---------------RLYVDG----------------------.................
Q97EW8_CLOAB/316-377---------------IPLGT---------------KLYVPG----------------------.................
Q97HG6_CLOAB/546-621---------------IKLGT---------------RVYLQF----------------------PDNKRYQTKNGQRYDL.
Q98DU5_RHILO/281-357---------------HTFGT---------------PFYIDA----------------------P.TLTAF.EK...RPF.
Q9A226_CAUCR/315-392---------------HAYGG---------------FYWLDA----------------------AAPKLV..GA...FPVY
Q9CEB6_LACLA/273-334---------------IPLNS---------------LVEVPG----------------------.................
Q9CMA6_PASMU/296-374---------------VPLGS---------------LLLVEV----------------------..PQMDKHGNWTGEHQ.
Q9EZ95_ZYMMB/374-450---------------TPLGA---------------PVFLML----------------------DSKHGG..NA...AFA.
Q9JPH9_NEIME/357-431---------------ITLGA---------------PLFVAT----------------------AHPV....TR...KAL.
Q9K7F7_BACHD/143-205---------------FPIGT---------------VLFIPG----------------------.................
Q9K7N9_BACHD/250-311---------------IPLGT---------------RVHVEG----------------------.................
Q9KGK6_BACHD/355-416---------------IPLGS---------------RVHVEG----------------------.................

PF00967

Q84565_PBCV1/23-145SVIFRAVDFGGCSD-------------------PKDQTGIDAD.PCLFNALDAG----SGAGIRD-GA-MR-VDVIEVDC
Q41802_MAIZE/27-145SIVARIVDQ..CSN-------------------G....GLDLDYETVFKKIDT.----NGQGYQM-GH-LN-VDYQFVAC
HEVL_ARATH/73-191AVTVRIVDQ..CSN-------------------G....GLDLD.VAMFNQIDT.----DGFGYQQ-GH-LI-VDYQFVDC
O03994_SOLLC/68-186QTTVRIVDQ..CSN-------------------G....GLDLD.INVFRQIDT.----DGVGNQQ-GH-LI-VNYQFVNC
Q41360_SAMNI/20-138SETVRIVDQ..CAN-------------------G....GLDLE.QGVFQRLDT.----DGRGYAR-GN-LN-VNYQFVNC
BARW_HORVU/2-123QITARIVDQ..CAN-------------------G....GLDLDWDTVFTKIDT.----NGIGYQQ-GH-LN-VNYQFVDC
PR4A_TOBAC/27-145QTTVRIVDQ..CSN-------------------G....GLDLD.VNVFNQLDT.----NGVGYQQ-GH-LT-VNYEFVNC
HEVE_HEVBR/69-187KTTVRIVDQ..CSN-------------------G....GLDLD.VNVFRQLDT.----DGKGYER-GH-IT-VNYQFVDC

PF03330

O51677_BORBU/31-121SVVVRINDR--GPF............-----...RKDRIIDLS-KYAAEKLDFL.........GI.GV.AP.VKI-----
EXP27_ORYSJ/62-150AVTVTATNL--CPPNWALPS..DGGG-----WCNPPRRHFDMS-QPAWERIGVY.........RA.GI.VP.VLY-----
EXPA2_ARATH/67-152SIIVSATNF--CPPNFALAN..DNGG-----WCNPPLKHFDLA-EPAFLQIAQY.........RA.GI.VP.VAF-----
EXPA3_ORYSJ/63-151SITITATNL--CPPNWALPS..NSGG-----WCNPPRQHFDMS-QPAWENIAVY.........QA.GI.VP.VNY-----
Q9ZP38_TOBAC/65-153YVTITATNF--CPPNYALPS..NNGG-----WCNPPRPHFDMA-QPACENIGIY.........RG.GI.VP.VLY-----
Q9FY30_FESPR/64-150SITITATNL--CPPNYALPN..DAGG-----WCNPPRAHFDMA-EPAYLQIGVY.........RA.GI.VP.VNY-----
EXB10_ORYSJ/78-157PVIIHITDM--NTE............-----..PIAAYHFDLS-GHAFGAMAKEGKD..EELRKA.GI.ID.MQF-----
RLPA_HELPY/115-205STIVRINDR--GPF............-----...VSDRIIDLS-NAAARDIDMV.........KK.GT.AS.VRL-----
EXLB1_ARATH/62-139GVYVVATDS--GE.............-----...GDGTDFILS-PKAYGRMARPGTE..NQLYSF.GV.VN.VEY-----
Q87WR7_PSESM/28-118SVIVRVNDR--GPH............-----...TRGRLIDVS-REAAEQLGML.........RS.GT.AP.VRV-----
Q9FY29_FESPR/64-151SITISATNL--CPANYALPN..DNGG-----WCNPPRRHFDMS-QPAWETIAIY.........RA.GI.VP.VTY-----
A9CKF5_AGRT5/29-116AVVVRINDR--GPF............-----...IKGRVLDLS-KAAAKNIGMI.........SS.GT.AK.VCY-----
EXPA4_ORYSJ/59-144SITVTATNF--CPPNYGLPS..DDGG-----WCNPPRPHFDMA-EPAFLHIAQY.........RA.GI.VP.VSF-----
Q9X5U4_STRLA/36-135TIRVPVRDK--CPS............-----...CDRTHIDLS-RTAFQKLAPL.........DR.GV.VNGITW-----
EXP24_ARATH/125-208SIKITATNF--CPPDFTKP....NDN-----WCNPPQKHFDLS-QPMFLKIAKY.........KA.GV.VP.VKF-----
Q7X9Q2_SAMNI/65-153SVTITATNF--CPPNFDLPS..NAGG-----WCNPPRQHFDMA-QPAWEKIGIY.........RG.GI.IP.VIY-----
Q87VW3_PSESM/103-193TVILRVNDR--GPF............-----...YSDRIIDLS-YAAAKKLGYA.........ES.GT.AR.VKV-----
RLPA_SYNY3/227-317SVVVRINDR--GPF............-----...TGGRVIDLS-AGAARAIGIH.........SS.GV.GN.VAL-----
EXPB4_ORYSJ/92-171SETVIITDM--NYY............-----..PVAPFHFDLS-GTAFGRLAKPGLN..DKLRHS.GI.ID.IEF-----
YDJM_BACSU/30-121VITVYKNDV--GR.............-----...MPNAVLDVS-PKAFKALGYP........LSK.GK.VA.GHY-----
RLPA_CAMJE/77-167QVTVRVNDR--GPF............-----...VNNRIIDLS-KGAASQIDMI.........AS.GT.AP.VRL-----
Q87C59_XYLFT/126-216SVVVRVNDR--GPF............-----...HDDRLIDLS-YAAAVKLGFT.........EN.GL.AN.VEV-----
EXP30_ORYSJ/72-160AITVTATNL--CPPNWAEDPDRGGGG-----WCNPPRAHFDLS-KPAFMRMADW.........RA.GI.VP.VMY-----
Q7V582_PROMM/105-195SAVVTINDR--GPF............-----...IAHRVIDLA-HGAAHELGLI.........SS.GI.AQ.VRL-----
EXPA5_ARATH/73-151SIVVTATNF--CPPGG..........-----ACDPPNHHFDLS-QPIYEKIALY.........KS.GI.IP.VMY-----
Q89QY0_BRAJA/43-149KVIVKINDV--GPL............-----...RPGRIIDLN-ERTMRHFDPS........LEL.GV.IPDVTV-----
Y3177_SYNY3/1-87SVVVTVSDR--CNC............-----.......SIDLS-RSAFQQIANP.........RK.GR.VP.VSI-----
Q8F9X6_LEPIN/103-193EVIVRVNDR--GPF............-----...VKDRIIDLS-EKAADTLDFK.........DV.GI.AK.VGI-----
Q89G77_BRAJA/82-168FVTVRVNDR--GPY............-----...VRGRVVDIS-PSAAEALGMV.........DK.GI.AN.VRL-----
Q7MN13_VIBVY/80-170STIVRVNDR--GPF............-----...HEGRIIDLS-YAAAYKLDVL.........KT.GT.AN.VEI-----
Q84V44_9BRYO/67-150SITVTATNY--CPQGSDG.......G-----WCDSPKQHFDLS-HPMFTSLAQE.........VG.GV.IP.VTY-----
Q7U4N9_SYNPX/113-203SAVIRINDR--GPF............-----...VDHRVIDLG-HGAASTLGLI.........SS.GI.AQ.VKL-----
Q8LBG2_ARATH/66-146AVTVIITDE--CPGC...........-----..SKTSTHFDLS-GAVFGRLAIAGES..GPLRNR.GL.IP.VIY-----
Q94KT0_MAIZE/117-199PVTIVITDQ--SPGGL..........-----.FPGEVEHFDMS-GTAMGAMARPGMA..DKLRAG.GV.LR.ILY-----
Q84V41_9BRYO/70-157GTNVVVTDF--CPGGT..........-----YCSTGENAFDMS-GAAINAMALRGRE..GQLRNR.GL.YN.LLY-----
Q39802_SOYBN/84-165PVKVVITDE--CAGC...........-----.GSDAQYHFDLS-GNAFGAMAISGQD..ENLRNA.GK.IN.IQH-----
Q9ZTG7_SOLLC/19-103VIIVTATNL--CPPNSKKT....NDD-----WCNPPQKHFDLT-MPMFIKIAEQ.........TA.GV.VP.VVY-----
Q7NPV8_CHRVO/99-189SVVVRVNDC--GPF............-----...HKKRLMDLS-YAAAYKLGFV.........QQ.GS.AK.IAI-----
RLPA_AQUAE/129-219KVIVKVVDR--GPY............-----...VRGRHLDLS-YAAAKKLGMI.........RD.GV.IP.FEA-----
RLPA_NOSS1/274-366SVVVRINDR--GPF............-----...TRGRVIDLS-TGAARVLGMI.........GS.GV.AP.VRI-----
Q8LC65_ARATH/58-137GTIVMITDL--NK.............-----...SNQTDLVLS-SRAFRAMAKPIVGADKDLLKQ.GI.VD.IEY-----
Q87AG9_XYLFT/395-464STTVYVTDL--YPT............-----...GSSGGLDLS-PNAFASIGNM.........AQ.GR.IP.VQW-----
Q84L77_PYRCO/65-150SIVVTATNF--CPPNNALPN..NAGG-----WCNPPQHHFDLS-QPVFQHIAQY.........KA.GV.VP.VSY-----
MPAL1_LOLPR/78-157AVTVTITDD--NEE............-----..PIAPYHFDLS-GHAFGSMAKKGEE..QNVRSA.GE.LE.LQF-----
EXLA3_ORYSJ/71-148GVRVVLTDF--HR.............-----...SNSTDFLLG-GPAFAGLAKPGMA..HKLKKL.DA.LS.VEY-----
Q9ZR84_WHEAT/77-158PRRIVITDM--NYY............-----..PVARYHLDLS-GTAFGSMAKYGLN..DRLRHA.GI.ID.MQF-----
Q8DLZ3_THEEB/217-307SVVVRINDR--GPF............-----...TGGREIDLS-RGAAAAIGLI.........GA.GV.GY.VRI-----
EXLA2_ORYSJ/68-146GAKVVVTDE--ARS............-----...TNRTDLVLS-AAAYAAMARPGMA..AQLRTR.RA.VD.VEY-----
Q7XJA2_9BRYO/67-149SAIITATNF--CPTGSNG.......G-----WCNPPKQHFDLA-QPVFSKIART.........VG.GV.IP.INY-----
Q7U7N8_SYNPX/60-150SVVVRINDR--GPF............-----...RYHRVIDLA-HGAARELRMM.........RA.GE.IP.VRL-----
Q8LKJ9_GOSHI/67-151GVTITATNF--CPSNNNG.......G-----WCNPPHHHFDMS-LPAFLRIARH.........GDEGI.VP.VLY-----
Q9FY28_FESPR/60-147SITVSATNL--CPPNYDLPN..DNGG-----WCNPPRPHFDMS-QPAWEKIGIY.........RA.GI.IP.IVY-----
Q7VKA6_HAEDU/76-166SVIVRVNDR--GPY............-----...YGSRIVDLS-KAAAIELGMK.........RA.GL.AK.VKL-----
RLPA_NEIMA/59-149SVIVRVNDR--GPF............-----...HGNRIIDVS-KAAAQKLGFV.........NQ.GT.AH.VKI-----
Q9FRU8_ATRLE/80-160PVTVTITDE--CPGC...........-----..PSDKPHFDLS-GTAFGAMAKSGQA..EQLRNA.GV.LD.IQY-----
Q82T62_NITEU/105-195SAVVRINDR--GPF............-----...LENRLIDLS-YVAAYKLGVL.........AN.GS.AR.VEV-----
EXP10_ORYSJ/67-153SIVVTATNF--CAPNFGLPA..DAGG-----VCNPPNHHFLLP-IQSFEKIALW.........KA.GV.MP.IQY-----
RLPA_TREPA/27-117KVIVRINDR--GPY............-----...AANREIDVS-KAAAVALDML.........NA.GV.AR.VSI-----
Q93MF1_AMYMD/34-132TITVPVVDK--CPS............-----...CDSAHIDLS-APAFAQLADP.........GL.GN.IP.VTW-----
YOAJ_BACSU/58-127KTTVYVTDL--YPE............-----...GARGALDLS-PNAFRKIGNM.........KD.GK.IN.IKW-----
Q98DT8_RHILO/32-119SVIVRINDR--GPF............-----...IRGRVLDLS-KGAAGQLGFI.........GS.GH.TS.VCM-----
EXPB2_ARATH/83-163PVTVVITDE--CPGC...........-----..VKESVHFDLS-GTAFGAMAISGQD..SQLRNV.GE.LQ.ILY-----
EXPB5_ARATH/70-149PIKVMISDE--CPGC...........-----..TKESVHFDLS-GKAFGALAKRGKG..DQLRNL.GE.LK.VSY-----
MPAC1_CYNDA/56-135PVLVKITDK--NYE............-----..HIAAYHFDLS-GKAFGAMAKKGQE..DKLRKA.GE.LT.LQF-----
O65013_PINRA/74-152GVKVVVTGM--SI.............-----...DDRTDFYVY-SPTFLSLARPNKS..EQLLNR.GAGLD.VEY-----
Q8FXW2_BRUSU/28-115SLVVRINDR--GPF............-----...IKGRVLDLS-KGAASRLGFI.........GA.GH.TK.VCF-----
Q84V62_HEDHE/26-102TVDVKVVDF--CRE............-----...PCNGDLNLS-RDAFRVIANT.........DA.GN.IR.VVY-----
Q9FYS9_STRAF/22-113SIFITATNH--CPPNYGLSS..DYRG-----WCNPPKPHFHLA-MPMFLQLASY.........KKMEI.VP.VQY-----
Q84V43_9BRYO/66-153SIVVTATNL--CPPGSHG.......G-----WCAW.RPHFDLP-MPAFTSLAKQ.........VG.GV.AP.VFY-----
EXP18_ARATH/66-152ATVVTATNI--CPPNYGQAS..NNGG-----WCNPPRVHFDLT-KPAFMKIANW.........KA.GI.IP.VSY-----
Q89LM2_BRAJA/151-241SLIVRVNDR--GPY............-----...HGNRLIDVS-NKAAELLEFK.........GN.GV.AK.VRV-----
Q9A7A1_CAUCR/66-156KMILRVNDR--GPF............-----...VGDRIIDLS-KAAADELGYR.........RQ.GV.AR.VRV-----
Q9AXE4_TOBAC/81-163PITVTITDE--CPATC..........-----.GDGAPFHFDLS-GTAFGALAKPGQA..DLFRGA.GI.LN.ITY-----
RLPA_YERPE/75-165QIVVRVNDR--GPY............-----...TPGRVIDLS-RAAADRLNIS.........NN.TK.VK.IDF-----
EXP12_ARATH/62-146AVTVTATNF--CPTNNNN.......G-----WCNLPRHHFDMS-SPAFFRIARR.........GNEGI.VP.VFY-----
Q7W015_BORPE/84-174TVIVRVNDR--GPF............-----...HSDRIMDLS-YVAAHKLGII.........GP.GS.GP.VTV-----
EXPA8_ORYSJ/60-147SITVTATNF--CPPNYALSG..DAGG-----WCNPPRRHFDMS-QPAWETIAVY.........RA.GI.VP.VNY-----
Q84V42_9BRYO/73-155GTRIVITDL--CPGGQ..........-----YCSTDQPAFDFS-GAAITAMALPGRD..GELRNI.GL.YD.IQY-----
O67382_AQUAE/55-145FTVVRINDR--GPY............-----...VDGRIIDLS-MAAADEIGML.........KK.GV.AK.VLV-----
Q7XJA1_9BRYO/86-171SVVVTATNF--CPPNPGQSA..NNGG-----WCNPPNEHFDLS-YPAFVKIADP.........KA.GA.VP.LQY-----
RLPA_ECOLI/78-166MIVVRINDR--GPY............-----...GNDRVISLS-RAAADRLNTS.........NN....TK.VRI-----
EXPB1_ARATH/76-159AVTIIATDQ--SPSGP..........-----SAKAKHTHFDLS-GAAFGHMAIPGHN..GVIRNR.GL.LN.ILY-----
Q8LG16_ARATH/61-149SVVITATNF--CPPNFALPN..NNGG-----WCNPPLKHFDMA-QPAWEKIGIY.........RG.GI.VP.VVF-----
RLPA_HAEIN/69-159KVIVRINDR--GPF............-----...SDKRLIDLS-HAAAKEIGLI.........SR.GI.GQ.VRI-----
Q97TP0_CLOAB/118-201STSVRILDR--GPY............-----...VSGRILDMS-QESFSKVANT.........DD.G.....VFY-----
Q8G0U5_BRUSU/105-195SVIVRVNDR--GPY............-----...EYDRVIDLS-WKAAEMLDYQ.........HH.GT.AN.VKV-----
EXP20_ARATH/65-152SVVVTATDF--CPPNSGLSS..DYGG-----WCNFPKEHLELS-HAAFTGIAET.........RA.EM.IP.IQY-----
Q9SWD3_9CARY/17-94AIVVTATNF--CPPGG..........-----CCSSPLRHFDLS-QPVFQQIAKY.........RA.GI.VP.VVY-----
Q89X70_BRAJA/74-161SVIVTINDR--GPF............-----...IRGRVLDLS-TGAARAIGLT.........GA.GV.GR.VTA-----
Q94KT1_MAIZE/22-101AETVIITDM--NYY............-----..PVAPYHFDLS-GTAFGAMAKDEHN..DELRHA.GI.ID.IQF-----
EXPB2_ORYSJ/68-147PRTVIITDM--NYY............-----..PVARYHFDLS-GTAFGAMARPGLN..DQLRHA.GI.ID.IQF-----
Q9SDZ3_9MONI/63-148TVEVTATNF--CPPNWAEAS..DNGG-----WCNPPRKHFDMA-QPAFEQIAKY.........RG.GI.VP.VKY-----
Q7NLH5_GLOVI/257-347QVTVKVQDR--GPF............-----...IRGRVIDLS-PRAAQLLGMV.........SS.GL.AR.VKV-----
Q84L47_MIRJA/44-123GTTIVVTDL--HPD............-----..TKNASDFVLS-NRAFRSMAWPGKD..VQVLQL.GI.AD.VEY-----
Q7N763_PHOLL/72-162MMIVRVNDR--GPY............-----...KPGRIIDLS-KASAERLNLT.........QS.TK.VK.VDF-----
EXPB5_ORYSJ/81-163PVTVVITDS--CPGGV..........-----.CLNEAAHFDMS-GTAFGAMANRGMG..DRLRSA.GV.LK.IQY-----
Q7M7V1_WOLSU/75-165STIVRINDR--GPF............-----...VEGRIIDLS-NTAAKEIDMV.........TK.GT.AP.VVV-----
EXP17_ARATH/63-151SITITATNF--CPPNFAQAS..DNGG-----WCNPPRPHFDMA-QPAFLTIAKY.........KA.GI.VP.ILY-----
Q7XHJ2_QUERO/61-138GTIVTVTDL--NR.............-----...NNQTDFVVS-SRAFMAMAQKGMG..QDILKL.GI.VD.VEY-----
Q7XJA5_MARPO/33-124SIKITATNQ--CPPNFDRPT..DNGG-----WCNPPRTHFDLS-LNMFRRLAQT.........QA.GI.IP.ISY-----
Q9FY31_FESPR/62-149IVTVTATNL--CPADYSKPN..NNGG-----WCNPPRKHMDMA-QPAWEKIGVY.........RA.GI.IP.MKY-----
Q84L40_MIRJA/67-154SVTITATNF--CPPNYALSS..DNGG-----WCNPPRQHFDMA-EPAFLQLAQY.........KA.GI.IP.VNY-----
EXPA7_ARATH/72-157STVVTATNL--CPPNWYQDS..NAGG-----WCNPPRTHFDMA-KPAFMKLAYW.........RA.GI.IP.VAY-----
Q9HVT6_PSEAE/31-121SVVVRINDR--GPF............-----...RRGRIIDVS-RKAAEGLGMI.........RS.GV.AP.VRI-----
Q8LAT2_ARATH/75-161SIILTATNF--CAPNYGFDP..DGGG-----HCNPPNKHFVLP-IEAFEKIAIW.........KA.GN.MP.VQY-----
Q8H6F7_MUSAC/60-147HITVTATNY--CPPNYDLPS..DNGG-----WCNPPRQHFDMS-QPAWETIAVY.........RG.GI.VP.VYY-----
Q8P513_XANCP/417-486TTTVYVTDL--YPE............-----...GASGGLDLS-HNAFAAIGDM.........VQ.GR.IP.ISW-----
Q8XUC4_RALSO/94-184VVVAKVTDR--GPY............-----...HGKRIIDLS-YAAAKRLDFV.........RR.GS.TQ.VEI-----
Q949I4_FESPR/69-150AKTVVITDI--NDG............-----..PMAKYHFDLS-GTAFGAMALPGRN..AQLRRA.GK.IS.IQF-----
Q7PBP9_RICSI/166-259AVILMVNDR--GPF............-----...KKNRIIDVS-QRAAEILAFK.........NQ.GI.TK.VKI-----
A9NCT5_COXBR/71-161SVVVKINDR--GPF............-----...APHRILDLS-YAAAKKLGYV.........NR.GT.AL.VEV-----
Q7S4C4_NEUCR/73-147SVTVTLVDR--CTQ............-----...CPYGGLDLS-PAAFSVLAST.........SV.GV.VQ.GSW-----
Q9P8A6_AGABI/167-239KVVVTIADA--CPT............-----..CKNKNSIDLS-VRAFERIATK.........DE.GE.VP.ITW-----
Q84L49_MIRJA/65-150SITVTATNF--CPPNYALAS..TNGG-----WCNPPLQHFDMA-QPAFLQIAKY.........RA.GI.VP.VSF-----
Q8S347_CAPAN/59-136IITVTATNF--CPPGG..........-----WCDPPNHHFDLS-QPIFLRIAQY.........RA.GI.VP.VAY-----
EGC1_ARATH/45-121SVKVKIVDH--CPS............-----...GCASTLDLS-REAFAQIANP.........VA.GI.IN.IDY-----
Q8KA94_CHLTE/70-164SIIVRVNDR--GPF............-----...VDGRVIDLS-AAAAKALGFY.........GK.GT.AR.VKI-----
Q9AF65_CLAMS/559-624TVRVQIVDQ--CHE............-----...CEIGHLDLS-EEAFRAIGDF.........DA.GI.IP.ISY-----
RLPA_PASMU/68-158KVIVRINDR--GPF............-----...VKGRIIDLS-RAAAREIGLI.........GS.GV.GH.VRV-----
Q8KAS8_CHLTE/66-156MVFVKINDR--GPY............-----...VKNRIIDLS-KAAAKQLDLV.........DS.GV.GR.VKI-----
Q8LGS7_9BRYO/73-158VITVTATNF--CPPNHKGDG...TPG-----WCNPPMRHFDLA-QPSFTKIAKY.........RA.GI.VP.VLF-----
Q89JS4_BRAJA/38-126SVQVTVTDR--GPF............-----...T.GAFLDLS-PAAASALGC..........RC.TH.RN.VTA-----
Q9AYR1_EUSER/33-120MITVTATNF--CPPNPSLPN..DDGG-----WCNPPRQHFDLA-EPAFLQIAQY.........RA.GI.VP.VEF-----
Q84V45_9BRYO/65-152TITITATNS--CPPGSHG.......G-----WCDW.KPHFDLP-MPAFMTLARR.........EG.GV.AP.VYY-----
EXPB9_ORYSJ/80-159PVTVFITDM--NYE............-----..PISAYHFDFS-GKAFGAMACPGKE..TELRKA.GI.ID.MQF-----
Q8EHQ2_SHEON/98-188QVIIRINDR--GPF............-----...HSERILDLS-YAAAYKLGML.........GT.GT.AR.IKL-----
EGC_CITJA/51-128SVLVKIVDL--CPA............-----...GCQATIDLS-QEAFSQIANP.........DA.GK.IK.IEF-----

PF07249

AL15_ASPFU/33-152TIYVTAIDA--APG------------------------GFNIA-TSAMDQLTNGMAV------EL-GR-VQ.ATYEEADP
SNP1_PHANO/17-136TIYVLAVDH--AGD------------------------GFNIA-KQAMDQLTNGQAA------GL-GR-ID.ANYQQVAT
Q8J0U4_LEPMC/20-136SIFVVAIDS--SST------------------------GFNIG-LTAMNELTNNQAT------SL-GR-IE.AEVTNASP
CEPL_CERFI/1-119SIFIRGVDS--GRG------------------------GFNVN-PTAFTKLVG..ST------EA-GR-VDNVNYVQVDL
Q9C2Q5_NEUCS/19-138TINILAIDH--AGA------------------------GVNLS-KKAMNELTGGNAE------QF-GR-VD.AQVQQVAL

PF02015

GUN1_USTMA/26-235QNFDFQIPG--GGLGAFPKGCPAQWGVEASLWGDQYGGVKSATECSKLPKPLQEGCKWRFSEWGD-NPVLK.GSPKRVKC
GUN_PHACE/39-241TSSIWPFPG--GGVGIFTQGCHDQWTPRGAAGGDQYGGVYSVEQCSDLPEVLQPGCRFRF.EFLE-NVSNPQVSFQQVQC
GUNK_FUSOX/21-220NHFDLMMPG--GGVGIFD.GCTSEFGK..ALGGAQYGGISSRSECDSYPELLKDGCHWRF.DWFE-NADNPDFTFEQVQC
O93783_HUMGT/22-220NHFDIAMPG--GGVGIFN.ACTDQYGAPPNGWGQRYGGISQRHECDAFPEKLKPGCYWRF.DWCV-SLFPP.LSLSLPPG
GUN5_HYPJE/19-166SIIVMVTNL--CPNNGNAQWCPVVGG......TNQYGYSYH........FDIMAQNEIFG.....-DNVVV..DFEPIAC
GUN5_HUMIN/2-200NHFDLNIPG--GGVGIFD.GCTPQFG...GLPGQRYGGISSRNECDRFPDALKPGCYWRF.DWFK-NADNPSFSFRQVQC

PF06725

A9CKT8_AGRT5/283-360ARLMLALDT--GSA-------------------IVGPARGDIFTGSGFEAGELAGTV------RNEAD-FY-ILL-----
YUIC_BACSU/124-186YGLGVVADT--GSA-------------------IKGN.RLDLYFETVKDVYNEWG..------KKTLD-VY-VIK-----
YOCH_BACSU/226-287YGEATAADT--GGA-------------------IKGN.KIDVFVPSKSDASN.WG..------VKTVS-VK-VLN-----
MLTA_ECOLI/276-354LRLMVALDV--GGA-------------------IKGQ.HFDIYQGIGPEAGHRAGWY------NHYGR-VW-VLK-----
YABE_BACSU/376-437YGYAIAADT--GSA-------------------IKGN.KIDVFFPEKSSAYR.WG..------NKTVK-IK-ILN-----
MLTA_BUCAI/279-357MRLVIALDV--GGA-------------------IKGH.HFDIYEGIGTKASILSGYY------NHYGY-AW-ILN-----
Q46212_CLOPF/19-80YGYAIAADT--GGA-------------------IKGN.RVDLFFNTEAEASN.WG..------VRNLD-VY-ILN-----
Q55666_SYNY3/304-381SRFVVDQDT--GSA-------------------IKGPGRVDIFMGTGQTPGDRAGLM------SDDGQ-IY-YLL-----
Q87M89_VIBPA/271-349LRMLIVLDT--GGA-------------------VKQN.HLDLYHGIGARAGTEAGHY------KHFGR-VW-KLG-----
Q888J9_PSESM/307-380VRPVAAQDT--GGA-------------------IAGEVRADLFWGTGDEAGKLAGDM------KQKGN-IW-LLW-----
Q895T3_CLOTE/294-355YGYAIAADT--GTS-------------------VKGN.FIDVYFDTHKEACN.WG..------LKYVN-VY-IQN-----
Q899D7_CLOTE/307-368YGYAIAEDT--GGA-------------------IKGN.RIDVYLSSNSEANN.WG..------VKWVN-VY-ILK-----
Q89WN5_BRAJA/328-406HRLMIAQDT--GSA-------------------IIGPARADLYFGAGADAGRVSGRL------RHPMH-FV-MLV-----
Q8CVE1_LEPIN/289-361NRIVFVHDR--GSQ-------------------ITGHGRLDYFLGTGETAEYQAGKI------NTQGK-IF-LIL-----
Q8DK97_THEEB/307-387SRFVLDQDT--GSA-------------------IRGPGRVDIFMGTGDVAKARAGLI------NTPGQ-LY-YLL-----
Q8EM05_OCEIH/197-258YGYATAADI--GSA-------------------INGN.KIDLHVPTKEEANN.YG..------VQQVD-VT-IVE-----
Q8ENX7_OCEIH/134-196YGFGVVADK--GSA-------------------ITGN.KIDLYYHTVDDVYEQWG..------KKEVD-VY-VIE-----
Q8FY16_BRUSU/286-362ARLMIAQDT--GTA-------------------IVGPARGDLFTGSGDEADKIAGGI------KDEAD-FY-VLV-----
MLTA_BUCAP/287-365MHLLIALDV--GGV-------------------IKGQ.HFDVYQGIGEKAGKLAGFY------NHYGY-AW-VLK-----
Q8KYU5_9PROT/259-330NRLMIAQDT--GSA-------------------ITGPQRADVFFGTGSQAGVAAGLT------KDSGR-MI-LFL-----
Q8RDC9_THETN/277-338YGFCIAADT--GGA-------------------IKGN.RIDVYFPTREEVRN.WG..------RRYVK-VY-ILQ-----
Q8XHG6_CLOPE/274-335YGYAVAEDT--GGA-------------------IKNN.IIDLFLNSAPECKQ.WG..------RRNVN-LY-IIA-----
Q8XL13_CLOPE/344-405YGYAIASDT--GGV-------------------IKGN.IIDLYMNSHDECIS.WG..------RRQVT-LH-IVA-----
Q8XVF5_RALSO/295-369QKLVFAQDV--GSA-------------------IRGAVRADYYFGHGDAAGDLAGRM------KQAGR-LW-VLV-----
Q8Y4C8_LISMO/216-277YGQAIAADT--GGA-------------------IKGN.KIDVHLNSVQEANN.WG..------VKQVK-VQ-ILD-----
Q8YSZ6_NOSS1/326-407SRYVLDQDT--GNA-------------------IKGPGRVDYFMGTGKQAGDRAGVT------GGHGS-LY-YLL-----
Q8YZB5_NOSS1/314-395SRFVLDQDT--GSA-------------------IKGPGRVDYFLGYGDLAGDRAGIT------VTTGS-IY-YLL-----
Q92F81_LISIN/344-405YGEAIAGDT--GGV-------------------IKGN.IVDVYFPNESQCYS.WG..------RRMVT-VK-VLN-----
Q92TE5_RHIME/280-357GRLMLALDT--GSA-------------------IVGPARGDIFTGSGDQAGELAGCV------RNDAE-FF-IFV-----
Q97ES4_CLOAB/290-351YGYAVADDT--GGD-------------------IIGN.RIDLFFSSKQDALN.WG..------RRTVT-VH-ILN-----
Q97EW8_CLOAB/316-377YGYGVAEDT--GGA-------------------IKGN.RLDLFFTSERECYD.WG..------AKNVT-VY-ILK-----
Q97HG6_CLOAB/546-621NGWYTAHDT--GGA-------------------IKGN.HIDLFMGFGGAEDT.....------ARCDN-FG-TVN-----
Q98DU5_RHILO/281-357RRLMIAQDT--GSA-------------------ITGPARGDLFAGSGDAAGEIAGVV------RNAAD-FY-ALV-----
Q9A226_CAUCR/315-392RRAVTALDT--GGA-------------------IKGEVRADLYMGSGAVAGVEAGRV------RHTLR-LY-RLT-----
Q9CEB6_LACLA/273-334YGIAIAGDT--GGA-------------------IIGN.IIDVHFPTNDQAIA.WG..------RKNIQ-IT-VLS-----
Q9CMA6_PASMU/296-374MHLMVALDV--GGA-------------------VKGH.HFDLYRGIGDDAGHIAGLS------KHYGR-VW-VLQ-----
Q9EZ95_ZYMMB/374-450NGLWIAQDK--GGA-------------------IKGANRFDSYWGYGDKAEHIAGGL------ASHGS-AW-LLL-----
Q9JPH9_NEIME/357-431NRLIMAQDT--GSA-------------------IKGAVRVDYFWGYGDEAGELAGKQ------KTTGY-VW-QLL-----
Q9K7F7_BACHD/143-205YGYGVVTDT--GSA-------------------IKGN.KIDLYYETVEDVFNQWG..------RKEVE-VY-IVE-----
Q9K7N9_BACHD/250-311YGEAVAADV--GGS-------------------IQGN.KIDLHMATKEDAIN.FG..------RQNVT-VT-ILD-----
Q9KGK6_BACHD/355-416YGTAIAGDT--GGA-------------------IVGN.KIDVHMPSTAEAQR.WG..------RKTVK-VT-ILD-----

PF00967

Q84565_PBCV1/23-145-----------
Q41802_MAIZE/27-145-----------
HEVL_ARATH/73-191-----------
O03994_SOLLC/68-186-----------
Q41360_SAMNI/20-138-----------
BARW_HORVU/2-123-----------
PR4A_TOBAC/27-145-----------
HEVE_HEVBR/69-187-----------

PF03330

O51677_BORBU/31-121-----------
EXP27_ORYSJ/62-150-----------
EXPA2_ARATH/67-152-----------
EXPA3_ORYSJ/63-151-----------
Q9ZP38_TOBAC/65-153-----------
Q9FY30_FESPR/64-150-----------
EXB10_ORYSJ/78-157-----------
RLPA_HELPY/115-205-----------
EXLB1_ARATH/62-139-----------
Q87WR7_PSESM/28-118-----------
Q9FY29_FESPR/64-151-----------
A9CKF5_AGRT5/29-116-----------
EXPA4_ORYSJ/59-144-----------
Q9X5U4_STRLA/36-135-----------
EXP24_ARATH/125-208-----------
Q7X9Q2_SAMNI/65-153-----------
Q87VW3_PSESM/103-193-----------
RLPA_SYNY3/227-317-----------
EXPB4_ORYSJ/92-171-----------
YDJM_BACSU/30-121-----------
RLPA_CAMJE/77-167-----------
Q87C59_XYLFT/126-216-----------
EXP30_ORYSJ/72-160-----------
Q7V582_PROMM/105-195-----------
EXPA5_ARATH/73-151-----------
Q89QY0_BRAJA/43-149-----------
Y3177_SYNY3/1-87-----------
Q8F9X6_LEPIN/103-193-----------
Q89G77_BRAJA/82-168-----------
Q7MN13_VIBVY/80-170-----------
Q84V44_9BRYO/67-150-----------
Q7U4N9_SYNPX/113-203-----------
Q8LBG2_ARATH/66-146-----------
Q94KT0_MAIZE/117-199-----------
Q84V41_9BRYO/70-157-----------
Q39802_SOYBN/84-165-----------
Q9ZTG7_SOLLC/19-103-----------
Q7NPV8_CHRVO/99-189-----------
RLPA_AQUAE/129-219-----------
RLPA_NOSS1/274-366-----------
Q8LC65_ARATH/58-137-----------
Q87AG9_XYLFT/395-464-----------
Q84L77_PYRCO/65-150-----------
MPAL1_LOLPR/78-157-----------
EXLA3_ORYSJ/71-148-----------
Q9ZR84_WHEAT/77-158-----------
Q8DLZ3_THEEB/217-307-----------
EXLA2_ORYSJ/68-146-----------
Q7XJA2_9BRYO/67-149-----------
Q7U7N8_SYNPX/60-150-----------
Q8LKJ9_GOSHI/67-151-----------
Q9FY28_FESPR/60-147-----------
Q7VKA6_HAEDU/76-166-----------
RLPA_NEIMA/59-149-----------
Q9FRU8_ATRLE/80-160-----------
Q82T62_NITEU/105-195-----------
EXP10_ORYSJ/67-153-----------
RLPA_TREPA/27-117-----------
Q93MF1_AMYMD/34-132-----------
YOAJ_BACSU/58-127-----------
Q98DT8_RHILO/32-119-----------
EXPB2_ARATH/83-163-----------
EXPB5_ARATH/70-149-----------
MPAC1_CYNDA/56-135-----------
O65013_PINRA/74-152-----------
Q8FXW2_BRUSU/28-115-----------
Q84V62_HEDHE/26-102-----------
Q9FYS9_STRAF/22-113-----------
Q84V43_9BRYO/66-153-----------
EXP18_ARATH/66-152-----------
Q89LM2_BRAJA/151-241-----------
Q9A7A1_CAUCR/66-156-----------
Q9AXE4_TOBAC/81-163-----------
RLPA_YERPE/75-165-----------
EXP12_ARATH/62-146-----------
Q7W015_BORPE/84-174-----------
EXPA8_ORYSJ/60-147-----------
Q84V42_9BRYO/73-155-----------
O67382_AQUAE/55-145-----------
Q7XJA1_9BRYO/86-171-----------
RLPA_ECOLI/78-166-----------
EXPB1_ARATH/76-159-----------
Q8LG16_ARATH/61-149-----------
RLPA_HAEIN/69-159-----------
Q97TP0_CLOAB/118-201-----------
Q8G0U5_BRUSU/105-195-----------
EXP20_ARATH/65-152-----------
Q9SWD3_9CARY/17-94-----------
Q89X70_BRAJA/74-161-----------
Q94KT1_MAIZE/22-101-----------
EXPB2_ORYSJ/68-147-----------
Q9SDZ3_9MONI/63-148-----------
Q7NLH5_GLOVI/257-347-----------
Q84L47_MIRJA/44-123-----------
Q7N763_PHOLL/72-162-----------
EXPB5_ORYSJ/81-163-----------
Q7M7V1_WOLSU/75-165-----------
EXP17_ARATH/63-151-----------
Q7XHJ2_QUERO/61-138-----------
Q7XJA5_MARPO/33-124-----------
Q9FY31_FESPR/62-149-----------
Q84L40_MIRJA/67-154-----------
EXPA7_ARATH/72-157-----------
Q9HVT6_PSEAE/31-121-----------
Q8LAT2_ARATH/75-161-----------
Q8H6F7_MUSAC/60-147-----------
Q8P513_XANCP/417-486-----------
Q8XUC4_RALSO/94-184-----------
Q949I4_FESPR/69-150-----------
Q7PBP9_RICSI/166-259-----------
A9NCT5_COXBR/71-161-----------
Q7S4C4_NEUCR/73-147-----------
Q9P8A6_AGABI/167-239-----------
Q84L49_MIRJA/65-150-----------
Q8S347_CAPAN/59-136-----------
EGC1_ARATH/45-121-----------
Q8KA94_CHLTE/70-164-----------
Q9AF65_CLAMS/559-624-----------
RLPA_PASMU/68-158-----------
Q8KAS8_CHLTE/66-156-----------
Q8LGS7_9BRYO/73-158-----------
Q89JS4_BRAJA/38-126-----------
Q9AYR1_EUSER/33-120-----------
Q84V45_9BRYO/65-152-----------
EXPB9_ORYSJ/80-159-----------
Q8EHQ2_SHEON/98-188-----------
EGC_CITJA/51-128-----------

PF07249

AL15_ASPFU/33-152SHCASGV----
SNP1_PHANO/17-136SNC..GL----
Q8J0U4_LEPMC/20-136SDC..RM----
CEPL_CERFI/1-119SNCINGA----
Q9C2Q5_NEUCS/19-138SAC..GL----

PF02015

GUN1_USTMA/26-235PKSLIDRSGCQ
GUN_PHACE/39-241PAEIVAISNCA
GUNK_FUSOX/21-220PKALLDISGCK
O93783_HUMGT/22-220TGQTMGRS.CV
GUN5_HYPJE/19-166PGQAASDWGTC
GUN5_HUMIN/2-200PAELVARTGCR

PF06725

A9CKT8_AGRT5/283-360-----------
YUIC_BACSU/124-186-----------
YOCH_BACSU/226-287-----------
MLTA_ECOLI/276-354-----------
YABE_BACSU/376-437-----------
MLTA_BUCAI/279-357-----------
Q46212_CLOPF/19-80-----------
Q55666_SYNY3/304-381-----------
Q87M89_VIBPA/271-349-----------
Q888J9_PSESM/307-380-----------
Q895T3_CLOTE/294-355-----------
Q899D7_CLOTE/307-368-----------
Q89WN5_BRAJA/328-406-----------
Q8CVE1_LEPIN/289-361-----------
Q8DK97_THEEB/307-387-----------
Q8EM05_OCEIH/197-258-----------
Q8ENX7_OCEIH/134-196-----------
Q8FY16_BRUSU/286-362-----------
MLTA_BUCAP/287-365-----------
Q8KYU5_9PROT/259-330-----------
Q8RDC9_THETN/277-338-----------
Q8XHG6_CLOPE/274-335-----------
Q8XL13_CLOPE/344-405-----------
Q8XVF5_RALSO/295-369-----------
Q8Y4C8_LISMO/216-277-----------
Q8YSZ6_NOSS1/326-407-----------
Q8YZB5_NOSS1/314-395-----------
Q92F81_LISIN/344-405-----------
Q92TE5_RHIME/280-357-----------
Q97ES4_CLOAB/290-351-----------
Q97EW8_CLOAB/316-377-----------
Q97HG6_CLOAB/546-621-----------
Q98DU5_RHILO/281-357-----------
Q9A226_CAUCR/315-392-----------
Q9CEB6_LACLA/273-334-----------
Q9CMA6_PASMU/296-374-----------
Q9EZ95_ZYMMB/374-450-----------
Q9JPH9_NEIME/357-431-----------
Q9K7F7_BACHD/143-205-----------
Q9K7N9_BACHD/250-311-----------
Q9KGK6_BACHD/355-416-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window