Sequence alignment for CL0203

PF09478

Q54SS3_DICDI/292-372--ANVTQKII-NQWYSNNV.YY.-------------IQVDATINNK-G...SKPVR---G----FNF-------------
Q54UH2_DICDI/243-323--VNITQTIV-NSWNDGNQ.DF.-------------IQVQVVITNI-G...PTTIR---S----FSF-------------
Q54UH2_DICDI/352-432--ANVTQTIT-SSWRENNQ.DY.-------------IQVETIITNI-G...QSMIQ---S----YTF-------------
Q54BC0_DICDI/1043-1124--YQVDQTII-SKWINSEVYHY.-------------LQASITIKNN-G...IKPIK---A----FSF-------------
Q55CG7_DICDI/1041-1122--YEVIQSIV-ATWIDSEKYPY.-------------LQASITIKNT-G...TRPIK---A----FSF-------------
Q54U76_DICDI/53-136--LTIIQTIT-NSWSDNNGKEFK-------------TQVSVDIINN-T...KRTVK---D----VII-------------
Q54DP5_DICDI/230-310--LKIDQTRY-SSWFENGK.TV.-------------SQFGGIITNT-G...SVTVT---N----PTF-------------
Q55C74_DICDI/483-564--AVIKQTIR-QTWFDGTN.TN.-------------TLVDCTLTNP-S...SSPIP---I----PRF-------------
Q54DJ4_DICDI/24-109--ISISQIQT-GSWDSHSA....-------------..WEVTLINT-G...TRPII---D----ATL-------------
Q86KB6_DICDI/23-109--LTISQALT-SSWNHNGQ.PF.-------------SVWDVRVRNT-G...KAIVF---G----ATI-------------
Q54EX0_DICDI/27-117--ISMSQNQT-STWDDKNT.TF.-------------TVWEVMLVNN-W...NATII---D----LTI-------------
Q54LF5_DICDI/181-262--INYKLDTD-SNWVANGV.TY.-------------YQYKVTLTNN-E...SSPIK---S----IEI-------------
Q54LG4_DICDI/193-274--ISYKLNID-NQWITSGV.TY.-------------YQYKLTLTNN-E...ATAIK---S----IEI-------------
Q54LG5_DICDI/182-259--L....DID-WQWDSNNV.HY.-------------YQYRVTVTNN-D...STAIK---S----IQI-------------
GUN2_ORYSJ/544-626--VEIEQKAT-ASWEKDGR.TY.-------------HRYAVTVSNR-SPAGGKTVE---E----LHI-------------
GUN15_ORYSJ/535-613--IGIEQNVT-GTWARRRR.TY.-------------YRYAVTVTNR-S..RGKTVR---E----LHL-------------
Q9ZSP9_SOLLC/533-611--VTIQQRAT-SSWALNGK.TY.-------------YRYSAVVTNK-S...GKTVK---N----LKL-------------
GUN19_ARATH/534-612--ITISQKMT-NSWKNEGK.VY.-------------YRYSTILTNR-S...TKTLK---I----LKI-------------
GUN6_ARATH/528-606--VAIVQKIT-SSWVSKGR.TY.-------------YRYSTTVINK-S...SRPLK---S----LNL-------------
GUN13_ORYSJ/531-610--LEFVHTVT-NTWKANGV.DY.-------------YRHVVTAKNT-C...GHAIT---Y----LKL-------------
I1K6A1_SOYBN/532-609--ISIEQKMT-TSWIAHGI.TY.-------------YRYSTVVTNK-S...NKSLN---S----LNL-------------
Q54DY8_DICDI/1219-1296--INVSQSIV-NSWRENTQ.DF.-------------IQVEVNLKNI-G...QNTVY---Q----FSF-------------
GUN5_ARATH/535-614--IEFLHSIT-SNWIAGNT.RY.-------------YRHKVIIKNN-S...QKPIS---D----LKL-------------

PF00553

GUND_CLOC7/411-512--VEVTYAIT-NSWGSG-------------------ASVNVTIKNN-G---TTPIN---G----WTL-------------
XYNB_CELJU/37-133--AACTYTID-SEWSTG-------------------FTANITLKND-T---GAAIN---N----WNV-------------
GUNC_CELJU/37-133--AGCEYVVT-NSWGSG-------------------FTAAIRITNS-T---SSVIN---G----WNV-------------
GUNA_CELJU/864-961--GNCQYVVT-NQWNNG-------------------FTAVIRVRNN-G---SSAIN---G----WSV-------------
GUNB_CELJU/30-127--AVCEYRVT-NEWGSG-------------------FTASIRITNN-G---SSTIN---G----WSV-------------
GUN1_ACIC1/465-559--CTASYQVN-SDWGNG-------------------FTVTVAVTNS-G---SVATK---T----WTV-------------
D6Y6N8_THEBD/360-452--CEATYALV-NQWPGG-------------------FQAEVTVKNT-G---SSPIN---G----WTV-------------
F4GZY2_CELFA/35-134--CRVDYAVT-NQWPGG-------------------FGANVTITNL-G---DPVS.---S----WKL-------------
F4H3U7_CELFA/946-1044--CTVVYSTN-.SWNVG-------------------FTGSVKITNT-G---TTPLT---.----WTL-------------
F4H454_CELFA/408-507--CQVLWGVN-.QWNTG-------------------FTANVTVKNT-S---SAPVD---G----WTL-------------
Y1987_MYCTU/41-139--.RATLSVT-STWQTG-------------------FIARFTITNS-S---TAPLT---D----WKL-------------
Q47RH8_THEFY/40-136--.TATVTKE-SSWDNG-------------------YSASVTVRND-T---SSTVS---Q----WEV-------------
Q7AKG2_STRCO/34-131--ATATFAKT-SDWGTG-------------------FGGSWTVKNT-G---TTSLS---S----WTV-------------
Q9F3Q0_STRCO/58-156--CKAEYTIT-SQWEGG-------------------FQAGVKITNL-G---DPV.S---G----WTL-------------

PF03173

I2BB67_SHIBC/32-191-QLAVNYTIN-DNHAGANGVDCA....ALGADWASCNKATITLTNH-G---.AAIT.DKD....WAIYFPSIRQILKIDN
A3QBY8_SHELP/54-215-.LAVNYHTL-TNYPQQ....CT....STGVD.GRCFAAQIELVPG-.---.VDFD.RKD....WAIYYSQMRPVKQVLT
B3PH90_CELJU/45-198-DAQLAFAPV-SNFALGHGQ................FQAQLTLNNQ-S---AIALPAGKG...DWRIYIHSIRKLHENKV
Q487J1_COLP3/52-215-NLEVNYRVV-TNIPTDK...CD....SKIAD.GACFEVELSFTAK-.---.KAIA.AKD....WTIHFSQISPIQSFES
D3VAI6_XENNA/45-204-QLKVNFKVI-DNQAGSHGTDCA....ILGADSAACNRVNITLGNG-N---.QAIN.SAD....WALYFHSIRQILKLDN
Q87RM3_VIBPA/35-194-NLDIQYQVL-TNHGANEGLACQ....DLGAEWASCNKVNMTLVNQ-G---.EAVN.SKD....WAIYFHSIRLILDVDN
A7MQU6_CROS8/34-190-..GLNYTIT-DNQAAQHGTDCA....ALGADWASCNKAVITLTNP-G---.DAVT.DKN....WTIWFHSIRQILKVDN
E6WFL0_PANSA/37-193-..GVQYQIT-DNQAASHGVDCA....QLGADWASCNRATIKLTNH-G---.PAIT.SKN....WAIYMSNVHETLRVDN
X2GWP3_9GAMM/38-198-QLHLNYQIV-DNDAANHGVDCA....ALGADWASCNKVTLTLKNT-G---.PAIT.SND....WAIYFHNIRMILAVNN
D4ZH44_SHEVD/49-211-TLEIKYRVV-TNYPQG....CS....TSGVD.GRCFTAQIDLTSA-.---.VDLD.SHD....WAIYFSQMRPVQSVNS
Q6LTD2_PHOPR/61-220-NLDVNYELV-TNHGANEGLKCQ....ELNAEWASCDLINLTLVNN-G---.PAVD.SKD....WTIYFHSIRMILDVQN
W8V3I6_YEREN/37-196-TLKVNYKVL-DNRAAENGVDCA....KLGADWASCNKVLITLTNT-G---.DEIK.GQD....WAIYFHSIRQILTVDN
K1RL03_CRAGI/26-177-NLNIKYDVI-NNLLNG................KSTFVSKITLENT-G---GSDIK.PGS....WELFFYSLHLIQPNSY
A1S444_SHEAM/47-209-GLDVKYRVV-TNRPDEQ...CK....KDAGE.GRCFQAEIVLTSP-.---.IDFD.GRD....FEIYYSQMRPVQSVQS
A7RSQ4_NEMVE/34-186-NLGIRYDVL-DNFQDS................WRSYKVQLTLSNA-G---SQAIA.NGD....WSIYLCHIRVIEPVHT
Q5DYR6_VIBF1/39-198-NLDINYTVI-TNQGADDGLACK....ELQAEWASCNKVNMTLTNT-G---.EAID.SKD....WTIYFHSIRLILDVEN
Q8CVD2_SHEON/53-215-NLGVTYRVL-TNRPDDN...CD....KAAAE.GRCFVAEIDFVPE-.---.VDLI.GKE....WAIYFSQMRPVQSVEG
A0KIG5_AERHH/37-197-NLVVKYEVV-TNDGAGAGLDCQ....ALGSEWASCGVAKLHLTNT-G---.ADVT.SKD....WSIYVSSIRRIQRVDN
Q7PC48_SACD2/44-221-NMQVHYQVL-LNKGDGE...CSLPSLPPSPK.SPCSIVELSLSSP-.---.DKLA.ANDLDGNWSIYFSQTDPIYAHPA
W0LCL7_SERFO/37-196-QLNVKLQMQ-DNRAADHGVDCA....KLGADWASCNKVLITLTNS-G---.QEIK.GQD....WAIYFHSPRQTLKVDN
C5BGA1_EDWI9/35-194-QVKVNYAVT-DNRGAENGVNCA....ALGADWASCNQAVISLTND-G---.SAIE.GKE....WAIYFHNIRQILKSGN
A8GB46_SERP5/37-196-QLKLNLKMV-DNRAADSGLDCG....KLGADWAACNKVLISLTND-H---.QEIK.GHD....WAIYFHSARQTMRVDN
D8MPP8_ERWBE/36-192-..GVKYKVT-DNLAAQHGVDCA....GLGADWASCNRATISFTNP-G---.PAID.SKD....WAIYMSNVHETLKVES
R9VRJ9_9ENTR/35-192-.FHLNYAVK-DNFAAQHGVDCA....KLGADWASCNKAVITLTNN-G---.DAVT.DKA....WAIYFHSIRPVLEVAN
B8CS99_SHEPW/50-212-QLAVNYRVV-TNVADNH...CD....KDSAG.GKCFVAEIDLTFP-.---.VDVA.TKD....WAIYYSQMRPVQSIEG
D0LVP4_HALO1/53-212-.IELRYELL-ETHGAQAGVDCK....ALAGDYASCHTARLVLSNR-G---EEALP.SGG....WTLYFHSIRRVLSVEG
U4K583_9VIBR/34-198-.LNVSTSLV-VNQPTDSKAECP.........WGLCYRAEITITNT-S---DKAV..NKD....WDLYFPSIHRVLDTRG
Q7NXY3_CHRVO/32-191-.LSLKIAVD-SNKGAAAGAPCA....DLGADWASCLKGRLILENK-G---GQAVPAGGG....WNLYLHSIRRILKLDT
I0DXS0_PROSM/38-196-.IDVKINVL-DNQAGEHGTHCA....ALGADWAACNRVDITLTNG-D---.TAIE.SND....WALYFHSIRQILKQDN
D3UXD7_XENBS/37-196-QLKVNFKIK-DNQAGAHGTDCA....ILGADGASCNRVHITLANG-N---.QAID.SSD....WAIYFHSIRQILKVDH
E1ST90_FERBD/37-199-QLQVVHRVV-DNRPGPH...CR....EDKGD.GACYRAEIELTTG-D---.TALP.ATG....WELRFSQVSYVQGSTG
Q7MBH3_PHOLL/37-196-QLKVNYKVV-DNQAGDHGVNCA....VLGADWAKCNRVDITLTNG-N---.QAID.SID....WAIYFHSIRQVLSVDN

PF00942

F2JLD6_CELLD/535-617-NAED..SQN-.EKHY--------------------IEVKALVYNH-TAWPARITD---N----LSF-------------
W6S3G9_9CLOT/4-92-QMFNINNST-SS.NV--------------------VSGKFKIINT-DSN.SVNLS---D----IKI-------------
S6D1L3_9EURY/574-658-......LQE-.NADR--------------------TQVRVTIHNE-SIHPPHRED---G----LSA-------------
I5ASR2_EUBCE/521-600-.....QNSS-DSGSS--------------------VELMIHFENR-TAWPAVPTD---S----LVV-------------
F3ZKG0_9ACTO/55-133-QYRQSSTGA-...DQ--------------------AEPWFKVVNS-GNS.SVSLS---Q----VKL-------------
F2R1Y0_STRVP/44-122-QYRQSATGS-...DQ--------------------VEPWLKVVNT-GST.SVPLS---Q----VKV-------------
K4KPQ8_SIMAS/500-582-EAKS..NAT-.GPRH--------------------IEIAAKVYNR-SAWPAANGD---K----LKF-------------
E3E7K8_PAEPS/879-959-QSFNGNISA-TS.NT--------------------ISSKFKITNT-GSS.PVSLA---D----VTL-------------
E3FP49_STIAD/660-740-.YRDGDNNA-PGNNQ--------------------IRPHLRVKNG-GTT.PVNLA---E----VKV-------------
A3DCG3_CLOTH/379-458-.FYNNNTLS-ET.GV--------------------IYMRINVINT-GNA.PLDLS---D----LKL-------------
E3E5T1_PAEPS/389-469-QYRTDDTNA-KD.NA--------------------IRPQFNIKNT-GKT.AVKLS---D----LKI-------------
A9B7H5_HERA2/511-590-EAKV..NAS-.GPRF--------------------IEISGVLHNQ-SAWPARNST---K----LSY-------------
A3DHY3_CLOTH/528-615-EGKI..EQE-.NKER--------------------TQVTIKIFND-TCHPPRFET---G----LMA-------------
A3DBH1_CLOTH/345-424-...YYSRKP-HDSAG--------------------IDFSFRMFNT-GNE.AIDLK---D----VKV-------------
A3DJ30_CLOTH/745-825-SYKCGVKDG-TK.NT--------------------IRATINIKNT-GTT.PVNLS---D----IKV-------------
G8LUU2_CLOCD/545-634-EAKVSTSQE-.NKER--------------------SQITIRIHNE-SAYPPHYET---G----LKA-------------
G8TEL8_NIAKG/1181-1261-QSQDGDKGK-TDNNS--------------------ISPYLQLVST-GKA.NVAYG---E----LTA-------------
W6RW99_9CLOT/507-586-EMYNKINQP-VY.NN--------------------ITPCFRITNA-GKT.SINLK---N----IKI-------------
G8LUA7_CLOCD/714-794-LYKTTDASD-AA.GD--------------------IKVTLKIENT-GKK.PVDLS---T----LKI-------------
B8I7V0_CLOCE/36-124-QFNNGSSPA-SS.NS--------------------IYARFKVTNT-SGS.PINLA---D----LKL-------------
A4XIF5_CALS8/719-799-LYANKETNS-TT.NT--------------------IRPWLKVVNS-GSS.SIDLS---R----VTI-------------
Q97KK3_CLOAB/486-568-DANI..MKE-.SNEE--------------------CTIQAFIHNA-SLLPPHYEK---G----MSF-------------
L7VTG9_CLOSH/843-923-QMFNGNTSD-KT.NG--------------------IMPRYRLTNT-GTT.PIRLS---D----VKI-------------
R7FAC7_9FIRM/489-575-ETKL..KSS-..DSG--------------------VTLSFKFTNH-SAWPARIED---N----MSY-------------
Q65JI9_BACLD/504-585-EASI..NSS-.GNSY--------------------TEIRAQLNNR-SGWPAKKTD---Q----LSF-------------
B8I0N0_CLOCE/480-561-.AKL..YKS-.NTEG--------------------VTVDLNLYNI-VTAPPQYEK---D----LSC-------------
F2JH11_CELLD/994-1077-.AHNNKGGA-TT.NT--------------------IGGQFVVTSE-G...AVDLS---K----LAI-------------
GUN2_BACSU/357-436-QYRAGDGSM-NS.NQ--------------------IRPQLQIKNN-GNT.TVDLK---D----VTA-------------
A5A671_BACLD/372-451-QYRAGDNNV-NG.NQ--------------------IRPQLNIKNN-SKK.TVSLN---R----ITV-------------
A9KT90_CLOPH/488-569-QAGI..NAS-.GPSF--------------------IEVKALVFNE-TGWPARVTD---K----LSF-------------
Q2SJA3_HAHCH/491-572-EAKL..NSS-.GPRY--------------------VEIAAQVHNH-SAWPARGSE---Q----LRF-------------
R7MSD4_9FIRM/509-590-EACI..NQE-.SGSY--------------------TEIKAYTTNH-SAWPARVVK---D----LSY-------------
A3DC31_CLOTH/164-244-QYKNGDSTS-SV.TA--------------------IYPIFKITNN-GDT.SVKLS---D----III-------------
Q097R6_STIAD/32-112-QYQNYNASG-PNDSI--------------------IEAGIQLKNN-TTA.AIPLS---T----VVV-------------
G8LUA7_CLOCD/540-626-EAKL..EQE-.NKER--------------------TQITIRLYNY-SVHPPHFEE---A----MKV-------------
A9GL35_SORC5/145-226-QYAARDTTV-EP.QH--------------------LSFMVQVKNT-DDA.SIALS---D----LTI-------------
L0G2U2_ECHVK/1172-1252-SYKNGDASS-PLNSQ--------------------IKPYFKLINM-DTM.SVDLG---N----ITA-------------
D9SS73_CLOC7/36-125-EFYNSNKSA-QT.NS--------------------ITPIIKITNT-SDS.DLNLN---D----VKV-------------
Q47MW0_THEFY/512-587-EAQI..NTP-.GTTF--------------------TEIKAMIRNQ-SGWPARMLD---K----GTF-------------
G8TEL8_NIAKG/1340-1416-STQNGGK..-...NT--------------------ISTYVTISNE-GNM.PVAYG---D----LSV-------------
A3DD31_CLOTH/476-558-EAAI..NQA-.SDHF--------------------TEIKALLNNR-SSWPARLIK---D----LSY-------------
G8LXL9_CLOCD/507-587-.MYNEVRTD-KA.KE--------------------IHPRFKLINT-GNT.PIKLS---T----VKI-------------
D2B808_STRRD/501-576-EAGV..NAS-.GPTF--------------------TEIKTIVRNQ-SAWPARPLT---N----GSF-------------
G8LUU2_CLOCD/727-807-LYKCLTSSD-SA.SD--------------------IRAILKIQND-GKK.PVNLS---D----IKV-------------
GUNI_CLOTH/743-823-QYANGNAGA-TS.NS--------------------INPRFKIINN-GTK.AINLS---D----VKI-------------
D4LFJ4_RUMC1/492-578-EAKA..TSD-..AGG--------------------VNLSLKFTNQ-TAWPARVED---N----LSY-------------
E4N479_KITSK/44-125-QYRTSASGA-TA.DQ--------------------SEPWLQVTNT-GSG.TVALN---R----ITL-------------
A3DEW0_CLOTH/42-124-EFYNGDFGA-SV.SS--------------------ISMNFRITNN-GSS.QISLS---D----IKL-------------
G8LUZ6_CLOCD/1397-1477-QYTNGNATD-ST.NG--------------------INPRLRLVNN-GNS.SINLS---D----VKI-------------
E3EAP2_PAEPS/1225-1305-QYRTADTKV-ND.NH--------------------LNPHFQIVNK-GTA.SVPLN---E----LKI-------------
E6UCK4_RUMA7/672-761-SGGK..AQE-.KKDG--------------------IQLKVVLHNR-TVDPPRFEC---N----VKA-------------
H1YBR2_9SPHI/1732-1812-QYIDGDNKQ-AGNNV--------------------IRPYIRIVNQ-DSV.AVAYN---E----LTM-------------
B8I218_CLOCE/2196-2280-..FNATTSA-TT.NS--------------------IDPRIMFENT-GKT.EFKLS---D----LKI-------------
D5UFH7_CELFN/504-581-EAKL..NQP-AGGTF--------------------TEVKAVVRNR-SAFPARSLT---N----ASI-------------
G8LWU8_CLOCD/748-828-EFYNTNTQA-ES.NS--------------------IYPKFRLTNT-GSS.PINLA---D----VKL-------------
F2JLD6_CELLD/733-819-....NASNS-KS.NT--------------------INLNLEIKGK-KES.QFDLK---D----LSI-------------
E3EJF1_PAEPS/850-930-QYRVGDTNP-GD.NQ--------------------IRPLFRVVNK-GKE.ALDLK---N----VKL-------------
I0K9X8_9BACT/1267-1346-..KNGNNNT-KKVNT--------------------IRPYLKLNNG-GTA.AIPYG---E----LTV-------------
D5SLE0_STRC2/48-129-QYRTGVTGA-TA.GQ--------------------AAPWFTVRNT-GTA.PVRLA---D----VRL-------------
GUNF_CLOTH/488-569-EAAV..NAA-.GPGF--------------------VNIKASIINK-SGWPARGSD---K----LSA-------------
GUNG_CLOCE/497-580-KAGL..NST-.GPNY--------------------TEIKAVVYNQ-TGWPARVTD---K----ISF-------------
CIPA_CLOTH/372-461-EFYNSNPSD-TT.NS--------------------INPQFKVTNT-GSS.AIDLS---K----LTL-------------
D5UG75_CELFN/568-654-RAEL..EQE-.NTSR--------------------TQVTLEISNR-SVHPPAEVD---D----LSL-------------
A8FDC3_BACP2/466-547-EAAV..MNN-.DATS--------------------TQVKAVLYNR-SGWPARRSQ---T----LSF-------------
A0LVL3_ACIC1/518-593-QASV..NSA-.GTNY--------------------TEIKAYIVNQ-SAWPARALD---H----GSF-------------
Q82QF2_STRAW/597-678-LYKNNDSSA-TD.NA--------------------IRPGLRIVNT-GSG.SLDLS---K----VTA-------------
D9ST82_CLOC7/545-633-ESKL..EQE-.NGER--------------------TQVTIRANNL-TVHPPHTED---T----IKV-------------
I0K9X8_9BACT/1423-1501-YAENKNRNT-TG.NQ--------------------IKPYLNVANE-GNL.PVDYS---Q----LTV-------------
G8M373_CLOCD/188-272-..YSGNPTN-SI.NS--------------------IMPRFKITNT-SKV.PIELK---Y----VKL-------------
R7ML41_9FIRM/560-649-TAGK..AQE-.TDAG--------------------LQVKLVIHNE-TTNPPKFES---D----MRV-------------
F4A374_MAHA5/503-583-NARV..TSE-.QTNF--------------------TEISVDLTNH-SAWPARSLD---R----MSY-------------
D9SV33_CLOC7/38-126-EMYNSNKAL-ET.NT--------------------ISPTFKIKNS-SDS.CLNLK---D----VTV-------------
A3DHY3_CLOTH/707-787-LYKYGDTTA-AT.KD--------------------IRGSIKIKNT-GTK.PVNLS---D----VKV-------------
F2JH10_CELLD/502-584-NAQD..KQN-.AINF--------------------VEIKAVVYNR-SAWPARVTD---K----LAY-------------
Q6D5R0_PECAS/360-440-QYRNVDNNP-SD.DA--------------------IRMAFNIKNT-GST.PIKLS---D----LQV-------------
R7H587_9FIRM/496-583-ETTL..KTA-.SASG--------------------VTVSFKLTNH-TAWPARVVN---N----LSY-------------
F2JH10_CELLD/988-1075-...TGNGQA-ST.NT--------------------LTNNFKLVHK-SGN.DIDLS---K----LEI-------------
A4XIF5_CALS8/494-575-EAGI..NAS-.GTNF--------------------IEIKAIVNNQ-SGWPARATN---K----LKF-------------
R7H7U6_9FIRM/569-656-EAAV..GQE-.DNMA--------------------SQVQIKIHNN-TILPPRYLD---H----IKV-------------
A9KMK6_CLOPH/584-672-..NTGNNNL-ST.NT--------------------INADFKIKHE-KGS.DIDLS---K----LVI-------------
G8LUZ6_CLOCD/1194-1273-EAGV..NAS-.GSNF--------------------IEIKAVINNK-SAWPARVCE---N----LSF-------------
D2BAV4_STRRD/35-116-QYRTSAAGG-TA.DQ--------------------VEPWFDLVND-GAS.AVPLS---G----VRI-------------
GUNI_CLOTH/537-616-EAGV..NAS-.GNNF--------------------IEIKAIVNNK-SGWPARVCE---N----LSF-------------
A9KJ82_CLOPH/713-793-QAFNGNTSA-ST.NG--------------------ISPKFKLINT-GNT.DINLS---D----IKL-------------
L7VTG9_CLOSH/489-570-MAGI..NAS-.GQNF--------------------IEIKALLHNQ-SGWPARVAD---K----LSF-------------
A9KT90_CLOPH/841-921-QMFNGNSSA-TT.NG--------------------IAPRIKLINT-GTT.AINLS---D----VKI-------------
R5VSS5_9FIRM/596-685-DARV..MQE-.TDAR--------------------SQIEISICND-TSLPPRYIS---T----LSA-------------
M1MLG4_9CLOT/497-578-EAGV..NAS-.GPNF--------------------MEIKALLYNK-SGWPAKVGD---K----LSF-------------
F2JID6_CELLD/34-122-EYCNTMASI-ST.NT--------------------MGGKIKLTNT-SNE.TINLE---D----LKV-------------
H6NM35_9BACL/438-516-QYRAADTNA-GD.NA--------------------IKPHFNIRNT-GAS.PVDLS---G----VKL-------------
R7FDD1_9FIRM/648-737-TAGK..AQE-.NDAG--------------------LQVKIVVHNR-TINPPQFCD---D----LRV-------------
B8I2K6_CLOCE/737-817-SYKSGTSDG-TK.NT--------------------IRSSINIKNT-GTV.PINLS---D----IKV-------------
Q97KK5_CLOAB/497-578-EAAV..NAT-.GKNF--------------------EEIKSKIYNK-TGWPARVTD---K----LSF-------------
H6NM36_9BACL/666-744-QYRAGNTNA-AD.NA--------------------ISPHFNIKNN-GTA.AVNLS---D----LKI-------------
B8I7V7_CLOCE/541-629-ESKL..EQE-.NTER--------------------TQVTVRIHNE-TSRPPEFVD---E----LKA-------------
B1VPK7_STRGG/566-647-EYRNTDNSP-TD.NQ--------------------IRMSLRLVNT-GSA.AIDLS---T----VTA-------------
F2JPM5_CELLD/858-938-TFNNCNLSE-KT.NS--------------------LMPRFKVTNT-GAD.AIDLS---D----VRL-------------
H6NDH3_9BACL/887-967-QVQNGTTAA-AT.NS--------------------IAPRIRLVNT-GTS.AIELS---D----VTL-------------
D2QPV6_SPILD/418-497-..YSAAKNS-DITSS--------------------ISTVLEVRNT-GNV.AIPLQ---D----LTV-------------
A3DC27_CLOTH/515-595-QAYNHIRTS-ET.KE--------------------LQPRIKLINT-GNT.PITLS---E----VKI-------------
A4XIF8_CALS8/490-570-.KFG..NSQ-.GANY--------------------TEIISYIYNR-TGWPPRVTD---N----LNF-------------
C7PX61_CATAD/871-951-QYETSVTTA-TT.QS--------------------FQPLLNVVNN-GTS.AVPLS---S----VTI-------------
Q977Y4_CLOAB/40-128-QFADTNTST-TM.NT--------------------IAPKFKITNN-TGA.PLDLT---T----LKL-------------
V4KLB1_9ACTO/579-659-QYRTSDTSP-TD.SQ--------------------IRMGLQVVNT-GQS.AVNLA---D----VKL-------------
A3DCY5_CLOTH/490-571-EATA..NSN-...NG--------------------VELKTYLYNK-SGWPARVCD---K----LSF-------------
G8LST1_CLOCD/340-417-....NEQQS-LYSKA--------------------IRWDFVIENT-GNS.YIDLR---N----VKV-------------
H1YBR2_9SPHI/1889-1968-SYQNQNQTS-GG.NT--------------------ISTYLSINNT-GNV.TVDYG---D----VTV-------------
D4LDI8_RUMC1/503-584-EAAV..NQS-.SESY--------------------TEVKVLATNH-SAWPARLIK---N----LSY-------------
R7FFS6_9FIRM/505-590-KASI..NQS-.ASSY--------------------TEIKAFAMNH-TAWPARTIK---N----LSY-------------
A3DIC9_CLOTH/55-150-EFFNNVKDD-NV.TL--------------------ISPYFRVINN-SSSDEIYLQ---H----VKI-------------
A3DDF1_CLOTH/490-571-EAYV..SSS-.DKNY--------------------VEIKTRLNNR-TAWPARVSE---G----LSF-------------
G8M2T9_CLOCD/481-563-EAKI..YEE-.SSSG--------------------ITVDLNMYNI-VTSPPQYEP---G----LSC-------------
H6NJY0_9BACL/593-671-QYRAGNTNP-AD.NT--------------------IAAHFNIKNT-GTT.AVKLS---D----LKL-------------
A0LVL3_ACIC1/753-834-QYKNNDSAP-GD.NQ--------------------IKPGLQVVNT-GSS.SVDLS---T----VTV-------------
W6S3G9_9CLOT/174-261-EMFNINTLT-TS.NS--------------------ITPKIKVTNI-GSV.DIDLS---K----LKL-------------
F2JNU4_CELLD/539-627-TAKI..EQE-.NSER--------------------SQITVKIHND-TSCPPSFES---G----LKA-------------
A3DBI3_CLOTH/794-874-QYANGNGSD-TT.NT--------------------INPRFKLINN-SGS.PVKLS---D----VKI-------------
G0GF20_SPITZ/498-578-EACL..NAS-.GSNF--------------------TEVKVLVNNR-SAWPARVIN---D----LRF-------------
E0RWD9_BUTPB/512-593-NAQD..KNN-.KINF--------------------VEIKAVIENH-TAWPARVTD---N----LTL-------------
G8LXM2_CLOCD/487-569-YGAL..NAS-.GPTF--------------------TNMKVTLANM-TGWPPRGSD---T----LSF-------------
D9SS71_CLOC7/498-579-EAGV..NCT-.GPNF--------------------VEIKALVNNR-TGWPARMGD---K----LSF-------------
C5BNA7_TERTT/495-574-GAKI..NSS-.GNRF--------------------VEMKAVIQNH-STTPAQGKD---D----LYM-------------
M1MVT4_9CLOT/40-123-...NVKTDE-ST.NA--------------------INGTFNVTNN-GEE.AINLS---D----VKI-------------
I0K805_9BACT/1555-1634-..YTDNRPV-GA.NT--------------------INTYLQVRNE-GNV.PVNYQ---D----IKV-------------
G8LYV1_CLOCD/158-238-KYKNGRTNV-NT.DT--------------------IYPMFTIVNK-GNQ.KVKLS---N----IKI-------------
M1MVT4_9CLOT/205-289-...NVSNGS-SA.NS--------------------IAPTFTITNT-GDE.ELDLT---T----LKL-------------
A9EQP9_SORC5/231-310-QYSNYDAAA-PNDTI--------------------VEAGIKIRNN-TAA.SIPLS---S----IVL-------------
A3DI46_CLOTH/56-139-..KNIKTGV-PS.DT--------------------IALKIGIINL-NKAININLN---D----IKL-------------
A9KT91_CLOPH/775-855-QMFNGNTSA-TT.NG--------------------IAPRFYLVNT-GSN.SINLS---D----VKL-------------
GUX2_CLOSH/770-850-QSFNANTQE-IS.NS--------------------IMPRFRIYNS-GNT.SIPLS---E----VKL-------------
Q9RK75_STRCO/42-123-QYRTSASGA-TA.DQ--------------------TEPWFKVRNT-GSS.IVQLS---Q----VKI-------------
L0G2U2_ECHVK/1326-1406-SVMAKNESS-KD.NT--------------------IKKVFNLKNT-GNV.PLDYE---G----ISI-------------
H6NJX8_9BACL/529-607-QYRAGNTNA-AD.NT--------------------IGPQFNIKNT-GTT.AVKLS---G----LKL-------------
F2JNU4_CELLD/909-995-....GSDSI-TS.NT--------------------IGRKIIMKNT-EGE.AVDLA---A----LSV-------------
F4H3U7_CELFA/500-576-EAML..NQP-PSGTF--------------------TEVKAMIRNQ-SAFPARSLK---N----AKV-------------
G8LXR4_CLOCD/470-550-EGVI..MNN-.NAND--------------------LSVKLLLNNR-SGWPARMIK---D----LKY-------------

PF00963

SLAP1_CLOTH/34-195IEMVLDKTEV.HVGDV--------------------ITATIKVNNI.RK...LAGY---Q----LNI-------------
O30295_ARCFU/279-418TTIIAGSAEA.PQGSD--------------------IQVPVKIENA.DK...VGSI---N----LIL-------------
CIPA_CLOTH/1549-1689LTLKIGRAEG.RPGDT--------------------VEIPVNLYGV.PQKG.IASG---D----FVV-------------
CBPA_CLOCL/291-428VTATIGKVQV.NAGET--------------------VAVPVNLTKV.PAAG.LATI---E----LPL-------------
CIPA_CLOTH/31-168MTVEIGKVTA.AVGSK--------------------VEIPITLKGV.PSKG.MANC---D----FVL-------------
CBPA_CLOCL/435-570MQISVGTATV.KAGEI--------------------AAVPVTLTSV.PSTG.IATA---E----AQV-------------
F0K9P3_CLOAE/1344-1482TTLAVGAASG.KAGDT--------------------VKVPVTISKV.TTP..VGLI---C----MEI-------------
Q9FDJ9_9FIRM/225-386VTVEVDKTDA.KVGDI--------------------ITATINVKNI.NG...FAGY---Q----ANL-------------
Q9RPL0_9FIRM/1161-1298MAVAVGAVQG.GVGET--------------------VTVPVTMTKV.PTTG.VSTA---D----FTV-------------
F0K9P3_CLOAE/382-520TNVTVGDVTGAKKGDT--------------------IKVPVSVSTV.KTP..IGLI---D----MEI-------------
A3DF10_CLOTH/34-197IELKFDRNKG.EVGDI--------------------LIGTVRINNI.KN...FAGF---Q----VNI-------------
Q9ZGA7_9CLOT/91-228AEISIGKVSG.ATGST--------------------VTIPVKLNNL.PKKG.IGSF---N----FNI-------------
Q9RPL0_9FIRM/1621-1754FKVSIDTVKA.ATGTQ--------------------VVVPVSFVNV.PATG.ISTT---D----MTI-------------
Q7WYN2_9FIRM/40-179LQVDIGKVSG.EPGSI--------------------VSVPVTFSNV.PATG.IYAL---S----FSV-------------
Q9FDJ9_9FIRM/1493-1654VFVTLDKTKA.AVGDI--------------------ITATINVKDF.DS...VAGY---Q----ASV-------------
D1NHZ3_CLOTM/34-172IEIIIGNVKA.RPGDR--------------------IEVPVSLKNV.PDKG.IVSS---D----FVI-------------
Q9RPL0_9FIRM/1304-1441MKVVIANVSG.NAGSE--------------------VVVPVSIEGV.SANG.VSAA---D----FTI-------------
Q7UY43_RHOBA/45-169AAVNIPDDLTSAPDAI--------------------VSVPVNIDSA.TG...VRAA---E----IRL-------------
Q9AE52_RUMFL/1217-1350IAWVVDTVAA.YPGDE--------------------VTLKITVKDPNAANLGIAGA---Q----FKV-------------
Q9AE52_RUMFL/58-185VEWLIPTVTA.APGQT--------------------VTMPVVVKSS...SLAVAGA---Q----FKI-------------
F0K9P3_CLOAE/616-754VKLSVGTVSG.NPGDT--------------------VKVPVTISQV.STP..VGLI---C----MDI-------------
O82830_CLOJO/1023-1161LGVKIASVTG.KTGDT--------------------ITVPVTLSNV.ATVGNVGTC---N----FYI-------------
Q9RPL0_9FIRM/1475-1612FNLSIDTVEG.NPGSS--------------------VVVPVKLSGI.SKNG.ISTA---D----FTV-------------
Q8PV77_METMA/33-166VTLQPASKNV.YAGEN--------------------ITLNVVVTPD.TQ...ISGI---Q----FDL-------------
CIPA_CLOTH/184-321VVVEIGKVTG.SVGTT--------------------VEIPVYFRGV.PSKG.IANC---D----FVF-------------
Q7WYN2_9FIRM/326-465LQVDIGSTSG.KAGSV--------------------VSVPITFTNV.PKSG.IYAL---S----FRT-------------
Q9AE52_RUMFL/194-326IKWVLDKVTA.APGET--------------------VTVKATVDASGEGTVAVAGA---Q----FDV-------------
F0K9P7_CLOAE/41-180SNLKISSSSG.KTGSN--------------------VEVKVKASNV.AKKN.VICC---D----FKI-------------
Q8XTG8_RALSO/623-752SALTIQGPSSVPAGST--------------------FDVLVNVQPE.RP...FTSL---P----LTL-------------
O82830_CLOJO/287-424LKVSVGTAVG.APGDT--------------------VTVPVTFADV.AKVNNVGTC---N----FYL-------------
Q45996_9CLOT/1170-1307LKVAVGTASG.KAGDT--------------------VTVPVTFADV.ATVGNVGTC---N----FYV-------------
O30294_ARCFU/33-156MVVKIPDTSG.AVGGT--------------------VEVPVEVENA.QN...LGSM---D----IVI-------------
CBPA_CLOCL/1709-1847FAVKIDKVSA.AAGST--------------------VKVPVSLINV.SKVGNVCVA---E----YKI-------------
CBPA_CLOCL/668-801VTATVGTATV.NAGET--------------------VAVPVTLSNV.SG...ISTA---E----LQL-------------
Q9AE52_RUMFL/474-603VEWVIPKVDA.DAGDN--------------------VTLQVAVKG..DADLPVSAA---Q----FDV-------------
Q7UY44_RHOBA/195-328VQLPVGGSGT.ELPAG--------------------LPIQLSNADG......VTSV---T----MTI-------------
Q9RPL0_9FIRM/480-612FTVNVDSVNG.NVGEQ--------------------IVVPVSFANV.PSNG.VSTA---D----MTI-------------
Q9FDJ9_9FIRM/771-932VVATVDKTTA.SVGDI--------------------ITYTINVKDV.AG...FAGY---Q----ANV-------------
Q7WYN2_9FIRM/183-322LKAEIGSVSG.KPGSV--------------------VSVPITFSNV.PKSG.IYAL---S----FRI-------------
CIPA_CLOTH/562-702IKIKVDTVNA.KPGDT--------------------VNIPVRFSGI.PSKG.IANC---D----FVY-------------

PF09478

Q54SS3_DICDI/292-372-----------------QLQ.NV.--------------------------....QDIWN-------ADQ.TSTNNYKLP-
Q54UH2_DICDI/243-323-----------------KLN.NI.--------------------------....ISIWE-------VET.LSSNSYQLP-
Q54UH2_DICDI/352-432-----------------ELN.DI.--------------------------....QSIWE-------IQT.LSNNTFTLP-
Q54BC0_DICDI/1043-1124-----------------MMS.NI.--------------------------....DQIWG-------VTI.SSGPTYSLP-
Q55CG7_DICDI/1041-1122-----------------IIE.KIA--------------------------...YGQIWG-------VDA.NGNNRYTLP-
Q54U76_DICDI/53-136-----------------ATDADLA--------------------------...FNQIWG-------VNK..NGYLLDLP-
Q54DP5_DICDI/230-310-----------------TSS....--------------------------PLRPNSIWG-------LAVDETKNTWAL.-
Q55C74_DICDI/483-564-----------------AID....--------------------------K.TPSSSWE-------LNL.VSSNIVSFT-
Q54DJ4_DICDI/24-109-----------------VAESNLI--------------------------LDKPENIWS-------MEL.ISPNKYHFP-
Q86KB6_DICDI/23-109-----------------VGVSNLE--------------------------...LENVWS-------VEQ.ISSNKFSFP-
Q54EX0_DICDI/27-117-----------------TATANFF--------------------------SSKPSDIWN-------VEK.VSDKVYHFQ-
Q54LF5_DICDI/181-262-----------------HSD.NWN--------------------------...PTEFWN-------IVRSQKTGNLSFP-
Q54LG4_DICDI/193-274-----------------HSD.NWN--------------------------...PTEFWN-------IERNVQTGNLGFP-
Q54LG5_DICDI/182-259-----------------HSD.NWN--------------------------...PTEFWN-------VEKNAQTGNLGFP-
GUN2_ORYSJ/544-626-----------------GIG.KLY--------------------------....GPVWG-------LEK.AARYGYVLP-
GUN15_ORYSJ/535-613-----------------GVS.GLR--------------------------....GRLWG-------LEE..ARYGYVPP-
Q9ZSP9_SOLLC/533-611-----------------SIV.KLY--------------------------....GPLWG-------LTK..YGNSFIFP-
GUN19_ARATH/534-612-----------------SIT.KLY--------------------------....GPIWG-------VTK..TGNSFSFP-
GUN6_ARATH/528-606-----------------SIK.NLY--------------------------....GPIWG-------LSR..SGNSFGLP-
GUN13_ORYSJ/531-610-----------------QIK.ELS--------------------------....GEIYG-------VSRTNAKDMYEFP-
I1K6A1_SOYBN/532-609-----------------SIS.KLY--------------------------....GPIWG-------VTK..SGDSYTFP-
Q54DY8_DICDI/1219-1296-----------------EIF.DL.--------------------------....VNIWG-------VEL.LSNNTYQLP-
GUN5_ARATH/535-614-----------------KIE.DLS--------------------------....GPIWG-------LNPTGQKYTYQLP-

PF00553

GUND_CLOC7/411-512-----------------KWTM.PI--------------------------NQTITNMWS-------ASFVASGTTLSVTN
XYNB_CELJU/37-133-----------------NWQY.S.--------------------------SNRMTSGWN-------ANFSGT.NPYNATN
GUNC_CELJU/37-133-----------------SWQY.N.--------------------------SNRVTNLWN-------ANLSGS.NPYSASN
GUNA_CELJU/864-961-----------------NWSY.SD--------------------------GSRITNSWN-------ANVTGN.NPYAASA
GUNB_CELJU/30-127-----------------SWNYTD.--------------------------GSRVTSSWN-------AGLSGA.NPYSATP
GUN1_ACIC1/465-559-----------------SWTF.GG--------------------------NQTITNSWN-------AAVTQNGQSVTARN
D6Y6N8_THEBD/360-452-----------------QWTL.PS--------------------------GQSITQLWN-------GDLSTSGSNVTVRN
F4GZY2_CELFA/35-134-----------------DWTY.TA--------------------------GQRIQQLWN-------GTASTNGGQVSVTS
F4H3U7_CELFA/946-1044-----------------GFAF.PS--------------------------GQQVTQGWS-------ATWSQTGTTVTATG
F4H454_CELFA/408-507-----------------TFSF.PS--------------------------GQQVTQAWS-------STVTQSGSAVTVRN
Y1987_MYCTU/41-139-----------------EFDL.PA--------------------------GESVLHTWN-------STVARSGTHYVLSP
Q47RH8_THEFY/40-136-----------------VLTL.PG--------------------------GTTVAQVWN-------AQHTSSGNSHTFTG
Q7AKG2_STRCO/34-131-----------------EWDF.PT--------------------------GTKVTSAWD-------ATVTNSGDHWTAKN
Q9F3Q0_STRCO/58-156-----------------GFTMPDA--------------------------GQRLVQGWN-------ATWSQSGSAVTAGG

PF03173

I2BB67_SHIBC/32-191D...........QFAVTHIVGDLH--------------------------KLTPTDKFTGFPAGKSVEIPIVNEYWQLFM
A3QBY8_SHELP/54-215D...........AFELTQVKGDLH--------------------------RITPTERFSGFQKDQPVDIAFLGELWQLSE
B3PH90_CELJU/45-198A...........GLQIKHVQGDLH--------------------------ALEPSADFTGLAAGASLEVPYSGGNWIVSY
Q487J1_COLP3/52-215E...........DFTVKHLNGDLH--------------------------VIALQDKFSGFSAAETKKITFRAMFWSLSE
D3VAI6_XENNA/45-204V...........QYKITHITGDLY--------------------------KLEPTEKFTGIKANEKIVLPIIGEYWQIYS
Q87RM3_VIBPA/35-194E...........QFKISRVTGDLH--------------------------KLEPTDKFDGFAAGEEVVLPLIGEYWQLFE
A7MQU6_CROS8/34-190D...........QFKVTHVMGDLH--------------------------KLEPTDKFTGFPAKSSVEIPIINEYWQLFI
E6WFL0_PANSA/37-193D...........QFKMTHIVGDLT--------------------------RLEPTDKFTGFAAGATVDIPIVNEYWQLFI
X2GWP3_9GAMM/38-198D...........QFKITHVTGDLH--------------------------KLEPTEKFKNIPANAVVTIPIIGEYWQISE
D4ZH44_SHEVD/49-211K...........EFTITRVKGDLH--------------------------KIAPTTEFTGLKQGITKTIEFKGELWQLSE
Q6LTD2_PHOPR/61-220D...........QFKITHVTGDLH--------------------------TLEPTDKFDGFAEGETVVIPYIGEYWTLFE
W8V3I6_YEREN/37-196D...........QFTITHLTGDLH--------------------------KIEPSAKFTGFPANQAVEIPITGEYWQLFA
K1RL03_CRAGI/26-177PYK.DGFLFSDCKMKVFHINGNLF--------------------------KLKPENKFR.LNTGGSVECIIEASDWQSIR
A1S444_SHEAM/47-209T...........DFVIEHVKGDLH--------------------------RIKPTGNFGGFKANQSQTLAFRGELWQLSE
A7RSQ4_NEMVE/34-186KHNPDGYVLPGYGLKVTHVNGCQH--------------------------RIQPTADFKPLLPGDSRPVLFNAENWAVAK
Q5DYR6_VIBF1/39-198D...........QFKITRVTGDLH--------------------------KLEPTEKFDGFAAGEEVVIPLIAEYWQLFE
Q8CVD2_SHEON/53-215K...........EFSITHIKGDLY--------------------------RIAPTEAFSGFSKGVKKTLRFRGELWQLSE
A0KIG5_AERHH/37-197D...........QFTITHLTGDLY--------------------------RLTPTEKFQGFAKDATVEVPLVVEYWVLFE
Q7PC48_SACD2/44-221G...........EFTIDHINGDLH--------------------------RIRPSASYQGFNVGEVKKVQFIVAGLTLTE
W0LCL7_SERFO/37-196E...........QFKITHITGDLY--------------------------KLEPTDKFTSFPANQAVEIPIIAEYWQVFH
C5BGA1_EDWI9/35-194E...........QFKITFITGDLH--------------------------KIEPTDKFKGFAAGERIEIPIVGEYWQLFE
A8GB46_SERP5/37-196D...........QFKIAHLTGDLY--------------------------KLEPTDKFTGFPAGQTVEIPIIAEYWQLFK
D8MPP8_ERWBE/36-192D...........QFRMVHIVGDLT--------------------------RLEPTDKFKGIAAGETIEIPIVNEYWQLFI
R9VRJ9_9ENTR/35-192E...........QFKVTHIMGDLH--------------------------KLEPTDKFTGFPARQAIEIPIINEYWQLFI
B8CS99_SHEPW/50-212D...........EFTISRVKGDLH--------------------------KIEPSTGFKGILKGQTKTIRFRGDNWQLAE
D0LVP4_HALO1/53-212E...........DFTISHINGDLH--------------------------ALRPTASFAGFAAGEALNVAFVAEYWTLYQ
U4K583_9VIBR/34-198D...........LFTITHIDGDLH--------------------------RVSPTAKFNGLQPGESVTVEYDAEYWQIVN
Q7NXY3_CHRVO/32-191P...........QFTLRHITGDLY--------------------------QITPTAAFQGLAPGQKLELPLIDEYWILQE
I0DXS0_PROSM/38-196P...........QFKITHITGDLH--------------------------KITPTEQFKGIKAHEKVVLPLTGEYWQVSY
D3UXD7_XENBS/37-196E...........QYKITHITGDLH--------------------------KLEPTEKFIGIKANEKILLPIFGEYWQIYS
E1ST90_FERBD/37-199P............LTIEHINGDLH--------------------------RLFPGDDFAGLAAQQTQAVPYTANFWSVSN
Q7MBH3_PHOLL/37-196E...........QFKITRITGDLH--------------------------RLEPTEKFTGIKANEQVKLPFIGEYWQIYS

PF00942

F2JLD6_CELLD/535-617-----------------KYFLDLTDYIKAGG..--------------...VPSDLITSYNNSS---GK............
W6S3G9_9CLOT/4-92-----------------RYYYTID.........--------------...SKREQSFWCDYSS---MNV..GYNSISITD
S6D1L3_9EURY/574-658-----------------RYFIDISELREAGQ..--------------...SIDAVSVEVQYDQ---QATEGDG......S
I5ASR2_EUBCE/521-600-----------------RTYLDISDVLEKGY..--------------...KPSDIKTSTNFAQ---GS............
F3ZKG0_9ACTO/55-133-----------------RYYFRSD.........--------------...NAAAYRFACSWAV---K....GC......A
F2R1Y0_STRVP/44-122-----------------RYYFKAD.........--------------...AGASYTYACSWAV---K....GC......A
K4KPQ8_SIMAS/500-582-----------------RYFVDLSAEMAKGY..--------------...TAADVTVSTAYSQ---A.............
E3E7K8_PAEPS/879-959-----------------RYYYTIN.........--------------...GEKSQNFFTDWSS---S....GT......E
E3FP49_STIAD/660-740-----------------RYYFTLE.........--------------...SPATLQITCDWSV---L....GC......G
A3DCG3_CLOTH/379-458-----------------RYYYTID.........--------------...SESEQRFNCDWSS---I....GA......H
E3E5T1_PAEPS/389-469-----------------RYYYTDE.........--------------...SKQAQQFFVDWAK---I....GN......E
A9B7H5_HERA2/511-590-----------------RYFVDLSEVFAAGY..--------------...GLSDVTVSTAYTQ---G.............
A3DHY3_CLOTH/528-615-----------------RYFFNISELLDAGQ..--------------...SIDDVKIEVYYDE---NKASYDG......P
A3DBH1_CLOTH/345-424-----------------RYYFKEDV........--------------...SIDEMNWAVYFYS---L....GS......E
A3DJ30_CLOTH/745-825-----------------RYWFTSD.........--------------...GNEQNNFVCDYAA---F....GT......D
G8LUU2_CLOCD/545-634-----------------RYFFNISELINAGQ..--------------...SIDDVQMEVYYDE---NEKCYDG......K
G8TEL8_NIAKG/1181-1261-----------------RYWFTAE.........--------------...NYAGINTFIDYAQ---L....GS......A
W6RW99_9CLOT/507-586-----------------RYYYTKD.........--------------...GNEKQVFECDWCS---F....DS......N
G8LUA7_CLOCD/714-794-----------------RYWYTKD.........--------------...SDDAQECIFDYVK---I....GK......E
B8I7V0_CLOCE/36-124-----------------RYYYTQD.........--------------...ADKPLTFWCDHAG---YMS..GSNYIDATS
A4XIF5_CALS8/719-799-----------------RYWYTVD.........--------------...GERAQSAISDWAQ---I....GA......S
Q97KK3_CLOAB/486-568-----------------RYYVDLSELYKKGY..--------------...TVNDVGVRANYAA---GG............
L7VTG9_CLOSH/843-923-----------------RYYYTID.........--------------...GEKDQNFWCDWSS---V....GS......N
R7FAC7_9FIRM/489-575-----------------RYYMDLSEVISAGY..--------------...QPSDVAVRVDRDQ---AKMYDDCKP.....
Q65JI9_BACLD/504-585-----------------RYYVDLTEAVEAGY..--------------...SAEDIKVTAGYNE---G.............
B8I0N0_CLOCE/480-561-----------------KFFVDLSEFAAEGI..--------------...NPSKFTTKVYYSP---AD............
F2JH11_CELLD/994-1077-----------------RYYYTLE.........--------------...GNGAQTAYKDNAG---MNLNKAPWYVNLTP
GUN2_BACSU/357-436-----------------RYWYKAK.........--------------....NKGQNFDCDYAQ---I....GC......G
A5A671_BACLD/372-451-----------------RYWYKTN.........--------------....RKGQNFDCDYAQ---I....GC......S
A9KT90_CLOPH/488-569-----------------KYFIDISEYVAKGY..--------------...TKNDFTVSTNYNN---G.............
Q2SJA3_HAHCH/491-572-----------------RYWVDLSDEFAAGY..--------------...GLQDVKVTTAYSQ---A.............
R7MSD4_9FIRM/509-590-----------------RYYIDLSEVFEAGF..--------------...TVDDVQVKIGYDE---WGN...........
A3DC31_CLOTH/164-244-----------------RYYYTKE.........--------------...GNENETFWCNEFT---R....DG......S
Q097R6_STIAD/32-112-----------------RYWFTKD.........--------------...GATTVAPACWWWN---TAACPGI......S
G8LUA7_CLOCD/540-626-----------------RYFFNISEMLDAGQ..--------------...TIDDVDLQIMYDE---NASSYGG......P
A9GL35_SORC5/145-226-----------------RYWFTADV........--------------...AKVDLKSECDFSS---ILG..GC......A
L0G2U2_ECHVK/1172-1252-----------------KYWLTPE.........--------------...QVDVIKTRVDYAP---FG...........E
D9SS73_CLOC7/36-125-----------------RYYYTSD.........--------------...GTQGQTFWCDHAG---ALL..GNSYVDNTS
Q47MW0_THEFY/512-587-----------------RYWF....TLDEGV..--------------...DPADITVSSAYNQ---C.............
G8TEL8_NIAKG/1340-1416-----------------RYWFTED.........--------------...GTAALNSWVDYAK---L....GT......S
A3DD31_CLOTH/476-558-----------------NYYMDLTEVFEAGY..--------------...SVDDIKVTIGYCE---SGMD..........
G8LXL9_CLOCD/507-587-----------------RYYYTIDI........--------------...EDKQQVFYCDWSN---I....GR......N
D2B808_STRRD/501-576-----------------RYYF....TLDGDT..--------------...TASQVTVTSSYNQ---C.............
G8LUU2_CLOCD/727-807-----------------QYWFTAD.........--------------...SIAEPAFSCDFAH---I....SS......S
GUNI_CLOTH/743-823-----------------RYYYTKE.........--------------...GGASQNFWCDWSS---A....GN......S
D4LFJ4_RUMC1/492-578-----------------RYYMDLSEVIAAGN..--------------...KPEDVVIRCDRDQ---SAMYSDVTP.....
E4N479_KITSK/44-125-----------------RYYFKSDG........--------------...PSTTYRFACSWAV---K....GC......A
A3DEW0_CLOTH/42-124-----------------RYYFTDD.........--------------...GVSPITVFIDYAN---NNGR.GI......N
G8LUZ6_CLOCD/1397-1477-----------------RYYYTID.........--------------...GEKPQTFWCDWSS---A....GT......S
E3EAP2_PAEPS/1225-1305-----------------RYYYTID.........--------------...GDREQTFNCDYAA---L....SC......S
E6UCK4_RUMA7/672-761-----------------RYFFNIKELLDAGY..--------------...GIDYITARIDYDQ---VAGYSNN......K
H1YBR2_9SPHI/1732-1812-----------------RYWFTAE.........--------------...NYSGINTWVDYAQ---L....GN......S
B8I218_CLOCE/2196-2280-----------------RYYFTSD.........--------------...SDKDQSYWCDYAE---IKGASGQ..RNITS
D5UFH7_CELFN/504-581-----------------RYWF....TLDAGV..--------------...DASAVTVSTNYSE---CG............
G8LWU8_CLOCD/748-828-----------------RYYFTID.........--------------...GEKSQNFWCDWSP---V....GS......S
F2JLD6_CELLD/733-819-----------------HYYYTSD.........--------------...TQDKQQFWCDNAQ---IDMNKEPWYINLNS
E3EJF1_PAEPS/850-930-----------------RYYYTVD.........--------------...GDKAQEFHCDYAQ---L....GS......S
I0K9X8_9BACT/1267-1346-----------------RYWLTVED........--------------...FAPMTNLYIDWAQ---L....GT......N
D5SLE0_STRC2/48-129-----------------RYYFSSDA........--------------...PDASYRFACDWAV---R....GC......S
GUNF_CLOTH/488-569-----------------KYFVDISEAVAKGI..--------------...TLDQITVQSTTNG---G.............
GUNG_CLOCE/497-580-----------------KYFMDLSEIVAAGI..--------------...DPLSLVTSSNYSE---GKN...........
CIPA_CLOTH/372-461-----------------RYYYTVD.........--------------...GQKDQTFWCDHAA---IIGSNGS.YNGITS
D5UG75_CELFN/568-654-----------------RYFFDISELQADAQ..--------------...TIDDVRVDVYYDE---AKTLSGK......A
A8FDC3_BACP2/466-547-----------------RYYVNLSEVFAKGL..--------------...TEKDIQVTAAYNE---G.............
A0LVL3_ACIC1/518-593-----------------RYYF....TLDGST..--------------...TPAQISLSSAYNQ---C.............
Q82QF2_STRAW/597-678-----------------RYYFTRDS........--------------...GSPTVNAWCDYAA---V....GC......S
D9ST82_CLOC7/545-633-----------------RYFFNISELMQYNQ..--------------...GIDAITCPVMYDQ---SNTVDVK......G
I0K9X8_9BACT/1423-1501-----------------RYWFTAE.........--------------...GNQPLVYTVDYAE---L....GN......S
G8M373_CLOCD/188-272-----------------RYYYTNE.........--------------...EEKEQNFWCDYAA---ILNPKHS....PLT
R7ML41_9FIRM/560-649-----------------RYYFNISEQLEAGE..--------------...DISFIETRIDYDQ---EKSFTDG......K
F4A374_MAHA5/503-583-----------------KYFFDITEIVNAGH..--------------...SASEITVAKNYSE---VP............
D9SV33_CLOC7/38-126-----------------RYYYTSD.........--------------...GNQEQNFWCDHAG---ALL..GYNYVDNTS
A3DHY3_CLOTH/707-787-----------------RYWFTKD.........--------------...GASSQEFVCDYAH---L....SE......S
F2JH10_CELLD/502-584-----------------RYFVDISDVLAAGY..--------------...KASDMKISANYNQ---SG............
Q6D5R0_PECAS/360-440-----------------RYYFHDD.........--------------...GKPGANLFVDWAN---V....GP......N
R7H587_9FIRM/496-583-----------------RYYMDLSEVLDAGY..--------------...QASDVVVRCDRDQ---AQMYSDYAN.....
F2JH10_CELLD/988-1075-----------------RYYYTAD.........--------------...GSEGQTVWCDNAA---AQMNKAPWYSPYTS
A4XIF5_CALS8/494-575-----------------RYFVDLSELIKAGY..--------------...SPNQLTLSTNYNQ---G.............
R7H7U6_9FIRM/569-656-----------------RYYFNISELLKNGQ..--------------...SLEDISVRMDYDE---EKANSDG......K
A9KMK6_CLOPH/584-672-----------------RYYYTKE.........--------------...GTAKENFYCDTAA---MQLNKDPWYIPYTS
G8LUZ6_CLOCD/1194-1273-----------------NYYIDISEAINAGH..--------------...SASDIKVSANYNQ---G.............
D2BAV4_STRRD/35-116-----------------RYYFKADP........--------------...GASQYRFACSWAV---V....SC......S
GUNI_CLOTH/537-616-----------------RYFINIEEIVNAGK..--------------...SASDLQVSSSYNQ---G.............
A9KJ82_CLOPH/713-793-----------------RYYYTID.........--------------...GEISQNFWCDWAS---V....GS......E
L7VTG9_CLOSH/489-570-----------------RYFVDLTELIEAGY..--------------...SASDVTITTNYNA---G.............
A9KT90_CLOPH/841-921-----------------RYYYTIN.........--------------...GEKDQAFWCDYST---I....GS......S
R5VSS5_9FIRM/596-685-----------------RYFFNINEMLKAGQ..--------------...TIDDLDIEIYYDE---ENANTNG......E
M1MLG4_9CLOT/497-578-----------------KYFIDISEIIKAGY..--------------...TSKDITISTNYNQ---G.............
F2JID6_CELLD/34-122-----------------RYYYTVD.........--------------...EPLTQTLWCDHAG---LMGSKGY..ETITS
H6NM35_9BACL/438-516-----------------RYYFTKD.........--------------...GIQPLSFAVDWAQ---V....GS......P
R7FDD1_9FIRM/648-737-----------------RYYFNIDELTAIGE..--------------...DISMVETRVDYDA---ESAMTNN......K
B8I2K6_CLOCE/737-817-----------------KYWFTND.........--------------...GNQQNSFTCEYAA---L....GT......G
Q97KK5_CLOAB/497-578-----------------KYFIDISEFVKQGY..--------------...KASDIKVTTNYNE---G.............
H6NM36_9BACL/666-744-----------------RYYFTKD.........--------------...GSAGLDSWVDWAQ---V....GG......A
B8I7V7_CLOCE/541-629-----------------RYFFDISEMLAAGQ..--------------...TIDDLTVAVMYDE---GKASDGK......E
B1VPK7_STRGG/566-647-----------------RYWFTPDG........--------------...GASTFGTACDYAV---L....GC......G
F2JPM5_CELLD/858-938-----------------RYYFTTD.........--------------...GNQENFFWCDWSQ---V....GN......S
H6NDH3_9BACL/887-967-----------------RYYYTID.........--------------...GEKAQSFFCDWSS---A....GC......P
D2QPV6_SPILD/418-497-----------------RYWFTSE.........--------------...TSQLLNSYIDYAQ---I....GA......Q
A3DC27_CLOTH/515-595-----------------RYYYTKD.........--------------...QVINEIYTCDWSN---I....TS......S
A4XIF8_CALS8/490-570-----------------KYFIDLSELIKAGY..--------------...GPDIVKVETYYSE---G.............
C7PX61_CATAD/871-951-----------------RYWFTSDG........--------------...GSSTFATNCWYAV---I....GC......A
Q977Y4_CLOAB/40-128-----------------RYYFTAD.........--------------...GTQDENFWCDHAG---MLN..GYNYQTITS
V4KLB1_9ACTO/579-659-----------------RYWFTPD.........--------------...GSSAVNSTCDWAQ---L....GC......G
A3DCY5_CLOTH/490-571-----------------RYFMDLTEYVSAGY..--------------...NPNDITVSIIYSA---APT...........
G8LST1_CLOCD/340-417-----------------RYYFKDD.........--------------....YKNINFAVYFYS---L....GD.....EK
H1YBR2_9SPHI/1889-1968-----------------RYWFMED.........--------------...GSQSMNYWIDYAV---K....GT......N
D4LDI8_RUMC1/503-584-----------------RYYFDISEILAAGL..--------------...TVDDITVRIGYDE---YST...........
R7FFS6_9FIRM/505-590-----------------NYYFDISELVDAGY..--------------...SIDDVSVKIGYDQ---HSSDKGK.......
A3DIC9_CLOTH/55-150-----------------RYYFTLDSSD......--------------...SEETMNYEIYYAG---KSNIDGTGAVEDIK
A3DDF1_CLOTH/490-571-----------------RYFIDLTEVIEAGY..--------------...GPNDLIISGGQGS---S.............
G8M2T9_CLOCD/481-563-----------------RYFIDLSEYAGENI..--------------...DLSKFVTKVYYSP---AG............
H6NJY0_9BACL/593-671-----------------RYYFTKD.........--------------...GSQALQSWVDWAQ---I....GS......A
A0LVL3_ACIC1/753-834-----------------RYWFTRDG........--------------...GSSTLVYNCDWAA---I....GC......G
W6S3G9_9CLOT/174-261-----------------RYYFTSD.........--------------...SDKLQKFWCDHAS---ITT..GG.YKAITS
F2JNU4_CELLD/539-627-----------------RYFFDISEMVEAGQ..--------------...SLKELSVQVMYDQ---ASIVDGV......K
A3DBI3_CLOTH/794-874-----------------RYYYTID.........--------------...GEKGQQFWCDWSS---A....GN......S
G0GF20_SPITZ/498-578-----------------RYFIDLSEVFAAGY..--------------...TVNDITISTNYVE---FP............
E0RWD9_BUTPB/512-593-----------------RMFFDLSDVLAQGY..--------------...SASDMKISTTYMQ---HK............
G8LXM2_CLOCD/487-569-----------------RYFVDISEVVNAGY..--------------...KASDITVSASASN---G.............
D9SS71_CLOC7/498-579-----------------KYFINVSEFVNAGY..--------------...SADDLKVTVGYNT---G.............
C5BNA7_TERTT/495-574-----------------RYFYDLSEVFAAGY..--------------...SLNDLTVASGYNQ---A.............
M1MVT4_9CLOT/40-123-----------------RYYFTAD.........--------------...NKKGQEFHCYNAD---I....ADPYKSVTG
I0K805_9BACT/1555-1634-----------------RYYLTADA........--------------...NPDKLRFYLDYAL---L....GN......P
G8LYV1_CLOCD/158-238-----------------RYYYTKE.........--------------...GNASETFWCDYFT---K....GS......S
M1MVT4_9CLOT/205-289-----------------KYFYTAD.........--------------...GDEAETFNCYYAG---TVG..GD.YQNLTG
A9EQP9_SORC5/231-310-----------------RYWFTKN.........--------------...GATTVTPACWWWS---S....GC......S
A3DI46_CLOTH/56-139-----------------RYYFTNDGCSPIQVNI--------------KLFGTETESFNPELVK---TSVVTGL......S
A9KT91_CLOPH/775-855-----------------RYYYTID.........--------------...GEKSQSFWCDWSS---I....GS......S
GUX2_CLOSH/770-850-----------------RYYYTVD.........--------------...GDKPQNFWCDWAS---I....GS......S
Q9RK75_STRCO/42-123-----------------RYYFKADS........--------------...PNASYRFACSWAV---R....GC......A
L0G2U2_ECHVK/1326-1406-----------------RYWFTKD.........--------------...GGGALTFWKDYAE---L....GS......E
H6NJX8_9BACL/529-607-----------------RYYFTKE.........--------------...GAPPLNAWVDWAQ---V....GS......A
F2JNU4_CELLD/909-995-----------------RYYFTKE.........--------------...GNVGQTYFCDHAS---MTFNKAPWYAALTS
F4H3U7_CELFA/500-576-----------------RYWF....TTD.GF..--------------...AASDVTLSANYSE---CG............
G8LXR4_CLOCD/470-550-----------------HYYVDLSE....GV..--------------...DPSDVTVSTNYIE---PNMD..........

PF00963

SLAP1_CLOTH/34-195-----------------KFDPEVLQPVDPATGEEFTDKSMPVNR..VLLTNSKYGPTPVAGND---IKSGIINFATGYNN
O30295_ARCFU/279-418-----------------SY.PNVLEVEDVLQGS..................LTQNSLFDYNVE---GNQIKVGIA.....
CIPA_CLOTH/1549-1689-----------------SYDPNVLEIIEIEPGE..............LIVDPNPTKSFDTAVY---PDRKMIVFL..FAE
CBPA_CLOCL/291-428-----------------TFDSASLEVVSITAGD..............IVL..NPSVNFSST..---VSGSTIKLL..FLD
CIPA_CLOTH/31-168-----------------GYDPNVLEVTEVKPGS..............IIKDPDPSKSFDSAIY---PDRKMIVFL..FAE
CBPA_CLOCL/435-570-----------------SFDATLLEVASVTAGD..............IVL..NPTVNFSYT..---VNGNVIKLL..FLD
F0K9P3_CLOAE/1344-1482-----------------DYDASKFTVKDVLPNT..............DLVKDTDNYSFIAN.T---TSAGKISIT..FTD
Q9FDJ9_9FIRM/225-386-----------------KYNPAVLQPVYE.DGTAYDNASAPEYG...KLLQKRYSPTDMASND---ITKGTLTFGRTYMN
Q9RPL0_9FIRM/1161-1298-----------------TYDATKLEYVSGAAGS..............IVT..NPDVNFGIN.K---EADGKIKVL..FLD
F0K9P3_CLOAE/382-520-----------------NYDPTELTAKDVVPTD...............LVKDTDNYSFIVN.T---STPGKISIT..FTD
A3DF10_CLOTH/34-197-----------------VYDPKVLMAVDPETGKEFTSSTFPPGR..TVLKNNAYGPIQIADND---PEKGILNFALAYSY
Q9ZGA7_9CLOT/91-228-----------------KYDTDALEVVEVKSGE..............IFG..SNNSNFDYTVI---DTTGLVSFL..YTS
Q9RPL0_9FIRM/1621-1754-----------------TYDATKLQYVSGDAGS..............IVT..NPGVNFGIN.K---EADGKLKVL..FLD
Q7WYN2_9FIRM/40-179-----------------NFDKSMLSVVSVEPGS..............LI...EDPSDFNHYYN---NVNGLASMS..FEA
Q9FDJ9_9FIRM/1493-1654-----------------KYDPAVLQPVYS.DGTAYDNSSVPEYG...KLLQKRYSPTDMGAND---TANGILTFGRTYMN
D1NHZ3_CLOTM/34-172-----------------EYDSKLFKVIELKAGD..............IVE..NPSESFSYNVV---EKDEIIAVL..YLE
Q9RPL0_9FIRM/1304-1441-----------------TYDATKLDYVSGAAGS..............IVK..NPDVNFGIN.K---EADGKLKVL..FLD
Q7UY43_RHOBA/45-169-----------------SYDTSVLDLDADDIDFG.............SIWGAGSDTQVTANVD---DAAGTVVIF.....
Q9AE52_RUMFL/1217-1350-----------------TPDGDV........................QLVKSGDKSGYGADII---PSKDGYKFV..FAD
Q9AE52_RUMFL/58-185-----------------QAATGV........................RYSSKTDGDAYGSGIV---YNNS..KYA..FGQ
F0K9P3_CLOAE/616-754-----------------SYDASKFTVKDVLPNT..............DLVKDTDNYSFIVN.T---STPGKISIT..FTD
O82830_CLOJO/1023-1161-----------------TYDPTLLQAVSATAGD..............IVI..NAPVNFSSSIN---ATNGTISIL..FLD
Q9RPL0_9FIRM/1475-1612-----------------TYDATKLEYISGDAGS..............IVT..NPGVNFGIN.K---ESDGKLKVL..FLD
Q8PV77_METMA/33-166-----------------EYDGSLFQIAGVTEGN..............LFSQSGQNTLFSPGQI---ENGKLTNVYGCILG
CIPA_CLOTH/184-321-----------------RYDPNVLEIIGIDPGD..............IIVDPNPTKSFDTAIY---PDRKIIVFL..FAE
Q7WYN2_9FIRM/326-465-----------------NFDPQKVTVASIDAGS..............LI...ENASDFTTYYN---NENGFASMT..FEA
Q9AE52_RUMFL/194-326-----------------NADSPI........................VYDSAKEGGAYITSLT---VNDAKHKFA..FGR
F0K9P7_CLOAE/41-180-----------------KYDASKLDVSGISPGE..............ILK..DPKDNLEYNVD---SKNGVITILYSYSD
Q8XTG8_RALSO/623-752-----------------QYNPAQLQIISVTPGS..............LV...SANEVFANNID---AAKGLV.....YMT
O82830_CLOJO/287-424-----------------GYDASLLDVVSVDAGP..............IVK..NAAVNFSSS..---ASNGTISFL..FLD
Q45996_9CLOT/1170-1307-----------------TYDTNLLEVASVTPGS..............IVT..NAAVNFSSS..---TSNGTISFL..FLD
O30294_ARCFU/33-156-----------------VYDPTILKVQNVGKGE...................LNKGLLSSNTG---EGMVAISLA.....
CBPA_CLOCL/1709-1847-----------------SFDSSVLTYVGTTAGT..............SIK..NPAVNFSSQ..---LNGNTITLL..FFD
CBPA_CLOCL/668-801-----------------SFDATLLEVVSITAGD..............IVL..NPSVNFSSV..---VNGSTIKLL..FLD
Q9AE52_RUMFL/474-603-----------------NGATP.........................LNYQESAGKPYGVDLV---VNDTKQHFA..FAQ
Q7UY44_RHOBA/195-328-----------------QYDPALLDISGVQLGADAPTGSQVEANLDTPGVATITFFSLEAMDA---GQADIIDLIATIPE
Q9RPL0_9FIRM/480-612-----------------TYDSSKLEYVSGAAGS..............IVT..NPTVNFGIN.K---EADGKLKVL..FLD
Q9FDJ9_9FIRM/771-932-----------------KYDPAVLQPVYD.DGTAYDSAAVPEYG...TLLQKRYSPTDMASND---LSKGTLTFGRTYMA
Q7WYN2_9FIRM/183-322-----------------GYDNTKIRVVGVESGS..............LV...EKAEDFNMFIN---NTYNFTSMT..FEA
CIPA_CLOTH/562-702-----------------SYDPNVLEIIEIKPGE..............LIVDPNPDKSFDTAVY---PDRKIIVFL..FAE

PF09478

Q54SS3_DICDI/292-372-SWLG...EIPV-NG-------------------------AHQFGYIQR..S-------T--------------
Q54UH2_DICDI/243-323-NWVG...SISS-GS-------------------------SHSFGYIQQ..S-------N--------------
Q54UH2_DICDI/352-432-NWKN...SIEV-GS-------------------------SHTFGYIQK..A-------Y--------------
Q54BC0_DICDI/1043-1124-SWNP...TINP-GN-------------------------EYTFGYILK..G-------T--------------
Q55CG7_DICDI/1041-1122-SYNL...IINP-RD-------------------------QYSFGYII....-------Q--------------
Q54U76_DICDI/53-136-NYA....TIAP-GA-------------------------KYTFGYINN..G-------K--------------
Q54DP5_DICDI/230-310-QWYP...VIQP-GQ-------------------------TFSFGYII....-------D--------------
Q55C74_DICDI/483-564-SWNN...QISP-GQ-------------------------TLSFGYIVS..S-------S--------------
Q54DJ4_DICDI/24-109-SWITQNGGLNS-GA-------------------------KHTFGYINN..S-------G--------------
Q86KB6_DICDI/23-109-KYISQNGGLKN-GT-------------------------YFNFGYINK..S-------E--------------
Q54EX0_DICDI/27-117-PYLIQ.NGLST-GE-------------------------NFTFGYINEAKT-------Q--------------
Q54LF5_DICDI/181-262-PFVV...NLQA-GD-------------------------SFSFGFVS....-------A--------------
Q54LG4_DICDI/193-274-AFVS...TLKV-GE-------------------------SFSFGFVS....-------S--------------
Q54LG5_DICDI/182-259-SFVN...TLPV-GD-------------------------SFSFGFVS....-------A--------------
GUN2_ORYSJ/544-626-SWTP...SLPA-GE-------------------------SAAFVYVH....-------A--------------
GUN15_ORYSJ/535-613-RWLP...ALRP-GR-------------------------SLRFVYV.....-------Q--------------
Q9ZSP9_SOLLC/533-611-AWLN...SLPA-GK-------------------------SLEFVYIH....-------T--------------
GUN19_ARATH/534-612-SWMQ...SLPS-GK-------------------------SMEFVYIH....-------S--------------
GUN6_ARATH/528-606-SWMH...SLPS-GK-------------------------SLEFVYIH....-------S--------------
GUN13_ORYSJ/531-610-SWMT...RLDA-GA-------------------------QLTIVYI.....-------Q--------------
I1K6A1_SOYBN/532-609-SWLS...SLSA-GK-------------------------SLEFVYIH....-------.--------------
Q54DY8_DICDI/1219-1296-SWVY...SIPV-GS-------------------------SHNFGYIQ....-------.--------------
GUN5_ARATH/535-614-QWQK...TLRA-GQ-------------------------AYDFVYVQ....-------.--------------

PF00553

GUND_CLOC7/411-512AGYNG---TIAANGG-------------------------TQSFGFNINYSG-------VLSKPTGFTVNGTEC
XYNB_CELJU/37-133MSWNG---SIAP.GQ-------------------------SISFGLQGEKNG-------ST..AERPTVTGAAC
GUNC_CELJU/37-133LSWNG---TIQP.GQ-------------------------TVEFGFQGVTNS-------GT..VESPTVNGAAC
GUNA_CELJU/864-961LGWNA---NIQP.GQ-------------------------TAEFGFQGTKGA-------GS..AQVPAVTGSVC
GUNB_CELJU/30-127VGWNT---SIPI.GS-------------------------SVEFGVQGNNGS-------SR..AQVPAVTGAIC
GUN1_ACIC1/465-559MSYNN---VIQP.GQ-------------------------NTTFGFQASYTG-------SNAAPT......VAC
D6Y6N8_THEBD/360-452VSWNG---NVPA.GG-------------------------STSFGFLGSGTG-------QLSSSIT........
F4GZY2_CELFA/35-134LPWNG---SIPT.GG-------------------------TASFGFNGSWAG-------SNPTPASFSLNGTTC
F4H3U7_CELFA/946-1044LSWNA---TLQP.GQ-------------------------STDIGFNGSHPG-------TNTNPASFTVNGEVC
F4H454_CELFA/408-507APWNG---SIPA.GG-------------------------TAQFGFNGSHTG-------TNAAPTAFSLNGTPC
Y1987_MYCTU/41-139ANWNR---IIAP.GG-------------------------SATGGLRGGLTG-------SYSPPSSCLLNGQY.
Q47RH8_THEFY/40-136VSWNS---TIPP.GG-------------------------TASFGFIASGSG-------E...PTHCTINGAPC
Q7AKG2_STRCO/34-131VGWNG---TLAP.GA-------------------------SVSFGFNGSGPG-------S...PSNCKLNGGSC
Q9F3Q0_STRCO/58-156VDWNR---TLAT.GA-------------------------SADLGFVGSGAN-------..PAPTSFTLNGATC

PF03173

I2BB67_SHIBC/32-191TDVIPRWYVTSG-EA........TPKVIAST.....NS..EDLSRFVSPLGG.....DQWKRTPEDKNILMTAE
A3QBY8_SHELP/54-215TDAMPNYYIVVP-GL........KPELISSTQLTVDASTGMEQRPYVETYVS...AESQYKRSDTDKLKWATPQ
B3PH90_CELJU/45-198SDFMPRAFIAQP-GL........EAAVFANT.....DT..EDLTRFVSPFVR.PEQQLRFNAPTADAFPIVTS.
Q487J1_COLP3/52-215TDALPNYIVSAP-GL........DARVIESTVPYIDKDTGLEILPYVEPFTD...EKTQFKRTASDKTQWLTSE
D3VAI6_XENNA/45-204TDFIPRWYATSG-NA........EPKILANT.....DT..GNISEFLSALEG.....DQWKRTTADHNTLMTAE
Q87RM3_VIBPA/35-194TDFMPGAFVAAP-NA........EPKMIASL.....NT..EDVASFVTGLEG.....NNLKRTPDDNNIFASAV
A7MQU6_CROS8/34-190TDVLPRWYVTAD-DG........APKVIAST.....DT..ETLTDFVSPL.N.....DQWKRTPDDKNILMTAE
E6WFL0_PANSA/37-193TDVMPRWYVSAE-GA........SPKIITST.....NT..ENLADFVLPF.G.....DQWKRTADDKNVLMQPT
X2GWP3_9GAMM/38-198SDVMPRWYVTSS-KA........EPKVIANT.....DTDSDNLSAFVKPL.G.....EQWKISPNDHNILMTPE
D4ZH44_SHEVD/49-211TDAMPNYYLVSA-EL........EPVLIKSTAVTLDSETGMELRPYVVSFTD...EDKQYKRSDTDKVKWATAE
Q6LTD2_PHOPR/61-220NDYMPRAYVVSG-DA........KPKTIKST.....DA..EDPSAYLTPISG.....DNWKRTPDDNNVLATAQ
W8V3I6_YEREN/37-196TDFMPRWYATSG-DA........QPKVLKST.....DT..EDINEYLTQFTG.....DQWKRTKDDNNVLMTPQ
K1RL03_CRAGI/26-177FESMPNWYVAAE-GL........IPKDIVSTQ........GEALNFVGPFDT....PEKYLRFPGDKF......
A1S444_SHEAM/47-209TDAMPNYYITAP-GL........KPVVIASTRLAVEAETGLELRPYVEAFTD...ADKQYRRTDNDKLPWATA.
A7RSQ4_NEMVE/34-186TDVMPNFYVAAE-GL........QARTITSTS........GESLDFVGPFDN....KFKWKRFDPDK.......
Q5DYR6_VIBF1/39-198TDFMPGAFVTAP-GA........EARNIISL.....DT..EDTGEYVDEIIG.....VQLKRTLADNNVVATAN
Q8CVD2_SHEON/53-215TDAMPNYYIVAG-DL........SPVVIASTQVKQDPETRMEVRPYVEPFTD...MVKQYSRTDADKLAPATA.
A0KIG5_AERHH/37-197SDIMPNWYVASE-GA........EPKVLASM.....SN.IDDATTYEKPMPA.....DGWKRTKDDNNILMNSE
Q7PC48_SACD2/44-221AKIMPNYYVVAE-GQDNKQALYSEARVIESTRIRIHPETGLEERPFAGEISR.....QNFKLSQADKTPYADAA
W0LCL7_SERFO/37-196SDFLPRWYATSG-DA........KPKILANT.....DT..EDVNQFVAPFTG.....DQWKRTKDDNNILMVPE
C5BGA1_EDWI9/35-194SDVMPRWYVTSP-DA........KPKVIANT.....DT..EDLRQFVTPFAG.....DLWKRIKDDKNVLMTPE
A8GB46_SERP5/37-196TDFVPRWYATSG-DA........KPKILVNT.....DT..EDLSQFVTPFSG.....DQWKRIKDDNNILMTPA
D8MPP8_ERWBE/36-192TDVMPRWYATSG-DA........TPKILVST.....DT..EILTDFVEPF.G.....AQWKRIADDKNLLMDAQ
R9VRJ9_9ENTR/35-192TDVLPRWYVTAD-GA........TAKVIANT.....DT..EDLSRFVTPL.D.....NQWKRTPDDKNILMTAE
B8CS99_SHEPW/50-212TDAMPNYYIVAN-GS........APILIDSTKVEIDAETGLELRPYAADFTD...AEKQYKRTENDKVEWATS.
D0LVP4_HALO1/53-212SDFMPRYYLSAD-GL........DSRIIANT.....DS..DDSDAYAAPITG.....ENRKRTPQDNNVFATAQ
U4K583_9VIBR/34-198SDFMPNYYISAD-GL........KGELIKNTAVKEADTGFEDLSGFLTPISNDPADTDQWRRTADDKTNVATA.
Q7NXY3_CHRVO/32-191SDVLPRPYVTVD-GQ........PPALLRH......DS..SDEASYLLPLSG.....DNWKNPAGELRPLATPE
I0DXS0_PROSM/38-196SDFMPRWYATSG-DA........SPRNLKST.....DT..QDPTTFVTPFEL.....KNWKRTDADNNLLMTPE
D3UXD7_XENBS/37-196TDFMPRWYATSG-DA........MPKILANT.....DT..EDLSAFLSDFTD.....EQWKRTTLDNNILMTPE
E1ST90_FERBD/37-199SDPMPNYYLVAE-GL........EPVVIASTKEVRDPETGLWQLPFVEPLTD...PERQLRRTAEDNMAQATP.
Q7MBH3_PHOLL/37-196TDFLPRWYATSG-DA........KPKVLVST.....DT..EDLSQFLSAFTD.....DQWKRTQTDNNILMTPE

PF00942

F2JLD6_CELLD/535-617..VMIS.KVLPW.DE-------------------------SKHLYYVEV-------------------------
W6S3G9_9CLOT/4-92.KVTGTFYKLDTV.V-------------------------KGADYYLEI-------------------------
S6D1L3_9EURY/574-658..TDVS.GPIAW.DE-------------------------DAGIYYIEL-------------------------
I5ASR2_EUBCE/521-600..AVIS.ELKPT..G-------------------------KNGIYYCDL-------------------------
F3ZKG0_9ACTO/55-133.NVTGTFGTLAHP.T-------------------------ATADRYLEI-------------------------
F2R1Y0_STRVP/44-122.NLTGTFGTLANP.T-------------------------ATADRYLEI-------------------------
K4KPQ8_SIMAS/500-582..TSVS.QLKVWGDP-------------------------SKNIYYTEV-------------------------
E3E7K8_PAEPS/879-959.NVIANFKALTNA.K-------------------------PSADSYAEI-------------------------
E3FP49_STIAD/660-740.NMGFQSAQLASP.R-------------------------PGASHYLEI-------------------------
A3DCG3_CLOTH/379-458.NVTGSFGKVNPS.R-------------------------NGADTYVEI-------------------------
E3E5T1_PAEPS/389-469.KVKATFVTLPNP.K-------------------------SKADKYVEI-------------------------
A9B7H5_HERA2/511-590..SGVS.SLKQW...-------------------------AGTIYYVEI-------------------------
A3DHY3_CLOTH/528-615..AEVR.GPIKY.D.-------------------------DAGTYYVEV-------------------------
A3DBH1_CLOTH/345-424KDVQCRFYELPG..K-------------------------KEANKYLEI-------------------------
A3DJ30_CLOTH/745-825.KVKGIVKKIENS.V-------------------------PGADTYCEI-------------------------
G8LUU2_CLOCD/545-634..AKYL.GPIKY.D.-------------------------DSGTYYVEF-------------------------
G8TEL8_NIAKG/1181-1261.KVKAKYVQLDTP.R-------------------------AGAYGYIE.-------------------------
W6RW99_9CLOT/507-586.SITANFGSINKG..-------------------------NNADYYLDL-------------------------
G8LUA7_CLOCD/714-794.MVEAKFVDVSPA.V-------------------------ENADNYLEI-------------------------
B8I7V0_CLOCE/36-124.KVTGSFKAVSPA.V-------------------------TNADHYLEV-------------------------
A4XIF5_CALS8/719-799.NVTFKFVKLSSS.V-------------------------SGADYYLEI-------------------------
Q97KK3_CLOAB/486-568..GTLS.GFIPY.DE-------------------------AKHIYYVEA-------------------------
L7VTG9_CLOSH/843-923.NITGTFVKMAEP.K-------------------------EGADYYLET-------------------------
R7FAC7_9FIRM/489-575..AEIS.PITQY...-------------------------QGNIYYIEI-------------------------
Q65JI9_BACLD/504-585..ASVS.ELKPH.DA-------------------------SKHIYYTEV-------------------------
B8I0N0_CLOCE/480-561..AQIS.GIQPY.DK-------------------------EKNIYYVEI-------------------------
F2JH11_CELLD/994-1077.DVSVNVVP.....V-------------------------SGNQYYMEI-------------------------
GUN2_BACSU/357-436.NVTHKFVTLHKP.K-------------------------QGADTYLEL-------------------------
A5A671_BACLD/372-451.KITHKFVQLKKA.V-------------------------NGADTYLEV-------------------------
A9KT90_CLOPH/488-569..ATTS.ALLPW.DA-------------------------ANNIYYVNV-------------------------
Q2SJA3_HAHCH/491-572..TEVS.GLQPWGDP-------------------------DDHIYYVD.-------------------------
R7MSD4_9FIRM/509-590..CTIS.KPIQY...-------------------------DGNIYYIEI-------------------------
A3DC31_CLOTH/164-244.QVYGTFVKMSKP.K-------------------------ENADHYLEI-------------------------
Q097R6_STIAD/32-112.LVTGSVS......A-------------------------TGADQYVEV-------------------------
G8LUA7_CLOCD/540-626..IKYK.GPYKW.D.-------------------------DTGVCYVE.-------------------------
A9GL35_SORC5/145-226.NATRTFGEAS...G-------------------------TQADHYLEL-------------------------
L0G2U2_ECHVK/1172-1252DQVAMEYVRLDGP.R-------------------------EGAYGYVQ.-------------------------
D9SS73_CLOC7/36-125.KVTANFVKETASPT-------------------------STYDTYVEF-------------------------
Q47MW0_THEFY/512-587..ATPE.DVHHV...-------------------------SGDLYYVEI-------------------------
G8TEL8_NIAKG/1340-1416.NIITGINTVSPA.L-------------------------TSADRYFEI-------------------------
A3DD31_CLOTH/476-558..VEIS.PITHL...-------------------------YDNIYYIKI-------------------------
G8LXL9_CLOCD/507-587.SITGKLVKMNTG.R-------------------------NDADHYLEI-------------------------
D2B808_STRRD/501-576..KAPS.GPTLL...-------------------------SGKTYYVTV-------------------------
G8LUU2_CLOCD/727-807.NVEGRFIKLDKK.G-------------------------EGFDRYLEI-------------------------
GUNI_CLOTH/743-823.NVTGNFFNLSSP.K-------------------------EGADTCLEV-------------------------
D4LFJ4_RUMC1/492-578..AQIS.GIQHY...-------------------------SGDIYYVEV-------------------------
E4N479_KITSK/44-125.NITGTFGTLANP.T-------------------------ATADRYLEI-------------------------
A3DEW0_CLOTH/42-124NDVTYTIKDIN...S-------------------------SGANKYIEF-------------------------
G8LUZ6_CLOCD/1397-1477.NVTGSFNKLTAA.K-------------------------NGADYYLEI-------------------------
E3EAP2_PAEPS/1225-1305.KLNGKLVKMEKA.A-------------------------TSADYYLEV-------------------------
E6UCK4_RUMA7/672-761SHAELS.DPVKY.D.-------------------------DKGTYYVDI-------------------------
H1YBR2_9SPHI/1732-1812.NVSMAYIPLPEP.R-------------------------NGATGYIE.-------------------------
B8I218_CLOCE/2196-2280.SVKGSSVLFT...G-------------------------TQCDHYIEI-------------------------
D5UFH7_CELFN/504-581..TTPS.KVVHA...-------------------------GGSLYYAEL-------------------------
G8LWU8_CLOCD/748-828.NVTGQFVKMTQA.T-------------------------ATADYYLEV-------------------------
F2JLD6_CELLD/733-819.NISGKIMRMDQV.K-------------------------DGADHYLEI-------------------------
E3EJF1_PAEPS/850-930.NIQGRFVKLDKA.V-------------------------NGADYYLEI-------------------------
I0K9X8_9BACT/1267-1346.KVKLKYVALPQP.R-------------------------QGALGYVE.-------------------------
D5SLE0_STRC2/48-129.NLTGAFAAHTPA.T-------------------------ATADRYLEI-------------------------
GUNF_CLOTH/488-569..AKVS.QLLPW.DP-------------------------DNHIYYVNI-------------------------
GUNG_CLOCE/497-580..TKVS.GVLPW.DV-------------------------SNNVYYVNV-------------------------
CIPA_CLOTH/372-461.NVKGTFVKMSSS.T-------------------------NNADTYLEI-------------------------
D5UG75_CELFN/568-654..VSIG.EPVHV.G.-------------------------.DGLYYVEV-------------------------
A8FDC3_BACP2/466-547..ASLS.PLKVY.DA-------------------------SAHVYYAEI-------------------------
A0LVL3_ACIC1/518-593..SAPQ.GPTQY...-------------------------SGNIYYVTI-------------------------
Q82QF2_STRAW/597-678.NVSLKVVPLTTP.V-------------------------PGADAYLEV-------------------------
D9ST82_CLOC7/545-633..ATIS.APVEW.DK-------------------------EKGIYYVEI-------------------------
I0K9X8_9BACT/1423-1501.KVTGRFVKVN...R-------------------------TGADTYLEL-------------------------
G8M373_CLOCD/188-272.GVTGKFYKLSPA.T-------------------------QDANYYLEI-------------------------
R7ML41_9FIRM/560-649NEAHIS.EPVKY.D.-------------------------DNGTYYIEI-------------------------
F4A374_MAHA5/503-583..VTVS.GPTKW...-------------------------SGNIYYITV-------------------------
D9SV33_CLOC7/38-126.KVTGKFIKEPNS.T-------------------------PNYDTYLEI-------------------------
A3DHY3_CLOTH/707-787.MITAKFVDLENP.V-------------------------ENADNYLEI-------------------------
F2JH10_CELLD/502-584..AKIS.SLQPW.DA-------------------------QNGIYYVEI-------------------------
Q6D5R0_PECAS/360-440.NIVTSTGMPAAS.T-------------------------DKANRYVLV-------------------------
R7H587_9FIRM/496-583..AEIS.GLIHD...-------------------------EGSIYYIEV-------------------------
F2JH10_CELLD/988-1075.KVSGKVIKMDAT.K-------------------------AGADCYIQI-------------------------
A4XIF5_CALS8/494-575..AKVS.GPYVW.DS-------------------------SRNIYYILV-------------------------
R7H7U6_9FIRM/569-656..TAVS.YQMKQ.YN-------------------------KTGDCYIE.-------------------------
A9KMK6_CLOPH/584-672.VVNGTFNSMAVP.K-------------------------TKADSYLDV-------------------------
G8LUZ6_CLOCD/1194-1273..AKVS.ELKPL...-------------------------KGNIYYVTV-------------------------
D2BAV4_STRRD/35-116.TVTGTFGTIAPG.T-------------------------ATADRYLEV-------------------------
GUNI_CLOTH/537-616..AKLS.DVKHY...-------------------------KDNIYYVEV-------------------------
A9KJ82_CLOPH/713-793.NVKGEFVKLAKP.V-------------------------SGADYYLEI-------------------------
L7VTG9_CLOSH/489-570..AKVT.GLHPW.NE-------------------------AENIYYVNV-------------------------
A9KT90_CLOPH/841-921.NVNGTFVKMSTP.K-------------------------TNADYYLEF-------------------------
R5VSS5_9FIRM/596-685SFATIS.KPVKW.D.-------------------------DNGTYYVEI-------------------------
M1MLG4_9CLOT/497-578..AKVS.NLIPW.NE-------------------------AQNIYYVNV-------------------------
F2JID6_CELLD/34-122.SVTSKFEALSSP.T-------------------------ENADTYVEI-------------------------
H6NM35_9BACL/438-516.NVKGTFGSASGA..-------------------------.GADTYLEV-------------------------
R7FDD1_9FIRM/648-737TSATIS.EPIKY.D.-------------------------DNGTYYVEI-------------------------
B8I2K6_CLOCE/737-817.NVIGNFSNISNP.V-------------------------PGADTYCEI-------------------------
Q97KK5_CLOAB/497-578..GTAS.QLIPW.DE-------------------------KNNIYYVNV-------------------------
H6NM36_9BACL/666-744.NVQRVFGSASGT..-------------------------.GADTYVEI-------------------------
B8I7V7_CLOCE/541-629..TAIN.GPFAW.DA-------------------------EKGIYYVEI-------------------------
B1VPK7_STRGG/566-647.NVTHGVRSASTP.A-------------------------TGASHYLEV-------------------------
F2JPM5_CELLD/858-938.NVKGTFVKMDNP.T-------------------------EAADCYLEI-------------------------
H6NDH3_9BACL/887-967.NVTGTFGKPAAA.K-------------------------PGADSYLEI-------------------------
D2QPV6_SPILD/418-497.TIKHNVVRLAQP.V-------------------------SGADSYLEL-------------------------
A3DC27_CLOTH/515-595.KITGTVVQMSNP.K-------------------------PNADSYVEI-------------------------
A4XIF8_CALS8/490-570..GKIS.GPYVW.NA-------------------------SKNIYYILV-------------------------
C7PX61_CATAD/871-951.KVTQSVSSVTA..T-------------------------TGADHYVQV-------------------------
Q977Y4_CLOAB/40-128.NVVGTFVAMDNA.T-------------------------ATADHYLEI-------------------------
V4KLB1_9ACTO/579-659.GVTHTVEQASGS.A-------------------------PGASHYVEV-------------------------
A3DCY5_CLOTH/490-571..AKIS.KPILY.DA-------------------------SKNIYYCEI-------------------------
G8LST1_CLOCD/340-417NDVKGKVYNIRQ..S-------------------------DSSHKYLEV-------------------------
H1YBR2_9SPHI/1889-1968.NISGKIVTLNTP.L-------------------------TGADHYFE.-------------------------
D4LDI8_RUMC1/503-584..TQIS.KPIQY...-------------------------DGNVYYVEI-------------------------
R7FFS6_9FIRM/505-590..ISIS.DPIQY...-------------------------SGNIYYVKL-------------------------
A3DIC9_CLOTH/55-150PNTIVKIAKMDIP.T-------------------------DMADHYLEI-------------------------
A3DDF1_CLOTH/490-571..GKVS.GPHLW.NK-------------------------EKNIYYIEV-------------------------
G8M2T9_CLOCD/481-563..AEIS.GLKPW.DK-------------------------DKNIYYVEI-------------------------
H6NJY0_9BACL/593-671.NVNRTFGTASGT..-------------------------.GADTYVEL-------------------------
A0LVL3_ACIC1/753-834.NIRASFGSVNPA.T-------------------------PTADTYLQL-------------------------
W6S3G9_9CLOT/174-261.SVLGTFGSFTPS.E-------------------------KSVDSYLEI-------------------------
F2JNU4_CELLD/539-627..TNIN.GPFMW.DE-------------------------EKNIAYIEL-------------------------
A3DBI3_CLOTH/794-874.NVTGKFVKLSSP.K-------------------------NNADYYLEI-------------------------
G0GF20_SPITZ/498-578..VTIT.GPVHY...-------------------------AGNIYYVEV-------------------------
E0RWD9_BUTPB/512-593..VNIS.EFKKS.D.-------------------------KDGIYYVDV-------------------------
G8LXM2_CLOCD/487-569..AKVSPKLIEW.DA-------------------------SKNIYYVEV-------------------------
D9SS71_CLOC7/498-579..GTVS.NLIPW.DK-------------------------ENNIYYVNV-------------------------
C5BNA7_TERTT/495-574..SDVT.GLQHW...-------------------------DGNVYYVEA-------------------------
M1MVT4_9CLOT/40-123.NVTGKFVKMESK.A-------------------------DGADTYLEI-------------------------
I0K805_9BACT/1555-1634.NVTGRFVKLDPV.L-------------------------ANADAYLEL-------------------------
G8LYV1_CLOCD/158-238.NVIGSFAKLNND.K-------------------------NNANSYLEI-------------------------
M1MVT4_9CLOT/205-289.NVEGKIVKLGSA.V-------------------------ANADSYIQV-------------------------
A9EQP9_SORC5/231-310.RITLTTGTVS...Y-------------------------TGADRYVQI-------------------------
A3DI46_CLOTH/56-139..............Y-------------------------PGADSYVEI-------------------------
A9KT91_CLOPH/775-855.NVTGTFVKMATP.K-------------------------TGADYYLEI-------------------------
GUX2_CLOSH/770-850.NVTGTFVKMDGA.T-------------------------TGADYYLEI-------------------------
Q9RK75_STRCO/42-123.AVTGTFGTLANP.T-------------------------AAADRYLEI-------------------------
L0G2U2_ECHVK/1326-1406.NLEGTFMAVEAS.T-------------------------AMADHYLDI-------------------------
H6NJX8_9BACL/529-607.NVLRSFGEAAGP..-------------------------.GADTYVEL-------------------------
F2JNU4_CELLD/909-995.DITYKVVNLDTP.V-------------------------NGADTYLEL-------------------------
F4H3U7_CELFA/500-576..AQSG.KGVSA...-------------------------GGTLGYVEL-------------------------
G8LXR4_CLOCD/470-550..ATVS.QLIPY.PN-------------------------KPNIYYVEV-------------------------

PF00963

SLAP1_CLOTH/34-195LTAYKSSGIDEHTGIIGEIGFKVLKKQNTSIRF...EDTLSMPGAISGTSLFDWDAETITGYEVIQ.PDL.IVV
O30295_ARCFU/279-418....DSNGISGD.GSLFYVKFRVTGNEKAEQAENVKGKLRGLGQQLSEITLRNSHALTLQGIEIYDIDGNSVKV
CIPA_CLOTH/1549-1689DSGTGAYAITED.GVFATIVAKVKEGAPEGF............SAIEISEFGAFADNDLVEVETDL.INGGVLV
CBPA_CLOCL/291-428DT.LGSQLITKD.GVFATITFKAK.AITGTTAKV.........TSVKLAGTPVVGDAQLQEKPCAV.NPGTVTI
CIPA_CLOTH/31-168DSGRGTYAITQD.GVFATIVATVKSAAA...............APITLLEVGAFADNDLVEISTTF.VAGGVNL
CBPA_CLOCL/435-570DT.LGSQLISKD.GVFVTINFKAK.AVTSTVT...........TPVTVSGTPVFADGTLAEVQSKT.AAGSVTI
F0K9P3_CLOAE/1344-1482PT.LEKFPISAD.GVIANIDFVVNSGAATGDS...........DLTVNSSGFIVADESDTDIDHVS.TNGKITV
Q9FDJ9_9FIRM/225-386LDSYKNSGAAEKEGSIAVIRFKVLKVEATTITL...QNAASLTNAVDGTMLFDWTGAQLAGYRVQQAPSINGVV
Q9RPL0_9FIRM/1161-1298YT.MATEYISKD.GVFANLTFKIKSTAAAGTT...........AAVGIAGTATFGDSALKPITAVI.TDGKVEI
F0K9P3_CLOAE/382-520PT.LGTYPIGTD.GIFAYLEFLVAGEKAGKY............DLKVNPTTLILADENDNDIDCNPPKDGSVTV
A3DF10_CLOTH/34-197IAGYKETGVAEESGIIAKIGFKILQKKSTAVKF...QDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSLGD
Q9ZGA7_9CLOT/91-228SN.SGKDAVTKP.GVITNITFKIKDNAKKGS............IKISQGTSGAFGDTELKKINPVF.TEGEITV
Q9RPL0_9FIRM/1621-1754YT.MTTQYISED.GVFANVTFKVIGTDG...............LAAVNAEDATFGDSSLSPVTASV.VNGGVNI
Q7WYN2_9FIRM/40-179PV.DGSRMIDNN.GVFASIKFKISETAPVGESY..........DITTNYSRTSFYSTGTEEIVNILCNNGAINV
Q9FDJ9_9FIRM/1493-1654LSGYKASGVAEKEGSIAVISFKVLKATETKVLL...KNVPSLTSPVDGTMVFDWDGVQLADYKVTQAPAVNAPV
D1NHZ3_CLOTM/34-172ETGLGIEAIRTD.GVFFTIVMEVSKDVKPGI............SPIKFESFGATADNDMNEMTPKL.VEGKVEI
Q9RPL0_9FIRM/1304-1441YT.MATEYISAD.GIFANLTFKIKSTAVNGDV...........AAISKSGTATFGDKNLGPISAVI.KDGSVTV
Q7UY43_RHOBA/45-169..VSASSALTDVSGSLVELPFSVASNA.........................VVDSTTVLDLTQVTLNEGQISV
Q9AE52_RUMFL/1217-1350GA..GVAHVAPDGTVVIELTYKVGEEVAPGTV...........IPVSIKDLYVVDEDGNDITKYVMPVDGSIIV
Q9AE52_RUMFL/58-185GA..GRGIVAADDSVVLTLAYTVPADCAEGT............YDVKWSDAFVSDTDGQNITSKVTLTDGAIIV
F0K9P3_CLOAE/616-754PT.LANYPISVD.GILAYLDFIINSNATAGDS...........ALTVDPATLIVADENDKDIKDAA.SNGKITV
O82830_CLOJO/1023-1161NT.ITDQPIASD.GVITNLTFKVLGSSSTT.............TPIAFKAGGAFGNGNMAKISDITFTNGSAKL
Q9RPL0_9FIRM/1475-1612YT.MSTGYISTD.GVFANLNFNIKSSAAIGSK...........AEVSISGTPTFGDSTLTPVVAKV.TNGAVNV
Q8PV77_METMA/33-166SSSVSTP......ETFATVTLKANTGVQGTSQFYLR......NVTVSSSASK.........PVDVRLVNTGITI
CIPA_CLOTH/184-321DSGTGAYAITKD.GVFAKIRATVKSSAP...............GYITFDEVGGFADNDLVEQKVSF.IDGGVNV
Q7WYN2_9FIRM/326-465PV.DRARIIDSD.GVFATINFKVSDSAKVGELY..........NITTNSAYTSFYYSGTDEIKNVVYNDGKIEV
Q9AE52_RUMFL/194-326TT..GTGIVAADKATVAAFTYKVPSDCTEGT............YDVKWSGGFVSDADGKDITSRVTFVDGSITV
F0K9P7_CLOAE/41-180KN.IGKELISKN.GDFVTLNLKIKDDAKKGK............TQISFNGNPEFYDKNQKGVSVTT.NKGEIEI
Q8XTG8_RALSO/623-752MNAKQTQGKDGA.GNVVRLTFKALAAGETSIHMQ.........DQMLITPSG........MASLKPTAPLVMTV
O82830_CLOJO/287-424NT.ITDELITSD.GVFANITFKIKSTATQGT............TPITFKDGGAFGDGTMSKIASVIKTSGSVVI
Q45996_9CLOT/1170-1307NT.ITDQLIKTD.GTFAEIKFKLKSVTAKTT............TPVAFKDGGAFGDGTMAKIATVTKTNGSVTI
O30294_ARCFU/33-156....DSKGINGK.GSVAVITFQVLKAGS...............TDLTIQSVKAYDVNTHVDIPVKA.DNGKFEA
CBPA_CLOCL/1709-1847NT.IGNELITAD.GQFATIEFKVNAAATSGTT...........AEVKVATISSFADASLTEITKVATVNGSVKV
CBPA_CLOCL/668-801DT.LGSQLISKD.GVFATINFKAK.SVTSTVT...........TPVKVSGTPVFADGTLAELSYET.VAGSVTI
Q9AE52_RUMFL/474-603AS..GISKTAKDGDKLFTITFKVPEDCADGI............YPVTWAKQFVSDENGNNITDKVTFTDGWVRV
Q7UY44_RHOBA/195-328DAPYGST......GSLTISSLDVNAGA...........................MTASADDAIQVVAFPGDVNA
Q9RPL0_9FIRM/480-612YT.MSTGYISTN.GVFANVTFKVLNSAP...............TTVGITGA.TFGDKNLGNISATI.NAGSING
Q9FDJ9_9FIRM/771-932LDSYKASGSAETTGSIAVIRFKVLRSTATAILL...QNAASLTNAVDGTMLFDWTGAQLKGYKVAQASSINGTV
Q7WYN2_9FIRM/183-322PI.DGSRMIKSD.GVFAQVKFQISDTALQGETY..........KISQISSNTSFYSTAVTEITDVIYADGAIKV
CIPA_CLOTH/562-702DSGTGAYAITKD.GVFATIVAKVKSGAPNGL............SVIKFVEVGGFANNDLVEQRTQF.FDGGVNV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window