Sequence alignment for CL0201

PF04586

Q8XLC1_CLOPE/14-176----------------------------SDLITRTLE...DTEE..KVISG--------------------YINKFNTLS
Q830G5_ENTFA/12-173----------------------------TNLKTRSEE...DSQT..QIVTG--------------------YAAVFNSPT
Q81Z10_BACAN/15-178----------------------------QKIEIREDD....NGN..RTLIG--------------------YAVKWEKKS
Q81XX9_BACAN/12-175----------------------------SALEIRELE....NGL..RTISG--------------------YAVKWEMKS
Q8DXJ7_STRA5/5-163----------------------------KTFVVKSVEDESADFH....FEA--------------------YASTYDNTD
Q813K0_BACCR/5-168----------------------------EEVKRMKIEVRGNQVI....LDG--------------------YVNVVDRES
Q88MK5_PSEPK/15-174----------------------------FDYDVKAVGDDGL.......FSG--------------------YGSVFGVVD
Q6N8L6_RHOPA/13-166----------------------------SPAPLPARLSLAEDGS....IDG--------------------YASLFGEID
Q8XYS5_RALSO/12-178----------------------------QLCELRSSE...AGAESVPTIYG--------------------YAAVFNTRS
Q6NK35_CORDI/146-313----------------------------KSYDVSIDETQTEGT.....ITA--------------------YASVFGNVD
Q2G1W7_STAA8/11-173----------------------------..IEVRSND...NNE...MVIEG--------------------YALKFDTWS
Q9CGQ7_LACLA/14-175----------------------------.SLDLNAND...EAAE..KIISG--------------------YFIVFNSET
Q9CI95_LACLA/13-174----------------------------.ELETRSPT..NTGFI..GQIAG--------------------YAIKFNTPS
Q9ZXB1_BPPHC/15-176----------------------------..LEERASD...DGRI...SMRG--------------------YAYRFNELS

PF00716

SCAF_VZVD/28-373ELNITPEIVRSALPPTS........KIPINIDHRKDCVVGEVIAIIEDIRGPFFLGIVRCPQLHAVLFEAAHSNFFGNRD
SCAF_HHV11/37-365ELALDPDTVRAALPPDN........PLPINVDHRAGCEVGRVLAVVDDPRGPFFVGLIACVQLERVLETAASAAIFERRG
SCAF_EBVB9/24-327CLHLDPLTVKSQLPLKK........PLPLTVEHLPDAPVGSVFGLYQSRAGLFSAASITSGDFLSLLDSIYHDCDIAQSQ
SCAF_EHV2/58-381ALYLNPADVGAHLPLPG........PIPLNVEHLQEAHVGWTLGLHLTRYGLFCVAVITAEEFFTLLDRLCAASSVARTR
SCAF_HCMVM/31-414ELLLPRDVVEHWLHAQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRG

PF14550

D4MX42_ANAHA/23-149----------------------------NRVDITKKD.EEKQYV---------------------------FGWAKIAVD
Q08QA7_STIAD/309-425----------------------------..PLLKGVEPDDERYV---------------------------LG...VVLE
D4LIB0_9FIRM/21-145----------------------------..FKVQKVD.EDKRLV---------------------------FGWANVSVD
B0VGF6_CLOAI/86-209----------------------------NSSKFKSETSGTQGRL---------------------------YV...TLME
L0AM66_NATGS/15-132----------------------------DVEFVSKND..DEQIA---------------------------TG...IVMV
E3E570_PAEPS/39-161----------------------------QVRLITKTD.DPKQLV---------------------------YG...VVYE
A8FGQ7_BACP2/40-155----------------------------EVSVLTKAE.DAHRLV---------------------------YG...VVYE
R7DEN0_9FIRM/81-194----------------------------....IVKAD.EDKHYV---------------------------TG...IVYE
N0AUF1_9BACI/41-158----------------------------EVKIIMKSE.DEQQLV---------------------------YG...VVYE
XKDF_BACSU/39-157----------------------------KVRLFTKSEQDEQKLV---------------------------YG...IVYE
C4ZCA6_AGARV/27-152----------------------------.RFKIAKSD.DDKHLA---------------------------FGWANVAIR
YQBD_BACSU/39-156----------------------------EVRILAKEA.DEQKLV---------------------------YG...IVYE
H1XPV5_9BACT/40-158----------------------------TVP.ILKVD.AEKRMV---------------------------YG...IVYA
D3DZY3_METRM/3-133----------------------------NILEVVTKS.RDSLLI---------------------------TA...PVLI
A0RNP3_CAMFF/39-157----------------------------SVK.IAKND.TEKGIV---------------------------YG...IVYS
R6JHS6_9CLOT/36-161----------------------------.RFKIHKSD.DDEMLA---------------------------FGWANVAIT
K8ESL9_CARML/40-156----------------------------TVRTITKAD.DPQKLV---------------------------YG...VVYE

PF03420

Q6WHE3_BPKVM/5-184---LLIEDWGVSSYATAETGE....KPLVEAKMPAEKGGD......LYIEG--------------------IFMQSNVVN
PCPP_BPT4/6-190---LLIETWG.......QPGEIIDGVPMLE....SHDGKDLGLKPGLYIEG--------------------IFMQAEVVN

PF04586

Q8XLC1_CLOPE/14-176QYLG.....FFEEVLPGAFDKTLADGH----N....IY-----AMYNHNSDMILGSTKSGSLKLNTDEV--GLHFELKI.
Q830G5_ENTFA/12-173ELWE....GLNEVIKPGAFSRALSN.S----D....VR-----CLFDHDWGKVLGRTRSGTLKLEEDDK--GLRFEVEL.
Q81Z10_BACAN/15-178VVMGYY.RKFREQFKNGAFTETLQN.D----D....QR-----FLWSHDTSKVLGRTKNNTLRLNEDAV--GLRFELDL.
Q81XX9_BACAN/12-175VTMGYW.QRFKEQFKKGAFTESLTQ.D----D....QL-----ALWSHDTSQVLGRTKNGTLRLFEDEI--GLRFELDL.
Q8DXJ7_STRA5/5-163R........EGDVMAKGCFDNTLKSKA----V....VP-----MCLNHDRNCVIGKH.....ELSVDEK--GLRTRSTF.
Q813K0_BACCR/5-168RMLPSPRGYFKERIVPKTFEKALKKAK----N....VD-----LLFNHDKNRNLGSIENGNLELYEDNI--GLRAIATV.
Q88MK5_PSEPK/15-174S........YNEVVAPGAFLESIAEAK----AKGRTFP-----VLWQHRTGEPIGSWNIE..SLKEDDR--GLFGEGGLW
Q6N8L6_RHOPA/13-166Q........ARDMVMPGAFTQTLKQRG----LR..KIP-----MLFQHDPAEPVGVWL....ELAEDLR--GLRARGRL.
Q8XYS5_RALSO/12-178ALIAG...LFVEEIMPGAFDGVLGD..----D....VR-----ALFNHDPNFVLGRTRSNTLQISVDSR--GLAYTVTP.
Q6NK35_CORDI/146-313S........YGDVVIPGAFEETLGEWQ----KSGNTIP-----LLYGHDFKDPFSNIGGVT.SAVEDAH--GLKITAQL.
Q2G1W7_STAA8/11-173ENLG....GFKETISRRALENTDLS..----D....VR-----CLVDHIPSQIIGRTKSGTLELETDDV--GLKYRCKL.
Q9CGQ7_LACLA/14-175ELYE....GCFEEISPESFDNVDLS..----D....VR-----ALIDHETSKVLGRTKSGTLTLSVDAK--GVYGEIKV.
Q9CI95_LACLA/13-174TAMA....PFIEYIAPIALDNVDLS..----D....VL-----ALYNHDYANVLGRVDAGTLKLSIDKV--GLHFVLDM.
Q9ZXB1_BPPHC/15-176HDLG....GFRERIVPGAGAPSLRQ.N----D....VY-----ATFNHDTRSLLGRTSSGTLRVGEDRE--GGWYEIDL.

PF00716

SCAF_VZVD/28-373S.VLSPLERALYLVTNYLPSVSLSSKR....LSPNEIP...DGNFFTHVALCVVGRRVGTVVNYDCTPE--SSIEPFRVL
SCAF_HHV11/37-365P.PLSREERLLYLITNYLPSVSLATKR....LGGEAHP...DRTLFAHVALCAIGRRLGTIVTYDTGLD--AAIAPFRHL
SCAF_EBVB9/24-327R.LPLPREPKVEALHAWLPSLSLASLH...PDIPQTTADGGKLSFFDHVSICALGRRRGTTAVYGTDLA--WVLKHFSDL
SCAF_EHV2/58-381ADHHLPPNPTLEMLHTWLPELSLSSIH...PDALPGAKG.GDTPIFQHVALCAMGQRRGTVAVYGESLD--WILSKFTSL
SCAF_HCMVM/31-414PVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSG.SETTPFKHVALCSVGRRRGTLAVYGRDPE--WVTQRFPDL

PF14550

D4MX42_ANAHA/23-149ENGNQLIDRQNDL....IDPEELEQTA----------------YTYVEFY.....REAGEMH..ERGGA..GVLIESIIF
Q08QA7_STIAD/309-425PE...TVDAQGDI....YSAAEIRQAA----------------HRFMEEF.....GGLGLMHQMRVNGH..VKVLESYLA
D4LIB0_9FIRM/21-145VGGNEVVDLQEDM....IDPETLEAAA----------------YKFAELY.....RDGGEMH..ERTGT..AVMVESVVL
B0VGF6_CLOAI/86-209PN...IHDSQGDY....YTREEIQKAC----------------DHFAKHGLV...GKCDVNHNMQPVPE..FTVVENYIL
L0AM66_NATGS/15-132PD...AVDRQYDF....VHEDTIREFA----------------DQF.ETFVDAGEAGGGIMH.........AVFPDEWMD
E3E570_PAEPS/39-161PD...AEDTHGDI....MTADEIEKAV----------------HGFMSNLAIAKGAVMDTQHDFD.PGV..GDVVECYVA
A8FGQ7_BACP2/40-155PN...TPDAHQDF....MTAKEIERAA----------------HGFMKDA.....RHIDKQHDFQ.DGV..GEVVESYIA
R7DEN0_9FIRM/81-194PM...TEDTDGNY....MTEEEITKAA----------------HWFMKNS.....GKPDIQHCFEKADN..VEIVESYVA
N0AUF1_9BACI/41-158PD...VADAHDDI....MNADEIEKAA----------------HKFMKDF.....RNIDTQHDFE.RGA..GELVESYIA
XKDF_BACSU/39-157PD...VPDAHGDF....MTAEEIEKAA----------------HGFLAEA.....REIDINHSFE.GGT..GVVVESYVA
C4ZCA6_AGARV/27-152ADGEEIEDWQEDI....IEPEELENAA----------------YQYVLLY.....REGGEMH..ERGGA..AVLVESVVF
YQBD_BACSU/39-156PD...TVDAHGDF....MTAAEIEKAA----------------HGFLKDA.....RQIDKQHDFQ.GGV..GEVVESYVA
H1XPV5_9BACT/40-158PN...EEDAHGDF....MTAEEIEKAA----------------HNFMKARRT...TNIDKQHDYE.ADE..GFVAESWIV
D3DZY3_METRM/3-133PG...ERDCEFDYGEEPLTEGQIRQIA----------------HEYLANY.....SLVDKNHEFFETREVIGVPVESYIT
A0RNP3_CAMFF/39-157PD...EIDTQGDA....ASAAEIEKAA----------------FSFMKGLNI...KNVDRDHNFK.PEG..AYICESWIV
R6JHS6_9CLOT/36-161SDGEQVTDLQEDI....VDPDVLEHAA----------------YNFVEFY.....REGGEMH..ERGGC..AVLVESIMF
K8ESL9_CARML/40-156PD...VKDAHDDF....MTAEEIEKAA----------------HGFMQNY.....QQIDKQHDFE.AGA..GTVVQSYIA

PF03420

Q6WHE3_BPKVM/5-184RNGRRYPKKVMENAVSKYIQEQVKTNQ--------------ALGELNHPSRSNVDPAEAAIRITELWWDGDNVMGKAIVL
PCPP_BPT4/6-190RNKRLYPKRILEKAVKDYINEQVLTKQ--------------ALGELNHPPRANVDPMQAAIIIEDMWWKGNDVYGRARVI

PF04586

Q8XLC1_CLOPE/14-176NSNISYANDL-------------------.YELVSNGDIDG-----CSFGFYVL.-.DDEWTYTE....DKVD...LRKV
Q830G5_ENTFA/12-173.PNTTVANDL-------------------.IQSMSRGDINQ-----CSFGFYPT.-.EETWDYSS....DPVL...R.TI
Q81Z10_BACAN/15-178.PDTTLGNDT-------------------.YKSIKRGDVDG-----VSFGFSMI.-.SEEIQEPD....DDLM...LRTV
Q81XX9_BACAN/12-175.ANTTLGNDT-------------------.YETIKRGDVDG-----VSFGFQMV.-.KEEWDESD....PDNV...VRSV
Q8DXJ7_STRA5/5-163NLSDPEAKKT-------------------.YDLMKMGALDS-----LSIGFFIK.-......DYEP.IDAKQPY.GGWIF
Q813K0_BACCR/5-168.TDEQVIKKA-------------------.....RNKELRG-----WSFGFVSE.-.KDSWEEGE....SGVQ...KRSI
Q88MK5_PSEPK/15-174LADAPYARIA-------------------.HRGMQTRSITG-----LSIGYYVR.-.ESSFDEKT...R.......IRTL
Q6N8L6_RHOPA/13-166IPDVARGREL-------------------.LALLRAGAIDG-----LSIGYRTV.-.RGQIDPRT...R.......VRRL
Q8XYS5_RALSO/12-178.PNTQTVRDL-------------------LLAPMARGDING-----SSFSFRVAP-DGDEWRKEG....E.LV...VRTI
Q6NK35_CORDI/146-313DLDNPKARQV-------------------.YNLLKAKRLSQ-----MSFAFDVV.-.EGSWGEREQ.QE.......VYEL
Q2G1W7_STAA8/11-173.PNTTFARDL-------------------.YENMRVGNINQ-----CSFGFMLDD-KGDEVRFDE....QENI..YKRTL
Q9CGQ7_LACLA/14-175NENDTEAMNL-------------------.YSRVQRGDVDQ-----CSFGFNIL.-.DEAMETRD....DGSY...KFTI
Q9CI95_LACLA/13-174.PDTTVGHDV-------------------.YNNIKAGNLKG-----MSFGFSVAD-GGDSWQQGA....D.SP...IRII
Q9ZXB1_BPPHC/15-176.PDTTVGRDV-------------------.AELLKRGDLQG-----SSFTFRVLD-GG..QRRADDDDPE..TGLPVREI

PF00716

SCAF_VZVD/28-373SMESKARLLS...LVKDYAGLN..KVWKVSEDKLAKVLLST-----AVNNMLLRD-RWDVVAKRRREAGIM.GHVYLQAS
SCAF_HHV11/37-365SPASREGARRLAAEAELALSG...RTWAPGVEALTHTLLST-----AVNNMMLRD-RWSLVAERRRQAGIA.GHTYLQAS
SCAF_EBVB9/24-327EPSIAAQIENDANAAKRESG......CPEDHPLPLTKLIAK-----AIDAGFLRN-RVETLRQDRGVANIP.AESYLKAS
SCAF_EHV2/58-381SPEERGAIAE....GYASPA.P.ESLPEPHFTCSNEILMAK-----AIDAGFIKN-RLEILKTDKGVAEVK.APTYLKAS
SCAF_HCMVM/31-414TAADRDGLRA....QWQRCGSTAVDASGDPFRSDSYGLLGN-----SVDALYIRE-RLPKLRYDKQLVGVTERESYVKAS

PF14550

D4MX42_ANAHA/23-149........TK--------------------EKMKTLGIEEGTLPEGWWVGFHITD..DDVWAKIK-----------DGTY
Q08QA7_STIAD/309-425.......PVD--------------------FNLGEVPVRKGT....WLLAVRVLS..DELWGRVK-----------DGQL
D4LIB0_9FIRM/21-145........TE--------------------EKQTAMGLAAGTLPVGWWIGFRVTD..DDVWEKVK-----------SGEY
B0VGF6_CLOAI/86-209KTSDREHFPD--------------------TKVGA...........WVQVLKCEDLGSELWQKVE-----------KGEF
L0AM66_NATGS/15-132LERNEVLDEA--------------------EEIGGTEAPAGA....WVQEWRINH..ADLWQLIV-----------DEII
E3E570_PAEPS/39-161.......PVD--------------------FEMGEETIKKGS....W.VLVTKAS..DDIWEKIQ-----------NEEV
A8FGQ7_BACP2/40-155.......PAD--------------------VEVGGELIRKGS....W.VLVTKAS..QEIWDQIQ-----------KGHI
R7DEN0_9FIRM/81-194.......KSD--------------------MEIEGQQIKKGT....WLMTMEVAD..DDVWGKIE-----------KGEI
N0AUF1_9BACI/41-158.......PVD--------------------MDIDGEIITKGS....W.VMVTKAT..DDIWESIK-----------KGEF
XKDF_BACSU/39-157.......PDD--------------------FMIGSKRITKGS....W.VLVTRAS..DEVWEQIK-----------AGII
C4ZCA6_AGARV/27-152........TE--------------------EKMQAMGIPAGTLPIGWWIGFKVTD..EDVWEKVK-----------DGTY
YQBD_BACSU/39-156.......PAD--------------------FEMNGETIKKGS....W.VLVTKAS..EEVWEQIK-----------KGEI
H1XPV5_9BACT/40-158RKGDPLFPNE--------------------........PEGA....WGVGIKVEN..DETWEQIK-----------NGEI
D3DZY3_METRM/3-133NEPISLKGLD--------------------GTVNEY..PKGT....WIATTRITD..EEEMEKAL-----------NGEY
A0RNP3_CAMFF/39-157KSGDPLFPNE--------------------........KEGS....WAVGIKLES..DELKEAVK-----------KGDL
R6JHS6_9CLOT/36-161........TK--------------------EKMAVMGIPEGTLPEAWWIGFRVTD..PDVWDKVK-----------SGEY
K8ESL9_CARML/40-156.......PCD--------------------LELG.ETIQKGS....W.VLVTKAT..DEIWESIQ-----------KGEF

PF03420

Q6WHE3_BPKVM/5-184NTPK..GQIV-------------------------RGLIEGG----WVPGVSSRG--LGSVKQVDG....INEVQDFRLT
PCPP_BPT4/6-190EGDHGPGDKL-------------------------AANIRAG----WIPGVSSRG--LGSLTDTNEGYRIVNE..GFKLT

PF04586

Q8XLC1_CLOPE/14-176KEVE.LIEVTITPF.PA-----------------------------YLDS..E....ASCRSFELHNKE-----------
Q830G5_ENTFA/12-173HEVE.LYEVSIVSL.PA-----------------------------YEDTEAA....LSRNK.QEMKQD-----------
Q81Z10_BACAN/15-178TKAK.LLEVSAVAF.PA-----------------------------YPDS..E....VSARGYDPYKHF-----------
Q81XX9_BACAN/12-175TKAK.LLEISPVAF.PA-----------------------------YPDS..Q....VSARSHDPYKQF-----------
Q8DXJ7_STRA5/5-163KEVE.IFEISVVTV.PA-----------------------------NPQATVD...NIKEFDMSAVDKR-----------
Q813K0_BACCR/5-168EELE.LLEVSILDMTPA-----------------------------YVATSIE.......TRGENTAMI-----------
Q88MK5_PSEPK/15-174TKLD.LIEISIVTV.PA-----------------------------NDEARTD....TIKSKLAHGGLP-----------
Q6N8L6_RHOPA/13-166YQVD.LWEISIVTF.PL-----------------------------LSGARIA........TVKHTPRP-----------
Q8XYS5_RALSO/12-178HRFQTLIDVSPVTY.PA-----------------------------YDES..H....SAQRSLTAWRQA-----------
Q6NK35_CORDI/146-313KKVK.LYEVSVVPI.GA-----------------------------NQETSIIDVKAVVAEELANMLDS-----------
Q2G1W7_STAA8/11-173TAIRELTDVSVVTY.PA-----------------------------YKDTDVK....PALRSIETVKK.-----------
Q9CGQ7_LACLA/14-175KAIE.LFEVSVVTF.PA-----------------------------YADTAVE....ARSKQIENMEK.-----------
Q9CI95_LACLA/13-174NQLQTLSEISVVSR.PA-----------------------------YDDTSVQ.....VTRSMDAFL..-----------
Q9ZXB1_BPPHC/15-176TAMD.VVELGPVVN.PA-----------------------------YPTTQAS......LRSIEETL..-----------

PF00716

SCAF_VZVD/28-373TGYG-LARITNVNG-VESKLPNAGVI................NATFHPGG.......P.IYDLALGVGE...........
SCAF_HHV11/37-365EKFK-MWGAEPVSA-PARGYKNGAPE................STDIPPGSI....AAAPQGDRCPIVRQ...........
SCAF_EBVB9/24-327DAPD-LQKPD....-KALQ...........................SPPP.............ASTDP............
SCAF_EHV2/58-381VQG.-.LPANLDEV-DSARG........................GEDPPTAAIATTPHPATDATTMNQQ...........
SCAF_HCMVM/31-414VSP.-.EAACVIKA-ASAERSGDSRSQAATPAAGARVPSSSPSPPVEPPSPVQPPALPASPSVLPAESPPSLSPSEPAEA

PF14550

D4MX42_ANAHA/23-149TMFS-IEGKAKRIE------------------------------------------------------------------
Q08QA7_STIAD/309-425TGFS-IGGTARR..------------------------------------------------------------------
D4LIB0_9FIRM/21-145SMFS-IGGTAIREE------------------------------------------------------------------
B0VGF6_CLOAI/86-209NGVS-IYGRADDY.------------------------------------------------------------------
L0AM66_NATGS/15-132AGYS-IGAI.....------------------------------------------------------------------
E3E570_PAEPS/39-161TGYS-MAGTAETIE------------------------------------------------------------------
A8FGQ7_BACP2/40-155TGYS-MAGTADI..------------------------------------------------------------------
R7DEN0_9FIRM/81-194TGFS-MGGTGNY..------------------------------------------------------------------
N0AUF1_9BACI/41-158TGYS-MAGTAETIE------------------------------------------------------------------
XKDF_BACSU/39-157TGYS-MAGTADVYE------------------------------------------------------------------
C4ZCA6_AGARV/27-152PMFS-IEGEAERVE------------------------------------------------------------------
YQBD_BACSU/39-156TGYS-MAGTAETIE------------------------------------------------------------------
H1XPV5_9BACT/40-158TGIS-MGGFGKRIE------------------------------------------------------------------
D3DZY3_METRM/3-133TGYS-ITTVSKKFA------------------------------------------------------------------
A0RNP3_CAMFF/39-157KALS-MAGTAIKEE------------------------------------------------------------------
R6JHS6_9CLOT/36-161PMFS-IEGEAVREE------------------------------------------------------------------
K8ESL9_CARML/40-156TGYS-LAGNAEVTE------------------------------------------------------------------

PF03420

Q6WHE3_BPKVM/5-184VGVDVVWGPSAPAA-------------------------------------------YVKP..VTESNE-----------
PCPP_BPT4/6-190VGVDAVWGPSAPDA-------------------------------------------WVTPKEITESQT-----------

PF04586

Q8XLC1_CLOPE/14-176--------------------------------------------------------------------------------
Q830G5_ENTFA/12-173--------------------------------------------------------------------------------
Q81Z10_BACAN/15-178--------------------------------------------------------------------------------
Q81XX9_BACAN/12-175--------------------------------------------------------------------------------
Q8DXJ7_STRA5/5-163--------------------------------------------------------------------------------
Q813K0_BACCR/5-168--------------------------------------------------------------------------------
Q88MK5_PSEPK/15-174--------------------------------------------------------------------------------
Q6N8L6_RHOPA/13-166--------------------------------------------------------------------------------
Q8XYS5_RALSO/12-178--------------------------------------------------------------------------------
Q6NK35_CORDI/146-313--------------------------------------------------------------------------------
Q2G1W7_STAA8/11-173--------------------------------------------------------------------------------
Q9CGQ7_LACLA/14-175--------------------------------------------------------------------------------
Q9CI95_LACLA/13-174--------------------------------------------------------------------------------
Q9ZXB1_BPPHC/15-176--------------------------------------------------------------------------------

PF00716

SCAF_VZVD/28-373..SNEDCEKTVPHLKVTQLCRNDSDMASVAGNASNISPQPPSGVPTGGEFVLIPTAYYSQLLTGQTKNPQVSIGAPNNGQ
SCAF_HHV11/37-365..RGVALSPVLPP.............MNPVPTSGTPAPAPPG....DGSYLWIPASHYNQLVAGHAAPQPQ......PHS
SCAF_EBVB9/24-327...ATMLSGNAGEG................ATACGGSAAAG......QDLISVPRNTFMTLLQTNLDNKPPR.QTPLPYA
SCAF_EHV2/58-381....QPFAAQAPAGG...............CEDLISVPRSTF.....MTMLQTNLDTMRQTSLGQRFGQPIDAP.AAPPA
SCAF_HCMVM/31-414ASMSHPLSAAVPAATAPP.......GATVAGASPAVSSLAWP.....HDGVYLPKDAFFSLLGASRSAAPVMYPGAVAAP

PF14550

D4MX42_ANAHA/23-149--------------------------------------------------------------------------------
Q08QA7_STIAD/309-425--------------------------------------------------------------------------------
D4LIB0_9FIRM/21-145--------------------------------------------------------------------------------
B0VGF6_CLOAI/86-209--------------------------------------------------------------------------------
L0AM66_NATGS/15-132--------------------------------------------------------------------------------
E3E570_PAEPS/39-161--------------------------------------------------------------------------------
A8FGQ7_BACP2/40-155--------------------------------------------------------------------------------
R7DEN0_9FIRM/81-194--------------------------------------------------------------------------------
N0AUF1_9BACI/41-158--------------------------------------------------------------------------------
XKDF_BACSU/39-157--------------------------------------------------------------------------------
C4ZCA6_AGARV/27-152--------------------------------------------------------------------------------
YQBD_BACSU/39-156--------------------------------------------------------------------------------
H1XPV5_9BACT/40-158--------------------------------------------------------------------------------
D3DZY3_METRM/3-133--------------------------------------------------------------------------------
A0RNP3_CAMFF/39-157--------------------------------------------------------------------------------
R6JHS6_9CLOT/36-161--------------------------------------------------------------------------------
K8ESL9_CARML/40-156--------------------------------------------------------------------------------

PF03420

Q6WHE3_BPKVM/5-184--------------------------------------------------------------------------------
PCPP_BPT4/6-190--------------------------------------------------------------------------------

PF04586

Q8XLC1_CLOPE/14-176---------------
Q830G5_ENTFA/12-173---------------
Q81Z10_BACAN/15-178---------------
Q81XX9_BACAN/12-175---------------
Q8DXJ7_STRA5/5-163---------------
Q813K0_BACCR/5-168---------------
Q88MK5_PSEPK/15-174---------------
Q6N8L6_RHOPA/13-166---------------
Q8XYS5_RALSO/12-178---------------
Q6NK35_CORDI/146-313---------------
Q2G1W7_STAA8/11-173---------------
Q9CGQ7_LACLA/14-175---------------
Q9CI95_LACLA/13-174---------------
Q9ZXB1_BPPHC/15-176---------------

PF00716

SCAF_VZVD/28-373YIVGPYGSPHPPAFP
SCAF_HHV11/37-365AFGFPAAAGSVAYGP
SCAF_EBVB9/24-327APLPPFSHQAIATAP
SCAF_EHV2/58-381QLRVPPPAAPFPVHP
SCAF_HCMVM/31-414PSASPAPLPL.PSY.

PF14550

D4MX42_ANAHA/23-149---------------
Q08QA7_STIAD/309-425---------------
D4LIB0_9FIRM/21-145---------------
B0VGF6_CLOAI/86-209---------------
L0AM66_NATGS/15-132---------------
E3E570_PAEPS/39-161---------------
A8FGQ7_BACP2/40-155---------------
R7DEN0_9FIRM/81-194---------------
N0AUF1_9BACI/41-158---------------
XKDF_BACSU/39-157---------------
C4ZCA6_AGARV/27-152---------------
YQBD_BACSU/39-156---------------
H1XPV5_9BACT/40-158---------------
D3DZY3_METRM/3-133---------------
A0RNP3_CAMFF/39-157---------------
R6JHS6_9CLOT/36-161---------------
K8ESL9_CARML/40-156---------------

PF03420

Q6WHE3_BPKVM/5-184---------------
PCPP_BPT4/6-190---------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window