Sequence alignment for CL0203

PF09478

Q54SS3_DICDI/292-372---ANVTQKIINQWYSNNV.Y-----------Y.IQVDATINNK-G.------------..SKPVRGFNFQLQ.NV.---
Q54UH2_DICDI/243-323---VNITQTIVNSWNDGNQ.D-----------F.IQVQVVITNI-G.------------..PTTIRSFSFKLN.NI.---
Q54UH2_DICDI/352-432---ANVTQTITSSWRENNQ.D-----------Y.IQVETIITNI-G.------------..QSMIQSYTFELN.DI.---
Q54BC0_DICDI/1043-1124---YQVDQTIISKWINSEVYH-----------Y.LQASITIKNN-G.------------..IKPIKAFSFMMS.NI.---
Q55CG7_DICDI/1041-1122---YEVIQSIVATWIDSEKYP-----------Y.LQASITIKNT-G.------------..TRPIKAFSFIIE.KIA---
Q54U76_DICDI/53-136---LTIIQTITNSWSDNNGKE-----------FKTQVSVDIINN-T.------------..KRTVKDVIIATDADLA---
Q54DP5_DICDI/230-310---LKIDQTRYSSWFENGK.T-----------V.SQFGGIITNT-G.------------..SVTVTNPTFTSS....---
Q55C74_DICDI/483-564---AVIKQTIRQTWFDGTN.T-----------N.TLVDCTLTNP-S.------------..SSPIPIPRFAID....---
Q54DJ4_DICDI/24-109---ISISQIQTGSWDSHSA..-----------....WEVTLINT-G.------------..TRPIIDATLVAESNLI---
Q86KB6_DICDI/23-109---LTISQALTSSWNHNGQ.P-----------F.SVWDVRVRNT-G.------------..KAIVFGATIVGVSNLE---
Q54EX0_DICDI/27-117---ISMSQNQTSTWDDKNT.T-----------F.TVWEVMLVNN-W.------------..NATIIDLTITATANFF---
Q54LF5_DICDI/181-262---INYKLDTDSNWVANGV.T-----------Y.YQYKVTLTNN-E.------------..SSPIKSIEIHSD.NWN---
Q54LG4_DICDI/193-274---ISYKLNIDNQWITSGV.T-----------Y.YQYKLTLTNN-E.------------..ATAIKSIEIHSD.NWN---
Q54LG5_DICDI/182-259---L....DIDWQWDSNNV.H-----------Y.YQYRVTVTNN-D.------------..STAIKSIQIHSD.NWN---
GUN2_ORYSJ/544-626---VEIEQKATASWEKDGR.T-----------Y.HRYAVTVSNR-SP------------AGGKTVEELHIGIG.KLY---
GUN15_ORYSJ/535-613---IGIEQNVTGTWARRRR.T-----------Y.YRYAVTVTNR-S.------------.RGKTVRELHLGVS.GLR---
Q9ZSP9_SOLLC/533-611---VTIQQRATSSWALNGK.T-----------Y.YRYSAVVTNK-S.------------..GKTVKNLKLSIV.KLY---
GUN19_ARATH/534-612---ITISQKMTNSWKNEGK.V-----------Y.YRYSTILTNR-S.------------..TKTLKILKISIT.KLY---
GUN6_ARATH/528-606---VAIVQKITSSWVSKGR.T-----------Y.YRYSTTVINK-S.------------..SRPLKSLNLSIK.NLY---
GUN13_ORYSJ/531-610---LEFVHTVTNTWKANGV.D-----------Y.YRHVVTAKNT-C.------------..GHAITYLKLQIK.ELS---
I1K6A1_SOYBN/532-609---ISIEQKMTTSWIAHGI.T-----------Y.YRYSTVVTNK-S.------------..NKSLNSLNLSIS.KLY---
Q54DY8_DICDI/1219-1296---INVSQSIVNSWRENTQ.D-----------F.IQVEVNLKNI-G.------------..QNTVYQFSFEIF.DL.---
GUN5_ARATH/535-614---IEFLHSITSNWIAGNT.R-----------Y.YRHKVIIKNN-S.------------..QKPISDLKLKIE.DLS---

PF00553

GUND_CLOC7/411-512---VEVTYAITNSWGSG-----------------ASVNVTIKNN-G---------------TTPINGWTLKWTM.PI---
XYNB_CELJU/37-133---AACTYTIDSEWSTG-----------------FTANITLKND-T---------------GAAINNWNVNWQY.S.---
GUNC_CELJU/37-133---AGCEYVVTNSWGSG-----------------FTAAIRITNS-T---------------SSVINGWNVSWQY.N.---
GUNA_CELJU/864-961---GNCQYVVTNQWNNG-----------------FTAVIRVRNN-G---------------SSAINGWSVNWSY.SD---
GUNB_CELJU/30-127---AVCEYRVTNEWGSG-----------------FTASIRITNN-G---------------SSTINGWSVSWNYTD.---
GUN1_ACIC1/465-559---CTASYQVNSDWGNG-----------------FTVTVAVTNS-G---------------SVATKTWTVSWTF.GG---
D6Y6N8_THEBD/360-452---CEATYALVNQWPGG-----------------FQAEVTVKNT-G---------------SSPINGWTVQWTL.PS---
F4GZY2_CELFA/35-134---CRVDYAVTNQWPGG-----------------FGANVTITNL-G---------------DPVS.SWKLDWTY.TA---
F4H3U7_CELFA/946-1044---CTVVYSTN.SWNVG-----------------FTGSVKITNT-G---------------TTPLT.WTLGFAF.PS---
F4H454_CELFA/408-507---CQVLWGVN.QWNTG-----------------FTANVTVKNT-S---------------SAPVDGWTLTFSF.PS---
Y1987_MYCTU/41-139---.RATLSVTSTWQTG-----------------FIARFTITNS-S---------------TAPLTDWKLEFDL.PA---
Q47RH8_THEFY/40-136---.TATVTKESSWDNG-----------------YSASVTVRND-T---------------SSTVSQWEVVLTL.PG---
Q7AKG2_STRCO/34-131---ATATFAKTSDWGTG-----------------FGGSWTVKNT-G---------------TTSLSSWTVEWDF.PT---
Q9F3Q0_STRCO/58-156---CKAEYTITSQWEGG-----------------FQAGVKITNL-G---------------DPV.SGWTLGFTMPDA---

PF00942

H6NM36_9BACL/665-744---VQYRAGNTNAAD....NA-----------.-ISPHFNIKNN-GT------------A.AVNLSDLKIRYYFTKD---
A3DC31_CLOTH/163-244---VQYKNGDSTSSV....TA-----------.-IYPIFKITNN-GD------------T.SVKLSDIIIRYYYTKE---
A3DJ30_CLOTH/744-825---VSYKCGVKDGTK....NT-----------.-IRATINIKNT-GT------------T.PVNLSDIKVRYWFTSD---
G8LST1_CLOCD/336-417---LKHYNEQQSLYS....KA-----------.-IRWDFVIENT-GN------------S.YIDLRNVKVRYYFKDD---
F4A374_MAHA5/502-583---ANARV.TSE.QT....NF-----------.-TEISVDLTNH-SA------------WPARSLDRMSYKYFFDIT---
F2R1Y0_STRVP/43-122---VQYRQSATGS......DQ-----------.-VEPWLKVVNT-GS------------T.SVPLSQVKVRYYFKAD---
R5VSS5_9FIRM/595-685---IDARV..MQETD....AR-----------.-SQIEISICND-TS------------LPPRYISTLSARYFFNIN---
A3DD31_CLOTH/475-558---VEAAI.NQA.SD....HF-----------.-TEIKALLNNR-SS------------WPARLIKDLSYNYYMDLT---
CIPA_CLOTH/371-461---VEFYNSNPSDTT....NS-----------.-INPQFKVTNT-GS------------S.AIDLSKLTLRYYYTVD---
A3DEW0_CLOTH/41-124---LEFYNGDFGASV....SS-----------.-ISMNFRITNN-GS------------S.QISLSDIKLRYYFTDD---
Q47MW0_THEFY/511-587---VEAQI.NTP.GT....TF-----------.-TEIKAMIRNQ-SG------------WPARMLDKGTFRYWFTLD---
L7VTG9_CLOSH/842-923---IQMFNGNTSDKT....NG-----------.-IMPRYRLTNT-GT------------T.PIRLSDVKIRYYYTID---
Q82QF2_STRAW/596-678---VLYKNNDSSATD....NA-----------.-IRPGLRIVNT-GS------------G.SLDLSKVTARYYFTRD---
A9KT90_CLOPH/840-921---LQMFNGNSSATT....NG-----------.-IAPRIKLINT-GT------------T.AINLSDVKIRYYYTIN---
G8TEL8_NIAKG/1335-1416---VKAYASTQNGGK....NT-----------.-ISTYVTISNE-GN------------M.PVAYGDLSVRYWFTED---
H1YBR2_9SPHI/1731-1813---VQYIDGDNKQAG....NN-----------V-IRPYIRIVNQ-DS------------V.AVAYNELTMRYWFTAE---
G8LXR4_CLOCD/469-550---VEGVIMNNN.A.....ND-----------.-LSVKLLLNNR-SG------------WPARMIKDLKYHYYVDLS---
R7FDD1_9FIRM/647-737---VTAGK..AQEND....AG-----------.-LQVKIVVHNR-TI------------NPPQFCDDLRVRYYFNID---
I0K9X8_9BACT/1264-1347---ILHKNGNNNTKKV...NT-----------.-IRPYLKLNNG-GT------------A.AIPYGELTVRYWLTVE---
M1MVT4_9CLOT/204-289---VNVSNGSSA.......NS-----------.-IAPTFTITNT-GD------------E.ELDLTTLKLKYFYTAD---
F2JNU4_CELLD/538-627---ATAKI..EQENS....ER-----------.-SQITVKIHND-TS------------CPPSFESGLKARYFFDIS---
G8M373_CLOCD/185-272---IETYSGNPTNSI....NS-----------.-IMPRFKITNT-SK------------V.PIELKYVKLRYYYTNE---
R7H7U6_9FIRM/568-657---LEAAV..GQEDN....MA-----------.-SQVQIKIHNN-TI------------LPPRYLDHIKVRYYFNIS---
G8M2T9_CLOCD/480-563---CEAKIYEESSSG......-----------.-ITVDLNMYNI-VT------------SPPQYEPGLSCRYFIDLS---
G8LUA7_CLOCD/713-794---VLYKTTDASDAA....GD-----------.-IKVTLKIENT-GK------------K.PVDLSTLKIRYWYTKD---
F2JH11_CELLD/993-1077---VA.HNNKGGATT....NT-----------.-IGGQFVVTSE-G.------------..AVDLSKLAIRYYYTLE---
A4XIF8_CALS8/487-570---VESKFGNSQ.GA....NY-----------.-TEIISYIYNR-TG------------WPPRVTDNLNFKYFIDLS---
Q2SJA3_HAHCH/490-573---VEAKL.NSS.GP....RY-----------.-VEIAAQVHNH-SA------------WPARGSEQLRFRYWVDLS---
C7PX61_CATAD/870-951---VQYETSVTTATT....QS-----------.-FQPLLNVVNN-GT------------S.AVPLSSVTIRYWFTSD---
L0G2U2_ECHVK/1325-1406---VSVMAKNESSKD....NT-----------.-IKKVFNLKNT-GN------------V.PLDYEGISIRYWFTKD---
B8I218_CLOCE/2193-2280---VKSFNATTSATT....NS-----------.-IDPRIMFENT-GK------------T.EFKLSDLKIRYYFTSD---
R7MSD4_9FIRM/508-590---MEACI.NQE.SG....SY-----------.-TEIKAYTTNH-SA------------WPARVVKDLSYRYYIDLS---
Q097R6_STIAD/31-112---VQYQNYNASGPN....DS-----------I-IEAGIQLKNN-TT------------A.AIPLSTVVVRYWFTKD---
I5ASR2_EUBCE/518-600---IQSQ..NSSDSG....SS-----------.-VELMIHFENR-TA------------WPAVPTDSLVVRTYLDIS---
F3ZKG0_9ACTN/54-133---VQYRQSSTGA......DQ-----------.-AEPWFKVVNS-GN------------S.SVSLSQVKLRYYFRSD---
D4LDI8_RUMC1/502-584---IEAAV.NQS.SE....SY-----------.-TEVKVLATNH-SA------------WPARLIKNLSYRYYFDIS---
I0K9X8_9BACT/1422-1501---VYAENKNRNTTG....NQ-----------.-IKPYLNVANE-GN------------L.PVDYSQLTVRYWFTAE---
GUX2_CLOSH/769-850---IQSFNANTQEIS....NS-----------.-IMPRFRIYNS-GN------------T.SIPLSEVKLRYYYTVD---
A3DI46_CLOTH/53-139---VTLKNIKTGVPS....DT-----------.-IALKIGIINL-NK------------AININLNDIKLRYYFTND---
A0LVL3_ACIC1/752-834---VQYKNNDSAPGD....NQ-----------.-IKPGLQVVNT-GS------------S.SVDLSTVTVRYWFTRD---
H1YBR2_9SPHI/1888-1968---VSYQNQNQTSGG....NT-----------.-ISTYLSINNT-GN------------V.TVDYGDVTVRYWFMED---
A3DBI3_CLOTH/793-874---LQYANGNGSDTT....NT-----------.-INPRFKLINN-SG------------S.PVKLSDVKIRYYYTID---
I0K805_9BACT/1554-1634---V..YTDNRPVGA....NT-----------.-INTYLQVRNE-GN------------V.PVNYQDIKVRYYLTAD---
R7H587_9FIRM/495-583---VETTL.KTA.SA....SG-----------.-VTVSFKLTNH-TA------------WPARVVNNLSYRYYMDLS---
Q97KK5_CLOAB/496-578---VEAAV.NAT.GK....NF-----------.-EEIKSKIYNK-TG------------WPARVTDKLSFKYFIDIS---
L7VTG9_CLOSH/488-570---VMAGI.NAS.GQ....NF-----------.-IEIKALLHNQ-SG------------WPARVADKLSFRYFVDLT---
A9KMK6_CLOPH/582-672---LT.NTGNNNLST....NT-----------.-INADFKIKHE-KG------------S.DIDLSKLVIRYYYTKE---
G8LUU2_CLOCD/544-634---VEAKVSTSQENK....ER-----------.-SQITIRIHNE-SA------------YPPHYETGLKARYFFNIS---
G8LUZ6_CLOCD/1193-1273---VEAGV.NAS.GS....NF-----------.-IEIKAVINNK-SA------------WPARVCENLSFNYYIDIS---
F2JH10_CELLD/497-584---LEAGI.NAQ.DKQNAINF-----------.-VEIKAVVYNR-SA------------WPARVTDKLAYRYFVDIS---
Q9RK75_STRCO/41-123---VQYRTSASGATA....DQ-----------.-TEPWFKVRNT-GS------------S.IVQLSQVKIRYYFKAD---
A4XIF5_CALS8/493-575---VEAGI.NAS.GT....NF-----------.-IEIKAIVNNQ-SG------------WPARATNKLKFRYFVDLS---
S6D1L3_9EURY/569-658---AEGEV..LQENA....DR-----------.-TQVRVTIHNE-SI------------HPPHREDGLSARYFIDIS---
G8LYV1_CLOCD/157-238---LKYKNGRTNVNT....DT-----------.-IYPMFTIVNK-GN------------Q.KVKLSNIKIRYYYTKE---
K4KPQ8_SIMAS/499-582---VEAKS.NAT.GP....RH-----------.-IEIAAKVYNR-SA------------WPAANGDKLKFRYFVDLS---
E4N479_KITSK/43-125---VQYRTSASGATA....DQ-----------.-SEPWLQVTNT-GS------------G.TVALNRITLRYYFKSD---
G8LWU8_CLOCD/747-828---VEFYNTNTQAES....NS-----------.-IYPKFRLTNT-GS------------S.PINLADVKLRYYFTID---
E3EAP2_PAEPS/1205-1286---LQYRTADTKVND....NH-----------.-LNPHFQIVNK-GT------------A.SVPLNELKIRYYYTID---
G8LXL9_CLOCD/505-587---LGMYNEVRTDKA....KE-----------.-IHPRFKLINT-GN------------T.PIKLSTVKIRYYYTID---
R7ML41_9FIRM/559-649---VTAGK..AQETD....AG-----------.-LQVKLVIHNE-TT------------NPPKFESDMRVRYYFNIS---
D4LFJ4_RUMC1/491-578---VEAKA.T.S.DA....GG-----------.-VNLSLKFTNQ-TA------------WPARVEDNLSYRYYMDLS---
W6S3G9_9CLOT/173-261---VEMFNINTLTTS....NS-----------.-ITPKIKVTNI-GS------------V.DIDLSKLKLRYYFTSD---
V4KLB1_9ACTN/578-659---VQYRTSDTSPTD....SQ-----------.-IRMGLQVVNT-GQ------------S.AVNLADVKLRYWFTPD---
D5UG75_CELFN/567-654---VRAEL..EQENT....SR-----------.-TQVTLEISNR-SV------------HPPAEVDDLSLRYFFDIS---
A3DIC9_CLOTH/54-150---LEFFNNVKDDNV....TL-----------.-ISPYFRVINN-SS------------SDEIYLQHVKIRYYFTLD---
A3DHY3_CLOTH/527-615---VEGKI..EQENK....ER-----------.-TQVTIKIFND-TC------------HPPRFETGLMARYFFNIS---
L0G2U2_ECHVK/1171-1253---VSYKNGDASSPL....NS-----------Q-IKPYFKLINM-DT------------M.SVDLGNITAKYWLTPE---
R7FAC7_9FIRM/488-575---VETKL.K.S.SD....SG-----------.-VTLSFKFTNH-SA------------WPARIEDNMSYRYYMDLS---
A9KT91_CLOPH/774-855---VQMFNGNTSATT....NG-----------.-IAPRFYLVNT-GS------------N.SINLSDVKLRYYYTID---
E3E7K8_PAEPS/878-959---VQSFNGNISATS....NT-----------.-ISSKFKITNT-GS------------S.PVSLADVTLRYYYTIN---
G8LUZ6_CLOCD/1396-1477---IQYTNGNATDST....NG-----------.-INPRLRLVNN-GN------------S.SINLSDVKIRYYYTID---
R7FFS6_9FIRM/504-590---MKASI.NQS.AS....SY-----------.-TEIKAFAMNH-TA------------WPARTIKNLSYNYYFDIS---
E6UCK4_RUMA7/671-761---VSGGK..AQEKK....DG-----------.-IQLKVVLHNR-TV------------DPPRFECNVKARYFFNIK---
D2QPV6_SPILD/417-497---VYSAAKNSDIT.....SS-----------.-ISTVLEVRNT-GN------------V.AIPLQDLTVRYWFTSE---
Q97KK3_CLOAB/485-568---VDANI.MKE.SN....EE-----------.-CTIQAFIHNA-SL------------LPPHYEKGMSFRYYVDLS---
D2BAV4_STRRD/34-116---LQYRTSAAGGTA....DQ-----------.-VEPWFDLVND-GA------------S.AVPLSGVRIRYYFKAD---
A9B7H5_HERA2/510-590---VEAKV.NAS.GP....RF-----------.-IEISGVLHNQ-SA------------WPARNSTKLSYRYFVDLS---
F2JID6_CELLD/33-122---LEYCNTMASIST....NT-----------.-MGGKIKLTNT-SN------------E.TINLEDLKVRYYYTVD---
B8I7V0_CLOCE/35-124---VQFNNGSSPASS....NS-----------.-IYARFKVTNT-SG------------S.PINLADLKLRYYYTQD---
F2JNU4_CELLD/905-995---FK.MQGSDSITS....NT-----------.-IGRKIIMKNT-EG------------E.AVDLAALSVRYYFTKE---
A3DDF1_CLOTH/489-571---VEAYV.SSS.DK....NY-----------.-VEIKTRLNNR-TA------------WPARVSEGLSFRYFIDLT---
A9KT90_CLOPH/487-569---IQAGI.NAS.GP....SF-----------.-IEVKALVFNE-TG------------WPARVTDKLSFKYFIDIS---
Q977Y4_CLOAB/39-128---IQFADTNTSTTM....NT-----------.-IAPKFKITNN-TG------------A.PLDLTTLKLRYYFTAD---
A0LVL3_ACIC1/517-593---MQASV.NSA.GT....NY-----------.-TEIKAYIVNQ-SA------------WPARALDHGSFRYYFTLD---
F2JLD6_CELLD/530-617---IEAGI.NAE.DSQNEKHY-----------.-IEVKALVYNH-TA------------WPARITDNLSFKYFLDLT---
F2JPM5_CELLD/857-938---VTFNNCNLSEKT....NS-----------.-LMPRFKVTNT-GA------------D.AIDLSDVRLRYYFTTD---
D9SS71_CLOC7/497-579---VEAGV.NCT.GP....NF-----------.-VEIKALVNNR-TG------------WPARMGDKLSFKYFINVS---
B1VPK7_STRGG/565-647---AEYRNTDNSPTD....NQ-----------.-IRMSLRLVNT-GS------------A.AIDLSTVTARYWFTPD---
A9KJ82_CLOPH/712-793---IQAFNGNTSAST....NG-----------.-ISPKFKLINT-GN------------T.DINLSDIKLRYYYTID---
G8LXM2_CLOCD/486-569---IYGAL.NAS.GP....TF-----------.-TNMKVTLANM-TG------------WPPRGSDTLSFRYFVDIS---
D9SV33_CLOC7/37-126---IEMYNSNKALET....NT-----------.-ISPTFKIKNS-SD------------S.CLNLKDVTVRYYYTSD---
W6S3G9_9CLOT/3-92---LQMFNINNSTSS....NV-----------.-VSGKFKIINT-DS------------N.SVNLSDIKIRYYYTID---
A3DCY5_CLOTH/489-571---VEATA.NSN.......NG-----------.-VELKTYLYNK-SG------------WPARVCDKLSFRYFMDLT---
H6NM35_9BACL/437-516---LQYRAADTNAGD....NA-----------.-IKPHFNIRNT-GA------------S.PVDLSGVKLRYYFTKD---
B8I2K6_CLOCE/736-817---VSYKSGTSDGTK....NT-----------.-IRSSINIKNT-GT------------V.PINLSDIKVKYWFTND---
A3DC27_CLOTH/514-595---LQAYNHIRTSET....KE-----------.-LQPRIKLINT-GN------------T.PITLSEVKIRYYYTKD---
G8LUU2_CLOCD/726-807---VLYKCLTSSDSA....SD-----------.-IRAILKIQND-GK------------K.PVNLSDIKVQYWFTAD---
GUNI_CLOTH/536-616---VEAGV.NAS.GN....NF-----------.-IEIKAIVNNK-SG------------WPARVCENLSFRYFINIE---
A3DHY3_CLOTH/706-787---VLYKYGDTTAAT....KD-----------.-IRGSIKIKNT-GT------------K.PVNLSDVKVRYWFTKD---
A9GL35_SORC5/144-226---LQYAARDTTVEP....QH-----------.-LSFMVQVKNT-DD------------A.SIALSDLTIRYWFTAD---
H6NJX8_9BACL/528-607---VQYRAGNTNAAD....NT-----------.-IGPQFNIKNT-GT------------T.AVKLSGLKLRYYFTKE---
Q65JI9_BACLD/503-585---AEASI.NSS.GN....SY-----------.-TEIRAQLNNR-SG------------WPAKKTDQLSFRYYVDLT---
E3E5T1_PAEPS/388-469---LQYRTDDTNAKD....NA-----------.-IRPQFNIKNT-GK------------T.AVKLSDLKIRYYYTDE---
G8LUA7_CLOCD/539-627---AEAKL..EQENK....ER-----------.-TQITIRLYNY-SV------------HPPHFEEAMKVRYFFNIS---
A3DBH1_CLOTH/343-424---IQYYSRKPHD......SA-----------G-IDFSFRMFNT-GN------------E.AIDLKDVKVRYYFKED---
G0GF20_SPITZ/497-578---TEACL.NAS.GS....NF-----------.-TEVKVLVNNR-SA------------WPARVINDLRFRYFIDLS---
Q6D5R0_PECAS/359-440---LQYRNVDNNPSD....DA-----------.-IRMAFNIKNT-GS------------T.PIKLSDLQVRYYFHDD---
E3EJF1_PAEPS/849-930---AQYRVGDTNPGD....NQ-----------.-IRPLFRVVNK-GK------------E.ALDLKNVKLRYYYTVD---
D9SS73_CLOC7/35-125---VEFYNSNKSAQT....NS-----------.-ITPIIKITNT-SD------------S.DLNLNDVKVRYYYTSD---
D5SLE0_STRC2/47-129---VQYRTGVTGATA....GQ-----------.-AAPWFTVRNT-GT------------A.PVRLADVRLRYYFSSD---
A5A671_BACLD/371-451---VQYRAGDNNVNG....NQ-----------.-IRPQLNIKNN-SK------------K.TVSLNRITVRYWYKTN---
GUNI_CLOTH/742-823---LQYANGNAGATS....NS-----------.-INPRFKIINN-GT------------K.AINLSDVKIRYYYTKE---
GUNF_CLOTH/487-569---VEAAV.NAA.GP....GF-----------.-VNIKASIINK-SG------------WPARGSDKLSAKYFVDIS---
H6NDH3_9BACL/886-967---VQVQNGTTAAAT....NS-----------.-IAPRIRLVNT-GT------------S.AIELSDVTLRYYYTID---
A3DCG3_CLOTH/377-458---VRFYNNNTLSET....GV-----------.-IYMRINVINT-GN------------A.PLDLSDLKLRYYYTID---
E0RWD9_BUTPB/507-593---LRAGI.NAQ.DKNNKINF-----------.-VEIKAVIENH-TA------------WPARVTDNLTLRMFFDLS---
F4H3U7_CELFA/499-576---VEAML.NQPPSG....TF-----------.-TEVKAMIRNQ-SA------------FPARSLKNAKVRYWFTTD---
A8FDC3_BACP2/465-547---VEAAV.MNN.DA....TS-----------.-TQVKAVLYNR-SG------------WPARRSQTLSFRYYVNLS---
GUNG_CLOCE/496-580---IKAGL.NST.GP....NY-----------.-TEIKAVVYNQ-TG------------WPARVTDKISFKYFMDLS---
B8I7V7_CLOCE/540-629---AESKL..EQENT....ER-----------.-TQVTVRIHNE-TS------------RPPEFVDELKARYFFDIS---
E3FP49_STIAD/658-740---ALYRDGDNNAPG....NN-----------Q-IRPHLRVKNG-GT------------T.PVNLAEVKVRYYFTLE---
D9ST82_CLOC7/544-633---VESKL..EQENG....ER-----------.-TQVTIRANNL-TV------------HPPHTEDTIKVRYFFNIS---
A4XIF5_CALS8/718-799---VLYANKETNSTT....NT-----------.-IRPWLKVVNS-GS------------S.SIDLSRVTIRYWYTVD---
D5UFH7_CELFN/503-581---VEAKL.NQPAGG....TF-----------.-TEVKAVVRNR-SA------------FPARSLTNASIRYWFTLD---
D2B808_STRRD/500-576---LEAGV.NAS.GP....TF-----------.-TEIKTIVRNQ-SA------------WPARPLTNGSFRYYFTLD---
G8TEL8_NIAKG/1180-1262---VQSQDGDKGKTD....NN-----------S-ISPYLQLVST-GK------------A.NVAYGELTARYWFTAE---
C5BNA7_TERTT/494-574---VGAKI.NSS.GN....RF-----------.-VEMKAVIQNH-ST------------TPAQGKDDLYMRYFYDLS---
W6RW99_9CLOT/506-586---VEMYNKINQPVY....NN-----------.-ITPCFRITNA-GK------------T.SINLKNIKIRYYYTKD---
GUN2_BACSU/356-436---VQYRAGDGSMNS....NQ-----------.-IRPQLQIKNN-GN------------T.TVDLKDVTARYWYKAK---
H6NJY0_9BACL/592-671---VQYRAGNTNPAD....NT-----------.-IAAHFNIKNT-GT------------T.AVKLSDLKLRYYFTKD---
M1MVT4_9CLOT/36-123---LDLTNVKTDEST....NA-----------.-INGTFNVTNN-GE------------E.AINLSDVKIRYYFTAD---
F2JLD6_CELLD/729-819---LK.QTNASNSKS....NT-----------.-INLNLEIKGK-KE------------S.QFDLKDLSIHYYYTSD---
M1MLG4_9CLOT/496-578---AEAGV.NAS.GP....NF-----------.-MEIKALLYNK-SG------------WPAKVGDKLSFKYFIDIS---
F2JH10_CELLD/985-1075---VG.NTGNGQAST....NT-----------.-LTNNFKLVHK-SG------------N.DIDLSKLEIRYYYTAD---
A9EQP9_SORC5/230-310---VQYSNYDAAAPN....DT-----------I-VEAGIKIRNN-TA------------A.SIPLSSIVLRYWFTKN---
B8I0N0_CLOCE/478-561---SEAKLYKSNTEG......-----------.-VTVDLNLYNI-VT------------APPQYEKDLSCKFFVDLS---

PF03173

I2BB67_SHIBC/32-191QLAVNYTINDNHAGANGVDCA....ALGADWASCNKATITLTNH-G.AAIT.DKD....W-AIYFPSIRQILKIDND...
A3QBY8_SHELP/54-215.LAVNYHTLTNYPQQ....CT....STGVD.GRCFAAQIELVPG-..VDFD.RKD....W-AIYYSQMRPVKQVLTD...
B3PH90_CELJU/45-198DAQLAFAPVSNFALGHGQ................FQAQLTLNNQ-SAIALPAGKG...DW-RIYIHSIRKLHENKVA...
Q487J1_COLP3/52-215NLEVNYRVVTNIPTDK...CD....SKIAD.GACFEVELSFTAK-..KAIA.AKD....W-TIHFSQISPIQSFESE...
D3VAI6_XENNA/45-204QLKVNFKVIDNQAGSHGTDCA....ILGADSAACNRVNITLGNG-N.QAIN.SAD....W-ALYFHSIRQILKLDNV...
Q87RM3_VIBPA/35-194NLDIQYQVLTNHGANEGLACQ....DLGAEWASCNKVNMTLVNQ-G.EAVN.SKD....W-AIYFHSIRLILDVDNE...
A7MQU6_CROS8/34-190..GLNYTITDNQAAQHGTDCA....ALGADWASCNKAVITLTNP-G.DAVT.DKN....W-TIWFHSIRQILKVDND...
E6WFL0_PANSA/37-193..GVQYQITDNQAASHGVDCA....QLGADWASCNRATIKLTNH-G.PAIT.SKN....W-AIYMSNVHETLRVDND...
X2GWP3_9GAMM/38-198QLHLNYQIVDNDAANHGVDCA....ALGADWASCNKVTLTLKNT-G.PAIT.SND....W-AIYFHNIRMILAVNND...
D4ZH44_SHEVD/49-211TLEIKYRVVTNYPQG....CS....TSGVD.GRCFTAQIDLTSA-..VDLD.SHD....W-AIYFSQMRPVQSVNSK...
Q6LTD2_PHOPR/61-220NLDVNYELVTNHGANEGLKCQ....ELNAEWASCDLINLTLVNN-G.PAVD.SKD....W-TIYFHSIRMILDVQND...
W8V3I6_YEREN/37-196TLKVNYKVLDNRAAENGVDCA....KLGADWASCNKVLITLTNT-G.DEIK.GQD....W-AIYFHSIRQILTVDND...
K1RL03_CRAGI/26-177NLNIKYDVINNLLNG................KSTFVSKITLENT-GGSDIK.PGS....W-ELFFYSLHLIQPNSYPYK.
A1S444_SHEAM/47-209GLDVKYRVVTNRPDEQ...CK....KDAGE.GRCFQAEIVLTSP-..IDFD.GRD....F-EIYYSQMRPVQSVQST...
A7RSQ4_NEMVE/34-186NLGIRYDVLDNFQDS................WRSYKVQLTLSNA-GSQAIA.NGD....W-SIYLCHIRVIEPVHTKHNP
Q5DYR6_VIBF1/39-198NLDINYTVITNQGADDGLACK....ELQAEWASCNKVNMTLTNT-G.EAID.SKD....W-TIYFHSIRLILDVEND...
Q8CVD2_SHEON/53-215NLGVTYRVLTNRPDDN...CD....KAAAE.GRCFVAEIDFVPE-..VDLI.GKE....W-AIYFSQMRPVQSVEGK...
A0KIG5_AERHH/37-197NLVVKYEVVTNDGAGAGLDCQ....ALGSEWASCGVAKLHLTNT-G.ADVT.SKD....W-SIYVSSIRRIQRVDND...
Q7PC48_SACD2/44-221NMQVHYQVLLNKGDGE...CSLPSLPPSPK.SPCSIVELSLSSP-..DKLA.ANDLDGNW-SIYFSQTDPIYAHPAG...
W0LCL7_9ENTR/37-196QLNVKLQMQDNRAADHGVDCA....KLGADWASCNKVLITLTNS-G.QEIK.GQD....W-AIYFHSPRQTLKVDNE...
C5BGA1_EDWI9/35-194QVKVNYAVTDNRGAENGVNCA....ALGADWASCNQAVISLTND-G.SAIE.GKE....W-AIYFHNIRQILKSGNE...
A8GB46_SERP5/37-196QLKLNLKMVDNRAADSGLDCG....KLGADWAACNKVLISLTND-H.QEIK.GHD....W-AIYFHSARQTMRVDND...
D8MPP8_ERWBE/36-192..GVKYKVTDNLAAQHGVDCA....GLGADWASCNRATISFTNP-G.PAID.SKD....W-AIYMSNVHETLKVESD...
D0LVP4_HALO1/53-212.IELRYELLETHGAQAGVDCK....ALAGDYASCHTARLVLSNR-GEEALP.SGG....W-TLYFHSIRRVLSVEGE...
U4K583_9VIBR/34-198.LNVSTSLVVNQPTDSKAECP.........WGLCYRAEITITNT-SDKAV..NKD....W-DLYFPSIHRVLDTRGD...
Q7NXY3_CHRVO/32-191.LSLKIAVDSNKGAAAGAPCA....DLGADWASCLKGRLILENK-GGQAVPAGGG....W-NLYLHSIRRILKLDTP...
I0DXS0_PROSM/38-196.IDVKINVLDNQAGEHGTHCA....ALGADWAACNRVDITLTNG-D.TAIE.SND....W-ALYFHSIRQILKQDNP...
D3UXD7_XENBS/37-196QLKVNFKIKDNQAGAHGTDCA....ILGADGASCNRVHITLANG-N.QAID.SSD....W-AIYFHSIRQILKVDHE...
E1ST90_FERBD/37-199QLQVVHRVVDNRPGPH...CR....EDKGD.GACYRAEIELTTG-D.TALP.ATG....W-ELRFSQVSYVQGSTGP...
Q7MBH3_PHOLL/37-196QLKVNYKVVDNQAGDHGVNCA....VLGADWAKCNRVDITLTNG-N.QAID.SID....W-AIYFHSIRQVLSVDNE...

PF00963

SLAP1_CLOTH/34-195---IEMVLDKTEV.HVG--DV-------------ITATIKVNNI.RK--------------...LAGYQLNIKFDPEVLQ
O30295_ARCFU/279-418---TTIIAGSAEA.PQG--SD-------------IQVPVKIENA.DK--------------...VGSINLILSY.PNVLE
CIPA_CLOTH/1549-1689---LTLKIGRAEG.RPG--DT-------------VEIPVNLYGV.PQ--------------KG.IASGDFVVSYDPNVLE
CBPA_CLOCL/291-428---VTATIGKVQV.NAG--ET-------------VAVPVNLTKV.PA--------------AG.LATIELPLTFDSASLE
CIPA_CLOTH/31-168---MTVEIGKVTA.AVG--SK-------------VEIPITLKGV.PS--------------KG.MANCDFVLGYDPNVLE
CBPA_CLOCL/435-570---MQISVGTATV.KAG--EI-------------AAVPVTLTSV.PS--------------TG.IATAEAQVSFDATLLE
Q977Y4_CLOAB/1344-1482---TTLAVGAASG.KAG--DT-------------VKVPVTISKV.TT--------------P..VGLICMEIDYDASKFT
Q9FDJ9_9FIRM/225-386---VTVEVDKTDA.KVG--DI-------------ITATINVKNI.NG--------------...FAGYQANLKYNPAVLQ
Q9RPL0_9FIRM/1161-1298---MAVAVGAVQG.GVG--ET-------------VTVPVTMTKV.PT--------------TG.VSTADFTVTYDATKLE
Q977Y4_CLOAB/382-520---TNVTVGDVTGAKKG--DT-------------IKVPVSVSTV.KT--------------P..IGLIDMEINYDPTELT
A3DF10_CLOTH/34-197---IELKFDRNKG.EVG--DI-------------LIGTVRINNI.KN--------------...FAGFQVNIVYDPKVLM
Q9ZGA7_9FIRM/91-228---AEISIGKVSG.ATG--ST-------------VTIPVKLNNL.PK--------------KG.IGSFNFNIKYDTDALE
Q9RPL0_9FIRM/1621-1754---FKVSIDTVKA.ATG--TQ-------------VVVPVSFVNV.PA--------------TG.ISTTDMTITYDATKLQ
Q7WYN2_9FIRM/40-179---LQVDIGKVSG.EPG--SI-------------VSVPVTFSNV.PA--------------TG.IYALSFSVNFDKSMLS
Q9FDJ9_9FIRM/1493-1654---VFVTLDKTKA.AVG--DI-------------ITATINVKDF.DS--------------...VAGYQASVKYDPAVLQ
ANCA_CLOTH/34-172---IEIIIGNVKA.RPG--DR-------------IEVPVSLKNV.PD--------------KG.IVSSDFVIEYDSKLFK
Q9RPL0_9FIRM/1304-1441---MKVVIANVSG.NAG--SE-------------VVVPVSIEGV.SA--------------NG.VSAADFTITYDATKLD
Q7UY43_RHOBA/45-169---AAVNIPDDLTSAPD--AI-------------VSVPVNIDSA.TG--------------...VRAAEIRLSYDTSVLD
Q9AE52_RUMFL/1217-1350---IAWVVDTVAA.YPG--DE-------------VTLKITVKDPNAA--------------NLGIAGAQFKVTPDGDV..
Q9AE52_RUMFL/58-185---VEWLIPTVTA.APG--QT-------------VTMPVVVKSS...--------------SLAVAGAQFKIQAATGV..
Q977Y4_CLOAB/616-754---VKLSVGTVSG.NPG--DT-------------VKVPVTISQV.ST--------------P..VGLICMDISYDASKFT
O82830_CLOJO/1023-1161---LGVKIASVTG.KTG--DT-------------ITVPVTLSNV.AT--------------VGNVGTCNFYITYDPTLLQ
Q9RPL0_9FIRM/1475-1612---FNLSIDTVEG.NPG--SS-------------VVVPVKLSGI.SK--------------NG.ISTADFTVTYDATKLE
Q8PV77_METMA/33-166---VTLQPASKNV.YAG--EN-------------ITLNVVVTPD.TQ--------------...ISGIQFDLEYDGSLFQ
CIPA_CLOTH/184-321---VVVEIGKVTG.SVG--TT-------------VEIPVYFRGV.PS--------------KG.IANCDFVFRYDPNVLE
Q7WYN2_9FIRM/326-465---LQVDIGSTSG.KAG--SV-------------VSVPITFTNV.PK--------------SG.IYALSFRTNFDPQKVT
Q9AE52_RUMFL/194-326---IKWVLDKVTA.APG--ET-------------VTVKATVDASGEG--------------TVAVAGAQFDVNADSPI..
Q97KK4_CLOAB/41-180---SNLKISSSSG.KTG--SN-------------VEVKVKASNV.AK--------------KN.VICCDFKIKYDASKLD
Q8XTG8_RALSO/623-752---SALTIQGPSSVPAG--ST-------------FDVLVNVQPE.RP--------------...FTSLPLTLQYNPAQLQ
O82830_CLOJO/287-424---LKVSVGTAVG.APG--DT-------------VTVPVTFADV.AK--------------VNNVGTCNFYLGYDASLLD
Q45996_9FIRM/1170-1307---LKVAVGTASG.KAG--DT-------------VTVPVTFADV.AT--------------VGNVGTCNFYVTYDTNLLE
O30294_ARCFU/33-156---MVVKIPDTSG.AVG--GT-------------VEVPVEVENA.QN--------------...LGSMDIVIVYDPTILK
CBPA_CLOCL/1709-1847---FAVKIDKVSA.AAG--ST-------------VKVPVSLINV.SK--------------VGNVCVAEYKISFDSSVLT
CBPA_CLOCL/668-801---VTATVGTATV.NAG--ET-------------VAVPVTLSNV.SG--------------...ISTAELQLSFDATLLE
Q9AE52_RUMFL/474-603---VEWVIPKVDA.DAG--DN-------------VTLQVAVKG..DA--------------DLPVSAAQFDVNGATP...
Q7UY44_RHOBA/195-328---VQLPVGGSGT.ELP--AG-------------LPIQLSNADG...--------------...VTSVTMTIQYDPALLD
Q9RPL0_9FIRM/480-612---FTVNVDSVNG.NVG--EQ-------------IVVPVSFANV.PS--------------NG.VSTADMTITYDSSKLE
Q9FDJ9_9FIRM/771-932---VVATVDKTTA.SVG--DI-------------ITYTINVKDV.AG--------------...FAGYQANVKYDPAVLQ
Q7WYN2_9FIRM/183-322---LKAEIGSVSG.KPG--SV-------------VSVPITFSNV.PK--------------SG.IYALSFRIGYDNTKIR
CIPA_CLOTH/562-702---IKIKVDTVNA.KPG--DT-------------VNIPVRFSGI.PS--------------KG.IANCDFVYSYDPNVLE

PF09478

Q54SS3_DICDI/292-372------------------------------------------....QDIWNADQ.TSTNNYKLP--SWLG...E-IPV-N
Q54UH2_DICDI/243-323------------------------------------------....ISIWEVET.LSSNSYQLP--NWVG...S-ISS-G
Q54UH2_DICDI/352-432------------------------------------------....QSIWEIQT.LSNNTFTLP--NWKN...S-IEV-G
Q54BC0_DICDI/1043-1124------------------------------------------....DQIWGVTI.SSGPTYSLP--SWNP...T-INP-G
Q55CG7_DICDI/1041-1122------------------------------------------...YGQIWGVDA.NGNNRYTLP--SYNL...I-INP-R
Q54U76_DICDI/53-136------------------------------------------...FNQIWGVNK..NGYLLDLP--NYA....T-IAP-G
Q54DP5_DICDI/230-310------------------------------------------PLRPNSIWGLAVDETKNTWAL.--QWYP...V-IQP-G
Q55C74_DICDI/483-564------------------------------------------K.TPSSSWELNL.VSSNIVSFT--SWNN...Q-ISP-G
Q54DJ4_DICDI/24-109------------------------------------------LDKPENIWSMEL.ISPNKYHFP--SWITQNGG-LNS-G
Q86KB6_DICDI/23-109------------------------------------------...LENVWSVEQ.ISSNKFSFP--KYISQNGG-LKN-G
Q54EX0_DICDI/27-117------------------------------------------SSKPSDIWNVEK.VSDKVYHFQ--PYLIQ.NG-LST-G
Q54LF5_DICDI/181-262------------------------------------------...PTEFWNIVRSQKTGNLSFP--PFVV...N-LQA-G
Q54LG4_DICDI/193-274------------------------------------------...PTEFWNIERNVQTGNLGFP--AFVS...T-LKV-G
Q54LG5_DICDI/182-259------------------------------------------...PTEFWNVEKNAQTGNLGFP--SFVN...T-LPV-G
GUN2_ORYSJ/544-626------------------------------------------....GPVWGLEK.AARYGYVLP--SWTP...S-LPA-G
GUN15_ORYSJ/535-613------------------------------------------....GRLWGLEE..ARYGYVPP--RWLP...A-LRP-G
Q9ZSP9_SOLLC/533-611------------------------------------------....GPLWGLTK..YGNSFIFP--AWLN...S-LPA-G
GUN19_ARATH/534-612------------------------------------------....GPIWGVTK..TGNSFSFP--SWMQ...S-LPS-G
GUN6_ARATH/528-606------------------------------------------....GPIWGLSR..SGNSFGLP--SWMH...S-LPS-G
GUN13_ORYSJ/531-610------------------------------------------....GEIYGVSRTNAKDMYEFP--SWMT...R-LDA-G
I1K6A1_SOYBN/532-609------------------------------------------....GPIWGVTK..SGDSYTFP--SWLS...S-LSA-G
Q54DY8_DICDI/1219-1296------------------------------------------....VNIWGVEL.LSNNTYQLP--SWVY...S-IPV-G
GUN5_ARATH/535-614------------------------------------------....GPIWGLNPTGQKYTYQLP--QWQK...T-LRA-G

PF00553

GUND_CLOC7/411-512------------------------------------------NQTITNMWSASFVASGTTLSVTNAGYNG---T-IAANG
XYNB_CELJU/37-133------------------------------------------SNRMTSGWNANFSGT.NPYNATNMSWNG---S-IAP.G
GUNC_CELJU/37-133------------------------------------------SNRVTNLWNANLSGS.NPYSASNLSWNG---T-IQP.G
GUNA_CELJU/864-961------------------------------------------GSRITNSWNANVTGN.NPYAASALGWNA---N-IQP.G
GUNB_CELJU/30-127------------------------------------------GSRVTSSWNAGLSGA.NPYSATPVGWNT---S-IPI.G
GUN1_ACIC1/465-559------------------------------------------NQTITNSWNAAVTQNGQSVTARNMSYNN---V-IQP.G
D6Y6N8_THEBD/360-452------------------------------------------GQSITQLWNGDLSTSGSNVTVRNVSWNG---N-VPA.G
F4GZY2_CELFA/35-134------------------------------------------GQRIQQLWNGTASTNGGQVSVTSLPWNG---S-IPT.G
F4H3U7_CELFA/946-1044------------------------------------------GQQVTQGWSATWSQTGTTVTATGLSWNA---T-LQP.G
F4H454_CELFA/408-507------------------------------------------GQQVTQAWSSTVTQSGSAVTVRNAPWNG---S-IPA.G
Y1987_MYCTU/41-139------------------------------------------GESVLHTWNSTVARSGTHYVLSPANWNR---I-IAP.G
Q47RH8_THEFY/40-136------------------------------------------GTTVAQVWNAQHTSSGNSHTFTGVSWNS---T-IPP.G
Q7AKG2_STRCO/34-131------------------------------------------GTKVTSAWDATVTNSGDHWTAKNVGWNG---T-LAP.G
Q9F3Q0_STRCO/58-156------------------------------------------GQRLVQGWNATWSQSGSAVTAGGVDWNR---T-LAT.G

PF00942

H6NM36_9BACL/665-744------------------------------.........GSAGLDSWVDWAQV....GG......ANVQRVFGS.ASG-T
A3DC31_CLOTH/163-244------------------------------.........GNENETFWCNEFTR....DG......SQVYGTFVK.MSK-P
A3DJ30_CLOTH/744-825------------------------------.........GNEQNNFVCDYAAF....GT......DKVKGIVKK.IEN-S
G8LST1_CLOCD/336-417------------------------------..........YKNINFAVYFYSL....GD....EKNDVKGKVYN.IRQ-S
F4A374_MAHA5/502-583------------------------------EIVNAGHSAS..EITVAKNYSEVP...........VTVS.GPTK.W..-.
F2R1Y0_STRVP/43-122------------------------------.........AGASYTYACSWAVK....GC......ANLTGTFGT.LAN-P
R5VSS5_9FIRM/595-685------------------------------EMLKAGQTID..DLDIEIYYDEENANTNG...ESFATIS.KPVK.W.D-.
A3DD31_CLOTH/475-558------------------------------EVFEAGYSVD..DIKVTIGYCESGMD.........VEIS.PITHLY..-.
CIPA_CLOTH/371-461------------------------------.........GQKDQTFWCDHAAIIGSNGS.YNGITSNVKGTFVK.MSS-S
A3DEW0_CLOTH/41-124------------------------------.........GVSPITVFIDYA......NNNGRGINNDVTYTIKD.INS-.
Q47MW0_THEFY/511-587------------------------------....EGVDPA..DITVSSAYNQCATPEDV......HHVS.........-.
L7VTG9_CLOSH/842-923------------------------------.........GEKDQNFWCDWSSV....GS......NNITGTFVK.MAE-P
Q82QF2_STRAW/596-678------------------------------........SGSPTVNAWCDYAAV....GC......SNVSLKVVP.LTT-P
A9KT90_CLOPH/840-921------------------------------.........GEKDQAFWCDYSTI....GS......SNVNGTFVK.MST-P
G8TEL8_NIAKG/1335-1416------------------------------.........GTAALNSWVDYAKL....GT......SNIITGINT.VSP-A
H1YBR2_9SPHI/1731-1813------------------------------.........NYSGINTWVDYAQL....GN......SNVSMAYIP.LPE-P
G8LXR4_CLOCD/469-550------------------------------E....GVDPS..DVTVSTNYIEPNM..D.......ATVS.QLIP.Y.P-N
R7FDD1_9FIRM/647-737------------------------------ELTAIGEDIS..MVETRVDYDAESAMTNN...KTSATIS.EPIK.Y.D-.
I0K9X8_9BACT/1264-1347------------------------------........DFAPMTNLYIDWAQL....GT......NKVKLKYVA.LPQ-P
M1MVT4_9CLOT/204-289------------------------------.........GDEAETFNCYYAGTV...GGDYQNLTGNVEGKIVK.LGS-A
F2JNU4_CELLD/538-627------------------------------EMVEAGQSLK..ELSVQVMYDQASIVDGV...K..TNIN.GPFM.W.D-E
G8M373_CLOCD/185-272------------------------------.........EEKEQNFWCDYAAI....LNPKHSPLTGVTGKFYK.LSP-A
R7H7U6_9FIRM/568-657------------------------------ELLKNGQSLE..DISVRMDYDEEKANSDG...K..TAVS.YQMK.Q.Y-N
G8M2T9_CLOCD/480-563------------------------------EYAGENIDLS..KFVTKVYYSPAG...........AEIS.GLKP.WDK-.
G8LUA7_CLOCD/713-794------------------------------.........SDDAQECIFDYVKI....GK......EMVEAKFVD.VSP-A
F2JH11_CELLD/993-1077------------------------------.........GNGAQTAYKDNAGMNLNKAPWYVNLTPDVSVNVVP....-.
A4XIF8_CALS8/487-570------------------------------ELIKAGYGPD..IVKVETYYSEG............GKIS.GPYV.W.N-A
Q2SJA3_HAHCH/490-573------------------------------DEFAAGYGLQ..DVKVTTAYSQA............TEVS.GLQP.WGD-P
C7PX61_CATAD/870-951------------------------------........GGSSTFATNCWYAVI....GC......AKVTQSVSS.VT.-A
L0G2U2_ECHVK/1325-1406------------------------------.........GGGALTFWKDYAEL....GS......ENLEGTFMA.VEA-S
B8I218_CLOCE/2193-2280------------------------------.........SDKDQSYWCDYAEIKGASGQ..RNITSSVKGSSVL.FTG-T
R7MSD4_9FIRM/508-590------------------------------EVFEAGFTVD..DVQVKIGYDEWGN..........CTIS.KPIQ.Y..-.
Q097R6_STIAD/31-112------------------------------.........GATTVAPACWWWNTAACPGI......SLVTGSVSA....-.
I5ASR2_EUBCE/518-600------------------------------DVLEKGYKPS..DIKTSTNFAQGS...........AVIS.ELKP.T..-G
F3ZKG0_9ACTN/54-133------------------------------.........NAAAYRFACSWAVK....GC......ANVTGTFGT.LAH-P
D4LDI8_RUMC1/502-584------------------------------EILAAGLTVD..DITVRIGYDEYST..........TQIS.KPIQ.Y..-.
I0K9X8_9BACT/1422-1501------------------------------.........GNQPLVYTVDYAEL....GN......SKVTGRFVK...V-N
GUX2_CLOSH/769-850------------------------------.........GDKPQNFWCDWASI....GS......SNVTGTFVK.MDG-A
A3DI46_CLOTH/53-139------------------------------.........GCSPIQVNIKLF......GTETESFNPELVKTSVV.TGL-S
A0LVL3_ACIC1/752-834------------------------------........GGSSTLVYNCDWAAI....GC......GNIRASFGS.VNP-A
H1YBR2_9SPHI/1888-1968------------------------------.........GSQSMNYWIDYAVK....GT......NNISGKIVT.LNT-P
A3DBI3_CLOTH/793-874------------------------------.........GEKGQQFWCDWSSA....GN......SNVTGKFVK.LSS-P
I0K805_9BACT/1554-1634------------------------------........ANPDKLRFYLDYALL....GN......PNVTGRFVK.LDP-V
R7H587_9FIRM/495-583------------------------------EVLDAGYQAS..DVVVRCDRDQAQMYSDY...AN.AEIS.GLIH.D..-.
Q97KK5_CLOAB/496-578------------------------------EFVKQGYKAS..DIKVTTNYNEG............GTAS.QLIP.W.D-E
L7VTG9_CLOSH/488-570------------------------------ELIEAGYSAS..DVTITTNYNAG............AKVT.GLHP.W.N-E
A9KMK6_CLOPH/582-672------------------------------.........GTAKENFYCDTAAMQLNKDPWYIPYTSVVNGTFNS.MAV-P
G8LUU2_CLOCD/544-634------------------------------ELINAGQSID..DVQMEVYYDENEKCYDG...K..AKYL.GPIK.Y.D-.
G8LUZ6_CLOCD/1193-1273------------------------------EAINAGHSAS..DIKVSANYNQG............AKVS.ELKP.L..-.
F2JH10_CELLD/497-584------------------------------DVLAAGYKAS..DMKISANYNQSG...........AKIS.SLQP.W.D-A
Q9RK75_STRCO/41-123------------------------------........SPNASYRFACSWAVR....GC......AAVTGTFGT.LAN-P
A4XIF5_CALS8/493-575------------------------------ELIKAGYSPN..QLTLSTNYNQG............AKVS.GPYV.W.D-S
S6D1L3_9EURY/569-658------------------------------ELREAGQSID..AVSVEVQYDQQATEGDG...S..TDVS.GPIA.W.D-E
G8LYV1_CLOCD/157-238------------------------------.........GNASETFWCDYFTK....GS......SNVIGSFAK.LNN-D
K4KPQ8_SIMAS/499-582------------------------------AEMAKGYTAA..DVTVSTAYSQA............TSVS.QLKV.WGD-P
E4N479_KITSK/43-125------------------------------........GPSTTYRFACSWAVK....GC......ANITGTFGT.LAN-P
G8LWU8_CLOCD/747-828------------------------------.........GEKSQNFWCDWSPV....GS......SNVTGQFVK.MTQ-A
E3EAP2_PAEPS/1205-1286------------------------------.........GDREQTFNCDYAAL....SC......SKLNGKLVK.MEK-A
G8LXL9_CLOCD/505-587------------------------------........IEDKQQVFYCDWSNI....GR......NSITGKLVK.MNT-G
R7ML41_9FIRM/559-649------------------------------EQLEAGEDIS..FIETRIDYDQEKSFTDG...KNEAHIS.EPVK.Y.D-.
D4LFJ4_RUMC1/491-578------------------------------EVIAAGNKPE..DVVIRCDRDQSAMYSDV...TP.AQIS.GIQH.Y..-.
W6S3G9_9CLOT/173-261------------------------------.........SDKLQKFWCDHASITT..GG.YKAITSSVLGTFGS.FTP-S
V4KLB1_9ACTN/578-659------------------------------.........GSSAVNSTCDWAQL....GC......GGVTHTVEQ.ASG-S
D5UG75_CELFN/567-654------------------------------ELQADAQTID..DVRVDVYYDEAKTLSGK...A..VSIG.EPVH.V.G-.
A3DIC9_CLOTH/54-150------------------------------......SSDSEETMNYEIYYAGKSNIDGTGAVEDIKPNTIVKIAKMDI-P
A3DHY3_CLOTH/527-615------------------------------ELLDAGQSID..DVKIEVYYDENKASYDG...P..AEVR.GPIK.Y.D-.
L0G2U2_ECHVK/1171-1253------------------------------.........QVDVIKTRVDYAPF....GE......DQVAMEYVR.LDG-P
R7FAC7_9FIRM/488-575------------------------------EVISAGYQPS..DVAVRVDRDQAKMYDDC...KP.AEIS.PITQ.Y..-.
A9KT91_CLOPH/774-855------------------------------.........GEKSQSFWCDWSSI....GS......SNVTGTFVK.MAT-P
E3E7K8_PAEPS/878-959------------------------------.........GEKSQNFFTDWSSS....GT......ENVIANFKA.LTN-A
G8LUZ6_CLOCD/1396-1477------------------------------.........GEKPQTFWCDWSSA....GT......SNVTGSFNK.LTA-A
R7FFS6_9FIRM/504-590------------------------------ELVDAGYSID..DVSVKIGYDQHSSDKGK......ISIS.DPIQ.Y..-.
E6UCK4_RUMA7/671-761------------------------------ELLDAGYGID..YITARIDYDQVAGYSNN...KSHAELS.DPVK.Y.D-.
D2QPV6_SPILD/417-497------------------------------.........TSQLLNSYIDYAQI....GA......QTIKHNVVR.LAQ-P
Q97KK3_CLOAB/485-568------------------------------ELYKKGYTVN..DVGVRANYAAGG...........GTLS.GFIP.Y.D-E
D2BAV4_STRRD/34-116------------------------------........PGASQYRFACSWAVV....SC......STVTGTFGT.IAP-G
A9B7H5_HERA2/510-590------------------------------EVFAAGYGLS..DVTVSTAYTQG............SGVS.SLKQ.W..-.
F2JID6_CELLD/33-122------------------------------.........EPLTQTLWCDHAGLMGSKGY..ETITSSVTSKFEA.LSS-P
B8I7V0_CLOCE/35-124------------------------------.........ADKPLTFWCDHAGYMS..GSNYIDATSKVTGSFKA.VSP-A
F2JNU4_CELLD/905-995------------------------------.........GNVGQTYFCDHASMTFNKAPWYAALTSDITYKVVN.LDT-P
A3DDF1_CLOTH/489-571------------------------------EVIEAGYGPN..DLIISGGQGSS............GKVS.GPHL.W.N-K
A9KT90_CLOPH/487-569------------------------------EYVAKGYTKN..DFTVSTNYNNG............ATTS.ALLP.W.D-A
Q977Y4_CLOAB/39-128------------------------------.........GTQDENFWCDHAGMLN..GYNYQTITSNVVGTFVA.MDN-A
A0LVL3_ACIC1/517-593------------------------------....GSTTPA..QISLSSAYNQCSAPQGP......TQYS.........-.
F2JLD6_CELLD/530-617------------------------------DYIKAGGVPS..DLITSYNNSSGK...........VMIS.KVLP.W.D-E
F2JPM5_CELLD/857-938------------------------------.........GNQENFFWCDWSQV....GN......SNVKGTFVK.MDN-P
D9SS71_CLOC7/497-579------------------------------EFVNAGYSAD..DLKVTVGYNTG............GTVS.NLIP.W.D-K
B1VPK7_STRGG/565-647------------------------------........GGASTFGTACDYAVL....GC......GNVTHGVRS.AST-P
A9KJ82_CLOPH/712-793------------------------------.........GEISQNFWCDWASV....GS......ENVKGEFVK.LAK-P
G8LXM2_CLOCD/486-569------------------------------EVVNAGYKAS..DITVSASASNG............AKVSPKLIE.W.D-A
D9SV33_CLOC7/37-126------------------------------.........GNQEQNFWCDHAGALL..GYNYVDNTSKVTGKFIK.EPN-S
W6S3G9_9CLOT/3-92------------------------------.........SKREQSFWCDYSSMNV..GYNSISITDKVTGTFYK.LDT-V
A3DCY5_CLOTH/489-571------------------------------EYVSAGYNPN..DITVSIIYSAAPT..........AKIS.KPIL.Y.D-A
H6NM35_9BACL/437-516------------------------------.........GIQPLSFAVDWAQV....GS......PNVKGTFGS.ASG-A
B8I2K6_CLOCE/736-817------------------------------.........GNQQNSFTCEYAAL....GT......GNVIGNFSN.ISN-P
A3DC27_CLOTH/514-595------------------------------.........QVINEIYTCDWSNI....TS......SKITGTVVQ.MSN-P
G8LUU2_CLOCD/726-807------------------------------.........SIAEPAFSCDFAHI....SS......SNVEGRFIK.LDK-K
GUNI_CLOTH/536-616------------------------------EIVNAGKSAS..DLQVSSSYNQG............AKLS.DVKH.Y..-.
A3DHY3_CLOTH/706-787------------------------------.........GASSQEFVCDYAHL....SE......SMITAKFVD.LEN-P
A9GL35_SORC5/144-226------------------------------........VAKVDLKSECDFSSILG..GC......ANATRTFGE...A-S
H6NJX8_9BACL/528-607------------------------------.........GAPPLNAWVDWAQV....GS......ANVLRSFGE.AAG-P
Q65JI9_BACLD/503-585------------------------------EAVEAGYSAE..DIKVTAGYNEG............ASVS.ELKP.H.D-A
E3E5T1_PAEPS/388-469------------------------------.........SKQAQQFFVDWAKI....GN......EKVKATFVT.LPN-P
G8LUA7_CLOCD/539-627------------------------------EMLDAGQTID..DVDLQIMYDENASSYGG...P..IKYK.GPYK.W.D-.
A3DBH1_CLOTH/343-424------------------------------........VSIDEMNWAVYFYSL....GS.....EKDVQCRFYE.LPG-K
G0GF20_SPITZ/497-578------------------------------EVFAAGYTVN..DITISTNYVEFP...........VTIT.GPVH.Y..-.
Q6D5R0_PECAS/359-440------------------------------.........GKPGANLFVDWANV....GP......NNIVTSTGM.PAA-S
E3EJF1_PAEPS/849-930------------------------------.........GDKAQEFHCDYAQL....GS......SNIQGRFVK.LDK-A
D9SS73_CLOC7/35-125------------------------------.........GTQGQTFWCDHAGALL..GNSYVDNTSKVTANFVKETAS-P
D5SLE0_STRC2/47-129------------------------------........APDASYRFACDWAVR....GC......SNLTGAFAA.HTP-A
A5A671_BACLD/371-451------------------------------..........RKGQNFDCDYAQI....GC......SKITHKFVQ.LKK-A
GUNI_CLOTH/742-823------------------------------.........GGASQNFWCDWSSA....GN......SNVTGNFFN.LSS-P
GUNF_CLOTH/487-569------------------------------EAVAKGITLD..QITVQSTTNGG............AKVS.QLLP.W.D-P
H6NDH3_9BACL/886-967------------------------------.........GEKAQSFFCDWSSA....GC......PNVTGTFGK.PAA-A
A3DCG3_CLOTH/377-458------------------------------.........SESEQRFNCDWSSI....GA......HNVTGSFGK.VNP-S
E0RWD9_BUTPB/507-593------------------------------DVLAQGYSAS..DMKISTTYMQHK...........VNIS.EFKK.S.D-.
F4H3U7_CELFA/499-576------------------------------.....GFAAS..DVTLSANYSECGAQSGK......GVSA.........-.
A8FDC3_BACP2/465-547------------------------------EVFAKGLTEK..DIQVTAAYNEG............ASLS.PLKV.Y.D-A
GUNG_CLOCE/496-580------------------------------EIVAAGIDPL..SLVTSSNYSEGKN..........TKVS.GVLP.W.D-V
B8I7V7_CLOCE/540-629------------------------------EMLAAGQTID..DLTVAVMYDEGKASDGK...E..TAIN.GPFA.W.D-A
E3FP49_STIAD/658-740------------------------------.........SPATLQITCDWSVL....GC......GNMGFQSAQ.LAS-P
D9ST82_CLOC7/544-633------------------------------ELMQYNQGID..AITCPVMYDQSNTVDVK...G..ATIS.APVE.W.D-K
A4XIF5_CALS8/718-799------------------------------.........GERAQSAISDWAQI....GA......SNVTFKFVK.LSS-S
D5UFH7_CELFN/503-581------------------------------....AGVDAS..AVTVSTNYSECGTTPSK......VVHA.........-.
D2B808_STRRD/500-576------------------------------....GDTTAS..QVTVTSSYNQCKAPSGP......TLLS.........-.
G8TEL8_NIAKG/1180-1262------------------------------.........NYAGINTFIDYAQL....GS......AKVKAKYVQ.LDT-P
C5BNA7_TERTT/494-574------------------------------EVFAAGYSLN..DLTVASGYNQA............SDVT.GLQH.W..-.
W6RW99_9CLOT/506-586------------------------------.........GNEKQVFECDWCSF....DS......NSITANFGS.INK-G
GUN2_BACSU/356-436------------------------------..........NKGQNFDCDYAQI....GC......GNVTHKFVT.LHK-P
H6NJY0_9BACL/592-671------------------------------.........GSQALQSWVDWAQI....GS......ANVNRTFGT.ASG-T
M1MVT4_9CLOT/36-123------------------------------.........NKKGQEFHCYNADI....ADPYKSVTGNVTGKFVK.MES-K
F2JLD6_CELLD/729-819------------------------------.........TQDKQQFWCDNAQIDMNKEPWYINLNSNISGKIMR.MDQ-V
M1MLG4_9CLOT/496-578------------------------------EIIKAGYTSK..DITISTNYNQG............AKVS.NLIP.W.N-E
F2JH10_CELLD/985-1075------------------------------.........GSEGQTVWCDNAAAQMNKAPWYSPYTSKVSGKVIK.MDA-T
A9EQP9_SORC5/230-310------------------------------.........GATTVTPACWWWSS....GC......SRITLTTGT.VS.-.
B8I0N0_CLOCE/478-561------------------------------EFAAEGINPS..KFTTKVYYSPAD...........AQIS.GIQP.YDK-.

PF03173

I2BB67_SHIBC/32-191----------------------........QFAVTHIVGDLHKLTPTDKFTGFPAGKSVEIPIVNEYWQLFMTDVIPRWY
A3QBY8_SHELP/54-215----------------------........AFELTQVKGDLHRITPTERFSGFQKDQPVDIAFLGELWQLSETDAMPNYY
B3PH90_CELJU/45-198----------------------........GLQIKHVQGDLHALEPSADFTGLAAGASLEVPYSGGNWIVSYSDFMPRAF
Q487J1_COLP3/52-215----------------------........DFTVKHLNGDLHVIALQDKFSGFSAAETKKITFRAMFWSLSETDALPNYI
D3VAI6_XENNA/45-204----------------------........QYKITHITGDLYKLEPTEKFTGIKANEKIVLPIIGEYWQIYSTDFIPRWY
Q87RM3_VIBPA/35-194----------------------........QFKISRVTGDLHKLEPTDKFDGFAAGEEVVLPLIGEYWQLFETDFMPGAF
A7MQU6_CROS8/34-190----------------------........QFKVTHVMGDLHKLEPTDKFTGFPAKSSVEIPIINEYWQLFITDVLPRWY
E6WFL0_PANSA/37-193----------------------........QFKMTHIVGDLTRLEPTDKFTGFAAGATVDIPIVNEYWQLFITDVMPRWY
X2GWP3_9GAMM/38-198----------------------........QFKITHVTGDLHKLEPTEKFKNIPANAVVTIPIIGEYWQISESDVMPRWY
D4ZH44_SHEVD/49-211----------------------........EFTITRVKGDLHKIAPTTEFTGLKQGITKTIEFKGELWQLSETDAMPNYY
Q6LTD2_PHOPR/61-220----------------------........QFKITHVTGDLHTLEPTDKFDGFAEGETVVIPYIGEYWTLFENDYMPRAY
W8V3I6_YEREN/37-196----------------------........QFTITHLTGDLHKIEPSAKFTGFPANQAVEIPITGEYWQLFATDFMPRWY
K1RL03_CRAGI/26-177----------------------DGFLFSDCKMKVFHINGNLFKLKPENKFR.LNTGGSVECIIEASDWQSIRFESMPNWY
A1S444_SHEAM/47-209----------------------........DFVIEHVKGDLHRIKPTGNFGGFKANQSQTLAFRGELWQLSETDAMPNYY
A7RSQ4_NEMVE/34-186----------------------DGYVLPGYGLKVTHVNGCQHRIQPTADFKPLLPGDSRPVLFNAENWAVAKTDVMPNFY
Q5DYR6_VIBF1/39-198----------------------........QFKITRVTGDLHKLEPTEKFDGFAAGEEVVIPLIAEYWQLFETDFMPGAF
Q8CVD2_SHEON/53-215----------------------........EFSITHIKGDLYRIAPTEAFSGFSKGVKKTLRFRGELWQLSETDAMPNYY
A0KIG5_AERHH/37-197----------------------........QFTITHLTGDLYRLTPTEKFQGFAKDATVEVPLVVEYWVLFESDIMPNWY
Q7PC48_SACD2/44-221----------------------........EFTIDHINGDLHRIRPSASYQGFNVGEVKKVQFIVAGLTLTEAKIMPNYY
W0LCL7_9ENTR/37-196----------------------........QFKITHITGDLYKLEPTDKFTSFPANQAVEIPIIAEYWQVFHSDFLPRWY
C5BGA1_EDWI9/35-194----------------------........QFKITFITGDLHKIEPTDKFKGFAAGERIEIPIVGEYWQLFESDVMPRWY
A8GB46_SERP5/37-196----------------------........QFKIAHLTGDLYKLEPTDKFTGFPAGQTVEIPIIAEYWQLFKTDFVPRWY
D8MPP8_ERWBE/36-192----------------------........QFRMVHIVGDLTRLEPTDKFKGIAAGETIEIPIVNEYWQLFITDVMPRWY
D0LVP4_HALO1/53-212----------------------........DFTISHINGDLHALRPTASFAGFAAGEALNVAFVAEYWTLYQSDFMPRYY
U4K583_9VIBR/34-198----------------------........LFTITHIDGDLHRVSPTAKFNGLQPGESVTVEYDAEYWQIVNSDFMPNYY
Q7NXY3_CHRVO/32-191----------------------........QFTLRHITGDLYQITPTAAFQGLAPGQKLELPLIDEYWILQESDVLPRPY
I0DXS0_PROSM/38-196----------------------........QFKITHITGDLHKITPTEQFKGIKAHEKVVLPLTGEYWQVSYSDFMPRWY
D3UXD7_XENBS/37-196----------------------........QYKITHITGDLHKLEPTEKFIGIKANEKILLPIFGEYWQIYSTDFMPRWY
E1ST90_FERBD/37-199----------------------.........LTIEHINGDLHRLFPGDDFAGLAAQQTQAVPYTANFWSVSNSDPMPNYY
Q7MBH3_PHOLL/37-196----------------------........QFKITRITGDLHRLEPTEKFTGIKANEQVKLPFIGEYWQIYSTDFLPRWY

PF00963

SLAP1_CLOTH/34-195PVDPATGEEFTDKSMPVNR..VLLTNSKYGPTPVAGNDIKSGIINFATGYNNLTAYKSSGIDEHTGIIGEIGFK-VLKKQ
O30295_ARCFU/279-418VEDVLQGS..................LTQNSLFDYNVEGNQIKVGIA.........DSNGISGD.GSLFYVKFR-VTGNE
CIPA_CLOTH/1549-1689IIEIEPGE..............LIVDPNPTKSFDTAVYPDRKMIVFL..FAEDSGTGAYAITED.GVFATIVAK-VKEGA
CBPA_CLOCL/291-428VVSITAGD..............IVL..NPSVNFSST..VSGSTIKLL..FLDDT.LGSQLITKD.GVFATITFK-AK.AI
CIPA_CLOTH/31-168VTEVKPGS..............IIKDPDPSKSFDSAIYPDRKMIVFL..FAEDSGRGTYAITQD.GVFATIVAT-VKSAA
CBPA_CLOCL/435-570VASVTAGD..............IVL..NPTVNFSYT..VNGNVIKLL..FLDDT.LGSQLISKD.GVFVTINFK-AK.AV
Q977Y4_CLOAB/1344-1482VKDVLPNT..............DLVKDTDNYSFIAN.TTSAGKISIT..FTDPT.LEKFPISAD.GVIANIDFV-VNSGA
Q9FDJ9_9FIRM/225-386PVYE.DGTAYDNASAPEYG...KLLQKRYSPTDMASNDITKGTLTFGRTYMNLDSYKNSGAAEKEGSIAVIRFK-VLKVE
Q9RPL0_9FIRM/1161-1298YVSGAAGS..............IVT..NPDVNFGIN.KEADGKIKVL..FLDYT.MATEYISKD.GVFANLTFK-IKSTA
Q977Y4_CLOAB/382-520AKDVVPTD...............LVKDTDNYSFIVN.TSTPGKISIT..FTDPT.LGTYPIGTD.GIFAYLEFL-VAGEK
A3DF10_CLOTH/34-197AVDPETGKEFTSSTFPPGR..TVLKNNAYGPIQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFK-ILQKK
Q9ZGA7_9FIRM/91-228VVEVKSGE..............IFG..SNNSNFDYTVIDTTGLVSFL..YTSSN.SGKDAVTKP.GVITNITFK-IKDNA
Q9RPL0_9FIRM/1621-1754YVSGDAGS..............IVT..NPGVNFGIN.KEADGKLKVL..FLDYT.MTTQYISED.GVFANVTFK-VIGTD
Q7WYN2_9FIRM/40-179VVSVEPGS..............LI...EDPSDFNHYYNNVNGLASMS..FEAPV.DGSRMIDNN.GVFASIKFK-ISETA
Q9FDJ9_9FIRM/1493-1654PVYS.DGTAYDNSSVPEYG...KLLQKRYSPTDMGANDTANGILTFGRTYMNLSGYKASGVAEKEGSIAVISFK-VLKAT
ANCA_CLOTH/34-172VIELKAGD..............IVE..NPSESFSYNVVEKDEIIAVL..YLEETGLGIEAIRTD.GVFFTIVME-VSKDV
Q9RPL0_9FIRM/1304-1441YVSGAAGS..............IVK..NPDVNFGIN.KEADGKLKVL..FLDYT.MATEYISAD.GIFANLTFK-IKSTA
Q7UY43_RHOBA/45-169LDADDIDFG.............SIWGAGSDTQVTANVDDAAGTVVIF.......VSASSALTDVSGSLVELPFS-VASNA
Q9AE52_RUMFL/1217-1350......................QLVKSGDKSGYGADIIPSKDGYKFV..FADGA..GVAHVAPDGTVVIELTYK-VGEEV
Q9AE52_RUMFL/58-185......................RYSSKTDGDAYGSGIVYNNS..KYA..FGQGA..GRGIVAADDSVVLTLAYT-VPADC
Q977Y4_CLOAB/616-754VKDVLPNT..............DLVKDTDNYSFIVN.TSTPGKISIT..FTDPT.LANYPISVD.GILAYLDFI-INSNA
O82830_CLOJO/1023-1161AVSATAGD..............IVI..NAPVNFSSSINATNGTISIL..FLDNT.ITDQPIASD.GVITNLTFK-VLGSS
Q9RPL0_9FIRM/1475-1612YISGDAGS..............IVT..NPGVNFGIN.KESDGKLKVL..FLDYT.MSTGYISTD.GVFANLNFN-IKSSA
Q8PV77_METMA/33-166IAGVTEGN..............LFSQSGQNTLFSPGQIENGKLTNVYGCILGSSSVSTP......ETFATVTLK-ANTGV
CIPA_CLOTH/184-321IIGIDPGD..............IIVDPNPTKSFDTAIYPDRKIIVFL..FAEDSGTGAYAITKD.GVFAKIRAT-VKSSA
Q7WYN2_9FIRM/326-465VASIDAGS..............LI...ENASDFTTYYNNENGFASMT..FEAPV.DRARIIDSD.GVFATINFK-VSDSA
Q9AE52_RUMFL/194-326......................VYDSAKEGGAYITSLTVNDAKHKFA..FGRTT..GTGIVAADKATVAAFTYK-VPSDC
Q97KK4_CLOAB/41-180VSGISPGE..............ILK..DPKDNLEYNVDSKNGVITILYSYSDKN.IGKELISKN.GDFVTLNLK-IKDDA
Q8XTG8_RALSO/623-752IISVTPGS..............LV...SANEVFANNIDAAKGLV.....YMTMNAKQTQGKDGA.GNVVRLTFK-ALAAG
O82830_CLOJO/287-424VVSVDAGP..............IVK..NAAVNFSSS..ASNGTISFL..FLDNT.ITDELITSD.GVFANITFK-IKSTA
Q45996_9FIRM/1170-1307VASVTPGS..............IVT..NAAVNFSSS..TSNGTISFL..FLDNT.ITDQLIKTD.GTFAEIKFK-LKSVT
O30294_ARCFU/33-156VQNVGKGE...................LNKGLLSSNTGEGMVAISLA.........DSKGINGK.GSVAVITFQ-VLKAG
CBPA_CLOCL/1709-1847YVGTTAGT..............SIK..NPAVNFSSQ..LNGNTITLL..FFDNT.IGNELITAD.GQFATIEFK-VNAAA
CBPA_CLOCL/668-801VVSITAGD..............IVL..NPSVNFSSV..VNGSTIKLL..FLDDT.LGSQLISKD.GVFATINFK-AK.SV
Q9AE52_RUMFL/474-603......................LNYQESAGKPYGVDLVVNDTKQHFA..FAQAS..GISKTAKDGDKLFTITFK-VPEDC
Q7UY44_RHOBA/195-328ISGVQLGADAPTGSQVEANLDTPGVATITFFSLEAMDAGQADIIDLIATIPEDAPYGST......GSLTISSLD-VNAGA
Q9RPL0_9FIRM/480-612YVSGAAGS..............IVT..NPTVNFGIN.KEADGKLKVL..FLDYT.MSTGYISTN.GVFANVTFK-VLNSA
Q9FDJ9_9FIRM/771-932PVYD.DGTAYDSAAVPEYG...TLLQKRYSPTDMASNDLSKGTLTFGRTYMALDSYKASGSAETTGSIAVIRFK-VLRST
Q7WYN2_9FIRM/183-322VVGVESGS..............LV...EKAEDFNMFINNTYNFTSMT..FEAPI.DGSRMIKSD.GVFAQVKFQ-ISDTA
CIPA_CLOTH/562-702IIEIKPGE..............LIVDPNPDKSFDTAVYPDRKIIVFL..FAEDSGTGAYAITKD.GVFATIVAK-VKSGA

PF09478

Q54SS3_DICDI/292-372GAHQFG------------------------------YIQR..ST---------------------
Q54UH2_DICDI/243-323SSHSFG------------------------------YIQQ..SN---------------------
Q54UH2_DICDI/352-432SSHTFG------------------------------YIQK..AY---------------------
Q54BC0_DICDI/1043-1124NEYTFG------------------------------YILK..GT---------------------
Q55CG7_DICDI/1041-1122DQYSFG------------------------------YII....Q---------------------
Q54U76_DICDI/53-136AKYTFG------------------------------YINN..GK---------------------
Q54DP5_DICDI/230-310QTFSFG------------------------------YII....D---------------------
Q55C74_DICDI/483-564QTLSFG------------------------------YIVS..SS---------------------
Q54DJ4_DICDI/24-109AKHTFG------------------------------YINN..SG---------------------
Q86KB6_DICDI/23-109TYFNFG------------------------------YINK..SE---------------------
Q54EX0_DICDI/27-117ENFTFG------------------------------YINEAKTQ---------------------
Q54LF5_DICDI/181-262DSFSFG------------------------------FVS....A---------------------
Q54LG4_DICDI/193-274ESFSFG------------------------------FVS....S---------------------
Q54LG5_DICDI/182-259DSFSFG------------------------------FVS....A---------------------
GUN2_ORYSJ/544-626ESAAFV------------------------------YVH....A---------------------
GUN15_ORYSJ/535-613RSLRFV------------------------------YV.....Q---------------------
Q9ZSP9_SOLLC/533-611KSLEFV------------------------------YIH....T---------------------
GUN19_ARATH/534-612KSMEFV------------------------------YIH....S---------------------
GUN6_ARATH/528-606KSLEFV------------------------------YIH....S---------------------
GUN13_ORYSJ/531-610AQLTIV------------------------------YI.....Q---------------------
I1K6A1_SOYBN/532-609KSLEFV------------------------------YIH.....---------------------
Q54DY8_DICDI/1219-1296SSHNFG------------------------------YIQ.....---------------------
GUN5_ARATH/535-614QAYDFV------------------------------YVQ.....---------------------

PF00553

GUND_CLOC7/411-512GTQSFG------------------------------FNINYSGVLSKPTGFTVNGTEC-------
XYNB_CELJU/37-133QSISFG------------------------------LQGEKNGST..AERPTVTGAAC-------
GUNC_CELJU/37-133QTVEFG------------------------------FQGVTNSGT..VESPTVNGAAC-------
GUNA_CELJU/864-961QTAEFG------------------------------FQGTKGAGS..AQVPAVTGSVC-------
GUNB_CELJU/30-127SSVEFG------------------------------VQGNNGSSR..AQVPAVTGAIC-------
GUN1_ACIC1/465-559QNTTFG------------------------------FQASYTGSNAAPT......VAC-------
D6Y6N8_THEBD/360-452GSTSFG------------------------------FLGSGTGQLSSSIT........-------
F4GZY2_CELFA/35-134GTASFG------------------------------FNGSWAGSNPTPASFSLNGTTC-------
F4H3U7_CELFA/946-1044QSTDIG------------------------------FNGSHPGTNTNPASFTVNGEVC-------
F4H454_CELFA/408-507GTAQFG------------------------------FNGSHTGTNAAPTAFSLNGTPC-------
Y1987_MYCTU/41-139GSATGG------------------------------LRGGLTGSYSPPSSCLLNGQY.-------
Q47RH8_THEFY/40-136GTASFG------------------------------FIASGSGE...PTHCTINGAPC-------
Q7AKG2_STRCO/34-131ASVSFG------------------------------FNGSGPGS...PSNCKLNGGSC-------
Q9F3Q0_STRCO/58-156ASADLG------------------------------FVGSGAN..PAPTSFTLNGATC-------

PF00942

H6NM36_9BACL/665-744..GADT------------------------------YVEI-------------------------
A3DC31_CLOTH/163-244KENADH------------------------------YLEI-------------------------
A3DJ30_CLOTH/744-825VPGADT------------------------------YCEI-------------------------
G8LST1_CLOCD/336-417.DSSHK------------------------------YLEV-------------------------
F4A374_MAHA5/502-583.SGNIY------------------------------YITV-------------------------
F2R1Y0_STRVP/43-122TATADR------------------------------YLEI-------------------------
R5VSS5_9FIRM/595-685.DNGTY------------------------------YVEI-------------------------
A3DD31_CLOTH/475-558..DNIY------------------------------YIKI-------------------------
CIPA_CLOTH/371-461TNNADT------------------------------YLEI-------------------------
A3DEW0_CLOTH/41-124.SGANK------------------------------YIEF-------------------------
Q47MW0_THEFY/511-587..GDLY------------------------------YVEI-------------------------
L7VTG9_CLOSH/842-923KEGADY------------------------------YLET-------------------------
Q82QF2_STRAW/596-678VPGADA------------------------------YLEV-------------------------
A9KT90_CLOPH/840-921KTNADY------------------------------YLEF-------------------------
G8TEL8_NIAKG/1335-1416LTSADR------------------------------YFEI-------------------------
H1YBR2_9SPHI/1731-1813RNGATG------------------------------YIEY-------------------------
G8LXR4_CLOCD/469-550.KPNIY------------------------------YVEV-------------------------
R7FDD1_9FIRM/647-737.DNGTY------------------------------YVEI-------------------------
I0K9X8_9BACT/1264-1347RQGALG------------------------------YVEY-------------------------
M1MVT4_9CLOT/204-289VANADS------------------------------YIQV-------------------------
F2JNU4_CELLD/538-627.EKNIA------------------------------YIEL-------------------------
G8M373_CLOCD/185-272TQDANY------------------------------YLEI-------------------------
R7H7U6_9FIRM/568-657.KTGDC------------------------------YIEF-------------------------
G8M2T9_CLOCD/480-563.DKNIY------------------------------YVEI-------------------------
G8LUA7_CLOCD/713-794VENADN------------------------------YLEI-------------------------
F2JH11_CELLD/993-1077VSGNQY------------------------------YMEI-------------------------
A4XIF8_CALS8/487-570.SKNIY------------------------------YILV-------------------------
Q2SJA3_HAHCH/490-573.DDHIY------------------------------YVDA-------------------------
C7PX61_CATAD/870-951TTGADH------------------------------YVQV-------------------------
L0G2U2_ECHVK/1325-1406TAMADH------------------------------YLDI-------------------------
B8I218_CLOCE/2193-2280..QCDH------------------------------YIEI-------------------------
R7MSD4_9FIRM/508-590.DGNIY------------------------------YIEI-------------------------
Q097R6_STIAD/31-112.TGADQ------------------------------YVEV-------------------------
I5ASR2_EUBCE/518-600.KNGIY------------------------------YCDL-------------------------
F3ZKG0_9ACTN/54-133TATADR------------------------------YLEI-------------------------
D4LDI8_RUMC1/502-584.DGNVY------------------------------YVEI-------------------------
I0K9X8_9BACT/1422-1501RTGADT------------------------------YLEL-------------------------
GUX2_CLOSH/769-850TTGADY------------------------------YLEI-------------------------
A3DI46_CLOTH/53-139YPGADS------------------------------YVEI-------------------------
A0LVL3_ACIC1/752-834TPTADT------------------------------YLQL-------------------------
H1YBR2_9SPHI/1888-1968LTGADH------------------------------YFE.-------------------------
A3DBI3_CLOTH/793-874KNNADY------------------------------YLEI-------------------------
I0K805_9BACT/1554-1634LANADA------------------------------YLEL-------------------------
R7H587_9FIRM/495-583.EGSIY------------------------------YIEV-------------------------
Q97KK5_CLOAB/496-578.KNNIY------------------------------YVNV-------------------------
L7VTG9_CLOSH/488-570.AENIY------------------------------YVNV-------------------------
A9KMK6_CLOPH/582-672KTKADS------------------------------YLDV-------------------------
G8LUU2_CLOCD/544-634.DSGTY------------------------------YVEF-------------------------
G8LUZ6_CLOCD/1193-1273.KGNIY------------------------------YVTV-------------------------
F2JH10_CELLD/497-584.QNGIY------------------------------YVEI-------------------------
Q9RK75_STRCO/41-123TAAADR------------------------------YLEI-------------------------
A4XIF5_CALS8/493-575.SRNIY------------------------------YILV-------------------------
S6D1L3_9EURY/569-658.DAGIY------------------------------YIEL-------------------------
G8LYV1_CLOCD/157-238KNNANS------------------------------YLEI-------------------------
K4KPQ8_SIMAS/499-582.SKNIY------------------------------YTEV-------------------------
E4N479_KITSK/43-125TATADR------------------------------YLEI-------------------------
G8LWU8_CLOCD/747-828TATADY------------------------------YLEV-------------------------
E3EAP2_PAEPS/1205-1286ATSADY------------------------------YLEV-------------------------
G8LXL9_CLOCD/505-587RNDADH------------------------------YLEI-------------------------
R7ML41_9FIRM/559-649.DNGTY------------------------------YIEI-------------------------
D4LFJ4_RUMC1/491-578.SGDIY------------------------------YVEV-------------------------
W6S3G9_9CLOT/173-261EKSVDS------------------------------YLEI-------------------------
V4KLB1_9ACTN/578-659APGASH------------------------------YVEV-------------------------
D5UG75_CELFN/567-654..DGLY------------------------------YVEV-------------------------
A3DIC9_CLOTH/54-150TDMADH------------------------------YLEI-------------------------
A3DHY3_CLOTH/527-615.DAGTY------------------------------YVEV-------------------------
L0G2U2_ECHVK/1171-1253REGAYG------------------------------YVQY-------------------------
R7FAC7_9FIRM/488-575.QGNIY------------------------------YIEI-------------------------
A9KT91_CLOPH/774-855KTGADY------------------------------YLEI-------------------------
E3E7K8_PAEPS/878-959KPSADS------------------------------YAEI-------------------------
G8LUZ6_CLOCD/1396-1477KNGADY------------------------------YLEI-------------------------
R7FFS6_9FIRM/504-590.SGNIY------------------------------YVKL-------------------------
E6UCK4_RUMA7/671-761.DKGTY------------------------------YVDI-------------------------
D2QPV6_SPILD/417-497VSGADS------------------------------YLEL-------------------------
Q97KK3_CLOAB/485-568.AKHIY------------------------------YVEA-------------------------
D2BAV4_STRRD/34-116TATADR------------------------------YLEV-------------------------
A9B7H5_HERA2/510-590.AGTIY------------------------------YVEI-------------------------
F2JID6_CELLD/33-122TENADT------------------------------YVEI-------------------------
B8I7V0_CLOCE/35-124VTNADH------------------------------YLEV-------------------------
F2JNU4_CELLD/905-995VNGADT------------------------------YLEL-------------------------
A3DDF1_CLOTH/489-571.EKNIY------------------------------YIEV-------------------------
A9KT90_CLOPH/487-569.ANNIY------------------------------YVNV-------------------------
Q977Y4_CLOAB/39-128TATADH------------------------------YLEI-------------------------
A0LVL3_ACIC1/517-593..GNIY------------------------------YVTI-------------------------
F2JLD6_CELLD/530-617.SKHLY------------------------------YVEV-------------------------
F2JPM5_CELLD/857-938TEAADC------------------------------YLEI-------------------------
D9SS71_CLOC7/497-579.ENNIY------------------------------YVNV-------------------------
B1VPK7_STRGG/565-647ATGASH------------------------------YLEV-------------------------
A9KJ82_CLOPH/712-793VSGADY------------------------------YLEI-------------------------
G8LXM2_CLOCD/486-569.SKNIY------------------------------YVEV-------------------------
D9SV33_CLOC7/37-126TPNYDT------------------------------YLEI-------------------------
W6S3G9_9CLOT/3-92VKGADY------------------------------YLEI-------------------------
A3DCY5_CLOTH/489-571.SKNIY------------------------------YCEI-------------------------
H6NM35_9BACL/437-516..GADT------------------------------YLEV-------------------------
B8I2K6_CLOCE/736-817VPGADT------------------------------YCEI-------------------------
A3DC27_CLOTH/514-595KPNADS------------------------------YVEI-------------------------
G8LUU2_CLOCD/726-807GEGFDR------------------------------YLEI-------------------------
GUNI_CLOTH/536-616.KDNIY------------------------------YVEV-------------------------
A3DHY3_CLOTH/706-787VENADN------------------------------YLEI-------------------------
A9GL35_SORC5/144-226GTQADH------------------------------YLEL-------------------------
H6NJX8_9BACL/528-607..GADT------------------------------YVEL-------------------------
Q65JI9_BACLD/503-585.SKHIY------------------------------YTEV-------------------------
E3E5T1_PAEPS/388-469KSKADK------------------------------YVEI-------------------------
G8LUA7_CLOCD/539-627.DTGVC------------------------------YVEF-------------------------
A3DBH1_CLOTH/343-424.KEANK------------------------------YLEI-------------------------
G0GF20_SPITZ/497-578.AGNIY------------------------------YVEV-------------------------
Q6D5R0_PECAS/359-440TDKANR------------------------------YVLV-------------------------
E3EJF1_PAEPS/849-930VNGADY------------------------------YLEI-------------------------
D9SS73_CLOC7/35-125TSTYDT------------------------------YVEF-------------------------
D5SLE0_STRC2/47-129TATADR------------------------------YLEI-------------------------
A5A671_BACLD/371-451VNGADT------------------------------YLEV-------------------------
GUNI_CLOTH/742-823KEGADT------------------------------CLEV-------------------------
GUNF_CLOTH/487-569.DNHIY------------------------------YVNI-------------------------
H6NDH3_9BACL/886-967KPGADS------------------------------YLEI-------------------------
A3DCG3_CLOTH/377-458RNGADT------------------------------YVEI-------------------------
E0RWD9_BUTPB/507-593.KDGIY------------------------------YVDV-------------------------
F4H3U7_CELFA/499-576.GGTLG------------------------------YVEL-------------------------
A8FDC3_BACP2/465-547.SAHVY------------------------------YAEI-------------------------
GUNG_CLOCE/496-580.SNNVY------------------------------YVNV-------------------------
B8I7V7_CLOCE/540-629.EKGIY------------------------------YVEI-------------------------
E3FP49_STIAD/658-740RPGASH------------------------------YLEI-------------------------
D9ST82_CLOC7/544-633.EKGIY------------------------------YVEI-------------------------
A4XIF5_CALS8/718-799VSGADY------------------------------YLEI-------------------------
D5UFH7_CELFN/503-581.GGSLY------------------------------YAEL-------------------------
D2B808_STRRD/500-576..GKTY------------------------------YVTV-------------------------
G8TEL8_NIAKG/1180-1262RAGAYG------------------------------YIEY-------------------------
C5BNA7_TERTT/494-574.DGNVY------------------------------YVEA-------------------------
W6RW99_9CLOT/506-586.NNADY------------------------------YLDL-------------------------
GUN2_BACSU/356-436KQGADT------------------------------YLEL-------------------------
H6NJY0_9BACL/592-671..GADT------------------------------YVEL-------------------------
M1MVT4_9CLOT/36-123ADGADT------------------------------YLEI-------------------------
F2JLD6_CELLD/729-819KDGADH------------------------------YLEI-------------------------
M1MLG4_9CLOT/496-578.AQNIY------------------------------YVNV-------------------------
F2JH10_CELLD/985-1075KAGADC------------------------------YIQI-------------------------
A9EQP9_SORC5/230-310YTGADR------------------------------YVQI-------------------------
B8I0N0_CLOCE/478-561.EKNIY------------------------------YVEI-------------------------

PF03173

I2BB67_SHIBC/32-191VTSGEA........TPKVIAST.....NS..EDLSRFVSPLGG.....DQWKRTPEDKNILMTAE
A3QBY8_SHELP/54-215IVVPGL........KPELISSTQLTVDASTGMEQRPYVETYVS...AESQYKRSDTDKLKWATPQ
B3PH90_CELJU/45-198IAQPGL........EAAVFANT.....DT..EDLTRFVSPFVR.PEQQLRFNAPTADAFPIVTS.
Q487J1_COLP3/52-215VSAPGL........DARVIESTVPYIDKDTGLEILPYVEPFTD...EKTQFKRTASDKTQWLTSE
D3VAI6_XENNA/45-204ATSGNA........EPKILANT.....DT..GNISEFLSALEG.....DQWKRTTADHNTLMTAE
Q87RM3_VIBPA/35-194VAAPNA........EPKMIASL.....NT..EDVASFVTGLEG.....NNLKRTPDDNNIFASAV
A7MQU6_CROS8/34-190VTADDG........APKVIAST.....DT..ETLTDFVSPL.N.....DQWKRTPDDKNILMTAE
E6WFL0_PANSA/37-193VSAEGA........SPKIITST.....NT..ENLADFVLPF.G.....DQWKRTADDKNVLMQPT
X2GWP3_9GAMM/38-198VTSSKA........EPKVIANT.....DTDSDNLSAFVKPL.G.....EQWKISPNDHNILMTPE
D4ZH44_SHEVD/49-211LVSAEL........EPVLIKSTAVTLDSETGMELRPYVVSFTD...EDKQYKRSDTDKVKWATAE
Q6LTD2_PHOPR/61-220VVSGDA........KPKTIKST.....DA..EDPSAYLTPISG.....DNWKRTPDDNNVLATAQ
W8V3I6_YEREN/37-196ATSGDA........QPKVLKST.....DT..EDINEYLTQFTG.....DQWKRTKDDNNVLMTPQ
K1RL03_CRAGI/26-177VAAEGL........IPKDIVSTQ........GEALNFVGPFDT....PEKYLRFPGDKF......
A1S444_SHEAM/47-209ITAPGL........KPVVIASTRLAVEAETGLELRPYVEAFTD...ADKQYRRTDNDKLPWATA.
A7RSQ4_NEMVE/34-186VAAEGL........QARTITSTS........GESLDFVGPFDN....KFKWKRFDPDK.......
Q5DYR6_VIBF1/39-198VTAPGA........EARNIISL.....DT..EDTGEYVDEIIG.....VQLKRTLADNNVVATAN
Q8CVD2_SHEON/53-215IVAGDL........SPVVIASTQVKQDPETRMEVRPYVEPFTD...MVKQYSRTDADKLAPATA.
A0KIG5_AERHH/37-197VASEGA........EPKVLASM.....SN.IDDATTYEKPMPA.....DGWKRTKDDNNILMNSE
Q7PC48_SACD2/44-221VVAEGQDNKQALYSEARVIESTRIRIHPETGLEERPFAGEISR.....QNFKLSQADKTPYADAA
W0LCL7_9ENTR/37-196ATSGDA........KPKILANT.....DT..EDVNQFVAPFTG.....DQWKRTKDDNNILMVPE
C5BGA1_EDWI9/35-194VTSPDA........KPKVIANT.....DT..EDLRQFVTPFAG.....DLWKRIKDDKNVLMTPE
A8GB46_SERP5/37-196ATSGDA........KPKILVNT.....DT..EDLSQFVTPFSG.....DQWKRIKDDNNILMTPA
D8MPP8_ERWBE/36-192ATSGDA........TPKILVST.....DT..EILTDFVEPF.G.....AQWKRIADDKNLLMDAQ
D0LVP4_HALO1/53-212LSADGL........DSRIIANT.....DS..DDSDAYAAPITG.....ENRKRTPQDNNVFATAQ
U4K583_9VIBR/34-198ISADGL........KGELIKNTAVKEADTGFEDLSGFLTPISNDPADTDQWRRTADDKTNVATA.
Q7NXY3_CHRVO/32-191VTVDGQ........PPALLRH......DS..SDEASYLLPLSG.....DNWKNPAGELRPLATPE
I0DXS0_PROSM/38-196ATSGDA........SPRNLKST.....DT..QDPTTFVTPFEL.....KNWKRTDADNNLLMTPE
D3UXD7_XENBS/37-196ATSGDA........MPKILANT.....DT..EDLSAFLSDFTD.....EQWKRTTLDNNILMTPE
E1ST90_FERBD/37-199LVAEGL........EPVVIASTKEVRDPETGLWQLPFVEPLTD...PERQLRRTAEDNMAQATP.
Q7MBH3_PHOLL/37-196ATSGDA........KPKVLVST.....DT..EDLSQFLSAFTD.....DQWKRTQTDNNILMTPE

PF00963

SLAP1_CLOTH/34-195NTSIRF...EDTLSMPGAISGTSLFDWDAETITGYEVIQ.PDL.IVV------------------
O30295_ARCFU/279-418KAEQAENVKGKLRGLGQQLSEITLRNSHALTLQGIEIYDIDGNSVKV------------------
CIPA_CLOTH/1549-1689PEGF............SAIEISEFGAFADNDLVEVETDL.INGGVLV------------------
CBPA_CLOCL/291-428TGTTAKV.........TSVKLAGTPVVGDAQLQEKPCAV.NPGTVTI------------------
CIPA_CLOTH/31-168A...............APITLLEVGAFADNDLVEISTTF.VAGGVNL------------------
CBPA_CLOCL/435-570TSTVT...........TPVTVSGTPVFADGTLAEVQSKT.AAGSVTI------------------
Q977Y4_CLOAB/1344-1482ATGDS...........DLTVNSSGFIVADESDTDIDHVS.TNGKITV------------------
Q9FDJ9_9FIRM/225-386ATTITL...QNAASLTNAVDGTMLFDWTGAQLAGYRVQQAPSINGVV------------------
Q9RPL0_9FIRM/1161-1298AAGTT...........AAVGIAGTATFGDSALKPITAVI.TDGKVEI------------------
Q977Y4_CLOAB/382-520AGKY............DLKVNPTTLILADENDNDIDCNPPKDGSVTV------------------
A3DF10_CLOTH/34-197STAVKF...QDTLSMPGAISGTQLFDWDGEVITGYEVIQPDVLSLGD------------------
Q9ZGA7_9FIRM/91-228KKGS............IKISQGTSGAFGDTELKKINPVF.TEGEITV------------------
Q9RPL0_9FIRM/1621-1754G...............LAAVNAEDATFGDSSLSPVTASV.VNGGVNI------------------
Q7WYN2_9FIRM/40-179PVGESY..........DITTNYSRTSFYSTGTEEIVNILCNNGAINV------------------
Q9FDJ9_9FIRM/1493-1654ETKVLL...KNVPSLTSPVDGTMVFDWDGVQLADYKVTQAPAVNAPV------------------
ANCA_CLOTH/34-172KPGI............SPIKFESFGATADNDMNEMTPKL.VEGKVEI------------------
Q9RPL0_9FIRM/1304-1441VNGDV...........AAISKSGTATFGDKNLGPISAVI.KDGSVTV------------------
Q7UY43_RHOBA/45-169.........................VVDSTTVLDLTQVTLNEGQISV------------------
Q9AE52_RUMFL/1217-1350APGTV...........IPVSIKDLYVVDEDGNDITKYVMPVDGSIIV------------------
Q9AE52_RUMFL/58-185AEGT............YDVKWSDAFVSDTDGQNITSKVTLTDGAIIV------------------
Q977Y4_CLOAB/616-754TAGDS...........ALTVDPATLIVADENDKDIKDAA.SNGKITV------------------
O82830_CLOJO/1023-1161STT.............TPIAFKAGGAFGNGNMAKISDITFTNGSAKL------------------
Q9RPL0_9FIRM/1475-1612AIGSK...........AEVSISGTPTFGDSTLTPVVAKV.TNGAVNV------------------
Q8PV77_METMA/33-166QGTSQFYLR......NVTVSSSASK.........PVDVRLVNTGITI------------------
CIPA_CLOTH/184-321P...............GYITFDEVGGFADNDLVEQKVSF.IDGGVNV------------------
Q7WYN2_9FIRM/326-465KVGELY..........NITTNSAYTSFYYSGTDEIKNVVYNDGKIEV------------------
Q9AE52_RUMFL/194-326TEGT............YDVKWSGGFVSDADGKDITSRVTFVDGSITV------------------
Q97KK4_CLOAB/41-180KKGK............TQISFNGNPEFYDKNQKGVSVTT.NKGEIEI------------------
Q8XTG8_RALSO/623-752ETSIHMQ.........DQMLITPSG........MASLKPTAPLVMTV------------------
O82830_CLOJO/287-424TQGT............TPITFKDGGAFGDGTMSKIASVIKTSGSVVI------------------
Q45996_9FIRM/1170-1307AKTT............TPVAFKDGGAFGDGTMAKIATVTKTNGSVTI------------------
O30294_ARCFU/33-156S...............TDLTIQSVKAYDVNTHVDIPVKA.DNGKFEA------------------
CBPA_CLOCL/1709-1847TSGTT...........AEVKVATISSFADASLTEITKVATVNGSVKV------------------
CBPA_CLOCL/668-801TSTVT...........TPVKVSGTPVFADGTLAELSYET.VAGSVTI------------------
Q9AE52_RUMFL/474-603ADGI............YPVTWAKQFVSDENGNNITDKVTFTDGWVRV------------------
Q7UY44_RHOBA/195-328...........................MTASADDAIQVVAFPGDVNA------------------
Q9RPL0_9FIRM/480-612P...............TTVGITGA.TFGDKNLGNISATI.NAGSING------------------
Q9FDJ9_9FIRM/771-932ATAILL...QNAASLTNAVDGTMLFDWTGAQLKGYKVAQASSINGTV------------------
Q7WYN2_9FIRM/183-322LQGETY..........KISQISSNTSFYSTAVTEITDVIYADGAIKV------------------
CIPA_CLOTH/562-702PNGL............SVIKFVEVGGFANNDLVEQRTQF.FDGGVNV------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window