Sequence alignment for CL0203

PF09478

Q54SS3_DICDI/292-372-ANVTQKIINQWYSN----NV.YY.-------------IQVDATINNK-G...SKPVR---G----FNF-----------
Q54UH2_DICDI/243-323-VNITQTIVNSWNDG----NQ.DF.-------------IQVQVVITNI-G...PTTIR---S----FSF-----------
Q54UH2_DICDI/352-432-ANVTQTITSSWREN----NQ.DY.-------------IQVETIITNI-G...QSMIQ---S----YTF-----------
Q54BC0_DICDI/1043-1124-YQVDQTIISKWINS----EVYHY.-------------LQASITIKNN-G...IKPIK---A----FSF-----------
Q55CG7_DICDI/1041-1122-YEVIQSIVATWIDS----EKYPY.-------------LQASITIKNT-G...TRPIK---A----FSF-----------
Q54U76_DICDI/53-136-LTIIQTITNSWSDN----NGKEFK-------------TQVSVDIINN-T...KRTVK---D----VII-----------
Q54DP5_DICDI/230-310-LKIDQTRYSSWFEN----GK.TV.-------------SQFGGIITNT-G...SVTVT---N----PTF-----------
Q55C74_DICDI/483-564-AVIKQTIRQTWFDG----TN.TN.-------------TLVDCTLTNP-S...SSPIP---I----PRF-----------
Q54DJ4_DICDI/24-109-ISISQIQTGSWDSH----SA....-------------..WEVTLINT-G...TRPII---D----ATL-----------
Q86KB6_DICDI/23-109-LTISQALTSSWNHN----GQ.PF.-------------SVWDVRVRNT-G...KAIVF---G----ATI-----------
Q54EX0_DICDI/27-117-ISMSQNQTSTWDDK----NT.TF.-------------TVWEVMLVNN-W...NATII---D----LTI-----------
Q54LF5_DICDI/181-262-INYKLDTDSNWVAN----GV.TY.-------------YQYKVTLTNN-E...SSPIK---S----IEI-----------
Q54LG4_DICDI/193-274-ISYKLNIDNQWITS----GV.TY.-------------YQYKLTLTNN-E...ATAIK---S----IEI-----------
Q54LG5_DICDI/182-259-L....DIDWQWDSN----NV.HY.-------------YQYRVTVTNN-D...STAIK---S----IQI-----------
GUN2_ORYSJ/544-626-VEIEQKATASWEKD----GR.TY.-------------HRYAVTVSNR-SPAGGKTVE---E----LHI-----------
GUN15_ORYSJ/535-613-IGIEQNVTGTWARR----RR.TY.-------------YRYAVTVTNR-S..RGKTVR---E----LHL-----------
Q9ZSP9_SOLLC/533-611-VTIQQRATSSWALN----GK.TY.-------------YRYSAVVTNK-S...GKTVK---N----LKL-----------
GUN19_ARATH/534-612-ITISQKMTNSWKNE----GK.VY.-------------YRYSTILTNR-S...TKTLK---I----LKI-----------
GUN6_ARATH/528-606-VAIVQKITSSWVSK----GR.TY.-------------YRYSTTVINK-S...SRPLK---S----LNL-----------
GUN13_ORYSJ/531-610-LEFVHTVTNTWKAN----GV.DY.-------------YRHVVTAKNT-C...GHAIT---Y----LKL-----------
I1K6A1_SOYBN/532-609-ISIEQKMTTSWIAH----GI.TY.-------------YRYSTVVTNK-S...NKSLN---S----LNL-----------
Q54DY8_DICDI/1219-1296-INVSQSIVNSWREN----TQ.DF.-------------IQVEVNLKNI-G...QNTVY---Q----FSF-----------
GUN5_ARATH/535-614-IEFLHSITSNWIAG----NT.RY.-------------YRHKVIIKNN-S...QKPIS---D----LKL-----------

PF00553

GUND_CLOC7/411-512-VEVTYAITNSWGSG-----------------------ASVNVTIKNN-G---TTPIN---G----WTL-----------
XYNB_CELJU/37-133-AACTYTIDSEWSTG-----------------------FTANITLKND-T---GAAIN---N----WNV-----------
GUNC_CELJU/37-133-AGCEYVVTNSWGSG-----------------------FTAAIRITNS-T---SSVIN---G----WNV-----------
GUNA_CELJU/864-961-GNCQYVVTNQWNNG-----------------------FTAVIRVRNN-G---SSAIN---G----WSV-----------
GUNB_CELJU/30-127-AVCEYRVTNEWGSG-----------------------FTASIRITNN-G---SSTIN---G----WSV-----------
GUN1_ACIC1/465-559-CTASYQVNSDWGNG-----------------------FTVTVAVTNS-G---SVATK---T----WTV-----------
D6Y6N8_THEBD/360-452-CEATYALVNQWPGG-----------------------FQAEVTVKNT-G---SSPIN---G----WTV-----------
F4GZY2_CELFA/35-134-CRVDYAVTNQWPGG-----------------------FGANVTITNL-G---DPVS.---S----WKL-----------
F4H3U7_CELFA/946-1044-CTVVYSTN.SWNVG-----------------------FTGSVKITNT-G---TTPLT---.----WTL-----------
F4H454_CELFA/408-507-CQVLWGVN.QWNTG-----------------------FTANVTVKNT-S---SAPVD---G----WTL-----------
Y1987_MYCTU/41-139-.RATLSVTSTWQTG-----------------------FIARFTITNS-S---TAPLT---D----WKL-----------
Q47RH8_THEFY/40-136-.TATVTKESSWDNG-----------------------YSASVTVRND-T---SSTVS---Q----WEV-----------
Q7AKG2_STRCO/34-131-ATATFAKTSDWGTG-----------------------FGGSWTVKNT-G---TTSLS---S----WTV-----------
Q9F3Q0_STRCO/58-156-CKAEYTITSQWEGG-----------------------FQAGVKITNL-G---DPV.S---G----WTL-----------

PF03173

I2BB67_SHIBC/32-191QLAVNYTINDNHAGA----NGVDCA....ALGADWASCNKATITLTNH-G---.AAIT.DKD....WAIYFPSIRQILKI
A3QBY8_SHELP/54-215.LAVNYHTLTNYPQQ----....CT....STGVD.GRCFAAQIELVPG-.---.VDFD.RKD....WAIYYSQMRPVKQV
B3PH90_CELJU/45-198DAQLAFAPVSNFALG----HGQ................FQAQLTLNNQ-S---AIALPAGKG...DWRIYIHSIRKLHEN
Q487J1_COLP3/52-215NLEVNYRVVTNIPTD----K...CD....SKIAD.GACFEVELSFTAK-.---.KAIA.AKD....WTIHFSQISPIQSF
D3VAI6_XENNA/45-204QLKVNFKVIDNQAGS----HGTDCA....ILGADSAACNRVNITLGNG-N---.QAIN.SAD....WALYFHSIRQILKL
Q87RM3_VIBPA/35-194NLDIQYQVLTNHGAN----EGLACQ....DLGAEWASCNKVNMTLVNQ-G---.EAVN.SKD....WAIYFHSIRLILDV
A7MQU6_CROS8/34-190..GLNYTITDNQAAQ----HGTDCA....ALGADWASCNKAVITLTNP-G---.DAVT.DKN....WTIWFHSIRQILKV
E6WFL0_PANSA/37-193..GVQYQITDNQAAS----HGVDCA....QLGADWASCNRATIKLTNH-G---.PAIT.SKN....WAIYMSNVHETLRV
X2GWP3_9GAMM/38-198QLHLNYQIVDNDAAN----HGVDCA....ALGADWASCNKVTLTLKNT-G---.PAIT.SND....WAIYFHNIRMILAV
D4ZH44_SHEVD/49-211TLEIKYRVVTNYPQG----....CS....TSGVD.GRCFTAQIDLTSA-.---.VDLD.SHD....WAIYFSQMRPVQSV
Q6LTD2_PHOPR/61-220NLDVNYELVTNHGAN----EGLKCQ....ELNAEWASCDLINLTLVNN-G---.PAVD.SKD....WTIYFHSIRMILDV
W8V3I6_YEREN/37-196TLKVNYKVLDNRAAE----NGVDCA....KLGADWASCNKVLITLTNT-G---.DEIK.GQD....WAIYFHSIRQILTV
K1RL03_CRAGI/26-177NLNIKYDVINNLLNG----................KSTFVSKITLENT-G---GSDIK.PGS....WELFFYSLHLIQPN
A1S444_SHEAM/47-209GLDVKYRVVTNRPDE----Q...CK....KDAGE.GRCFQAEIVLTSP-.---.IDFD.GRD....FEIYYSQMRPVQSV
A7RSQ4_NEMVE/34-186NLGIRYDVLDNFQDS----................WRSYKVQLTLSNA-G---SQAIA.NGD....WSIYLCHIRVIEPV
Q5DYR6_VIBF1/39-198NLDINYTVITNQGAD----DGLACK....ELQAEWASCNKVNMTLTNT-G---.EAID.SKD....WTIYFHSIRLILDV
Q8CVD2_SHEON/53-215NLGVTYRVLTNRPDD----N...CD....KAAAE.GRCFVAEIDFVPE-.---.VDLI.GKE....WAIYFSQMRPVQSV
A0KIG5_AERHH/37-197NLVVKYEVVTNDGAG----AGLDCQ....ALGSEWASCGVAKLHLTNT-G---.ADVT.SKD....WSIYVSSIRRIQRV
Q7PC48_SACD2/44-221NMQVHYQVLLNKGDG----E...CSLPSLPPSPK.SPCSIVELSLSSP-.---.DKLA.ANDLDGNWSIYFSQTDPIYAH
W0LCL7_9GAMM/37-196QLNVKLQMQDNRAAD----HGVDCA....KLGADWASCNKVLITLTNS-G---.QEIK.GQD....WAIYFHSPRQTLKV
C5BGA1_EDWI9/35-194QVKVNYAVTDNRGAE----NGVNCA....ALGADWASCNQAVISLTND-G---.SAIE.GKE....WAIYFHNIRQILKS
A8GB46_SERP5/37-196QLKLNLKMVDNRAAD----SGLDCG....KLGADWAACNKVLISLTND-H---.QEIK.GHD....WAIYFHSARQTMRV
D8MPP8_ERWBE/36-192..GVKYKVTDNLAAQ----HGVDCA....GLGADWASCNRATISFTNP-G---.PAID.SKD....WAIYMSNVHETLKV
D0LVP4_HALO1/53-212.IELRYELLETHGAQ----AGVDCK....ALAGDYASCHTARLVLSNR-G---EEALP.SGG....WTLYFHSIRRVLSV
U4K583_9VIBR/34-198.LNVSTSLVVNQPTD----SKAECP.........WGLCYRAEITITNT-S---DKAV..NKD....WDLYFPSIHRVLDT
Q7NXY3_CHRVO/32-191.LSLKIAVDSNKGAA----AGAPCA....DLGADWASCLKGRLILENK-G---GQAVPAGGG....WNLYLHSIRRILKL
D3UXD7_XENBS/37-196QLKVNFKIKDNQAGA----HGTDCA....ILGADGASCNRVHITLANG-N---.QAID.SSD....WAIYFHSIRQILKV
E1ST90_FERBD/37-199QLQVVHRVVDNRPGP----H...CR....EDKGD.GACYRAEIELTTG-D---.TALP.ATG....WELRFSQVSYVQGS
Q7MBH3_PHOLL/37-196QLKVNYKVVDNQAGD----HGVNCA....VLGADWAKCNRVDITLTNG-N---.QAID.SID....WAIYFHSIRQVLSV

PF00942

H6NM36_9BACL/665-744---VQYRAGNTNAAD....NA.----------------ISPHFNIKNN-GTA.AVNLS---D----LKIRYYFTKD....
A3DC31_CLOTH/163-244---VQYKNGDSTSSV....TA.----------------IYPIFKITNN-GDT.SVKLS---D----IIIRYYYTKE....
A3DJ30_CLOTH/744-825---VSYKCGVKDGTK....NT.----------------IRATINIKNT-GTT.PVNLS---D----IKVRYWFTSD....
G8LST1_CLOCD/336-417---LKHYNEQQSLYS....KA.----------------IRWDFVIENT-GNS.YIDLR---N----VKVRYYFKDD....
F4A374_MAHA5/502-583---ANARV.TSE.QT....NF.----------------TEISVDLTNH-SAWPARSLD---R----MSYKYFFDITEIVN
F2R1Y0_STRVP/43-122---VQYRQSATGS......DQ.----------------VEPWLKVVNT-GST.SVPLS---Q----VKVRYYFKAD....
R5VSS5_9FIRM/595-685---IDARV..MQETD....AR.----------------SQIEISICND-TSLPPRYIS---T----LSARYFFNINEMLK
A3DD31_CLOTH/475-558---VEAAI.NQA.SD....HF.----------------TEIKALLNNR-SSWPARLIK---D----LSYNYYMDLTEVFE
CIPA_CLOTH/371-461---VEFYNSNPSDTT....NS.----------------INPQFKVTNT-GSS.AIDLS---K----LTLRYYYTVD....
A3DEW0_CLOTH/41-124---LEFYNGDFGASV....SS.----------------ISMNFRITNN-GSS.QISLS---D----IKLRYYFTDD....
Q47MW0_THEFY/511-587---VEAQI.NTP.GT....TF.----------------TEIKAMIRNQ-SGWPARMLD---K----GTFRYWFTLD....
L7VTG9_CLOSH/842-923---IQMFNGNTSDKT....NG.----------------IMPRYRLTNT-GTT.PIRLS---D----VKIRYYYTID....
Q82QF2_STRAW/596-678---VLYKNNDSSATD....NA.----------------IRPGLRIVNT-GSG.SLDLS---K----VTARYYFTRD....
A9KT90_CLOPH/840-921---LQMFNGNSSATT....NG.----------------IAPRIKLINT-GTT.AINLS---D----VKIRYYYTIN....
G8TEL8_NIAKG/1335-1416---VKAYASTQNGGK....NT.----------------ISTYVTISNE-GNM.PVAYG---D----LSVRYWFTED....
H1YBR2_9SPHI/1731-1813---VQYIDGDNKQAG....NNV----------------IRPYIRIVNQ-DSV.AVAYN---E----LTMRYWFTAE....
G8LXR4_CLOCD/469-550---VEGVIMNNN.A.....ND.----------------LSVKLLLNNR-SGWPARMIK---D----LKYHYYVDLSE...
R7FDD1_9FIRM/647-737---VTAGK..AQEND....AG.----------------LQVKIVVHNR-TINPPQFCD---D----LRVRYYFNIDELTA
I0K9X8_9BACT/1264-1347---ILHKNGNNNTKKV...NT.----------------IRPYLKLNNG-GTA.AIPYG---E----LTVRYWLTVE....
M1MVT4_9CLOT/204-289---VNVSNGSSA.......NS.----------------IAPTFTITNT-GDE.ELDLT---T----LKLKYFYTAD....
F2JNU4_CELLD/538-627---ATAKI..EQENS....ER.----------------SQITVKIHND-TSCPPSFES---G----LKARYFFDISEMVE
G8M373_CLOCD/185-272---IETYSGNPTNSI....NS.----------------IMPRFKITNT-SKV.PIELK---Y----VKLRYYYTNE....
R7H7U6_9FIRM/568-657---LEAAV..GQEDN....MA.----------------SQVQIKIHNN-TILPPRYLD---H----IKVRYYFNISELLK
G8M2T9_CLOCD/480-563---CEAKIYEESSSG.......----------------ITVDLNMYNI-VTSPPQYEP---G----LSCRYFIDLSEYAG
G8LUA7_CLOCD/713-794---VLYKTTDASDAA....GD.----------------IKVTLKIENT-GKK.PVDLS---T----LKIRYWYTKD....
F2JH11_CELLD/993-1077---VA.HNNKGGATT....NT.----------------IGGQFVVTSE-G...AVDLS---K----LAIRYYYTLE....
A4XIF8_CALS8/487-570---VESKFGNSQ.GA....NY.----------------TEIISYIYNR-TGWPPRVTD---N----LNFKYFIDLSELIK
Q2SJA3_HAHCH/490-573---VEAKL.NSS.GP....RY.----------------VEIAAQVHNH-SAWPARGSE---Q----LRFRYWVDLSDEFA
C7PX61_CATAD/870-951---VQYETSVTTATT....QS.----------------FQPLLNVVNN-GTS.AVPLS---S----VTIRYWFTSD....
L0G2U2_ECHVK/1325-1406---VSVMAKNESSKD....NT.----------------IKKVFNLKNT-GNV.PLDYE---G----ISIRYWFTKD....
B8I218_CLOCE/2193-2280---VKSFNATTSATT....NS.----------------IDPRIMFENT-GKT.EFKLS---D----LKIRYYFTSD....
R7MSD4_9FIRM/508-590---MEACI.NQE.SG....SY.----------------TEIKAYTTNH-SAWPARVVK---D----LSYRYYIDLSEVFE
Q097R6_STIAD/31-112---VQYQNYNASGPN....DSI----------------IEAGIQLKNN-TTA.AIPLS---T----VVVRYWFTKD....
I5ASR2_EUBCE/518-600---IQSQ..NSSDSG....SS.----------------VELMIHFENR-TAWPAVPTD---S----LVVRTYLDISDVLE
F3ZKG0_9ACTN/54-133---VQYRQSSTGA......DQ.----------------AEPWFKVVNS-GNS.SVSLS---Q----VKLRYYFRSD....
D4LDI8_RUMC1/502-584---IEAAV.NQS.SE....SY.----------------TEVKVLATNH-SAWPARLIK---N----LSYRYYFDISEILA
I0K9X8_9BACT/1422-1501---VYAENKNRNTTG....NQ.----------------IKPYLNVANE-GNL.PVDYS---Q----LTVRYWFTAE....
GUX2_CLOSH/769-850---IQSFNANTQEIS....NS.----------------IMPRFRIYNS-GNT.SIPLS---E----VKLRYYYTVD....
A3DI46_CLOTH/53-139---VTLKNIKTGVPS....DT.----------------IALKIGIINL-NKAININLN---D----IKLRYYFTND....
A0LVL3_ACIC1/752-834---VQYKNNDSAPGD....NQ.----------------IKPGLQVVNT-GSS.SVDLS---T----VTVRYWFTRD....
H1YBR2_9SPHI/1888-1968---VSYQNQNQTSGG....NT.----------------ISTYLSINNT-GNV.TVDYG---D----VTVRYWFMED....
A3DBI3_CLOTH/793-874---LQYANGNGSDTT....NT.----------------INPRFKLINN-SGS.PVKLS---D----VKIRYYYTID....
I0K805_9BACT/1554-1634---V..YTDNRPVGA....NT.----------------INTYLQVRNE-GNV.PVNYQ---D----IKVRYYLTAD....
R7H587_9FIRM/495-583---VETTL.KTA.SA....SG.----------------VTVSFKLTNH-TAWPARVVN---N----LSYRYYMDLSEVLD
Q97KK5_CLOAB/496-578---VEAAV.NAT.GK....NF.----------------EEIKSKIYNK-TGWPARVTD---K----LSFKYFIDISEFVK
L7VTG9_CLOSH/488-570---VMAGI.NAS.GQ....NF.----------------IEIKALLHNQ-SGWPARVAD---K----LSFRYFVDLTELIE
A9KMK6_CLOPH/582-672---LT.NTGNNNLST....NT.----------------INADFKIKHE-KGS.DIDLS---K----LVIRYYYTKE....
G8LUU2_CLOCD/544-634---VEAKVSTSQENK....ER.----------------SQITIRIHNE-SAYPPHYET---G----LKARYFFNISELIN
G8LUZ6_CLOCD/1193-1273---VEAGV.NAS.GS....NF.----------------IEIKAVINNK-SAWPARVCE---N----LSFNYYIDISEAIN
F2JH10_CELLD/497-584---LEAGI.NAQ.DKQNAINF.----------------VEIKAVVYNR-SAWPARVTD---K----LAYRYFVDISDVLA
Q9RK75_STRCO/41-123---VQYRTSASGATA....DQ.----------------TEPWFKVRNT-GSS.IVQLS---Q----VKIRYYFKAD....
A4XIF5_CALS8/493-575---VEAGI.NAS.GT....NF.----------------IEIKAIVNNQ-SGWPARATN---K----LKFRYFVDLSELIK
S6D1L3_9EURY/569-658---AEGEV..LQENA....DR.----------------TQVRVTIHNE-SIHPPHRED---G----LSARYFIDISELRE
G8LYV1_CLOCD/157-238---LKYKNGRTNVNT....DT.----------------IYPMFTIVNK-GNQ.KVKLS---N----IKIRYYYTKE....
K4KPQ8_SIMAS/499-582---VEAKS.NAT.GP....RH.----------------IEIAAKVYNR-SAWPAANGD---K----LKFRYFVDLSAEMA
E4N479_KITSK/43-125---VQYRTSASGATA....DQ.----------------SEPWLQVTNT-GSG.TVALN---R----ITLRYYFKSD....
G8LWU8_CLOCD/747-828---VEFYNTNTQAES....NS.----------------IYPKFRLTNT-GSS.PINLA---D----VKLRYYFTID....
E3EAP2_PAEPS/1205-1286---LQYRTADTKVND....NH.----------------LNPHFQIVNK-GTA.SVPLN---E----LKIRYYYTID....
G8LXL9_CLOCD/505-587---LGMYNEVRTDKA....KE.----------------IHPRFKLINT-GNT.PIKLS---T----VKIRYYYTID....
R7ML41_9FIRM/559-649---VTAGK..AQETD....AG.----------------LQVKLVIHNE-TTNPPKFES---D----MRVRYYFNISEQLE
D4LFJ4_RUMC1/491-578---VEAKA.T.S.DA....GG.----------------VNLSLKFTNQ-TAWPARVED---N----LSYRYYMDLSEVIA
W6S3G9_9CLOT/173-261---VEMFNINTLTTS....NS.----------------ITPKIKVTNI-GSV.DIDLS---K----LKLRYYFTSD....
V4KLB1_9ACTN/578-659---VQYRTSDTSPTD....SQ.----------------IRMGLQVVNT-GQS.AVNLA---D----VKLRYWFTPD....
D5UG75_CELFN/567-654---VRAEL..EQENT....SR.----------------TQVTLEISNR-SVHPPAEVD---D----LSLRYFFDISELQA
A3DIC9_CLOTH/54-150---LEFFNNVKDDNV....TL.----------------ISPYFRVINN-SSSDEIYLQ---H----VKIRYYFTLD....
A3DHY3_CLOTH/527-615---VEGKI..EQENK....ER.----------------TQVTIKIFND-TCHPPRFET---G----LMARYFFNISELLD
L0G2U2_ECHVK/1171-1253---VSYKNGDASSPL....NSQ----------------IKPYFKLINM-DTM.SVDLG---N----ITAKYWLTPE....
R7FAC7_9FIRM/488-575---VETKL.K.S.SD....SG.----------------VTLSFKFTNH-SAWPARIED---N----MSYRYYMDLSEVIS
A9KT91_CLOPH/774-855---VQMFNGNTSATT....NG.----------------IAPRFYLVNT-GSN.SINLS---D----VKLRYYYTID....
E3E7K8_PAEPS/878-959---VQSFNGNISATS....NT.----------------ISSKFKITNT-GSS.PVSLA---D----VTLRYYYTIN....
G8LUZ6_CLOCD/1396-1477---IQYTNGNATDST....NG.----------------INPRLRLVNN-GNS.SINLS---D----VKIRYYYTID....
R7FFS6_9FIRM/504-590---MKASI.NQS.AS....SY.----------------TEIKAFAMNH-TAWPARTIK---N----LSYNYYFDISELVD
E6UCK4_RUMA7/671-761---VSGGK..AQEKK....DG.----------------IQLKVVLHNR-TVDPPRFEC---N----VKARYFFNIKELLD
D2QPV6_SPILD/417-497---VYSAAKNSDIT.....SS.----------------ISTVLEVRNT-GNV.AIPLQ---D----LTVRYWFTSE....
Q97KK3_CLOAB/485-568---VDANI.MKE.SN....EE.----------------CTIQAFIHNA-SLLPPHYEK---G----MSFRYYVDLSELYK
D2BAV4_STRRD/34-116---LQYRTSAAGGTA....DQ.----------------VEPWFDLVND-GAS.AVPLS---G----VRIRYYFKAD....
A9B7H5_HERA2/510-590---VEAKV.NAS.GP....RF.----------------IEISGVLHNQ-SAWPARNST---K----LSYRYFVDLSEVFA
F2JID6_CELLD/33-122---LEYCNTMASIST....NT.----------------MGGKIKLTNT-SNE.TINLE---D----LKVRYYYTVD....
B8I7V0_CLOCE/35-124---VQFNNGSSPASS....NS.----------------IYARFKVTNT-SGS.PINLA---D----LKLRYYYTQD....
F2JNU4_CELLD/905-995---FK.MQGSDSITS....NT.----------------IGRKIIMKNT-EGE.AVDLA---A----LSVRYYFTKE....
A3DDF1_CLOTH/489-571---VEAYV.SSS.DK....NY.----------------VEIKTRLNNR-TAWPARVSE---G----LSFRYFIDLTEVIE
A9KT90_CLOPH/487-569---IQAGI.NAS.GP....SF.----------------IEVKALVFNE-TGWPARVTD---K----LSFKYFIDISEYVA
Q977Y4_CLOAB/39-128---IQFADTNTSTTM....NT.----------------IAPKFKITNN-TGA.PLDLT---T----LKLRYYFTAD....
A0LVL3_ACIC1/517-593---MQASV.NSA.GT....NY.----------------TEIKAYIVNQ-SAWPARALD---H----GSFRYYFTLD....
F2JLD6_CELLD/530-617---IEAGI.NAE.DSQNEKHY.----------------IEVKALVYNH-TAWPARITD---N----LSFKYFLDLTDYIK
F2JPM5_CELLD/857-938---VTFNNCNLSEKT....NS.----------------LMPRFKVTNT-GAD.AIDLS---D----VRLRYYFTTD....
D9SS71_CLOC7/497-579---VEAGV.NCT.GP....NF.----------------VEIKALVNNR-TGWPARMGD---K----LSFKYFINVSEFVN
B1VPK7_STRGG/565-647---AEYRNTDNSPTD....NQ.----------------IRMSLRLVNT-GSA.AIDLS---T----VTARYWFTPD....
A9KJ82_CLOPH/712-793---IQAFNGNTSAST....NG.----------------ISPKFKLINT-GNT.DINLS---D----IKLRYYYTID....
G8LXM2_CLOCD/486-569---IYGAL.NAS.GP....TF.----------------TNMKVTLANM-TGWPPRGSD---T----LSFRYFVDISEVVN
D9SV33_CLOC7/37-126---IEMYNSNKALET....NT.----------------ISPTFKIKNS-SDS.CLNLK---D----VTVRYYYTSD....
W6S3G9_9CLOT/3-92---LQMFNINNSTSS....NV.----------------VSGKFKIINT-DSN.SVNLS---D----IKIRYYYTID....
A3DCY5_CLOTH/489-571---VEATA.NSN.......NG.----------------VELKTYLYNK-SGWPARVCD---K----LSFRYFMDLTEYVS
H6NM35_9BACL/437-516---LQYRAADTNAGD....NA.----------------IKPHFNIRNT-GAS.PVDLS---G----VKLRYYFTKD....
B8I2K6_CLOCE/736-817---VSYKSGTSDGTK....NT.----------------IRSSINIKNT-GTV.PINLS---D----IKVKYWFTND....
RSGI2_CLOTH/514-595---LQAYNHIRTSET....KE.----------------LQPRIKLINT-GNT.PITLS---E----VKIRYYYTKD....
G8LUU2_CLOCD/726-807---VLYKCLTSSDSA....SD.----------------IRAILKIQND-GKK.PVNLS---D----IKVQYWFTAD....
GUNI_CLOTH/536-616---VEAGV.NAS.GN....NF.----------------IEIKAIVNNK-SGWPARVCE---N----LSFRYFINIEEIVN
A3DHY3_CLOTH/706-787---VLYKYGDTTAAT....KD.----------------IRGSIKIKNT-GTK.PVNLS---D----VKVRYWFTKD....
A9GL35_SORC5/144-226---LQYAARDTTVEP....QH.----------------LSFMVQVKNT-DDA.SIALS---D----LTIRYWFTAD....
H6NJX8_9BACL/528-607---VQYRAGNTNAAD....NT.----------------IGPQFNIKNT-GTT.AVKLS---G----LKLRYYFTKE....
Q65JI9_BACLD/503-585---AEASI.NSS.GN....SY.----------------TEIRAQLNNR-SGWPAKKTD---Q----LSFRYYVDLTEAVE
E3E5T1_PAEPS/388-469---LQYRTDDTNAKD....NA.----------------IRPQFNIKNT-GKT.AVKLS---D----LKIRYYYTDE....
G8LUA7_CLOCD/539-627---AEAKL..EQENK....ER.----------------TQITIRLYNY-SVHPPHFEE---A----MKVRYFFNISEMLD
RSGI1_CLOTH/343-424---IQYYSRKPHD......SAG----------------IDFSFRMFNT-GNE.AIDLK---D----VKVRYYFKED....
G0GF20_SPITZ/497-578---TEACL.NAS.GS....NF.----------------TEVKVLVNNR-SAWPARVIN---D----LRFRYFIDLSEVFA
Q6D5R0_PECAS/359-440---LQYRNVDNNPSD....DA.----------------IRMAFNIKNT-GST.PIKLS---D----LQVRYYFHDD....
E3EJF1_PAEPS/849-930---AQYRVGDTNPGD....NQ.----------------IRPLFRVVNK-GKE.ALDLK---N----VKLRYYYTVD....
D9SS73_CLOC7/35-125---VEFYNSNKSAQT....NS.----------------ITPIIKITNT-SDS.DLNLN---D----VKVRYYYTSD....
D5SLE0_STRC2/47-129---VQYRTGVTGATA....GQ.----------------AAPWFTVRNT-GTA.PVRLA---D----VRLRYYFSSD....
A5A671_BACLD/371-451---VQYRAGDNNVNG....NQ.----------------IRPQLNIKNN-SKK.TVSLN---R----ITVRYWYKTN....
GUNI_CLOTH/742-823---LQYANGNAGATS....NS.----------------INPRFKIINN-GTK.AINLS---D----VKIRYYYTKE....
GUNF_CLOTH/487-569---VEAAV.NAA.GP....GF.----------------VNIKASIINK-SGWPARGSD---K----LSAKYFVDISEAVA
H6NDH3_9BACL/886-967---VQVQNGTTAAAT....NS.----------------IAPRIRLVNT-GTS.AIELS---D----VTLRYYYTID....
RSGI4_CLOTH/377-458---VRFYNNNTLSET....GV.----------------IYMRINVINT-GNA.PLDLS---D----LKLRYYYTID....
E0RWD9_BUTPB/507-593---LRAGI.NAQ.DKNNKINF.----------------VEIKAVIENH-TAWPARVTD---N----LTLRMFFDLSDVLA
F4H3U7_CELFA/499-576---VEAML.NQPPSG....TF.----------------TEVKAMIRNQ-SAFPARSLK---N----AKVRYWFTTD....
A8FDC3_BACP2/465-547---VEAAV.MNN.DA....TS.----------------TQVKAVLYNR-SGWPARRSQ---T----LSFRYYVNLSEVFA
GUNG_CLOCE/496-580---IKAGL.NST.GP....NY.----------------TEIKAVVYNQ-TGWPARVTD---K----ISFKYFMDLSEIVA
B8I7V7_CLOCE/540-629---AESKL..EQENT....ER.----------------TQVTVRIHNE-TSRPPEFVD---E----LKARYFFDISEMLA
E3FP49_STIAD/658-740---ALYRDGDNNAPG....NNQ----------------IRPHLRVKNG-GTT.PVNLA---E----VKVRYYFTLE....
D9ST82_CLOC7/544-633---VESKL..EQENG....ER.----------------TQVTIRANNL-TVHPPHTED---T----IKVRYFFNISELMQ
A4XIF5_CALS8/718-799---VLYANKETNSTT....NT.----------------IRPWLKVVNS-GSS.SIDLS---R----VTIRYWYTVD....
D5UFH7_CELFN/503-581---VEAKL.NQPAGG....TF.----------------TEVKAVVRNR-SAFPARSLT---N----ASIRYWFTLD....
D2B808_STRRD/500-576---LEAGV.NAS.GP....TF.----------------TEIKTIVRNQ-SAWPARPLT---N----GSFRYYFTLD....
G8TEL8_NIAKG/1180-1262---VQSQDGDKGKTD....NNS----------------ISPYLQLVST-GKA.NVAYG---E----LTARYWFTAE....
C5BNA7_TERTT/494-574---VGAKI.NSS.GN....RF.----------------VEMKAVIQNH-STTPAQGKD---D----LYMRYFYDLSEVFA
W6RW99_9CLOT/506-586---VEMYNKINQPVY....NN.----------------ITPCFRITNA-GKT.SINLK---N----IKIRYYYTKD....
GUN2_BACSU/356-436---VQYRAGDGSMNS....NQ.----------------IRPQLQIKNN-GNT.TVDLK---D----VTARYWYKAK....
H6NJY0_9BACL/592-671---VQYRAGNTNPAD....NT.----------------IAAHFNIKNT-GTT.AVKLS---D----LKLRYYFTKD....
M1MVT4_9CLOT/36-123---LDLTNVKTDEST....NA.----------------INGTFNVTNN-GEE.AINLS---D----VKIRYYFTAD....
F2JLD6_CELLD/729-819---LK.QTNASNSKS....NT.----------------INLNLEIKGK-KES.QFDLK---D----LSIHYYYTSD....
M1MLG4_9CLOT/496-578---AEAGV.NAS.GP....NF.----------------MEIKALLYNK-SGWPAKVGD---K----LSFKYFIDISEIIK
F2JH10_CELLD/985-1075---VG.NTGNGQAST....NT.----------------LTNNFKLVHK-SGN.DIDLS---K----LEIRYYYTAD....
A9EQP9_SORC5/230-310---VQYSNYDAAAPN....DTI----------------VEAGIKIRNN-TAA.SIPLS---S----IVLRYWFTKN....
B8I0N0_CLOCE/478-561---SEAKLYKSNTEG.......----------------VTVDLNLYNI-VTAPPQYEK---D----LSCKFFVDLSEFAA

PF00963

SLAP1_CLOTH/34-195-IEMVLDKTEV.HVG----DV-----------------ITATIKVNNI.RK...LAGY---Q----LNIKFDPEVLQPVD
O30295_ARCFU/279-418-TTIIAGSAEA.PQG----SD-----------------IQVPVKIENA.DK...VGSI---N----LILSY.PNVLEVED
CIPA_CLOTH/1549-1689-LTLKIGRAEG.RPG----DT-----------------VEIPVNLYGV.PQKG.IASG---D----FVVSYDPNVLEIIE
CBPA_CLOCL/291-428-VTATIGKVQV.NAG----ET-----------------VAVPVNLTKV.PAAG.LATI---E----LPLTFDSASLEVVS
CIPA_CLOTH/31-168-MTVEIGKVTA.AVG----SK-----------------VEIPITLKGV.PSKG.MANC---D----FVLGYDPNVLEVTE
CBPA_CLOCL/435-570-MQISVGTATV.KAG----EI-----------------AAVPVTLTSV.PSTG.IATA---E----AQVSFDATLLEVAS
Q977Y4_CLOAB/1344-1482-TTLAVGAASG.KAG----DT-----------------VKVPVTISKV.TTP..VGLI---C----MEIDYDASKFTVKD
Q9FDJ9_9FIRM/225-386-VTVEVDKTDA.KVG----DI-----------------ITATINVKNI.NG...FAGY---Q----ANLKYNPAVLQPVY
Q9RPL0_9FIRM/1161-1298-MAVAVGAVQG.GVG----ET-----------------VTVPVTMTKV.PTTG.VSTA---D----FTVTYDATKLEYVS
Q977Y4_CLOAB/382-520-TNVTVGDVTGAKKG----DT-----------------IKVPVSVSTV.KTP..IGLI---D----MEINYDPTELTAKD
A3DF10_CLOTH/34-197-IELKFDRNKG.EVG----DI-----------------LIGTVRINNI.KN...FAGF---Q----VNIVYDPKVLMAVD
Q9ZGA7_9FIRM/91-228-AEISIGKVSG.ATG----ST-----------------VTIPVKLNNL.PKKG.IGSF---N----FNIKYDTDALEVVE
Q9RPL0_9FIRM/1621-1754-FKVSIDTVKA.ATG----TQ-----------------VVVPVSFVNV.PATG.ISTT---D----MTITYDATKLQYVS
Q7WYN2_9FIRM/40-179-LQVDIGKVSG.EPG----SI-----------------VSVPVTFSNV.PATG.IYAL---S----FSVNFDKSMLSVVS
Q9FDJ9_9FIRM/1493-1654-VFVTLDKTKA.AVG----DI-----------------ITATINVKDF.DS...VAGY---Q----ASVKYDPAVLQPVY
ANCA_CLOTH/34-172-IEIIIGNVKA.RPG----DR-----------------IEVPVSLKNV.PDKG.IVSS---D----FVIEYDSKLFKVIE
Q9RPL0_9FIRM/1304-1441-MKVVIANVSG.NAG----SE-----------------VVVPVSIEGV.SANG.VSAA---D----FTITYDATKLDYVS
Q7UY43_RHOBA/45-169-AAVNIPDDLTSAPD----AI-----------------VSVPVNIDSA.TG...VRAA---E----IRLSYDTSVLDLDA
Q9AE52_RUMFL/1217-1350-IAWVVDTVAA.YPG----DE-----------------VTLKITVKDPNAANLGIAGA---Q----FKVTPDGDV.....
Q9AE52_RUMFL/58-185-VEWLIPTVTA.APG----QT-----------------VTMPVVVKSS...SLAVAGA---Q----FKIQAATGV.....
Q977Y4_CLOAB/616-754-VKLSVGTVSG.NPG----DT-----------------VKVPVTISQV.STP..VGLI---C----MDISYDASKFTVKD
O82830_CLOJO/1023-1161-LGVKIASVTG.KTG----DT-----------------ITVPVTLSNV.ATVGNVGTC---N----FYITYDPTLLQAVS
Q9RPL0_9FIRM/1475-1612-FNLSIDTVEG.NPG----SS-----------------VVVPVKLSGI.SKNG.ISTA---D----FTVTYDATKLEYIS
Q8PV77_METMA/33-166-VTLQPASKNV.YAG----EN-----------------ITLNVVVTPD.TQ...ISGI---Q----FDLEYDGSLFQIAG
CIPA_CLOTH/184-321-VVVEIGKVTG.SVG----TT-----------------VEIPVYFRGV.PSKG.IANC---D----FVFRYDPNVLEIIG
Q7WYN2_9FIRM/326-465-LQVDIGSTSG.KAG----SV-----------------VSVPITFTNV.PKSG.IYAL---S----FRTNFDPQKVTVAS
Q9AE52_RUMFL/194-326-IKWVLDKVTA.APG----ET-----------------VTVKATVDASGEGTVAVAGA---Q----FDVNADSPI.....
Q97KK4_CLOAB/41-180-SNLKISSSSG.KTG----SN-----------------VEVKVKASNV.AKKN.VICC---D----FKIKYDASKLDVSG
Q8XTG8_RALSO/623-752-SALTIQGPSSVPAG----ST-----------------FDVLVNVQPE.RP...FTSL---P----LTLQYNPAQLQIIS
O82830_CLOJO/287-424-LKVSVGTAVG.APG----DT-----------------VTVPVTFADV.AKVNNVGTC---N----FYLGYDASLLDVVS
Q45996_9FIRM/1170-1307-LKVAVGTASG.KAG----DT-----------------VTVPVTFADV.ATVGNVGTC---N----FYVTYDTNLLEVAS
O30294_ARCFU/33-156-MVVKIPDTSG.AVG----GT-----------------VEVPVEVENA.QN...LGSM---D----IVIVYDPTILKVQN
CBPA_CLOCL/1709-1847-FAVKIDKVSA.AAG----ST-----------------VKVPVSLINV.SKVGNVCVA---E----YKISFDSSVLTYVG
CBPA_CLOCL/668-801-VTATVGTATV.NAG----ET-----------------VAVPVTLSNV.SG...ISTA---E----LQLSFDATLLEVVS
Q9AE52_RUMFL/474-603-VEWVIPKVDA.DAG----DN-----------------VTLQVAVKG..DADLPVSAA---Q----FDVNGATP......
Q7UY44_RHOBA/195-328-VQLPVGGSGT.ELP----AG-----------------LPIQLSNADG......VTSV---T----MTIQYDPALLDISG
Q9RPL0_9FIRM/480-612-FTVNVDSVNG.NVG----EQ-----------------IVVPVSFANV.PSNG.VSTA---D----MTITYDSSKLEYVS
Q9FDJ9_9FIRM/771-932-VVATVDKTTA.SVG----DI-----------------ITYTINVKDV.AG...FAGY---Q----ANVKYDPAVLQPVY
Q7WYN2_9FIRM/183-322-LKAEIGSVSG.KPG----SV-----------------VSVPITFSNV.PKSG.IYAL---S----FRIGYDNTKIRVVG
CIPA_CLOTH/562-702-IKIKVDTVNA.KPG----DT-----------------VNIPVRFSGI.PSKG.IANC---D----FVYSYDPNVLEIIE

PF09478

Q54SS3_DICDI/292-372-------------------QLQ.NV.....QDIWN-------ADQ.TSTNNYKLP--SWLG...E-IPV-NG--------
Q54UH2_DICDI/243-323-------------------KLN.NI.....ISIWE-------VET.LSSNSYQLP--NWVG...S-ISS-GS--------
Q54UH2_DICDI/352-432-------------------ELN.DI.....QSIWE-------IQT.LSNNTFTLP--NWKN...S-IEV-GS--------
Q54BC0_DICDI/1043-1124-------------------MMS.NI.....DQIWG-------VTI.SSGPTYSLP--SWNP...T-INP-GN--------
Q55CG7_DICDI/1041-1122-------------------IIE.KIA...YGQIWG-------VDA.NGNNRYTLP--SYNL...I-INP-RD--------
Q54U76_DICDI/53-136-------------------ATDADLA...FNQIWG-------VNK..NGYLLDLP--NYA....T-IAP-GA--------
Q54DP5_DICDI/230-310-------------------TSS....PLRPNSIWG-------LAVDETKNTWAL.--QWYP...V-IQP-GQ--------
Q55C74_DICDI/483-564-------------------AID....K.TPSSSWE-------LNL.VSSNIVSFT--SWNN...Q-ISP-GQ--------
Q54DJ4_DICDI/24-109-------------------VAESNLILDKPENIWS-------MEL.ISPNKYHFP--SWITQNGG-LNS-GA--------
Q86KB6_DICDI/23-109-------------------VGVSNLE...LENVWS-------VEQ.ISSNKFSFP--KYISQNGG-LKN-GT--------
Q54EX0_DICDI/27-117-------------------TATANFFSSKPSDIWN-------VEK.VSDKVYHFQ--PYLIQ.NG-LST-GE--------
Q54LF5_DICDI/181-262-------------------HSD.NWN...PTEFWN-------IVRSQKTGNLSFP--PFVV...N-LQA-GD--------
Q54LG4_DICDI/193-274-------------------HSD.NWN...PTEFWN-------IERNVQTGNLGFP--AFVS...T-LKV-GE--------
Q54LG5_DICDI/182-259-------------------HSD.NWN...PTEFWN-------VEKNAQTGNLGFP--SFVN...T-LPV-GD--------
GUN2_ORYSJ/544-626-------------------GIG.KLY....GPVWG-------LEK.AARYGYVLP--SWTP...S-LPA-GE--------
GUN15_ORYSJ/535-613-------------------GVS.GLR....GRLWG-------LEE..ARYGYVPP--RWLP...A-LRP-GR--------
Q9ZSP9_SOLLC/533-611-------------------SIV.KLY....GPLWG-------LTK..YGNSFIFP--AWLN...S-LPA-GK--------
GUN19_ARATH/534-612-------------------SIT.KLY....GPIWG-------VTK..TGNSFSFP--SWMQ...S-LPS-GK--------
GUN6_ARATH/528-606-------------------SIK.NLY....GPIWG-------LSR..SGNSFGLP--SWMH...S-LPS-GK--------
GUN13_ORYSJ/531-610-------------------QIK.ELS....GEIYG-------VSRTNAKDMYEFP--SWMT...R-LDA-GA--------
I1K6A1_SOYBN/532-609-------------------SIS.KLY....GPIWG-------VTK..SGDSYTFP--SWLS...S-LSA-GK--------
Q54DY8_DICDI/1219-1296-------------------EIF.DL.....VNIWG-------VEL.LSNNTYQLP--SWVY...S-IPV-GS--------
GUN5_ARATH/535-614-------------------KIE.DLS....GPIWG-------LNPTGQKYTYQLP--QWQK...T-LRA-GQ--------

PF00553

GUND_CLOC7/411-512-------------------KWTM.PINQTITNMWS-------ASFVASGTTLSVTNAGYNG---T-IAANGG--------
XYNB_CELJU/37-133-------------------NWQY.S.SNRMTSGWN-------ANFSGT.NPYNATNMSWNG---S-IAP.GQ--------
GUNC_CELJU/37-133-------------------SWQY.N.SNRVTNLWN-------ANLSGS.NPYSASNLSWNG---T-IQP.GQ--------
GUNA_CELJU/864-961-------------------NWSY.SDGSRITNSWN-------ANVTGN.NPYAASALGWNA---N-IQP.GQ--------
GUNB_CELJU/30-127-------------------SWNYTD.GSRVTSSWN-------AGLSGA.NPYSATPVGWNT---S-IPI.GS--------
GUN1_ACIC1/465-559-------------------SWTF.GGNQTITNSWN-------AAVTQNGQSVTARNMSYNN---V-IQP.GQ--------
D6Y6N8_THEBD/360-452-------------------QWTL.PSGQSITQLWN-------GDLSTSGSNVTVRNVSWNG---N-VPA.GG--------
F4GZY2_CELFA/35-134-------------------DWTY.TAGQRIQQLWN-------GTASTNGGQVSVTSLPWNG---S-IPT.GG--------
F4H3U7_CELFA/946-1044-------------------GFAF.PSGQQVTQGWS-------ATWSQTGTTVTATGLSWNA---T-LQP.GQ--------
F4H454_CELFA/408-507-------------------TFSF.PSGQQVTQAWS-------STVTQSGSAVTVRNAPWNG---S-IPA.GG--------
Y1987_MYCTU/41-139-------------------EFDL.PAGESVLHTWN-------STVARSGTHYVLSPANWNR---I-IAP.GG--------
Q47RH8_THEFY/40-136-------------------VLTL.PGGTTVAQVWN-------AQHTSSGNSHTFTGVSWNS---T-IPP.GG--------
Q7AKG2_STRCO/34-131-------------------EWDF.PTGTKVTSAWD-------ATVTNSGDHWTAKNVGWNG---T-LAP.GA--------
Q9F3Q0_STRCO/58-156-------------------GFTMPDAGQRLVQGWN-------ATWSQSGSAVTAGGVDWNR---T-LAT.GA--------

PF03173

I2BB67_SHIBC/32-191DND...........QFAVTHIVGDLHKLTPTDKFTGFPAGKSVEIPIVNEYWQLFMTDVIPRWYV-TSG-EA........
A3QBY8_SHELP/54-215LTD...........AFELTQVKGDLHRITPTERFSGFQKDQPVDIAFLGELWQLSETDAMPNYYI-VVP-GL........
B3PH90_CELJU/45-198KVA...........GLQIKHVQGDLHALEPSADFTGLAAGASLEVPYSGGNWIVSYSDFMPRAFI-AQP-GL........
Q487J1_COLP3/52-215ESE...........DFTVKHLNGDLHVIALQDKFSGFSAAETKKITFRAMFWSLSETDALPNYIV-SAP-GL........
D3VAI6_XENNA/45-204DNV...........QYKITHITGDLYKLEPTEKFTGIKANEKIVLPIIGEYWQIYSTDFIPRWYA-TSG-NA........
Q87RM3_VIBPA/35-194DNE...........QFKISRVTGDLHKLEPTDKFDGFAAGEEVVLPLIGEYWQLFETDFMPGAFV-AAP-NA........
A7MQU6_CROS8/34-190DND...........QFKVTHVMGDLHKLEPTDKFTGFPAKSSVEIPIINEYWQLFITDVLPRWYV-TAD-DG........
E6WFL0_PANSA/37-193DND...........QFKMTHIVGDLTRLEPTDKFTGFAAGATVDIPIVNEYWQLFITDVMPRWYV-SAE-GA........
X2GWP3_9GAMM/38-198NND...........QFKITHVTGDLHKLEPTEKFKNIPANAVVTIPIIGEYWQISESDVMPRWYV-TSS-KA........
D4ZH44_SHEVD/49-211NSK...........EFTITRVKGDLHKIAPTTEFTGLKQGITKTIEFKGELWQLSETDAMPNYYL-VSA-EL........
Q6LTD2_PHOPR/61-220QND...........QFKITHVTGDLHTLEPTDKFDGFAEGETVVIPYIGEYWTLFENDYMPRAYV-VSG-DA........
W8V3I6_YEREN/37-196DND...........QFTITHLTGDLHKIEPSAKFTGFPANQAVEIPITGEYWQLFATDFMPRWYA-TSG-DA........
K1RL03_CRAGI/26-177SYPYK.DGFLFSDCKMKVFHINGNLFKLKPENKFR.LNTGGSVECIIEASDWQSIRFESMPNWYV-AAE-GL........
A1S444_SHEAM/47-209QST...........DFVIEHVKGDLHRIKPTGNFGGFKANQSQTLAFRGELWQLSETDAMPNYYI-TAP-GL........
A7RSQ4_NEMVE/34-186HTKHNPDGYVLPGYGLKVTHVNGCQHRIQPTADFKPLLPGDSRPVLFNAENWAVAKTDVMPNFYV-AAE-GL........
Q5DYR6_VIBF1/39-198END...........QFKITRVTGDLHKLEPTEKFDGFAAGEEVVIPLIAEYWQLFETDFMPGAFV-TAP-GA........
Q8CVD2_SHEON/53-215EGK...........EFSITHIKGDLYRIAPTEAFSGFSKGVKKTLRFRGELWQLSETDAMPNYYI-VAG-DL........
A0KIG5_AERHH/37-197DND...........QFTITHLTGDLYRLTPTEKFQGFAKDATVEVPLVVEYWVLFESDIMPNWYV-ASE-GA........
Q7PC48_SACD2/44-221PAG...........EFTIDHINGDLHRIRPSASYQGFNVGEVKKVQFIVAGLTLTEAKIMPNYYV-VAE-GQDNKQALYS
W0LCL7_9GAMM/37-196DNE...........QFKITHITGDLYKLEPTDKFTSFPANQAVEIPIIAEYWQVFHSDFLPRWYA-TSG-DA........
C5BGA1_EDWI9/35-194GNE...........QFKITFITGDLHKIEPTDKFKGFAAGERIEIPIVGEYWQLFESDVMPRWYV-TSP-DA........
A8GB46_SERP5/37-196DND...........QFKIAHLTGDLYKLEPTDKFTGFPAGQTVEIPIIAEYWQLFKTDFVPRWYA-TSG-DA........
D8MPP8_ERWBE/36-192ESD...........QFRMVHIVGDLTRLEPTDKFKGIAAGETIEIPIVNEYWQLFITDVMPRWYA-TSG-DA........
D0LVP4_HALO1/53-212EGE...........DFTISHINGDLHALRPTASFAGFAAGEALNVAFVAEYWTLYQSDFMPRYYL-SAD-GL........
U4K583_9VIBR/34-198RGD...........LFTITHIDGDLHRVSPTAKFNGLQPGESVTVEYDAEYWQIVNSDFMPNYYI-SAD-GL........
Q7NXY3_CHRVO/32-191DTP...........QFTLRHITGDLYQITPTAAFQGLAPGQKLELPLIDEYWILQESDVLPRPYV-TVD-GQ........
D3UXD7_XENBS/37-196DHE...........QYKITHITGDLHKLEPTEKFIGIKANEKILLPIFGEYWQIYSTDFMPRWYA-TSG-DA........
E1ST90_FERBD/37-199TGP............LTIEHINGDLHRLFPGDDFAGLAAQQTQAVPYTANFWSVSNSDPMPNYYL-VAE-GL........
Q7MBH3_PHOLL/37-196DNE...........QFKITRITGDLHRLEPTEKFTGIKANEQVKLPFIGEYWQIYSTDFLPRWYA-TSG-DA........

PF00942

H6NM36_9BACL/665-744.------------------....GSAGLDSWVDWA-------QV....GG......ANVQRVFGS.ASG-T.--------
A3DC31_CLOTH/163-244.------------------....GNENETFWCNEF-------TR....DG......SQVYGTFVK.MSK-PK--------
A3DJ30_CLOTH/744-825.------------------....GNEQNNFVCDYA-------AF....GT......DKVKGIVKK.IEN-SV--------
G8LST1_CLOCD/336-417.------------------.....YKNINFAVYFY-------SL....GD....EKNDVKGKVYN.IRQ-S.--------
F4A374_MAHA5/502-583A------------------GHSAS..EITVAKNYS-------EVP...........VTVS.GPTK.W..-..--------
F2R1Y0_STRVP/43-122.------------------....AGASYTYACSWA-------VK....GC......ANLTGTFGT.LAN-PT--------
R5VSS5_9FIRM/595-685A------------------GQTID..DLDIEIYYD-------EENANTNG...ESFATIS.KPVK.W.D-..--------
A3DD31_CLOTH/475-558A------------------GYSVD..DIKVTIGYC-------ESGMD.........VEIS.PITHLY..-..--------
CIPA_CLOTH/371-461.------------------....GQKDQTFWCDHA-------AIIGSNGS.YNGITSNVKGTFVK.MSS-ST--------
A3DEW0_CLOTH/41-124.------------------....GVSPITVFIDYA-------......NNNGRGINNDVTYTIKD.INS-..--------
Q47MW0_THEFY/511-587E------------------GVDPA..DITVSSAYN-------QCATPEDV......HHVS.........-..--------
L7VTG9_CLOSH/842-923.------------------....GEKDQNFWCDWS-------SV....GS......NNITGTFVK.MAE-PK--------
Q82QF2_STRAW/596-678.------------------...SGSPTVNAWCDYA-------AV....GC......SNVSLKVVP.LTT-PV--------
A9KT90_CLOPH/840-921.------------------....GEKDQAFWCDYS-------TI....GS......SNVNGTFVK.MST-PK--------
G8TEL8_NIAKG/1335-1416.------------------....GTAALNSWVDYA-------KL....GT......SNIITGINT.VSP-AL--------
H1YBR2_9SPHI/1731-1813.------------------....NYSGINTWVDYA-------QL....GN......SNVSMAYIP.LPE-PR--------
G8LXR4_CLOCD/469-550.------------------GVDPS..DVTVSTNYI-------EPNM..D.......ATVS.QLIP.Y.P-N.--------
R7FDD1_9FIRM/647-737I------------------GEDIS..MVETRVDYD-------AESAMTNN...KTSATIS.EPIK.Y.D-..--------
I0K9X8_9BACT/1264-1347.------------------...DFAPMTNLYIDWA-------QL....GT......NKVKLKYVA.LPQ-PR--------
M1MVT4_9CLOT/204-289.------------------....GDEAETFNCYYA-------GTV...GGDYQNLTGNVEGKIVK.LGS-AV--------
F2JNU4_CELLD/538-627A------------------GQSLK..ELSVQVMYD-------QASIVDGV...K..TNIN.GPFM.W.D-E.--------
G8M373_CLOCD/185-272.------------------....EEKEQNFWCDYA-------AI....LNPKHSPLTGVTGKFYK.LSP-AT--------
R7H7U6_9FIRM/568-657N------------------GQSLE..DISVRMDYD-------EEKANSDG...K..TAVS.YQMK.Q.Y-N.--------
G8M2T9_CLOCD/480-563E------------------NIDLS..KFVTKVYYS-------PAG...........AEIS.GLKP.WDK-..--------
G8LUA7_CLOCD/713-794.------------------....SDDAQECIFDYV-------KI....GK......EMVEAKFVD.VSP-AV--------
F2JH11_CELLD/993-1077.------------------....GNGAQTAYKDNA-------GMNLNKAPWYVNLTPDVSVNVVP....-.V--------
A4XIF8_CALS8/487-570A------------------GYGPD..IVKVETYYS-------EG............GKIS.GPYV.W.N-A.--------
Q2SJA3_HAHCH/490-573A------------------GYGLQ..DVKVTTAYS-------QA............TEVS.GLQP.WGD-P.--------
C7PX61_CATAD/870-951.------------------...GGSSTFATNCWYA-------VI....GC......AKVTQSVSS.VT.-AT--------
L0G2U2_ECHVK/1325-1406.------------------....GGGALTFWKDYA-------EL....GS......ENLEGTFMA.VEA-ST--------
B8I218_CLOCE/2193-2280.------------------....SDKDQSYWCDYA-------EIKGASGQ..RNITSSVKGSSVL.FTG-T.--------
R7MSD4_9FIRM/508-590A------------------GFTVD..DVQVKIGYD-------EWGN..........CTIS.KPIQ.Y..-..--------
Q097R6_STIAD/31-112.------------------....GATTVAPACWWW-------NTAACPGI......SLVTGSVSA....-..--------
I5ASR2_EUBCE/518-600K------------------GYKPS..DIKTSTNFA-------QGS...........AVIS.ELKP.T..-G.--------
F3ZKG0_9ACTN/54-133.------------------....NAAAYRFACSWA-------VK....GC......ANVTGTFGT.LAH-PT--------
D4LDI8_RUMC1/502-584A------------------GLTVD..DITVRIGYD-------EYST..........TQIS.KPIQ.Y..-..--------
I0K9X8_9BACT/1422-1501.------------------....GNQPLVYTVDYA-------EL....GN......SKVTGRFVK...V-NR--------
GUX2_CLOSH/769-850.------------------....GDKPQNFWCDWA-------SI....GS......SNVTGTFVK.MDG-AT--------
A3DI46_CLOTH/53-139.------------------....GCSPIQVNIKLF-------......GTETESFNPELVKTSVV.TGL-SY--------
A0LVL3_ACIC1/752-834.------------------...GGSSTLVYNCDWA-------AI....GC......GNIRASFGS.VNP-AT--------
H1YBR2_9SPHI/1888-1968.------------------....GSQSMNYWIDYA-------VK....GT......NNISGKIVT.LNT-PL--------
A3DBI3_CLOTH/793-874.------------------....GEKGQQFWCDWS-------SA....GN......SNVTGKFVK.LSS-PK--------
I0K805_9BACT/1554-1634.------------------...ANPDKLRFYLDYA-------LL....GN......PNVTGRFVK.LDP-VL--------
R7H587_9FIRM/495-583A------------------GYQAS..DVVVRCDRD-------QAQMYSDY...AN.AEIS.GLIH.D..-..--------
Q97KK5_CLOAB/496-578Q------------------GYKAS..DIKVTTNYN-------EG............GTAS.QLIP.W.D-E.--------
L7VTG9_CLOSH/488-570A------------------GYSAS..DVTITTNYN-------AG............AKVT.GLHP.W.N-E.--------
A9KMK6_CLOPH/582-672.------------------....GTAKENFYCDTA-------AMQLNKDPWYIPYTSVVNGTFNS.MAV-PK--------
G8LUU2_CLOCD/544-634A------------------GQSID..DVQMEVYYD-------ENEKCYDG...K..AKYL.GPIK.Y.D-..--------
G8LUZ6_CLOCD/1193-1273A------------------GHSAS..DIKVSANYN-------QG............AKVS.ELKP.L..-..--------
F2JH10_CELLD/497-584A------------------GYKAS..DMKISANYN-------QSG...........AKIS.SLQP.W.D-A.--------
Q9RK75_STRCO/41-123.------------------...SPNASYRFACSWA-------VR....GC......AAVTGTFGT.LAN-PT--------
A4XIF5_CALS8/493-575A------------------GYSPN..QLTLSTNYN-------QG............AKVS.GPYV.W.D-S.--------
S6D1L3_9EURY/569-658A------------------GQSID..AVSVEVQYD-------QQATEGDG...S..TDVS.GPIA.W.D-E.--------
G8LYV1_CLOCD/157-238.------------------....GNASETFWCDYF-------TK....GS......SNVIGSFAK.LNN-DK--------
K4KPQ8_SIMAS/499-582K------------------GYTAA..DVTVSTAYS-------QA............TSVS.QLKV.WGD-P.--------
E4N479_KITSK/43-125.------------------...GPSTTYRFACSWA-------VK....GC......ANITGTFGT.LAN-PT--------
G8LWU8_CLOCD/747-828.------------------....GEKSQNFWCDWS-------PV....GS......SNVTGQFVK.MTQ-AT--------
E3EAP2_PAEPS/1205-1286.------------------....GDREQTFNCDYA-------AL....SC......SKLNGKLVK.MEK-AA--------
G8LXL9_CLOCD/505-587.------------------...IEDKQQVFYCDWS-------NI....GR......NSITGKLVK.MNT-GR--------
R7ML41_9FIRM/559-649A------------------GEDIS..FIETRIDYD-------QEKSFTDG...KNEAHIS.EPVK.Y.D-..--------
D4LFJ4_RUMC1/491-578A------------------GNKPE..DVVIRCDRD-------QSAMYSDV...TP.AQIS.GIQH.Y..-..--------
W6S3G9_9CLOT/173-261.------------------....SDKLQKFWCDHA-------SITT..GG.YKAITSSVLGTFGS.FTP-SE--------
V4KLB1_9ACTN/578-659.------------------....GSSAVNSTCDWA-------QL....GC......GGVTHTVEQ.ASG-SA--------
D5UG75_CELFN/567-654D------------------AQTID..DVRVDVYYD-------EAKTLSGK...A..VSIG.EPVH.V.G-..--------
A3DIC9_CLOTH/54-150.------------------.SSDSEETMNYEIYYA-------GKSNIDGTGAVEDIKPNTIVKIAKMDI-PT--------
A3DHY3_CLOTH/527-615A------------------GQSID..DVKIEVYYD-------ENKASYDG...P..AEVR.GPIK.Y.D-..--------
L0G2U2_ECHVK/1171-1253.------------------....QVDVIKTRVDYA-------PF....GE......DQVAMEYVR.LDG-PR--------
R7FAC7_9FIRM/488-575A------------------GYQPS..DVAVRVDRD-------QAKMYDDC...KP.AEIS.PITQ.Y..-..--------
A9KT91_CLOPH/774-855.------------------....GEKSQSFWCDWS-------SI....GS......SNVTGTFVK.MAT-PK--------
E3E7K8_PAEPS/878-959.------------------....GEKSQNFFTDWS-------SS....GT......ENVIANFKA.LTN-AK--------
G8LUZ6_CLOCD/1396-1477.------------------....GEKPQTFWCDWS-------SA....GT......SNVTGSFNK.LTA-AK--------
R7FFS6_9FIRM/504-590A------------------GYSID..DVSVKIGYD-------QHSSDKGK......ISIS.DPIQ.Y..-..--------
E6UCK4_RUMA7/671-761A------------------GYGID..YITARIDYD-------QVAGYSNN...KSHAELS.DPVK.Y.D-..--------
D2QPV6_SPILD/417-497.------------------....TSQLLNSYIDYA-------QI....GA......QTIKHNVVR.LAQ-PV--------
Q97KK3_CLOAB/485-568K------------------GYTVN..DVGVRANYA-------AGG...........GTLS.GFIP.Y.D-E.--------
D2BAV4_STRRD/34-116.------------------...PGASQYRFACSWA-------VV....SC......STVTGTFGT.IAP-GT--------
A9B7H5_HERA2/510-590A------------------GYGLS..DVTVSTAYT-------QG............SGVS.SLKQ.W..-..--------
F2JID6_CELLD/33-122.------------------....EPLTQTLWCDHA-------GLMGSKGY..ETITSSVTSKFEA.LSS-PT--------
B8I7V0_CLOCE/35-124.------------------....ADKPLTFWCDHA-------GYMS..GSNYIDATSKVTGSFKA.VSP-AV--------
F2JNU4_CELLD/905-995.------------------....GNVGQTYFCDHA-------SMTFNKAPWYAALTSDITYKVVN.LDT-PV--------
A3DDF1_CLOTH/489-571A------------------GYGPN..DLIISGGQG-------SS............GKVS.GPHL.W.N-K.--------
A9KT90_CLOPH/487-569K------------------GYTKN..DFTVSTNYN-------NG............ATTS.ALLP.W.D-A.--------
Q977Y4_CLOAB/39-128.------------------....GTQDENFWCDHA-------GMLN..GYNYQTITSNVVGTFVA.MDN-AT--------
A0LVL3_ACIC1/517-593G------------------STTPA..QISLSSAYN-------QCSAPQGP......TQYS.........-..--------
F2JLD6_CELLD/530-617A------------------GGVPS..DLITSYNNS-------SGK...........VMIS.KVLP.W.D-E.--------
F2JPM5_CELLD/857-938.------------------....GNQENFFWCDWS-------QV....GN......SNVKGTFVK.MDN-PT--------
D9SS71_CLOC7/497-579A------------------GYSAD..DLKVTVGYN-------TG............GTVS.NLIP.W.D-K.--------
B1VPK7_STRGG/565-647.------------------...GGASTFGTACDYA-------VL....GC......GNVTHGVRS.AST-PA--------
A9KJ82_CLOPH/712-793.------------------....GEISQNFWCDWA-------SV....GS......ENVKGEFVK.LAK-PV--------
G8LXM2_CLOCD/486-569A------------------GYKAS..DITVSASAS-------NG............AKVSPKLIE.W.D-A.--------
D9SV33_CLOC7/37-126.------------------....GNQEQNFWCDHA-------GALL..GYNYVDNTSKVTGKFIK.EPN-ST--------
W6S3G9_9CLOT/3-92.------------------....SKREQSFWCDYS-------SMNV..GYNSISITDKVTGTFYK.LDT-VV--------
A3DCY5_CLOTH/489-571A------------------GYNPN..DITVSIIYS-------AAPT..........AKIS.KPIL.Y.D-A.--------
H6NM35_9BACL/437-516.------------------....GIQPLSFAVDWA-------QV....GS......PNVKGTFGS.ASG-A.--------
B8I2K6_CLOCE/736-817.------------------....GNQQNSFTCEYA-------AL....GT......GNVIGNFSN.ISN-PV--------
RSGI2_CLOTH/514-595.------------------....QVINEIYTCDWS-------NI....TS......SKITGTVVQ.MSN-PK--------
G8LUU2_CLOCD/726-807.------------------....SIAEPAFSCDFA-------HI....SS......SNVEGRFIK.LDK-KG--------
GUNI_CLOTH/536-616A------------------GKSAS..DLQVSSSYN-------QG............AKLS.DVKH.Y..-..--------
A3DHY3_CLOTH/706-787.------------------....GASSQEFVCDYA-------HL....SE......SMITAKFVD.LEN-PV--------
A9GL35_SORC5/144-226.------------------...VAKVDLKSECDFS-------SILG..GC......ANATRTFGE...A-SG--------
H6NJX8_9BACL/528-607.------------------....GAPPLNAWVDWA-------QV....GS......ANVLRSFGE.AAG-P.--------
Q65JI9_BACLD/503-585A------------------GYSAE..DIKVTAGYN-------EG............ASVS.ELKP.H.D-A.--------
E3E5T1_PAEPS/388-469.------------------....SKQAQQFFVDWA-------KI....GN......EKVKATFVT.LPN-PK--------
G8LUA7_CLOCD/539-627A------------------GQTID..DVDLQIMYD-------ENASSYGG...P..IKYK.GPYK.W.D-..--------
RSGI1_CLOTH/343-424.------------------...VSIDEMNWAVYFY-------SL....GS.....EKDVQCRFYE.LPG-K.--------
G0GF20_SPITZ/497-578A------------------GYTVN..DITISTNYV-------EFP...........VTIT.GPVH.Y..-..--------
Q6D5R0_PECAS/359-440.------------------....GKPGANLFVDWA-------NV....GP......NNIVTSTGM.PAA-ST--------
E3EJF1_PAEPS/849-930.------------------....GDKAQEFHCDYA-------QL....GS......SNIQGRFVK.LDK-AV--------
D9SS73_CLOC7/35-125.------------------....GTQGQTFWCDHA-------GALL..GNSYVDNTSKVTANFVKETAS-PT--------
D5SLE0_STRC2/47-129.------------------...APDASYRFACDWA-------VR....GC......SNLTGAFAA.HTP-AT--------
A5A671_BACLD/371-451.------------------.....RKGQNFDCDYA-------QI....GC......SKITHKFVQ.LKK-AV--------
GUNI_CLOTH/742-823.------------------....GGASQNFWCDWS-------SA....GN......SNVTGNFFN.LSS-PK--------
GUNF_CLOTH/487-569K------------------GITLD..QITVQSTTN-------GG............AKVS.QLLP.W.D-P.--------
H6NDH3_9BACL/886-967.------------------....GEKAQSFFCDWS-------SA....GC......PNVTGTFGK.PAA-AK--------
RSGI4_CLOTH/377-458.------------------....SESEQRFNCDWS-------SI....GA......HNVTGSFGK.VNP-SR--------
E0RWD9_BUTPB/507-593Q------------------GYSAS..DMKISTTYM-------QHK...........VNIS.EFKK.S.D-..--------
F4H3U7_CELFA/499-576.------------------GFAAS..DVTLSANYS-------ECGAQSGK......GVSA.........-..--------
A8FDC3_BACP2/465-547K------------------GLTEK..DIQVTAAYN-------EG............ASLS.PLKV.Y.D-A.--------
GUNG_CLOCE/496-580A------------------GIDPL..SLVTSSNYS-------EGKN..........TKVS.GVLP.W.D-V.--------
B8I7V7_CLOCE/540-629A------------------GQTID..DLTVAVMYD-------EGKASDGK...E..TAIN.GPFA.W.D-A.--------
E3FP49_STIAD/658-740.------------------....SPATLQITCDWS-------VL....GC......GNMGFQSAQ.LAS-PR--------
D9ST82_CLOC7/544-633Y------------------NQGID..AITCPVMYD-------QSNTVDVK...G..ATIS.APVE.W.D-K.--------
A4XIF5_CALS8/718-799.------------------....GERAQSAISDWA-------QI....GA......SNVTFKFVK.LSS-SV--------
D5UFH7_CELFN/503-581A------------------GVDAS..AVTVSTNYS-------ECGTTPSK......VVHA.........-..--------
D2B808_STRRD/500-576G------------------DTTAS..QVTVTSSYN-------QCKAPSGP......TLLS.........-..--------
G8TEL8_NIAKG/1180-1262.------------------....NYAGINTFIDYA-------QL....GS......AKVKAKYVQ.LDT-PR--------
C5BNA7_TERTT/494-574A------------------GYSLN..DLTVASGYN-------QA............SDVT.GLQH.W..-..--------
W6RW99_9CLOT/506-586.------------------....GNEKQVFECDWC-------SF....DS......NSITANFGS.INK-G.--------
GUN2_BACSU/356-436.------------------.....NKGQNFDCDYA-------QI....GC......GNVTHKFVT.LHK-PK--------
H6NJY0_9BACL/592-671.------------------....GSQALQSWVDWA-------QI....GS......ANVNRTFGT.ASG-T.--------
M1MVT4_9CLOT/36-123.------------------....NKKGQEFHCYNA-------DI....ADPYKSVTGNVTGKFVK.MES-KA--------
F2JLD6_CELLD/729-819.------------------....TQDKQQFWCDNA-------QIDMNKEPWYINLNSNISGKIMR.MDQ-VK--------
M1MLG4_9CLOT/496-578A------------------GYTSK..DITISTNYN-------QG............AKVS.NLIP.W.N-E.--------
F2JH10_CELLD/985-1075.------------------....GSEGQTVWCDNA-------AAQMNKAPWYSPYTSKVSGKVIK.MDA-TK--------
A9EQP9_SORC5/230-310.------------------....GATTVTPACWWW-------SS....GC......SRITLTTGT.VS.-.Y--------
B8I0N0_CLOCE/478-561E------------------GINPS..KFTTKVYYS-------PAD...........AQIS.GIQP.YDK-..--------

PF00963

SLAP1_CLOTH/34-195PATGEEFTDKSMPVNR..VLLTNSKYGPTPVAGND-------IKSGIINFATGYNNLTAYKSSGI-DEHTGIIGEIGFKV
O30295_ARCFU/279-418VLQGS..................LTQNSLFDYNVE-------GNQIKVGIA.........DSNGI-SGD.GSLFYVKFRV
CIPA_CLOTH/1549-1689IEPGE..............LIVDPNPTKSFDTAVY-------PDRKMIVFL..FAEDSGTGAYAI-TED.GVFATIVAKV
CBPA_CLOCL/291-428ITAGD..............IVL..NPSVNFSST..-------VSGSTIKLL..FLDDT.LGSQLI-TKD.GVFATITFKA
CIPA_CLOTH/31-168VKPGS..............IIKDPDPSKSFDSAIY-------PDRKMIVFL..FAEDSGRGTYAI-TQD.GVFATIVATV
CBPA_CLOCL/435-570VTAGD..............IVL..NPTVNFSYT..-------VNGNVIKLL..FLDDT.LGSQLI-SKD.GVFVTINFKA
Q977Y4_CLOAB/1344-1482VLPNT..............DLVKDTDNYSFIAN.T-------TSAGKISIT..FTDPT.LEKFPI-SAD.GVIANIDFVV
Q9FDJ9_9FIRM/225-386E.DGTAYDNASAPEYG...KLLQKRYSPTDMASND-------ITKGTLTFGRTYMNLDSYKNSGA-AEKEGSIAVIRFKV
Q9RPL0_9FIRM/1161-1298GAAGS..............IVT..NPDVNFGIN.K-------EADGKIKVL..FLDYT.MATEYI-SKD.GVFANLTFKI
Q977Y4_CLOAB/382-520VVPTD...............LVKDTDNYSFIVN.T-------STPGKISIT..FTDPT.LGTYPI-GTD.GIFAYLEFLV
A3DF10_CLOTH/34-197PETGKEFTSSTFPPGR..TVLKNNAYGPIQIADND-------PEKGILNFALAYSYIAGYKETGV-AEESGIIAKIGFKI
Q9ZGA7_9FIRM/91-228VKSGE..............IFG..SNNSNFDYTVI-------DTTGLVSFL..YTSSN.SGKDAV-TKP.GVITNITFKI
Q9RPL0_9FIRM/1621-1754GDAGS..............IVT..NPGVNFGIN.K-------EADGKLKVL..FLDYT.MTTQYI-SED.GVFANVTFKV
Q7WYN2_9FIRM/40-179VEPGS..............LI...EDPSDFNHYYN-------NVNGLASMS..FEAPV.DGSRMI-DNN.GVFASIKFKI
Q9FDJ9_9FIRM/1493-1654S.DGTAYDNSSVPEYG...KLLQKRYSPTDMGAND-------TANGILTFGRTYMNLSGYKASGV-AEKEGSIAVISFKV
ANCA_CLOTH/34-172LKAGD..............IVE..NPSESFSYNVV-------EKDEIIAVL..YLEETGLGIEAI-RTD.GVFFTIVMEV
Q9RPL0_9FIRM/1304-1441GAAGS..............IVK..NPDVNFGIN.K-------EADGKLKVL..FLDYT.MATEYI-SAD.GIFANLTFKI
Q7UY43_RHOBA/45-169DDIDFG.............SIWGAGSDTQVTANVD-------DAAGTVVIF.......VSASSAL-TDVSGSLVELPFSV
Q9AE52_RUMFL/1217-1350...................QLVKSGDKSGYGADII-------PSKDGYKFV..FADGA..GVAHV-APDGTVVIELTYKV
Q9AE52_RUMFL/58-185...................RYSSKTDGDAYGSGIV-------YNNS..KYA..FGQGA..GRGIV-AADDSVVLTLAYTV
Q977Y4_CLOAB/616-754VLPNT..............DLVKDTDNYSFIVN.T-------STPGKISIT..FTDPT.LANYPI-SVD.GILAYLDFII
O82830_CLOJO/1023-1161ATAGD..............IVI..NAPVNFSSSIN-------ATNGTISIL..FLDNT.ITDQPI-ASD.GVITNLTFKV
Q9RPL0_9FIRM/1475-1612GDAGS..............IVT..NPGVNFGIN.K-------ESDGKLKVL..FLDYT.MSTGYI-STD.GVFANLNFNI
Q8PV77_METMA/33-166VTEGN..............LFSQSGQNTLFSPGQI-------ENGKLTNVYGCILGSSSVSTP..-....ETFATVTLKA
CIPA_CLOTH/184-321IDPGD..............IIVDPNPTKSFDTAIY-------PDRKIIVFL..FAEDSGTGAYAI-TKD.GVFAKIRATV
Q7WYN2_9FIRM/326-465IDAGS..............LI...ENASDFTTYYN-------NENGFASMT..FEAPV.DRARII-DSD.GVFATINFKV
Q9AE52_RUMFL/194-326...................VYDSAKEGGAYITSLT-------VNDAKHKFA..FGRTT..GTGIV-AADKATVAAFTYKV
Q97KK4_CLOAB/41-180ISPGE..............ILK..DPKDNLEYNVD-------SKNGVITILYSYSDKN.IGKELI-SKN.GDFVTLNLKI
Q8XTG8_RALSO/623-752VTPGS..............LV...SANEVFANNID-------AAKGLV.....YMTMNAKQTQGK-DGA.GNVVRLTFKA
O82830_CLOJO/287-424VDAGP..............IVK..NAAVNFSSS..-------ASNGTISFL..FLDNT.ITDELI-TSD.GVFANITFKI
Q45996_9FIRM/1170-1307VTPGS..............IVT..NAAVNFSSS..-------TSNGTISFL..FLDNT.ITDQLI-KTD.GTFAEIKFKL
O30294_ARCFU/33-156VGKGE...................LNKGLLSSNTG-------EGMVAISLA.........DSKGI-NGK.GSVAVITFQV
CBPA_CLOCL/1709-1847TTAGT..............SIK..NPAVNFSSQ..-------LNGNTITLL..FFDNT.IGNELI-TAD.GQFATIEFKV
CBPA_CLOCL/668-801ITAGD..............IVL..NPSVNFSSV..-------VNGSTIKLL..FLDDT.LGSQLI-SKD.GVFATINFKA
Q9AE52_RUMFL/474-603...................LNYQESAGKPYGVDLV-------VNDTKQHFA..FAQAS..GISKT-AKDGDKLFTITFKV
Q7UY44_RHOBA/195-328VQLGADAPTGSQVEANLDTPGVATITFFSLEAMDA-------GQADIIDLIATIPEDAPYGST..-....GSLTISSLDV
Q9RPL0_9FIRM/480-612GAAGS..............IVT..NPTVNFGIN.K-------EADGKLKVL..FLDYT.MSTGYI-STN.GVFANVTFKV
Q9FDJ9_9FIRM/771-932D.DGTAYDSAAVPEYG...TLLQKRYSPTDMASND-------LSKGTLTFGRTYMALDSYKASGS-AETTGSIAVIRFKV
Q7WYN2_9FIRM/183-322VESGS..............LV...EKAEDFNMFIN-------NTYNFTSMT..FEAPI.DGSRMI-KSD.GVFAQVKFQI
CIPA_CLOTH/562-702IKPGE..............LIVDPNPDKSFDTAVY-------PDRKIIVFL..FAEDSGTGAYAI-TKD.GVFATIVAKV

PF09478

Q54SS3_DICDI/292-372-----------------AHQFGYIQR..S-------T--------------
Q54UH2_DICDI/243-323-----------------SHSFGYIQQ..S-------N--------------
Q54UH2_DICDI/352-432-----------------SHTFGYIQK..A-------Y--------------
Q54BC0_DICDI/1043-1124-----------------EYTFGYILK..G-------T--------------
Q55CG7_DICDI/1041-1122-----------------QYSFGYII....-------Q--------------
Q54U76_DICDI/53-136-----------------KYTFGYINN..G-------K--------------
Q54DP5_DICDI/230-310-----------------TFSFGYII....-------D--------------
Q55C74_DICDI/483-564-----------------TLSFGYIVS..S-------S--------------
Q54DJ4_DICDI/24-109-----------------KHTFGYINN..S-------G--------------
Q86KB6_DICDI/23-109-----------------YFNFGYINK..S-------E--------------
Q54EX0_DICDI/27-117-----------------NFTFGYINEAKT-------Q--------------
Q54LF5_DICDI/181-262-----------------SFSFGFVS....-------A--------------
Q54LG4_DICDI/193-274-----------------SFSFGFVS....-------S--------------
Q54LG5_DICDI/182-259-----------------SFSFGFVS....-------A--------------
GUN2_ORYSJ/544-626-----------------SAAFVYVH....-------A--------------
GUN15_ORYSJ/535-613-----------------SLRFVYV.....-------Q--------------
Q9ZSP9_SOLLC/533-611-----------------SLEFVYIH....-------T--------------
GUN19_ARATH/534-612-----------------SMEFVYIH....-------S--------------
GUN6_ARATH/528-606-----------------SLEFVYIH....-------S--------------
GUN13_ORYSJ/531-610-----------------QLTIVYI.....-------Q--------------
I1K6A1_SOYBN/532-609-----------------SLEFVYIH....-------.--------------
Q54DY8_DICDI/1219-1296-----------------SHNFGYIQ....-------.--------------
GUN5_ARATH/535-614-----------------AYDFVYVQ....-------.--------------

PF00553

GUND_CLOC7/411-512-----------------TQSFGFNINYSG-------VLSKPTGFTVNGTEC
XYNB_CELJU/37-133-----------------SISFGLQGEKNG-------ST..AERPTVTGAAC
GUNC_CELJU/37-133-----------------TVEFGFQGVTNS-------GT..VESPTVNGAAC
GUNA_CELJU/864-961-----------------TAEFGFQGTKGA-------GS..AQVPAVTGSVC
GUNB_CELJU/30-127-----------------SVEFGVQGNNGS-------SR..AQVPAVTGAIC
GUN1_ACIC1/465-559-----------------NTTFGFQASYTG-------SNAAPT......VAC
D6Y6N8_THEBD/360-452-----------------STSFGFLGSGTG-------QLSSSIT........
F4GZY2_CELFA/35-134-----------------TASFGFNGSWAG-------SNPTPASFSLNGTTC
F4H3U7_CELFA/946-1044-----------------STDIGFNGSHPG-------TNTNPASFTVNGEVC
F4H454_CELFA/408-507-----------------TAQFGFNGSHTG-------TNAAPTAFSLNGTPC
Y1987_MYCTU/41-139-----------------SATGGLRGGLTG-------SYSPPSSCLLNGQY.
Q47RH8_THEFY/40-136-----------------TASFGFIASGSG-------E...PTHCTINGAPC
Q7AKG2_STRCO/34-131-----------------SVSFGFNGSGPG-------S...PSNCKLNGGSC
Q9F3Q0_STRCO/58-156-----------------SADLGFVGSGAN-------..PAPTSFTLNGATC

PF03173

I2BB67_SHIBC/32-191TPKVIAST.....NS..EDLSRFVSPLGG.....DQWKRTPEDKNILMTAE
A3QBY8_SHELP/54-215KPELISSTQLTVDASTGMEQRPYVETYVS...AESQYKRSDTDKLKWATPQ
B3PH90_CELJU/45-198EAAVFANT.....DT..EDLTRFVSPFVR.PEQQLRFNAPTADAFPIVTS.
Q487J1_COLP3/52-215DARVIESTVPYIDKDTGLEILPYVEPFTD...EKTQFKRTASDKTQWLTSE
D3VAI6_XENNA/45-204EPKILANT.....DT..GNISEFLSALEG.....DQWKRTTADHNTLMTAE
Q87RM3_VIBPA/35-194EPKMIASL.....NT..EDVASFVTGLEG.....NNLKRTPDDNNIFASAV
A7MQU6_CROS8/34-190APKVIAST.....DT..ETLTDFVSPL.N.....DQWKRTPDDKNILMTAE
E6WFL0_PANSA/37-193SPKIITST.....NT..ENLADFVLPF.G.....DQWKRTADDKNVLMQPT
X2GWP3_9GAMM/38-198EPKVIANT.....DTDSDNLSAFVKPL.G.....EQWKISPNDHNILMTPE
D4ZH44_SHEVD/49-211EPVLIKSTAVTLDSETGMELRPYVVSFTD...EDKQYKRSDTDKVKWATAE
Q6LTD2_PHOPR/61-220KPKTIKST.....DA..EDPSAYLTPISG.....DNWKRTPDDNNVLATAQ
W8V3I6_YEREN/37-196QPKVLKST.....DT..EDINEYLTQFTG.....DQWKRTKDDNNVLMTPQ
K1RL03_CRAGI/26-177IPKDIVSTQ........GEALNFVGPFDT....PEKYLRFPGDKF......
A1S444_SHEAM/47-209KPVVIASTRLAVEAETGLELRPYVEAFTD...ADKQYRRTDNDKLPWATA.
A7RSQ4_NEMVE/34-186QARTITSTS........GESLDFVGPFDN....KFKWKRFDPDK.......
Q5DYR6_VIBF1/39-198EARNIISL.....DT..EDTGEYVDEIIG.....VQLKRTLADNNVVATAN
Q8CVD2_SHEON/53-215SPVVIASTQVKQDPETRMEVRPYVEPFTD...MVKQYSRTDADKLAPATA.
A0KIG5_AERHH/37-197EPKVLASM.....SN.IDDATTYEKPMPA.....DGWKRTKDDNNILMNSE
Q7PC48_SACD2/44-221EARVIESTRIRIHPETGLEERPFAGEISR.....QNFKLSQADKTPYADAA
W0LCL7_9GAMM/37-196KPKILANT.....DT..EDVNQFVAPFTG.....DQWKRTKDDNNILMVPE
C5BGA1_EDWI9/35-194KPKVIANT.....DT..EDLRQFVTPFAG.....DLWKRIKDDKNVLMTPE
A8GB46_SERP5/37-196KPKILVNT.....DT..EDLSQFVTPFSG.....DQWKRIKDDNNILMTPA
D8MPP8_ERWBE/36-192TPKILVST.....DT..EILTDFVEPF.G.....AQWKRIADDKNLLMDAQ
D0LVP4_HALO1/53-212DSRIIANT.....DS..DDSDAYAAPITG.....ENRKRTPQDNNVFATAQ
U4K583_9VIBR/34-198KGELIKNTAVKEADTGFEDLSGFLTPISNDPADTDQWRRTADDKTNVATA.
Q7NXY3_CHRVO/32-191PPALLRH......DS..SDEASYLLPLSG.....DNWKNPAGELRPLATPE
D3UXD7_XENBS/37-196MPKILANT.....DT..EDLSAFLSDFTD.....EQWKRTTLDNNILMTPE
E1ST90_FERBD/37-199EPVVIASTKEVRDPETGLWQLPFVEPLTD...PERQLRRTAEDNMAQATP.
Q7MBH3_PHOLL/37-196KPKVLVST.....DT..EDLSQFLSAFTD.....DQWKRTQTDNNILMTPE

PF00942

H6NM36_9BACL/665-744-----------------.GADTYVEI-------------------------
A3DC31_CLOTH/163-244-----------------ENADHYLEI-------------------------
A3DJ30_CLOTH/744-825-----------------PGADTYCEI-------------------------
G8LST1_CLOCD/336-417-----------------DSSHKYLEV-------------------------
F4A374_MAHA5/502-583-----------------SGNIYYITV-------------------------
F2R1Y0_STRVP/43-122-----------------ATADRYLEI-------------------------
R5VSS5_9FIRM/595-685-----------------DNGTYYVEI-------------------------
A3DD31_CLOTH/475-558-----------------.DNIYYIKI-------------------------
CIPA_CLOTH/371-461-----------------NNADTYLEI-------------------------
A3DEW0_CLOTH/41-124-----------------SGANKYIEF-------------------------
Q47MW0_THEFY/511-587-----------------.GDLYYVEI-------------------------
L7VTG9_CLOSH/842-923-----------------EGADYYLET-------------------------
Q82QF2_STRAW/596-678-----------------PGADAYLEV-------------------------
A9KT90_CLOPH/840-921-----------------TNADYYLEF-------------------------
G8TEL8_NIAKG/1335-1416-----------------TSADRYFEI-------------------------
H1YBR2_9SPHI/1731-1813-----------------NGATGYIEY-------------------------
G8LXR4_CLOCD/469-550-----------------KPNIYYVEV-------------------------
R7FDD1_9FIRM/647-737-----------------DNGTYYVEI-------------------------
I0K9X8_9BACT/1264-1347-----------------QGALGYVEY-------------------------
M1MVT4_9CLOT/204-289-----------------ANADSYIQV-------------------------
F2JNU4_CELLD/538-627-----------------EKNIAYIEL-------------------------
G8M373_CLOCD/185-272-----------------QDANYYLEI-------------------------
R7H7U6_9FIRM/568-657-----------------KTGDCYIEF-------------------------
G8M2T9_CLOCD/480-563-----------------DKNIYYVEI-------------------------
G8LUA7_CLOCD/713-794-----------------ENADNYLEI-------------------------
F2JH11_CELLD/993-1077-----------------SGNQYYMEI-------------------------
A4XIF8_CALS8/487-570-----------------SKNIYYILV-------------------------
Q2SJA3_HAHCH/490-573-----------------DDHIYYVDA-------------------------
C7PX61_CATAD/870-951-----------------TGADHYVQV-------------------------
L0G2U2_ECHVK/1325-1406-----------------AMADHYLDI-------------------------
B8I218_CLOCE/2193-2280-----------------.QCDHYIEI-------------------------
R7MSD4_9FIRM/508-590-----------------DGNIYYIEI-------------------------
Q097R6_STIAD/31-112-----------------TGADQYVEV-------------------------
I5ASR2_EUBCE/518-600-----------------KNGIYYCDL-------------------------
F3ZKG0_9ACTN/54-133-----------------ATADRYLEI-------------------------
D4LDI8_RUMC1/502-584-----------------DGNVYYVEI-------------------------
I0K9X8_9BACT/1422-1501-----------------TGADTYLEL-------------------------
GUX2_CLOSH/769-850-----------------TGADYYLEI-------------------------
A3DI46_CLOTH/53-139-----------------PGADSYVEI-------------------------
A0LVL3_ACIC1/752-834-----------------PTADTYLQL-------------------------
H1YBR2_9SPHI/1888-1968-----------------TGADHYFE.-------------------------
A3DBI3_CLOTH/793-874-----------------NNADYYLEI-------------------------
I0K805_9BACT/1554-1634-----------------ANADAYLEL-------------------------
R7H587_9FIRM/495-583-----------------EGSIYYIEV-------------------------
Q97KK5_CLOAB/496-578-----------------KNNIYYVNV-------------------------
L7VTG9_CLOSH/488-570-----------------AENIYYVNV-------------------------
A9KMK6_CLOPH/582-672-----------------TKADSYLDV-------------------------
G8LUU2_CLOCD/544-634-----------------DSGTYYVEF-------------------------
G8LUZ6_CLOCD/1193-1273-----------------KGNIYYVTV-------------------------
F2JH10_CELLD/497-584-----------------QNGIYYVEI-------------------------
Q9RK75_STRCO/41-123-----------------AAADRYLEI-------------------------
A4XIF5_CALS8/493-575-----------------SRNIYYILV-------------------------
S6D1L3_9EURY/569-658-----------------DAGIYYIEL-------------------------
G8LYV1_CLOCD/157-238-----------------NNANSYLEI-------------------------
K4KPQ8_SIMAS/499-582-----------------SKNIYYTEV-------------------------
E4N479_KITSK/43-125-----------------ATADRYLEI-------------------------
G8LWU8_CLOCD/747-828-----------------ATADYYLEV-------------------------
E3EAP2_PAEPS/1205-1286-----------------TSADYYLEV-------------------------
G8LXL9_CLOCD/505-587-----------------NDADHYLEI-------------------------
R7ML41_9FIRM/559-649-----------------DNGTYYIEI-------------------------
D4LFJ4_RUMC1/491-578-----------------SGDIYYVEV-------------------------
W6S3G9_9CLOT/173-261-----------------KSVDSYLEI-------------------------
V4KLB1_9ACTN/578-659-----------------PGASHYVEV-------------------------
D5UG75_CELFN/567-654-----------------.DGLYYVEV-------------------------
A3DIC9_CLOTH/54-150-----------------DMADHYLEI-------------------------
A3DHY3_CLOTH/527-615-----------------DAGTYYVEV-------------------------
L0G2U2_ECHVK/1171-1253-----------------EGAYGYVQY-------------------------
R7FAC7_9FIRM/488-575-----------------QGNIYYIEI-------------------------
A9KT91_CLOPH/774-855-----------------TGADYYLEI-------------------------
E3E7K8_PAEPS/878-959-----------------PSADSYAEI-------------------------
G8LUZ6_CLOCD/1396-1477-----------------NGADYYLEI-------------------------
R7FFS6_9FIRM/504-590-----------------SGNIYYVKL-------------------------
E6UCK4_RUMA7/671-761-----------------DKGTYYVDI-------------------------
D2QPV6_SPILD/417-497-----------------SGADSYLEL-------------------------
Q97KK3_CLOAB/485-568-----------------AKHIYYVEA-------------------------
D2BAV4_STRRD/34-116-----------------ATADRYLEV-------------------------
A9B7H5_HERA2/510-590-----------------AGTIYYVEI-------------------------
F2JID6_CELLD/33-122-----------------ENADTYVEI-------------------------
B8I7V0_CLOCE/35-124-----------------TNADHYLEV-------------------------
F2JNU4_CELLD/905-995-----------------NGADTYLEL-------------------------
A3DDF1_CLOTH/489-571-----------------EKNIYYIEV-------------------------
A9KT90_CLOPH/487-569-----------------ANNIYYVNV-------------------------
Q977Y4_CLOAB/39-128-----------------ATADHYLEI-------------------------
A0LVL3_ACIC1/517-593-----------------.GNIYYVTI-------------------------
F2JLD6_CELLD/530-617-----------------SKHLYYVEV-------------------------
F2JPM5_CELLD/857-938-----------------EAADCYLEI-------------------------
D9SS71_CLOC7/497-579-----------------ENNIYYVNV-------------------------
B1VPK7_STRGG/565-647-----------------TGASHYLEV-------------------------
A9KJ82_CLOPH/712-793-----------------SGADYYLEI-------------------------
G8LXM2_CLOCD/486-569-----------------SKNIYYVEV-------------------------
D9SV33_CLOC7/37-126-----------------PNYDTYLEI-------------------------
W6S3G9_9CLOT/3-92-----------------KGADYYLEI-------------------------
A3DCY5_CLOTH/489-571-----------------SKNIYYCEI-------------------------
H6NM35_9BACL/437-516-----------------.GADTYLEV-------------------------
B8I2K6_CLOCE/736-817-----------------PGADTYCEI-------------------------
RSGI2_CLOTH/514-595-----------------PNADSYVEI-------------------------
G8LUU2_CLOCD/726-807-----------------EGFDRYLEI-------------------------
GUNI_CLOTH/536-616-----------------KDNIYYVEV-------------------------
A3DHY3_CLOTH/706-787-----------------ENADNYLEI-------------------------
A9GL35_SORC5/144-226-----------------TQADHYLEL-------------------------
H6NJX8_9BACL/528-607-----------------.GADTYVEL-------------------------
Q65JI9_BACLD/503-585-----------------SKHIYYTEV-------------------------
E3E5T1_PAEPS/388-469-----------------SKADKYVEI-------------------------
G8LUA7_CLOCD/539-627-----------------DTGVCYVEF-------------------------
RSGI1_CLOTH/343-424-----------------KEANKYLEI-------------------------
G0GF20_SPITZ/497-578-----------------AGNIYYVEV-------------------------
Q6D5R0_PECAS/359-440-----------------DKANRYVLV-------------------------
E3EJF1_PAEPS/849-930-----------------NGADYYLEI-------------------------
D9SS73_CLOC7/35-125-----------------STYDTYVEF-------------------------
D5SLE0_STRC2/47-129-----------------ATADRYLEI-------------------------
A5A671_BACLD/371-451-----------------NGADTYLEV-------------------------
GUNI_CLOTH/742-823-----------------EGADTCLEV-------------------------
GUNF_CLOTH/487-569-----------------DNHIYYVNI-------------------------
H6NDH3_9BACL/886-967-----------------PGADSYLEI-------------------------
RSGI4_CLOTH/377-458-----------------NGADTYVEI-------------------------
E0RWD9_BUTPB/507-593-----------------KDGIYYVDV-------------------------
F4H3U7_CELFA/499-576-----------------GGTLGYVEL-------------------------
A8FDC3_BACP2/465-547-----------------SAHVYYAEI-------------------------
GUNG_CLOCE/496-580-----------------SNNVYYVNV-------------------------
B8I7V7_CLOCE/540-629-----------------EKGIYYVEI-------------------------
E3FP49_STIAD/658-740-----------------PGASHYLEI-------------------------
D9ST82_CLOC7/544-633-----------------EKGIYYVEI-------------------------
A4XIF5_CALS8/718-799-----------------SGADYYLEI-------------------------
D5UFH7_CELFN/503-581-----------------GGSLYYAEL-------------------------
D2B808_STRRD/500-576-----------------.GKTYYVTV-------------------------
G8TEL8_NIAKG/1180-1262-----------------AGAYGYIEY-------------------------
C5BNA7_TERTT/494-574-----------------DGNVYYVEA-------------------------
W6RW99_9CLOT/506-586-----------------NNADYYLDL-------------------------
GUN2_BACSU/356-436-----------------QGADTYLEL-------------------------
H6NJY0_9BACL/592-671-----------------.GADTYVEL-------------------------
M1MVT4_9CLOT/36-123-----------------DGADTYLEI-------------------------
F2JLD6_CELLD/729-819-----------------DGADHYLEI-------------------------
M1MLG4_9CLOT/496-578-----------------AQNIYYVNV-------------------------
F2JH10_CELLD/985-1075-----------------AGADCYIQI-------------------------
A9EQP9_SORC5/230-310-----------------TGADRYVQI-------------------------
B8I0N0_CLOCE/478-561-----------------EKNIYYVEI-------------------------

PF00963

SLAP1_CLOTH/34-195LKKQNTSIRF...EDTLSMPGAISGTSLFDWDAETITGYEVIQ.PDL.IVV
O30295_ARCFU/279-418TGNEKAEQAENVKGKLRGLGQQLSEITLRNSHALTLQGIEIYDIDGNSVKV
CIPA_CLOTH/1549-1689KEGAPEGF............SAIEISEFGAFADNDLVEVETDL.INGGVLV
CBPA_CLOCL/291-428K.AITGTTAKV.........TSVKLAGTPVVGDAQLQEKPCAV.NPGTVTI
CIPA_CLOTH/31-168KSAAA...............APITLLEVGAFADNDLVEISTTF.VAGGVNL
CBPA_CLOCL/435-570K.AVTSTVT...........TPVTVSGTPVFADGTLAEVQSKT.AAGSVTI
Q977Y4_CLOAB/1344-1482NSGAATGDS...........DLTVNSSGFIVADESDTDIDHVS.TNGKITV
Q9FDJ9_9FIRM/225-386LKVEATTITL...QNAASLTNAVDGTMLFDWTGAQLAGYRVQQAPSINGVV
Q9RPL0_9FIRM/1161-1298KSTAAAGTT...........AAVGIAGTATFGDSALKPITAVI.TDGKVEI
Q977Y4_CLOAB/382-520AGEKAGKY............DLKVNPTTLILADENDNDIDCNPPKDGSVTV
A3DF10_CLOTH/34-197LQKKSTAVKF...QDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSLGD
Q9ZGA7_9FIRM/91-228KDNAKKGS............IKISQGTSGAFGDTELKKINPVF.TEGEITV
Q9RPL0_9FIRM/1621-1754IGTDG...............LAAVNAEDATFGDSSLSPVTASV.VNGGVNI
Q7WYN2_9FIRM/40-179SETAPVGESY..........DITTNYSRTSFYSTGTEEIVNILCNNGAINV
Q9FDJ9_9FIRM/1493-1654LKATETKVLL...KNVPSLTSPVDGTMVFDWDGVQLADYKVTQAPAVNAPV
ANCA_CLOTH/34-172SKDVKPGI............SPIKFESFGATADNDMNEMTPKL.VEGKVEI
Q9RPL0_9FIRM/1304-1441KSTAVNGDV...........AAISKSGTATFGDKNLGPISAVI.KDGSVTV
Q7UY43_RHOBA/45-169ASNA.........................VVDSTTVLDLTQVTLNEGQISV
Q9AE52_RUMFL/1217-1350GEEVAPGTV...........IPVSIKDLYVVDEDGNDITKYVMPVDGSIIV
Q9AE52_RUMFL/58-185PADCAEGT............YDVKWSDAFVSDTDGQNITSKVTLTDGAIIV
Q977Y4_CLOAB/616-754NSNATAGDS...........ALTVDPATLIVADENDKDIKDAA.SNGKITV
O82830_CLOJO/1023-1161LGSSSTT.............TPIAFKAGGAFGNGNMAKISDITFTNGSAKL
Q9RPL0_9FIRM/1475-1612KSSAAIGSK...........AEVSISGTPTFGDSTLTPVVAKV.TNGAVNV
Q8PV77_METMA/33-166NTGVQGTSQFYLR......NVTVSSSASK.........PVDVRLVNTGITI
CIPA_CLOTH/184-321KSSAP...............GYITFDEVGGFADNDLVEQKVSF.IDGGVNV
Q7WYN2_9FIRM/326-465SDSAKVGELY..........NITTNSAYTSFYYSGTDEIKNVVYNDGKIEV
Q9AE52_RUMFL/194-326PSDCTEGT............YDVKWSGGFVSDADGKDITSRVTFVDGSITV
Q97KK4_CLOAB/41-180KDDAKKGK............TQISFNGNPEFYDKNQKGVSVTT.NKGEIEI
Q8XTG8_RALSO/623-752LAAGETSIHMQ.........DQMLITPSG........MASLKPTAPLVMTV
O82830_CLOJO/287-424KSTATQGT............TPITFKDGGAFGDGTMSKIASVIKTSGSVVI
Q45996_9FIRM/1170-1307KSVTAKTT............TPVAFKDGGAFGDGTMAKIATVTKTNGSVTI
O30294_ARCFU/33-156LKAGS...............TDLTIQSVKAYDVNTHVDIPVKA.DNGKFEA
CBPA_CLOCL/1709-1847NAAATSGTT...........AEVKVATISSFADASLTEITKVATVNGSVKV
CBPA_CLOCL/668-801K.SVTSTVT...........TPVKVSGTPVFADGTLAELSYET.VAGSVTI
Q9AE52_RUMFL/474-603PEDCADGI............YPVTWAKQFVSDENGNNITDKVTFTDGWVRV
Q7UY44_RHOBA/195-328NAGA...........................MTASADDAIQVVAFPGDVNA
Q9RPL0_9FIRM/480-612LNSAP...............TTVGITGA.TFGDKNLGNISATI.NAGSING
Q9FDJ9_9FIRM/771-932LRSTATAILL...QNAASLTNAVDGTMLFDWTGAQLKGYKVAQASSINGTV
Q7WYN2_9FIRM/183-322SDTALQGETY..........KISQISSNTSFYSTAVTEITDVIYADGAIKV
CIPA_CLOTH/562-702KSGAPNGL............SVIKFVEVGGFANNDLVEQRTQF.FDGGVNV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window