Sequence alignment for CL0205

PF00372

HCYA_APHCL/112-375PVQEVFADRFIPAD-----------------SLIKAFTL............ATTT.........................
HCYD_APHCL/110-371PIQEVFPDRFVPAE-----------------TINRALKV............DKVS.........................
HCYE_APHCL/109-369AIQEIFPDRFVPTE-----------------TINLAVK.............EAAN.........................
HCYA_PANIN/136-393PLYQITPHMFTNSE-----------------VIDKAYS.............AKMT.........................
SSP1_BOMMO/164-442APYEIYPYFFVDSH-----------------VISKAFMM............KMTKAAKDPVLWKYYG.............
BJSB1_TRINI/162-439APYEIYPYVFVDSH-----------------IINKAFMM............KMTKAARDPVMLDYYG.............
HCY2_LIMPO/110-373PVQEIFPDKFIPSA-----------------AINEAFKK............AHVR.........................
BJSB2_TRINI/158-440PPYEIYPYYFVRAD-----------------VIQKAYLL............KMKKGLLDLKLCDFYG.............
ARYB_MANSE/161-440APYEVYPQFFANLN-----------------TMLKVYRT............KMQDGVVSADLAAQHG.............
ARYA_MANSE/164-443APYEVYPQYFTNME-----------------VLFKVDRI............KMQDGFLNKDLAAYYG.............
SSP2_BOMMO/161-440APYEVYPKMFMNME-----------------VLQKIYVT............KMQHGLINPEAAAKYG.............
HCY6_ANDAU/109-370PIQEVFPDRFVPAE-----------------TINRANK.............EASN.........................
ARY1_CALVI/140-479SIHEIFPQYFFNSK-----------------FVYEAEKFDYDVWSKYIMYEKEYKDILYKDYSTFYKNHDNHHYYYFTKD
HCYC_PANIN/142-399PLYEVTPHMFTNSE-----------------VIHEAYK.............AQMT.........................

PF00264

HCY2E_RAPVE/39-233------ADGFQSLA.................SFHAQPPLCP..........................-------------
Q4WFT7_ASPFU/96-324------RSRYDDFV.................AVHI................................-------------
A7DZQ9_9PEZI/52-325------PLGYYQVA.................GVHGTPYIPWM..............EK.........-------------
TYRO_ASPFU/59-373------RLSYFQIA.................GIHHFPLITWD..............EE.........-------------
TYRO_NEUCR/57-320------LDSYYQVA.................GIHGMPFKPWAG...........VPS.DT.......-------------
TYRO_PHONA/48-300------VRSFFQIG.................GIHGLPYTPWDG............IT.GD.......-------------
Q0UEG5_PHANO/69-233------KNRYDDFV.................ATHI................................-------------
Q0U7P7_PHANO/109-364------TLSYYQVA.................GVHGRPFTTW...............N.K........-------------
Q0UNZ8_PHANO/95-336------AGQWDNVA.................GRKTS...............................-------------
Q0U440_PHANO/111-339------RTRYDDFV.................AQHM................................-------------
Q0UXF5_PHANO/87-320------KNRYDDFV.................VTHI................................-------------
A1IHF0_PINFU/135-332------MSRYDTIA.................GMHS................................-------------
Q9GP18_HALTU/1711-1908------ADGYQAIA.................SFHALPPLCP..........................-------------
Q9BJ58_ENTDO/1727-1922------SDGFEAIA.................SFHALPPLCP..........................-------------
Q1QJ90_NITHX/70-260------KFNWVQLA.................NFHGSI..............................-------------
O49960_SACHY/160-403------PLSFKAQA.................AIHQAYCDNYYK............YH.KS.......-------------
Q2KHE3_MAGO7/117-305------VGQGGPLL.................LMEN................................-------------
Q96TI3_LENED/54-303------IDSFFQIG.................GIHGLPYVPWD.............GA.G........-------------
Q6SS53_BACTU/28-187------NGEYQPYV.................DVHR................................-------------
Q2HCB5_CHAGB/546-729------KTRWDELV.................SLHQ................................-------------
A7E8E8_SCLS1/81-336------LLSYYQIA.................GIHGFPLVAW...............D.G........-------------
Q2YAJ8_NITMU/75-337------PRNWYRIA.................LTHT................................-------------
A7RQY2_NEMVE/97-287------KSEYDRIT.................KYHS................................-------------
Q2TWH3_ASPOR/65-256------TSRFSDLQ.................ALHRGM..............................-------------
A6RKM8_BOTFB/87-285------TSRFSDLQ.................SLHRDKTN............................-------------
Q7NXK8_CHRVO/71-272------PLNWIFQW.................YTHFVRGDRTKQQ.........ELNR.VYPS.....-------------
A2QTR2_ASPNC/82-308------RDRHDDFV.................ATHI................................-------------
A2QUC2_ASPNC/107-337------KTRYDEFV.................ATHI................................-------------
A6RE01_AJECN/73-357------RGSFFQVA.................GIHGQPYVPYD..............E.P........-------------
A6SQE9_BOTFB/103-376------IRSWYQIAGNYRCYLSSGKLLTSQQGIHGRPYLPYD..............G.V........-------------
Q5AXC0_EMENI/55-404------LKSYFRLA.................AIHSAPWCEWD..............D.V........-------------
Q8Y2J8_RALSO/71-266------ALSWLGFA.................NQHGTL..............................-------------
Q82V60_NITEU/28-223------EGIYDRFV.................LRHA................................-------------
A6SST5_BOTFB/67-300------RSRFDDFV.................AAHI................................-------------
Q5AYZ4_EMENI/638-868------RHRMDDFS.................ATHI................................-------------
A3K3J4_9RHOB/68-259------PTSWQFQF.................FTHWMDEQKAAAI.........DRIY.GPD......-------------
Q0UUJ6_PHANO/114-348------KSRFDDWV.................ATHI................................-------------
Q564J1_APLCA/1731-1925------ADGYQSIA.................SFHAIPPLCP..........................-------------
Q2H2F5_CHAGB/109-341------KSRFDDFV.................VTHI................................-------------
A3JWQ9_9RHOB/119-304------PNSYFQVA.................GMHWL...............................-------------
A5X3N8_ORYRU/161-370------PRSFEQQW.................RVHCAYCDGA..........................-------------
Q19VI0_SALSA/174-408------VSVYDLFV.................WMHYYVSRDT...............L.L........-------------
A1IHF1_PINFU/134-334------MSRYNTLA.................AMHN................................-------------
Q2TL94_9APHY/53-300------LISFFQIG.................GIHGLPYVAWS..............D.A........-------------
Q287T6_PINFU/134-328------GNRFDTMA.................RIHAM...............................-------------
Q53IP9_MEGCR/1705-1901------SDGFQAIA.................SFHALPPLCP..........................-------------
Q2U7F6_ASPOR/78-307------QTRYDEFL.................ATHI................................-------------
Q27Q57_SEPOF/2142-2337------ADGFETIA.................SFHALPPLCP..........................-------------
Q1QPI1_NITHX/200-472------KRSYNNLA.................LIHQ................................-------------
Q8T777_BRAFL/161-422------ISVYDYFV.................AVHYYASRETLP............PS.ST.......-------------
A6S0E1_BOTFB/124-317------GTLYDDFP.................WVHR................................-------------
A2Q9V3_ASPNC/114-348------KTRYDDFL.................ATHI................................-------------
Q7S218_NEUCR/78-316------ELSYFSLA.................GIHGLPHKVWN..............G.V........-------------
A1CDX9_ASPCL/62-270------RHRMDDFT.................ATHV................................-------------
PPO1_AGABI/47-299------TASYFQVA.................GVHGYPLIPFDD............AV.GP.......-------------
Q4W5X1_STRGR/29-261------RGIYDRFV.................KLHIQINST...........................-------------
Q2HEC0_CHAGB/91-343------PMSYYGLA.................GIHGMPHQSWG..............G.V........-------------
Q2JGG6_FRASC/46-284------VRTYDLFV.................IWHVIAMNTP..........................-------------
Q2UHJ4_ASPOR/41-346------DDSFHKLG.................GYHGEPFHYEK..............A.P........-------------
Q5LTK9_SILPO/37-259------RTSWWYLA.................AIHGIDIPGWVQQ.........GIVP.SAG......-------------
Q0CYP3_ASPTN/93-321------RNRYDDFV.................AVHI................................-------------
Q21NZ9_SACD2/207-494------RRSLNSWG.................KLHG................................-------------
A7UWM5_NEUCR/100-339------VSAFDDFI.................YLHL................................-------------
Q2GZJ4_CHAGB/104-327------RTAWDDYG.................ALHY................................-------------
Q54QT0_DICDI/95-368------YSVYDQFV.................ILHMGAVSLARK...........SEY.DEK......-------------
A0ZXZ4_HYPJE/71-313------PYSFFQIA.................GIHGAPYIEYN..............K.A........-------------
A1CVG0_NEOFI/71-291------RTRWDDFV.................ATHI................................-------------
TYRO_ASPOR/53-346------EDSFFYLA.................GLHGEPFRGA..........................-------------
Q3UFK6_MOUSE/182-417------ISVYNYFV.................WTHYYSVKKT...............F.L........-------------
Q876W6_GIBZA/69-281------TSRMDDLV.................YTHF................................-------------
Q0U1I9_PHANO/177-359------KSRYEDLV.................ALHQ................................-------------
Q7S4R1_NEUCR/95-301------RTVYDDFA.................ILHG................................-------------
Q2YBN6_NITMU/117-305------EGKYLELV.................QFHR................................-------------
A6R210_AJECN/53-380------PKSYFQIS.................GIHGMPYLPWN..............G.E........-------------
Q41388_SPIOL/183-401------PRSHMQQA.................RVHCAYCDGS..........................-------------
Q39ND4_BURS3/46-332------PNSFFMIG.................GFHGEPFRGA..........................-------------
Q5VM57_9GAMM/34-262------PSSWWYQG.................AIHGYGLDKRPNLANN....ESWSES.SVWEQA...-------------
Q1MVA1_MEGCR/1716-1912------PDGYQAIA.................SFHALPPLCP..........................-------------
Q5ATE5_EMENI/58-339------RDSFFQIA.................GIHGMPFTSWD..............E.P........-------------
Q2IY37_RHOP2/143-320------QGPYRIVR.................DMHD................................-------------
Q2H5H1_CHAGB/120-347------QNHFDDFV.................AVHM................................-------------
Q5DB10_SCHJA/171-406------ASIQYYLT.................YVHRYGSRSTL..............Y.K........-------------
PPO2_AGABI/47-295------YSSFFQLA.................GIHGLPFTEWA..............K.E........-------------
B0UQY1_METS4/67-305------PQSWTFQS.................YIHAVPANPFDPAFSGGLPSGTPALKTRIDEIYGNP-------------
A1CIU9_ASPCL/95-322------KDRFDDFV.................ATHI................................-------------
Q2U5S1_ASPOR/110-305------GTIYDDFA.................ILHG................................-------------
Q9U5P3_HALTU/454-650------PDGFQAIA.................SFHALPPLCP..........................-------------
A3RUW3_RALSL/143-320------TGRFTDFR.................NMHVA...............................-------------
Q0TZT9_PHANO/73-288------VNRFDEFQ.................AVHK................................-------------
A7SSF6_NEMVE/299-492------IKTYDKLT.................HLHP................................-------------
A6SR72_BOTFB/76-338------DLSWYGIA.................GIHGRPYRPWG..............G.V........-------------
Q2GQI5_CHAGB/102-339------KSLFDDFV.................AIHL................................-------------
Q093B2_STIAD/65-326------PRNWFRNA.................FIHF................................-------------
Q70KX7_SUBDO/179-430------VSTYNFFI.................FLHNFIARDGT..............Q.A........-------------
A1CVX2_NEOFI/64-292------QDRFDDFV.................ATHI................................-------------
Q868D0_HALRO/174-442------ITIYNLFV.................WMHYYISRSNFAITEEVYNNLTTDVGPRDFTNIPLE-------------
Q6PLR1_WHEAT/160-367------PRSFKSQA.................AIHEAYCNFHY..............K.V........-------------
A7UX66_NEUCR/102-340------RSRFDDFV.................VTHI................................-------------
Q5DHS0_SCHJA/178-415------VDVQYLFT.................FLHRYASRATL..............F.H........-------------
Q2HF52_CHAGB/72-288------LSRYDDLI.................YTHI................................-------------
Q0U6S4_PHANO/81-292------RSLYDDFS.................YSHA................................-------------
Q2UP46_ASPOR/57-381------QLSYFRLA.................GIHGAPWTEWD.............GV.PG.......-------------
Q56N25_9BRYO/92-311------PRSLYAQA.................RMHCAYCGAA..........................-------------
Q92LD3_RHIME/65-275------PASWHFQA.................NTHWYPRTENLEEIFST.VGASPAEA.QKIEAFRA.-------------
A6UM82_SINMW/70-311------PRNWYRNG.................FIHL................................-------------
A6R858_AJECN/138-381------KNLFDSFA.................VVHI................................-------------
Q7YT36_SEPOF/122-301------PNKFEVIA.................DLHV................................-------------
Q0C7G8_ASPTN/47-357------EDSFYVIA.................GYHGQPFRGA..........................-------------
A6R3Q4_AJECN/72-315------LLSFFQIA.................GIHGYPYVSW..........................-------------
Q2H5C8_CHAGB/79-307------KSRYDDFV.................VVHM................................-------------
Q93HK5_STRAW/28-238------RGEYDEFV.................RMHIKYYV............................-------------
A1C4G0_ASPCL/62-293------RHRMDDFA.................ATHI................................-------------
PPOA_SOLLC/170-383------PIGFKQQA.................NIHCAYCNG...........................-------------
Q9XUS8_CAEEL/185-376------NGEYDRLS.................RQHLE...............................-------------
Q5AUW8_EMENI/94-328------RSRFDDFQ.................ATHI................................-------------
Q2Y722_NITMU/28-226------NGSYDVFV.................AQHRTA..............................-------------
Q5BGU9_EMENI/69-304------QDRVDDFV.................ATHI................................-------------
A2QYL5_ASPNC/41-332------EDSFYTIA.................GYHGQPFRGA..........................-------------
A2QFP6_ASPNC/96-325------RNRFDDFV.................AVHI................................-------------
A6RHX7_BOTFB/78-326------GLSYFQLA.................GIHGRPYVSWD..............G.V........-------------
Q33CJ6_CYNPY/88-316------ASVFDVGA.................WVRYYAYKPI..........................-------------
Q2H7D7_CHAGB/62-379------KLSFFQVA.................GIHGYPYQPWD..............E.E........-------------
A3NMB3_BURP6/46-332------PKSFFALG.................GYHGEPFQYRKP............VD.AL.......-------------
A1BB10_PARDP/150-379------SSPWQKWA.................YVHT................................-------------
Q5AQP2_EMENI/67-282------ANRFDDFQ.................AVHS................................-------------
Q5BDR2_EMENI/99-327------RTRYDDFV.................AVHI................................-------------
Q7SFK3_NEUCR/96-354------PVSWYGIT.................GIHGIPHQTWG..............G.V........-------------

PF00372

HCYA_APHCL/112-375............................QPGDES...........DIIVDVKDTGNIL..DPEYKLAYFREDIGVNA---
HCYD_APHCL/110-371............................DP.NKD............TVVPIQKTGNIR..DPEYNVAYFREDIGINS---
HCYE_APHCL/109-369............................HP.DQD............ISVHVVETGNIL..DEEYKLAYFKEDVGTNA---
HCYA_PANIN/136-393............................QKQGT...............FNVSFTGTKK..NREQRVAYFGEDIGMNI---
SSP1_BOMMO/164-442...........................ITVTDDN...........LVVIDWRKGVRRS.LSQNDVMSYFMEDVDLNT---
BJSB1_TRINI/162-439...........................IKVTDKN...........LVVIDWRKGVRRT.LTEHDRISYFTEDIDLNT---
HCY2_LIMPO/110-373............................PEFDES...........PILVDVQDTGNIL..DPEYRLAYYREDVGINA---
BJSB2_TRINI/158-440...........................IKKTDKD...........VFIIDENVYDKRVHLNKEDKLRYFTEDIDLNT---
ARYB_MANSE/161-440...........................IVK.EKN...........YYVYYANYSNSLVYNNEEQRLSYFTEDIGLNS---
ARYA_MANSE/164-443...........................MYH.END...........NYVFYANYSNSLSYPNEEERIAYFYEDIGLNS---
SSP2_BOMMO/161-440...........................IHK.END...........YFVYKANYSNAVLYNNEEQRLTYFTEDIGMNA---
HCY6_ANDAU/109-370............................HPDQQS............IVVEAEETGNIL..DPEYKLSYFREDIGINA---
ARY1_CALVI/140-479FKTYQWWKMMGLGEHWYSEDRFMLRDNMNKYNKDSKYLEIFEGTKMFFMPVDYTRDIEFFNKESVLSYFTEDVGLNT---
HCYC_PANIN/142-399............................NTPSK...............FESHFTGSKK..NPEQHVAYFGEDVGMNT---

PF00264

HCY2E_RAPVE/39-233------------------------------------------------..........YPEANKRFACC.VHG..MA...
Q4WFT7_ASPFU/96-324------------------------------------------------................NQTWV.IHG..TG...
A7DZQ9_9PEZI/52-325------------------------------------------------..........ADADDRAGDYC.THG..TA...
TYRO_ASPFU/59-373------------------------------------------------..........EPPVPNKPGYC.VHN..NV...
TYRO_NEUCR/57-320------------------------------------------------.......DWSQPGSSGFGGYC.THS..SI...
TYRO_PHONA/48-300------------------------------------------------........QPFDPNTQWGGYC.THG..SV...
Q0UEG5_PHANO/69-233------------------------------------------------................NSTLF.IHG..TG...
Q0U7P7_PHANO/109-364------------------------------------------------.........FPTPLVNQAGFC.PHN..SN...
Q0UNZ8_PHANO/95-336------------------------------------------------...............HVMGYC.PHV..SN...
Q0U440_PHANO/111-339------------------------------------------------................NQTLT.IHV..TG...
Q0UXF5_PHANO/87-320------------------------------------------------................LQTCS.VHG..TA...
A1IHF0_PINFU/135-332------------------------------------------------...............FAAYRY.AHL..GP...
Q9GP18_HALTU/1711-1908------------------------------------------------..........NPSAAHRYACC.VHG..MA...
Q9BJ58_ENTDO/1727-1922------------------------------------------------..........SPTAKHRHACC.LHG..MA...
Q1QJ90_NITHX/70-260------------------------------------------------..............NTGFRYC.PHG..DW...
O49960_SACHY/160-403------------------------------------------------........SGSTVAKDDPAFD.VHY..SW...
Q2KHE3_MAGO7/117-305------------------------------------------------......................IHA..VG...
Q96TI3_LENED/54-303------------------------------------------------........NKPVDTDAWEGYC.THG..SV...
Q6SS53_BACTU/28-187------------------------------------------------...............KHFFHP.IHQ..SA...
Q2HCB5_CHAGB/546-729------------------------------------------------................IHALQ.IHT..TG...
A7E8E8_SCLS1/81-336------------------------------------------------.........VQATASGNTGYC.THG..SN...
Q2YAJ8_NITMU/75-337------------------------------------------------..................MDC.PHG..NW...
A7RQY2_NEMVE/97-287------------------------------------------------................DLFNQ.VHI..LE...
Q2TWH3_ASPOR/65-256------------------------------------------------.............TNTAHADI.IHH..VG...
A6RKM8_BOTFB/87-285------------------------------------------------...........QTIDGLYVQDIIHN..VG...
Q7NXK8_CHRVO/71-272------------------------------------------------......PSANRTLAEKMWNTCQAHS..SGQRE
A2QTR2_ASPNC/82-308------------------------------------------------................NYTLN.IHN..DG...
A2QUC2_ASPNC/107-337------------------------------------------------................NLTEH.IHV..TA...
A6RE01_AJECN/73-357------------------------------------------------........DTDLADIKDKGYC.THN..NI...
A6SQE9_BOTFB/103-376------------------------------------------------.........QATPGDENNGYC.THV..SI...
Q5AXC0_EMENI/55-404------------------------------------------------........PQAQREPGERGYC.VHS..NY...
Q8Y2J8_RALSO/71-266------------------------------------------------..............NGGYKYC.PHG..DW...
Q82V60_NITEU/28-223------------------------------------------------...............NANMSA.IHR..CS...
A6SST5_BOTFB/67-300------------------------------------------------................NQSFT.IHG..TG...
Q5AYZ4_EMENI/638-868------------------------------------------------................NYTLN.IHL..SG...
A3K3J4_9RHOB/68-259------------------------------------------------......ASPEKMAAEAMWNTC.RGHITWASQS
Q0UUJ6_PHANO/114-348------------------------------------------------................NQTTT.IHY..TG...
Q564J1_APLCA/1731-1925------------------------------------------------..........SPSASKRYACC.LHG..MA...
Q2H2F5_CHAGB/109-341------------------------------------------------................QQTLA.IHY..SG...
A3JWQ9_9RHOB/119-304------------------------------------------------..............PAPDVYC.RHH..EN...
A5X3N8_ORYRU/161-370------------------------------------------------.........YDQVGFPGLEIQ.IHS..CW...
Q19VI0_SALSA/174-408------------------------------------------------.........GGPGNVWQDIDF.AHE..SA...
A1IHF1_PINFU/134-334------------------------------------------------...............LQAFGN.AHN..GP...
Q2TL94_9APHY/53-300------------------------------------------------.........GADDPAEPSGYC.THG..SV...
Q287T6_PINFU/134-328------------------------------------------------...............PAVIAN.AHD..GS...
Q53IP9_MEGCR/1705-1901------------------------------------------------..........SPAASKRFACC.VHG..MA...
Q2U7F6_ASPOR/78-307------------------------------------------------................NLTSV.IHQ..TA...
Q27Q57_SEPOF/2142-2337------------------------------------------------..........NPTAKHRYACC.LHG..MA...
Q1QPI1_NITHX/200-472------------------------------------------------..................NHC.QHG..WE...
Q8T777_BRAFL/161-422------------------------------------------------........GICVEEKDCSLDF.AHE..GA...
A6S0E1_BOTFB/124-317------------------------------------------------................YTSTS.THK..AS...
A2Q9V3_ASPNC/114-348------------------------------------------------................NQTLE.IHY..TG...
Q7S218_NEUCR/78-316------------------------------------------------.........EQVEGAPDTGYC.PHG..ET...
A1CDX9_ASPCL/62-270------------------------------------------------................NYATQ.IHT..NG...
PPO1_AGABI/47-299------------------------------------------------........TEFSPFDQWTGYC.THG..ST...
Q4W5X1_STRGR/29-261------------------------------------------------..........DYLDKETGKRL.GHV..NP...
Q2HEC0_CHAGB/91-343------------------------------------------------.........EPVTGNENTGYC.THS..SV...
Q2JGG6_FRASC/46-284------------------------------------------------.........VPPGGSPSNRNA.AHA..GP...
Q2UHJ4_ASPOR/41-346------------------------------------------------.........PNRSSKWWGGYC.FHG..CV...
Q5LTK9_SILPO/37-259------------------------------------------------......TLPPQGEQDLIFNQC.QHA..GW...
Q0CYP3_ASPTN/93-321------------------------------------------------................NQTHF.IHG..TG...
Q21NZ9_SACD2/207-494------------------------------------------------..................DVC.AHG..FE...
A7UWM5_NEUCR/100-339------------------------------------------------................NVTPY.IHF..SG...
Q2GZJ4_CHAGB/104-327------------------------------------------------................YQTPY.VHN..SA...
Q54QT0_DICDI/95-368------------------------------------------------.......DLDVYNNNKLKVDP.GHG..NP...
A0ZXZ4_HYPJE/71-313------------------------------------------------.........GAKSGDGWLGYC.PHG..ED...
A1CVG0_NEOFI/71-291------------------------------------------------................NYTLY.IHF..NG...
TYRO_ASPOR/53-346------------------------------------------------.........GYNNSHWWGGYC.HHG..NI...
Q3UFK6_MOUSE/182-417------------------------------------------------.........GTGQESFGDVDF.SHE..GP...
Q876W6_GIBZA/69-281------------------------------------------------................SLNTE.IHF..VA...
Q0U1I9_PHANO/177-359------------------------------------------------................TLTPN.VHG..SS...
Q7S4R1_NEUCR/95-301------------------------------------------------................GVGSW.CHR..SA...
Q2YBN6_NITMU/117-305------------------------------------------------................DMSHD.MHGMMGETGL
A6R210_AJECN/53-380------------------------------------------------........EVPRNGPKPTGYC.THS..TV...
Q41388_SPIOL/183-401------------------------------------------------.........YPVLGHNDTRLE.VHA..SW...
Q39ND4_BURS3/46-332------------------------------------------------.........GWGSASYWGGYC.NHG..NV...
Q5VM57_9GAMM/34-262------------------------------------------------...EGFPPSEGLVNSQFWQQC.QHG..TW...
Q1MVA1_MEGCR/1716-1912------------------------------------------------..........SPSAAHRHACC.LHG..MA...
Q5ATE5_EMENI/58-339------------------------------------------------........FETEANVAQKGYC.THA..NY...
Q2IY37_RHOP2/143-320------------------------------------------------...............ADSDLE.IHR..NE...
Q2H5H1_CHAGB/120-347------------------------------------------------................NQTNF.IHG..TA...
Q5DB10_SCHJA/171-406------------------------------------------------........DIRDCEEYGILNF.NHD..GV...
PPO2_AGABI/47-295------------------------------------------------.........RPSMNLYKAGYC.THG..QV...
B0UQY1_METS4/67-305------------------------------------------------.PAGSPAAAWKEAALKCWGTC.THA..SP...
A1CIU9_ASPCL/95-322------------------------------------------------................NYTSN.IHN..DG...
Q2U5S1_ASPOR/110-305------------------------------------------------................GIGSW.CHR..SA...
Q9U5P3_HALTU/454-650------------------------------------------------..........SPSAAHRYACC.VHG..MA...
A3RUW3_RALSL/143-320------------------------------------------------...............GLADKQ.AHD..GP...
Q0TZT9_PHANO/73-288------------------------------------------------................EQTPY.IHI..VG...
A7SSF6_NEMVE/299-492------------------------------------------------................KFFDM.VHN..KK...
A6SR72_BOTFB/76-338------------------------------------------------.........QGDNPAGWQGYC.THS..SI...
Q2GQI5_CHAGB/102-339------------------------------------------------................MQTMN.IHL..SG...
Q093B2_STIAD/65-326------------------------------------------------..................MDC.PHG..NW...
Q70KX7_SUBDO/179-430------------------------------------------------.........CQKVNKDNIVDF.AHS..GP...
A1CVX2_NEOFI/64-292------------------------------------------------................NYTSH.IHN..NG...
Q868D0_HALRO/174-442------------------------------------------------NLQRFLNNSSNLLVINNDLDY.AHE..GP...
Q6PLR1_WHEAT/160-367------------------------------------------------........TAAASRTPEIDFD.VHF..SS...
A7UX66_NEUCR/102-340------------------------------------------------................NQTQT.AHY..TG...
Q5DHS0_SCHJA/178-415------------------------------------------------........DNKDCIQHQHLDN.NHD..TV...
Q2HF52_CHAGB/72-288------------------------------------------------................QQTFD.IHY..TG...
Q0U6S4_PHANO/81-292------------------------------------------------................LVEHS.AHR..NA...
Q2UP46_ASPOR/57-381------------------------------------------------........GQKDSKGNPTGFC.VHN..NY...
Q56N25_9BRYO/92-311------------------------------------------------..........FYYPRSDYSLE.IHD..GW...
Q92LD3_RHIME/65-275------------------------------------------------..LALGGSMDGQNVEGVWRTC.LHS..SSSIN
A6UM82_SINMW/70-311------------------------------------------------..................MDC.PHG..DW...
A6R858_AJECN/138-381------------------------------------------------................TKTPF.IHG..NF...
Q7YT36_SEPOF/122-301------------------------------------------------...............GFITNS.AHG..GP...
Q0C7G8_ASPTN/47-357------------------------------------------------.........GYGNKEWWGGYC.HHG..NV...
A6R3Q4_AJECN/72-315------------------------------------------------.........DGVNGLGGAGYC.SHG..ST...
Q2H5C8_CHAGB/79-307------------------------------------------------................NQTMT.IHG..TG...
Q93HK5_STRAW/28-238------------------------------------------------............ADGETGLRA.AHM..AP...
A1C4G0_ASPCL/62-293------------------------------------------------................NYTLN.IHL..SG...
PPOA_SOLLC/170-383------------------------------------------------...........GYSIDGKVLQ.VHN..SW...
Q9XUS8_CAEEL/185-376------------------------------------------------...............VGVGSG.AHS..GP...
Q5AUW8_EMENI/94-328------------------------------------------------................RHTRT.IHA..TG...
Q2Y722_NITMU/28-226------------------------------------------------.............FLAGVNDP.AHG..GP...
Q5BGU9_EMENI/69-304------------------------------------------------................NLTMV.IHR..NA...
A2QYL5_ASPNC/41-332------------------------------------------------.........GYGNRAWWGGFC.HHG..NV...
A2QFP6_ASPNC/96-325------------------------------------------------................NQTLY.IHG..TG...
A6RHX7_BOTFB/78-326------------------------------------------------.........NQTIGAPVTGYC.THD..SV...
Q33CJ6_CYNPY/88-316------------------------------------------------.........LQNNIFNYSTTF.ATR..GP...
Q2H7D7_CHAGB/62-379------------------------------------------------.........EYTAAAGGAGYC.THN..SI...
A3NMB3_BURP6/46-332------------------------------------------------........PQSDIYPYWGGYC.NHG..NV...
A1BB10_PARDP/150-379------------------------------------------------..................NWC.LHY..QE...
Q5AQP2_EMENI/67-282------------------------------------------------................NQTPS.IHW..VG...
Q5BDR2_EMENI/99-327------------------------------------------------................NQTLR.IHT..TG...
Q7SFK3_NEUCR/96-354------------------------------------------------.........TPTPGNEETGYC.THS..SI...

PF00372

HCYA_APHCL/112-375-HHWHWHVVYPSTYD-----PAFFG-----------------------------------KVKDRKGELFYYMHQ-----
HCYD_APHCL/110-371-HHWHWHLVYPAFYD-----ADIFG-----------------------------------KIKDRKGELFYYMHQ-----
HCYE_APHCL/109-369-HHWHWHIVYPATWD-----PAFMG-----------------------------------RMKDRKGELFYYMHQ-----
HCYA_PANIN/136-393-HHVTWHMDFPFWWE-----.DSYG-----------------------------------YHLDRKGELFFWVHH-----
SSP1_BOMMO/164-442-YMYYLHMNYPFWMT-----DDAYG-----------------------------------INKERRGEIMMYANQ-----
BJSB1_TRINI/162-439-YMYYLHMSYPFWMT-----DDMYT-----------------------------------VNKERRGEIMG.TYT-----
HCY2_LIMPO/110-373-HHWHWHLVYPSTWN-----PKYFG-----------------------------------KKKDRKGELFYYMHQ-----
BJSB2_TRINI/158-440-YYFYFHVDYPFWMK-----DKFMD-----------------------------------KMKMRRFELTYIMYQ-----
ARYB_MANSE/161-440-YYYYFHSHLPFWWN-----SERYG-----------------------------------ALKSRRGEIYYYFYQ-----
ARYA_MANSE/164-443-YYYYFHMHLPFWWN-----SEKYG-----------------------------------PFKERRGEIYYYFYQ-----
SSP2_BOMMO/161-440-YYYYFHSHLPFWWT-----SEKYG-----------------------------------ALKERRGEVYFYFYQ-----
HCY6_ANDAU/109-370-HHWHWHIVYPATWN-----PTVMG-----------------------------------KEKDRKGELFFYMHQ-----
ARY1_CALVI/140-479-YWYYLNMDYAFILD-----GKTFG-----------------------------------LNKDRRGEYWLYNVR-----
HCYC_PANIN/142-399-HHVLWHMEFPFWWE-----.DSSG-----------------------------------RHLDRKGESFFWVHH-----

PF00264

HCY2E_RAPVE/39-233.TFPEWHRLYTVQFE.....DALRR.................HG....................SVVGIPYWDTV.....
Q4WFT7_ASPFU/96-324.NFLTWHRYFTWAYE.....QALRN.................EC................GYTGY...QPYWAWN.....
A7DZQ9_9PEZI/52-325.LFLTWHRPYLLLFE.....QRIVE.................EALTIARNF.SDKYRAEYEEAALNIRIPYWDWA.....
TYRO_ASPFU/59-373.TFPTWHRPYMLLFE.....QRLFE.................IMETTIKETVPESHKQEWRDAARQWRLPYWDFAKTSGP
TYRO_NEUCR/57-320.LFITWHRPYLALYE.....QALYASVQAVAQKFPVEGGLRAKY................VAAAKDFRAPYFDWAS....
TYRO_PHONA/48-300.LFPTWHRPYVLLYE.....QILHK.................HVQDIAATY.TTSDKAAWVQAAANLRQPYWDWA.....
Q0UEG5_PHANO/69-233.NFLTWHRYFTWAYE.....RALKD.................EC................GYKGT...QPYYQWA.....
Q0U7P7_PHANO/109-364.LFGSWHRPYLAIFE.....QAWYL.................AVTEVINDF.PQDQRDRWNRAAATLRMPYWDWAQ....
Q0UNZ8_PHANO/95-336.LFGTWHRPYLALFE.....QILHDRAVDIANE.YPAGEARQNA................RKIADKVRLTYWDWAV....
Q0U440_PHANO/111-339.NFLSWHRYFVYGYE.....KALRE.................EC................GYKGY...QPYWNWF.....
Q0UXF5_PHANO/87-320.NFLAWHRYFIYAYE.....QLLRT.................EC................GLEGY...LPYYNWA.....
A1IHF0_PINFU/135-332.SFLGWHREYLIMYE.....EALQE.................IR....................SDVVLCYWDST.....
Q9GP18_HALTU/1711-1908.TFPQWHRLYTVQVQ.....DALRR.................HG....................SLVGIPYWDWTK....
Q9BJ58_ENTDO/1727-1922.TFPHWHRLYVVQFE.....QALHR.................HG....................ATVGVPYWDWTR....
Q1QJ90_NITHX/70-260.YFLPWHRAFTAMYE.....RIVRH.................LT..................KNDDFAMPYWDWTAN...
O49960_SACHY/160-403.IFAPWHRMYIYFYE.....RALGD.................LI..................GDKTFALPFWSWD.....
Q2KHE3_MAGO7/117-305.HFNVWHRLFLWHYQ.....ETLRD.................QC................GYPRD.LPLPWWDET.....
Q96TI3_LENED/54-303.LFPTFHRPYVLLIE.....QAIQAAAVD........IAATYIVDR...........ARYQDAALNLRQPYWDWA.....
Q6SS53_BACTU/28-187.MFLPWHREFLHKFE.....IELQK.................VD....................RNVTIPYWDWT.....
Q2HCB5_CHAGB/546-729.QFLPYHRYYLKTLE.....FLLQ..................EC................GYTGA...IPYWDET.....
A7E8E8_SCLS1/81-336.LFGPWHRPYLAVFE.....QQLHAWGVKI.......AQQFNGSDS...........EAYLQASSTLRVPYWDWAA....
Q2YAJ8_NITMU/75-337.WFLVWHRGYIGWFE.....QICRE.................LS..................GDPGFALPYWDWTENTD.
A7RQY2_NEMVE/97-287.YFFPWHRWYLLLFE.....NLLRK.................ID....................CRVTVPYWDWSR....
Q2TWH3_ASPOR/65-256.QFLPWHRYYMHIYE.....TLLRE.................EC................SYTGP...IPWWDEQ.....
A6RKM8_BOTFB/87-285.QFLPWHRYYMHTHE.....TLLRT.................EC................GYTGP...MSWWDEA.....
Q7NXK8_CHRVO/71-272DFFLPWHRMFITYFE.....DIIRQ.................VS..................GRHDFTLPYWDYTDP...
A2QTR2_ASPNC/82-308.LLLPWHRHFTYLYE.....KALQD.................EC................DYQGT...VPYWNWP.....
A2QUC2_ASPNC/107-337.DFLAWHRFFIHAFE.....NALRV.................EC................NYTGT...LPYWEWG.....
A6RE01_AJECN/73-357.LFPIWHRPYLALLE.....QLLYENMISD......IIPKFPKDKQ...........AGLKEAADSWRLPFWDWA.....
A6SQE9_BOTFB/103-376.LFPTWHRPYLALYE.....QTLHSIVVFI......AAQFSAGAER...........DRYTAAAANFRIPYWDWAV....
Q5AXC0_EMENI/55-404.TFPTWHRVYMMLYE.....RTLYEAMLEW......IHEAVPESHK...........DIWRKEADKWRLPYWDFARFADR
Q8Y2J8_RALSO/71-266.YFLPWHRGFVLMYE.....RAVAA.................LT..................GYKTFAMPYWNWT.....
Q82V60_NITEU/28-223.AFLPWHRRFIYDLE.....LELQR.................VS..................GNPNLGIPYWNWP.....
A6SST5_BOTFB/67-300.NFLGWHRYYVHTYE.....KALRE.................EC................GYKGY...QPYWNWG.....
Q5AYZ4_EMENI/638-868.IFFGWHRHFVYLWE.....KALQE.................EC................GYRGD...QPYWDWA.....
A3K3J4_9RHOB/68-259DFFVPWHRMYVLYLE.....KIVRQ.................VS..................GEDDFTLPYWNYSD....
Q0UUJ6_PHANO/114-348.TFLGWHRYFTWQYE.....QALRK.................EC................GYKGY...QPYWNWA.....
Q564J1_APLCA/1731-1925.TFPQWHRLYTVQVE.....DALRR.................HG....................SLVGIPYWDWSR....
Q2H2F5_CHAGB/109-341.VFQPWHRWFVHQYE.....KALRD.................EC................GYTGY...QPYWDWA.....
A3JWQ9_9RHOB/119-304.AYNPWHRAYMFRFE.....NALRS.................IA..................GCEDITMPYWNIY.....
A5X3N8_ORYRU/161-370.LFFPWHRMYLYFHE.....RILGK.................LI..................GDETFALPFWNWD.....
Q19VI0_SALSA/174-408.AFLPWHRVYLLHWE.....HEIRK.................MT..................GDFNFTIPYWDWR.....
A1IHF1_PINFU/134-334.NFLGWHRVYLNMYE.....EALQE.................IR....................PGVALCYWDST.....
Q2TL94_9APHY/53-300.LFPTWHRPYVALYE.....QILHKYAGE........IADKYTVDK...........PRWQKAAADLRQPFWDWA.....
Q287T6_PINFU/134-328.SILGWHRVFLYLFE.....NALRR.................KV....................PGVVLCYWDST.....
Q53IP9_MEGCR/1705-1901.TFPQWHRLYTVQFQ.....DSLRK.................HG....................AVVGLPYWDWTL....
Q2U7F6_ASPOR/78-307.DFLAWHRYFIHTFE.....QDLKS.................KC................QYTGS...LPYWDWG.....
Q27Q57_SEPOF/2142-2337.TFPQWHRLHVVQFE.....QALHR.................HG....................ATVGVPYWDWTY....
Q1QPI1_NITHX/200-472.RFLPWHRVYLYEFE.....QALQD.................FC....................PDVTMPWWDFP.....
Q8T777_BRAFL/161-422.GFPTWHRAFLLEAE.....RALQE.................VN..................GDPDWTLPYWDWG.....
A6S0E1_BOTFB/124-317.AFLPWHRYYIQIYE.....NALKD.................DC................SYTGT...LPYWDWS.....
A2Q9V3_ASPNC/114-348.TFLAWHRYFIYEFE.....QALRD.................EC................HYTGD...YPYWDWG.....
Q7S218_NEUCR/78-316.IFASWHRPYVALFE.....QTLVSHALAI.......ASRYPPSLL...........PAYTDAARTLRLPFWDWA.....
A1CDX9_ASPCL/62-270.ALVGWHREFLWLWE.....QALRD.................EC................GYRGA...VPYWNWS.....
PPO1_AGABI/47-299.LFPTWHRPYVLILE.....QILSGHAQQ........IADTYTVNK...........SEWKKAATEFRHPYWDWA.....
Q4W5X1_STRGR/29-261.GFLPWHRQYLLKFE.....QALQK.................VD....................PRVTLPYWDWT.....
Q2HEC0_CHAGB/91-343.LFPTWHRPYMALYE..........MIA..........TFWPEDER...........QRYESAARRFRLPYWDWAA....
Q2JGG6_FRASC/46-284.VFLPWHRVMLGWLE.....VHLQR.................VL..................GDPNFGLPYWDWAR....
Q2UHJ4_ASPOR/41-346.LFPTWHRAYMLRFE.....QALRT.................AP..................GCEDVTLPFWDECAG...
Q5LTK9_SILPO/37-259.FFLPWHRGYLAAFE.....AIL...................DAWI...........SAQPGGPQDWALPYWNYL.....
Q0CYP3_ASPTN/93-321.NFLTWHRYFTWAYE.....QALRD.................EC................GYAGD...LPYWAWN.....
Q21NZ9_SACD2/207-494.QFLTWHRMFLYDFE.....KNLQD.................FD....................PDVTLPFWDWTS....
A7UWM5_NEUCR/100-339.LFLPWHRYYIHGFE.....QGLQ..................KC................GYKGA...LAYWNHG.....
Q2GZJ4_CHAGB/104-327.TFLLWHRHYNWVLE.....QDLRD.................LC................GYNGV...FPYWEWG.....
Q54QT0_DICDI/95-368.AFLSWHRMLLNKFE.....KALQT.................ID....................PSVTLPYWDWT.....
A0ZXZ4_HYPJE/71-313.LFISWHRPYVLLFE.....QALVSVAKGI.......ANSYPPSVR...........AKYQAAAASLRAPYWDWA.....
A1CVG0_NEOFI/71-291.LLLPWHRNFIHLWE.....TALRE.................EC................GYKGY...QPYWDWP.....
TYRO_ASPOR/53-346.LFPTWHRAYLMAVE.....KALRK.................AC....................PDVSLPYWDES.....
Q3UFK6_MOUSE/182-417.AFLTWHRYHLLQLE.....RDMQE.................ML..................QEPSFSLPYWNFA.....
Q876W6_GIBZA/69-281.NFLPWHRWFVQLHE.....DLLKT.................EC................DYKGV...QPYWDWT.....
Q0U1I9_PHANO/177-359.KFLLWHRYYLFTFE.....DILRS.................EC................GFDRN...LPWFDET.....
Q7S4R1_NEUCR/95-301.SFLPWHRWTLHIFE.....NILKD.................KC................GFPRG.GTIPYWDWS.....
Q2YBN6_NITMU/117-305YRFLGWHRRYLVEFE.....RELQR.................VDAV...........LRPGATEK.LAVPYWRWE.....
A6R210_AJECN/53-380.LFPSWHRPYVVLYEAKNTQQLIQEIIATEI....LPKIPQSDKDY...........DKYKTATETFRIPFWDWAA....
Q41388_SPIOL/183-401.LFPSFHRWYLYFYE.....RILGK.................LI..................NKPDFALPYWNWD.....
Q39ND4_BURS3/46-332.LFPTWHRAYLLRLE.....QALQS.................IP..................GCEQVMLPFWDET.....
Q5VM57_9GAMM/34-262.FFLPWHRMYLQFFE.....AIVAK.................TVV..............ELGGPKDWTLPYWNYC.....
Q1MVA1_MEGCR/1716-1912.TFPQWHRLYTVQFE.....DSLKR.................HG....................SIVGLPYWDWLK....
Q5ATE5_EMENI/58-339.LFPSWHRPYLLLYE.....QQIYEIMINE......IIPQYPEKHR...........PTLRAAADTWRLPYWDWA.....
Q2IY37_RHOP2/143-320.GFLPWHRAYVLGLE.....RALQA.................IN....................PVVTLPYWQFD.....
Q2H5H1_CHAGB/120-347.NFLTWHRYLIWLWE.....QKLRN.................DC................GYTGY...LPYWNWF.....
Q5DB10_SCHJA/171-406.CFPTWHRYYILLWE.....RLMSK.................ITK..............VIFGITDYATPYWDWV.....
PPO2_AGABI/47-295.LFPTWHRTYLSVLE.....QILQGAAIE........VAKKFTSNQ...........TDWVQAAQDLRQPYWDWG.....
B0UQY1_METS4/67-305.YFATWHRWYMYYFE.....RVCRV.................MC..................KDPNFLLPYWNYGSG...
A1CIU9_ASPCL/95-322.LLLPWHRHFLYLFE.....KALRD.................EC................GYTGH...LPYWDWS.....
Q2U5S1_ASPOR/110-305.SFLPWHRYTLVVFE.....KALRE.................HC................GFTGQ...VPYWDWT.....
Q9U5P3_HALTU/454-650.TFPQWHRLYTVQFQ.....DALRR.................HG....................ATVGVPYWDWLR....
A3RUW3_RALSL/143-320.GFLPWHRAYLLDLE.....RELQA.................ID....................PAVTIPYWRFD.....
Q0TZT9_PHANO/73-288.QFLLWHRYFLATYE.....KALKD.................EC................GWTLG...QPYWDWS.....
A7SSF6_NEMVE/299-492.NFFPWHRWFILNFE.....NFIRK.................ID....................CRVTVPYWDWSQ....
A6SR72_BOTFB/76-338.LFAPWHRPYLALFE.....QYLYQIIQKI.......AATFPTSTK...........ARYQQAALTFRMPYWDWAA....
Q2GQI5_CHAGB/102-339.IFLTWHRYYTWAYE.....EKLRT.................EC................NYRGT...VPYWEWG.....
Q093B2_STIAD/65-326.WFYVWHRGYVGYVE.....ETIRS.................LS..................GDPSFAFPYWDWTEL...
Q70KX7_SUBDO/179-430.SFPVWHRRYMLTVE.....KEFQR.................IM..................GNDTFGFPYWQWE.....
A1CVX2_NEOFI/64-292.VFLSWHRHYLHLFE.....TALRT.................EC................AFNGS...IPYWNWP.....
Q868D0_HALRO/174-442.SFLPWHRYFLLKWE.....EEIRN.................VV.................LNSESFGLPYWDWT.....
Q6PLR1_WHEAT/160-367.IFAPWHRMYIYFFE.....RIIGE.................LI..................GDSTFALPYWNWD.....
A7UX66_NEUCR/102-340.NFLGLHRYFISLYE.....QALRE.................EC................GYRGT...QPYWDWA.....
Q5DHS0_SCHJA/178-415.GFLTWHRYYMLFWE.....KQLRK.................IAI..............RLYGWTDFTLPYWDWV.....
Q2HF52_CHAGB/72-288.HFLAWHRYYVAVYE.....RMLRN.................EC................GYGGA...QPYWDWT.....
Q0U6S4_PHANO/81-292.YFLPWHRWFIYLFD.....TSLRQ.................TC................GYSGP...TPYWDWS.....
Q2UP46_ASPOR/57-381.TFPTWHRVYVTLYE.....QVIYEAMLDF......IKQNVPQNGK...........ADWENEAKQWRLPYWDFARFA..
Q56N25_9BRYO/92-311.FFFPWHRMFLYFHE.....RILAS.................LI..................GDPTFALPFWNWD.....
Q92LD3_RHIME/65-275YDFLPWHRAYLLCIE.....TLIES.................AI...................GEPFAMPYWDYTV....
A6UM82_SINMW/70-311.WFTSWHRGYLGYFE.....ETCRE.................LS..................GNPDFALPYWDWTAN...
A6R858_AJECN/138-381.NFLAWHRYFVWAYE.....KALRE.................EC................GYHGI...SPYWEWG.....
Q7YT36_SEPOF/122-301.GFLPWHRIYMMIWE.....EGLRE.................QI....................PSVVVPYWDVT.....
Q0C7G8_ASPTN/47-357.LFPTWHRAYLCRLE.....QALQG.................VS..................GFSDVALPYWNEYK....
A6R3Q4_AJECN/72-315.LFPMWHRPYLAIYE.....ERISRHAQAI.......ANTYPQMLR...........AVYQKAATDLRLPYWDWA.....
Q2H5C8_CHAGB/79-307.NFLSWHRYYTWAFE.....RVLQT.................EC................GYNGT...QPYWDWG.....
Q93HK5_STRAW/28-238.SFLPWHRMFLLDLE.....RVLRR.................VD....................ESVTMPYWDWT.....
A1C4G0_ASPCL/62-293.IFFGWHRRFVWLWE.....RAMRE.................EC................GYQGY...QPYWNWA.....
PPOA_SOLLC/170-383.LFFPFHRWYLYFYE.....RILGS.................LI..................DDPTFGLPFWNWD.....
Q9XUS8_CAEEL/185-376.GFLPWHREYLKRVE.....IALRM.................VD....................PTVFIPYWDSV.....
Q5AUW8_EMENI/94-328.SFFAWHRHFVYLYE.....KALRE.................EC................GYTGY...QPYWEWS.....
Q2Y722_NITMU/28-226.AFLPWHREYLRRFE.....RALQQ.................ID....................PSVSIPYWDWT.....
Q5BGU9_EMENI/69-304.PFLPWHRQYIHLWE.....TALRE.................EC................GYNGT...VPYWNWT.....
A2QYL5_ASPNC/41-332.LFPTWHRAYVLRLE.....EALCN.................VS..................GNPNLALPYWDEI.....
A2QFP6_ASPNC/96-325.NFLTWHRYFTWAYE.....NALRT.................EC................GYDGY...QPYWAWN.....
A6RHX7_BOTFB/78-326.LFTTWHRPYLALFE.....QVLASYAQKI.......AKTYISTLY...........PAYQAAADNLRIPFWDWG.....
Q33CJ6_CYNPY/88-316.AFLTWHRWHLAFIE.....REIQV.................IT..................GDDNFTIPYYDWS.....
Q2H7D7_CHAGB/62-379.LFPSWHRPYMLLYE.....QALYEIMTTEI.....IPKIPDEAAQ...........QQWENAAATWRLPFWDWALK...
A3NMB3_BURP6/46-332.LFPTWHRMYVYKLE.....EALQS.................IV....................PGVSMPFWDET.....
A1BB10_PARDP/150-379.AFAFWHRGFLLYLE.....AML..........................................GCPVPYWDWMA....
Q5AQP2_EMENI/67-282.HFALWHRYFVASYE.....KSLRE.................EC................GYTGA...QPYWNWS.....
Q5BDR2_EMENI/99-327.NFLTWHRYFTWAYE.....QALRN.................EC................GYTGY...QPYWSWG.....
Q7SFK3_NEUCR/96-354.LFPTWHRPYLALYE..........NIAK.........WWPEGEPR...........NRYQAAALRFRIPYWDWAS....

PF00372

HCYA_APHCL/112-375----------QMCARYDCERLSNGLNRM-IPFHNF----NEPLGGY----------------------------------
HCYD_APHCL/110-371----------QMCARYDCERLSVGLQRM-IPFQNL----DDELEGY----------------------------------
HCYE_APHCL/109-369----------QMCARYDCERLSNGMRRM-IPFSNF----DEKLEGY----------------------------------
HCYA_PANIN/136-393----------QLTARFDFERLSNWLDPV-DELHWD----RIIREGF----------------------------------
SSP1_BOMMO/164-442----------QLLARMRLERLSHKMCDV-KPMMWN----EPLETGY----------------------------------
BJSB1_TRINI/162-439----------QLLARLRLERLSHEMCDI-KSIMWN----EPLKTGY----------------------------------
HCY2_LIMPO/110-373----------QMCARYDCERLSNGMHRM-LPFNNF----DEPLAGY----------------------------------
BJSB2_TRINI/158-440----------QILARYILERLSNGMGMI-KDLSWH----KTIKKGY----------------------------------
ARYB_MANSE/161-440----------QLMARYYFERLSNGLGDI-PEFSWY----SPVKSGY----------------------------------
ARYA_MANSE/164-443----------QLIARYYLERLTNGLGEI-PEFSWY----SPVKTGY----------------------------------
SSP2_BOMMO/161-440----------QLLARYYFERLTNGLGKI-PEFSWY----SPIKTGY----------------------------------
HCY6_ANDAU/109-370----------QMCARYDSERLSNGLQRM-IPFHNF----DEPLEGY----------------------------------
ARY1_CALVI/140-479----------QLLSRYYMERLTHGYGEI-PHFSFL----NTIEHGY----------------------------------
HCYC_PANIN/142-399----------QLTVRYDAERLSNHLDPV-EELSWN----KAIDEGF----------------------------------

PF00264

HCY2E_RAPVE/39-233.....V...........PQEDLPA..FF.NDEIWD....DPLF.HA..................................
Q4WFT7_ASPFU/96-324...................KYADD..PR.NSPIFD....GSDY.SMSGDGSYIPHDGS..........EAAPGIVLTPGN
A7DZQ9_9PEZI/52-325....................TDSD..VP.QSIRFA....ETDI.TLPEVGS........................DAPPV
TYRO_ASPFU/59-373HATGPL...........SLPVLCG..LA.NVVILN....PANP.ET..................................
TYRO_NEUCR/57-320...QP.P........KGTLAFPES..LS.SRTIQV....VDVD.GK..................................
TYRO_PHONA/48-300....................ANAV..PP.DQVIVS....KKVT.ITG................................S
Q0UEG5_PHANO/69-233...................YWAAD..PA.KSPALD....GSQT.SL..................................
Q0U7P7_PHANO/109-364....E.T........NGGPTVPTQ..MR.DQQVTV....TKPQ.GQ..................................
Q0UNZ8_PHANO/95-336...DP.P........TSEGIMPKC..LR.SPTATV....TFPN.GT..................................
Q0U440_PHANO/111-339...................TYQDN..LR.ASPIFD....GSDT.SMGGDGSFVKHNGS.........VGGHPDVHLPSGE
Q0UXF5_PHANO/87-320...................WWHED..PA.NSPLFD....GSAT.SIGSGGTYVPGRNYTCI...PNDQPLGCPIKLPPGS
A1IHF0_PINFU/135-332....L...........DFLMPGST..QR.FTVAFS....ADLF.GN..................................
Q9GP18_HALTU/1711-1908...PV.N........ELPELLSSA..TF.YHPIRN....INIS.NP..................................
Q9BJ58_ENTDO/1727-1922...PI.S........KIPDFIASK..RY.SDPFTK....IEDY.NP..................................
Q1QJ90_NITHX/70-260..PTM.PE......VFLPEKTPDG..KT.NWLCVS....EDGK.KR..................................
O49960_SACHY/160-403....................APAG..MV.VPALFK....EAFA.NP..................................
Q2KHE3_MAGO7/117-305...................KDSGN..FA.NSPIFT....PEYY.GSAPKVV.......................VKDGKE
Q96TI3_LENED/54-303....R...........NPVPPPEV..IS.LDEVTI....VNPS.GE..................................
Q6SS53_BACTU/28-187.....................VDN..SI.TSSIWR....GNFM.GA..................................
Q2HCB5_CHAGB/546-729...................RDAGK..FS.ASTIFD....PVTG.FGAG.............................GTA
A7E8E8_SCLS1/81-336...NP.A........NNGPILAEV..LS.NPTASV....TYPN.GS..................................
Q2YAJ8_NITMU/75-337PDSPF.QARV..PAVMFEDVLTPA..HP.AYIANS....REFQ.NRFRG............................VIA
A7RQY2_NEMVE/97-287....A.V.........GAGRLWRG..SY.LHDVWS....PGPH.GIGGN............................GEG
Q2TWH3_ASPOR/65-256.................KDADSGN..MW.QSSMWG....PDAF.GGNG..............................TG
A6RKM8_BOTFB/87-285.................KDADAGD..FF.QSDMWT....AEYF.GSTN..............................LD
Q7NXK8_CHRVO/71-272...SQ.QV......LPIEFRRPGD..PVWGPLYRE....TRWP.GT..................................
A2QTR2_ASPNC/82-308....................TTTN..LT.ASPVFD....GSPT.SFSGNGLPQNNTSNL........CPLNITPCPSPGT
A2QUC2_ASPNC/107-337...................LDAEN..PQ.DSVLFN....GDLY.SMGTNGVDLNRTSI.........YWASQNITIPAGT
A6RE01_AJECN/73-357................INHRVPTL..AK.YPTTTI....PTPN.GK..................................
A6SQE9_BOTFB/103-376...VP.P........TGESVLPPS..VS.TPTITV....NGPA.GV..................................
Q5AXC0_EMENI/55-404PPSTAGPLPHDIDHDQLRLPILCM..MPNVRITLF....TKDS.GP..................................
Q8Y2J8_RALSO/71-266.....................EDR..LL.PEAFTA....KTYN.GK..................................
Q82V60_NITEU/28-223......................SG..SA.NASMWN....DDLL.GGN...............................GD
A6SST5_BOTFB/67-300...................RYADD..PI.HSPLFD....GSPT.SMSGNGLYYNHTGVPI......NLAPAPFDIIPPGV
Q5AYZ4_EMENI/638-868...................LSADN..IS.ASPIFD....GSPT.SLSGDGDPIPQDPFF........KLVPTNITIPNGS
A3K3J4_9RHOB/68-259...PA.S........LAIPEEFRD..PA.SPLFVA....DRNP.GI..................................
Q0UUJ6_PHANO/114-348...................KTAES..GLEKSPMLD....GSPF.SMSGNGEFIPGGKEVN.....LGGNGLPDFWLPAGT
Q564J1_APLCA/1731-1925...QT.D........HLPGLLANP..TY.TDVYTG....QTID.NP..................................
Q2H2F5_CHAGB/109-341...................KYANA..PQ.NSPLFN....GDPT.SLGGNGEYIPHDGPVIV...PPAGVGGGNISLPAGE
A3JWQ9_9RHOB/119-304......................SG..AL.PAIFDE....APFN.SY..................................
A5X3N8_ORYRU/161-370....................APDG..MS.FPAIYA....NRWS.PL..................................
Q19VI0_SALSA/174-408.......................D..AT.DCTVCT....DTMM.GGR...............................SP
A1IHF1_PINFU/134-334....L...........DYLMPGDS..QR.RTVAFS....DELF.GN..................................
Q2TL94_9APHY/53-300....K...........NTLPPPEV..IS.LDKVTI....TTPD.GQ..................................
Q287T6_PINFU/134-328....I...........DYLIPGPG..QA.QSSSFS....HNMF.GN..................................
Q53IP9_MEGCR/1705-1901...PR.S........ELPELLTVS..TI.HDPETG....RDIP.NP..................................
Q2U7F6_ASPOR/78-307...................LDAEN..PH.LSVLFN....GDEY.SMGSNGAFIPNRDPA........YWPAIHEYIPVGT
Q27Q57_SEPOF/2142-2337...PM.K........EVPHLLTSE..KY.TDPFTG....VETF.NP..................................
Q1QPI1_NITHX/200-472................APRYKPEN..PA.DGAILP....DAFK.GFLTDASVRFLR.............AHGFPAEVETL
Q8T777_BRAFL/161-422.....................AAE..QH.QCDICT....NEYV.GA.................................N
A6S0E1_BOTFB/124-317...................LDWED..FS.RAPIWG....HDNF.GSDGNLD.......................AETSVG
A2Q9V3_ASPNC/114-348...................YDAIH..TMEASEVFD....GSET.SMSGNGYFIPNQGNIS.....LYLGNYPAIVLPPGT
Q7S218_NEUCR/78-316................SDPSLPYA..VM.NDSIKV...SNTPN.....................................
A1CDX9_ASPCL/62-270....................LYPD..LA.SSPLFD....GSPT.SFSGDGD........................PNANY
PPO1_AGABI/47-299....S...........NSVPPPEV..IS.LPKVTI....TTPN.GQ..................................
Q4W5X1_STRGR/29-261.....................TDH..GE.NSPLWS....DTFM.GGNG..............................RP
Q2HEC0_CHAGB/91-343...TP.P........SGESVLPKS..IGGSPFIEV....NGPN.GV..................................
Q2JGG6_FRASC/46-284...DG.T........PSAPATAPN..PA.ASALWR....NTPD.GFG................................G
Q2UHJ4_ASPOR/41-346...LV.GR.......PSVGLRPHH..LI.PRVLTM....RTYE.LD..................................
Q5LTK9_SILPO/37-259.....................SDS..NP.NGRAIP....PEFL.DPTLP............................DGS
Q0CYP3_ASPTN/93-321...................KYAAD..PL.HSPVFD....GSPY.SMSGDGTYIPHNGT..........EAAPGFVIAAGH
Q21NZ9_SACD2/207-494....P.E........YDENRDKSK..PS.NGGIIP....KIFR.CFITEQAIAELVDEY........HLPESVAQKLKAV
A7UWM5_NEUCR/100-339...................LDVAN..LL.ASPIFD....GSDT.SLGGNGDPVPHGDSGFIF..PGFTQVNILPAGPNGR
Q2GZJ4_CHAGB/104-327................LDCGSVGS..MD.KSPVFD....GSEY.SLGGNGEFIEGH.............RAAIGGAKPGS
Q54QT0_DICDI/95-368.....................DRD..AS.ANNIFI....KEFM.GGNGGID........................GLGGK
A0ZXZ4_HYPJE/71-313................ADSSVPAV..TV.PQTLKI....NVPS.GS..................................
A1CVG0_NEOFI/71-291...................SNSHD..LA.NSPHFD....GSPT.SLSGDGEYDEHA..............ERDPTLPKGT
TYRO_ASPOR/53-346.................DDETAKK..GI.PLIFTQ....KEYK.GK..................................
Q3UFK6_MOUSE/182-417......................TG..KN.VCDVCT....DDLM.GSR...............................SN
Q876W6_GIBZA/69-281.................IDADKKD..MK.NSPLF.....DAKT.GFGGDGQR.....................TDSDVPG
Q0U1I9_PHANO/177-359...................RYAGR..FA.ESSIFS....DQWY.GGI...............................NA
Q7S4R1_NEUCR/95-301...................LDHLS..LS.SSSIF.....SPTT.GFGSDGAP.....................SAPPSVG
Q2YBN6_NITMU/117-305...............................DPFP....AWLN.GF..................................
A6R210_AJECN/53-380...PP.P........ESQQEIINK..WLPPTSQEK....KVPN.LV..................................
Q41388_SPIOL/183-401....................HRDG..MR.IPEIFK....EMDS.PL..................................
Q39ND4_BURS3/46-332.................SEESLTK..GI.PWALTA....PDFE.LD..................................
Q5VM57_9GAMM/34-262.......................D..AN.NPALNP....TEQL.QA..................................
Q1MVA1_MEGCR/1716-1912...PQ.S........ALPDLVTQE..TY.EHLFSH....KTFP.NP..................................
Q5ATE5_EMENI/58-339................VNPKIPWL..AE.DPELQV....SLFG.EL..................................
Q2IY37_RHOP2/143-320..........................AP.APVLFT....IDYM.GR..................................
Q2H5H1_CHAGB/120-347...................KYQDD..LS.KSPVFD....GSDT.SLGGDGEYFAHNGS.........VVGAGRVWLPSGE
Q5DB10_SCHJA/171-406.......................G..LK.HCDICT....NRYI.GAPG.............................RRS
PPO2_AGABI/47-295....F...........ELMPPDEV..IK.NEEVNI....TNYD.GK..................................
B0UQY1_METS4/67-305...PN.AT......LQLPPGFRNQ..DY.PSLMFD....DRGV.GFSTPQ.........................GDGAQ
A1CIU9_ASPCL/95-322..................RYDNVN..LT.HTALFD....NSPT.SLSGDGAYNPNEQT..........ICTPEGCMGRGT
Q2U5S1_ASPOR/110-305...................LDWMN..LA.NSSIF.....NSVD.GFGGDGDR.....................TGQEVVG
Q9U5P3_HALTU/454-650...PQ.S........HLPELVTME..TY.HDIWSN....RDFP.NP..................................
A3RUW3_RALSL/143-320..........................RA.APNLFT....TDFI.GVPD.............................ALG
Q0TZT9_PHANO/73-288.................LDAEPLN..ET.SARIFDSAIFNPDT.GFGGNGYPKVAPP............EMNPQNLTGNT
A7SSF6_NEMVE/299-492....A.V.........SGNRIFRR..SH.IRDVWY....PGNH.GLGSN............................GVG
A6SR72_BOTFB/76-338...AP.P........AGDKYFPTV..VG.QPLIQI....ITPT.SN..................................
Q2GQI5_CHAGB/102-339...................LDIAD..PA.ASPVFD....GSDT.SLGGNGDAIPHEGLILT....EPFNAEALIPLPAGS
Q093B2_STIAD/65-326..PQI.PG......EMFDSVLTPA..DA.AYAPYT....QDIG.TFTSFIQPAL..................EAYWNQLN
Q70KX7_SUBDO/179-430..........................EN.DMSPFT....PEYF.GVPAN...........................GFSP
A1CVX2_NEOFI/64-292....................LHPN..LT.VSPLFD....NSPS.SLSGDGIYNPDELI.........LCDEQVGCVGRGS
Q868D0_HALRO/174-442.......................A..SQ.DCDMCS....DEYF.GGR...............................NP
Q6PLR1_WHEAT/160-367....................APDG..MM.LPPIFN....NASS.PL..................................
A7UX66_NEUCR/102-340...................KTAET..GLSASPIFD....GSAT.SMSGNGVYIPNQGDIVLG..GIEGSKLPPVYLPAGT
Q5DHS0_SCHJA/178-415.......................D..ST.KCDVCV....NSLL.GAYG.............................QWV
Q2HF52_CHAGB/72-288.................LDTPAGQ..WA.SSPVF.....DPVT.GFGGNGALVAAD.............PANPMEVPGRT
Q0U6S4_PHANO/81-292...................RDHAD..LF.NSPVFE....DSPE.YGLG.............................RTG
Q2UP46_ASPOR/57-381.RHGH.DNTQ...GDELRLPILVT..MP.MVKVLV....PGQP.GK..................................
Q56N25_9BRYO/92-311....N...........QSQGATQG..NV.MPRYYS....ERRW.SN..................................
Q92LD3_RHIME/65-275...AP.LL.......PTEFRQPSN..NT.NALYHE....QRLL.ND..................................
A6UM82_SINMW/70-311..PEV.LP......PLFGTILDPV..NSSAYIPDH....NRFQ.DIMQEPIK.....................ACWDSLS
A6R858_AJECN/138-381...................YDVYD..PQ.KSALFD....GSPY.SFGSNGAPLAERDPTYRLPPPPPFPKAEGREFPAGT
Q7YT36_SEPOF/122-301.................RDSALED..PR.RSIIWS....PEFQ.GN..................................
Q0C7G8_ASPTN/47-357...TE.KL.......PDIFTTESY..TFQDSIISE....DSFE.DKDD.............................IIV
A6R3Q4_AJECN/72-315................NDPELPKS..VI.TPQLNI....NTPN.GL..................................
Q2H5C8_CHAGB/79-307...................RWAQD..PE.TSPIFD....GSDT.SLSGNGEKIDH...............KASGMVPAGN
Q93HK5_STRAW/28-238.....................RSR..SR.TAAPWT....EDLL.GGTG..............................RQ
A1C4G0_ASPCL/62-293...................LSANN..LS.ASPLFD....GSDT.SLSGDGDPVENSKST.......MILLPTNVTIPNGS
PPOA_SOLLC/170-383....................HPKG..MR.FPPMFD....VPGT.AL..................................
Q9XUS8_CAEEL/185-376.................MDSYLPD..PR.DSIMFS....DLFV.GGT................................D
Q5AUW8_EMENI/94-328................HWANL..P..IT.ANPLYD....GSNA.SLSGNGVYIPNRNGTLQLFPIPNPSPDTAIYTPPGT
Q2Y722_NITMU/28-226.....................VDR..TT.NASIWN....ANFM.GGNG..............................TG
Q5BGU9_EMENI/69-304......................KNPDLY.TNPVFDTTQSPETSLSLSGDGAYVAPSPTD........PDPDPGLDFAPGR
A2QYL5_ASPNC/41-332.....................ADQ..SV.PTIFTT....RRYT.LR..................................
A2QFP6_ASPNC/96-325...................KYAAN..PI.NSPVFD....GTEY.SMSGNGDFVPHNGT..........PATDYTIIPPGV
A6RHX7_BOTFB/78-326................VSPSMPSI..IN.VPTVSI....VLPS.GT..................................
Q33CJ6_CYNPY/88-316......................RD..GK.HCEICT....DEFM.GK.................................S
Q2H7D7_CHAGB/62-379...KA.RP......EDSTDPGSTK..LIYDVPVIV....KYPK.VDVLD...........................YQKG
A3NMB3_BURP6/46-332.................DEYTLRH..GI.PSILTQ....ETFE.LD..................................
A1BB10_PARDP/150-379....E.D........ASKDGSPSA..GL.PRCFLD....QTYI.HP..................................
Q5AQP2_EMENI/67-282..................LDASTN..LS.STAIFETEIFDPDT.GFGGNGAWVEITD...........PADNPFNLTGRT
Q5BDR2_EMENI/99-327...................KYVDD..LL.GSPIFD....GSEY.SMSGDGSYIPHDGP..........EVFEGVFLEPGN
Q7SFK3_NEUCR/96-354...SP.P........SGQSVLPLS..VGGSPYVDV....NGPN.GV..................................

PF00372

HCYA_APHCL/112-375AAHLTHVASGRHYAQRPDGLAMHDVREVD-----------------------.VQDMERWTERIMEAIDLRR--------
HCYD_APHCL/110-371SPHLRSLVSGLSYGSRPAGMHLRDINDCS-----------------------.VQDMERWRERILDAIHTGL--------
HCYE_APHCL/109-369SAHLTSLVSGLPYAFRPDGLCLHDLKDID-----------------------.LKEMFRWRERILDAIDSGY--------
HCYA_PANIN/136-393AP.LTSYKYGGEFPVRPDNIHFEDVDGVA-----------------------HVHDLEITESRIHEAIDHGY--------
SSP1_BOMMO/164-442WP.KIRLPSGDEMPVRQNNMVVATKDNLK-----------------------MKQMMDDVEMMIREGILTGK--------
BJSB1_TRINI/162-439WP.KIRLHTGDEMPVRSNNKIIVTKENVK-----------------------VKRMLDDVERMLRDGILTGK--------
HCY2_LIMPO/110-373APHLTHVASGKYYSPRPDGLKLRDLGDIE-----------------------.ISEMVRMRERILDSIHLGY--------
BJSB2_TRINI/158-440WP.WMKLHNGVEIPVRFDNYVIVRDHNRD-----------------------VIRLCDEYERIIRDAIIKGF--------
ARYB_MANSE/161-440YP..LMSSYYYPFAQRPNYWNVHSEENYE-----------------------KVRFLDTYEMSFLQFLQNGH--------
ARYA_MANSE/164-443YP..MLYGSYYPFAQRPNYYDIHNDKNYE-----------------------QIRFLDMFEMTFLQYLQKGH--------
SSP2_BOMMO/161-440YP..LMLTKFTPFAQRPDYYNLHTEENYE-----------------------RVRFLDTYEKTFVQFLQKDH--------
HCY6_ANDAU/109-370APHLTSLVSGLQYASRPEGYSIHDLSDVD-----------------------.VQDMVRWRERILDAINMHY--------
ARY1_CALVI/140-479DS.QLVYNNGVGFSYRKNYYEVESYGKFS-----------------------YYYKVMDFFNRLDEIITKGV--------
HCYC_PANIN/142-399AP.HTAYKYGGYFPSRPDNVHFSDVDGVA-----------------------RVRDMSMTEDRIRDAIAHGY--------

PF00264

HCY2E_RAPVE/39-233....N...FTNP..FNGADIDFNHQKIAR...........................DINVDKLFKEGPKGYD........
Q4WFT7_ASPFU/96-324GGGCV...FSGP..FK..NFTVNLGPVFPSLK.....VPGIV............AQNGSGLDYNPRCLRRDI........
A7DZQ9_9PEZI/52-325TRKGV...PNPMYSYKFKTSIRRQRDFSI...........VG............VQEMVAWEETKRCPDE..........
TYRO_ASPFU/59-373.PIEL...PNPVYKYRAPDLMGNLDKPFHIPPERIDPDKDDY............YPWDKCQATTKYGLLKNN........
TYRO_NEUCR/57-320.TKSI...NNPLHRFTFHPVNPSPGDFSA...........................AWSRYPSTVRYPNRLT........
TYRO_PHONA/48-300NGHKVE.VDNPLYHYKFHPIDSSFPRPYS..............................EWPTTLRQPNSSRP.......
Q0UEG5_PHANO/69-233....G...GDGA..YI................................................................
Q0U7P7_PHANO/109-364..VRI...NNPLYSYSWGNSLPAE....I........................GGGPWNSFPQTLRRPVANP........
Q0UNZ8_PHANO/95-336.KGEI...ANPLYRYDFHPLKAEDFSALK.........................GFEFTEWEHTIRYPLDPHS.......
Q0U440_PHANO/111-339GGGCI...KSGP..FK..GVQANLGPLSPA..........M.D.........GEVIVNTTFAYNPRCLKRDL........
Q0UXF5_PHANO/87-320GGGCI...IGPL...A..NWTMSLGPIQST.........FE.GV........KPNPQADGLGYNPRCLSRDV........
A1IHF0_PINFU/135-332GRGNV...INGA..FANWQLPGG..........................................GTLRRNIA.......
Q9GP18_HALTU/1711-1908....F...LGADIEFEGPGVHTERHINTE....................................RLFHSGDH.......
Q9BJ58_ENTDO/1727-1922....F...NQGQISFISEDTETKREVSE.....................................YLFEHPVL.......
Q1QJ90_NITHX/70-260................................................................................
O49960_SACHY/160-403.............LYDPNRNTANLNALVDLD.......YLS.HRD.....AKPIDFKGPKDEKYKELVNKNL........
Q2KHE3_MAGO7/117-305FATCI...EDGA..FA..NITVSIGPAKS................................VTTPHCLSRAL........
Q96TI3_LENED/54-303....KISVPNPLRRYTFHPIDPSF..............................PEPYQSWSTTLRHPLS..D.......
Q6SS53_BACTU/28-187..............FTG..................................................LNRQL........
Q2HCB5_CHAGB/546-729ANPCV...PNGP..FA..NLTVNIGPGFR.................................SEPRCVNRRI........
A7E8E8_SCLS1/81-336....TATISNPLFSYNFHPLVPSD................F.R..........NGYPYSVYDTTLRWPTS..D.......
Q2YAJ8_NITMU/75-337RADYWKRFCGPNGEFDDETQYGQLLARGIRSP......EDL.WFDM....LNDPRGRFFFDLKQARGTTREKPE......
A7RQY2_NEMVE/97-287SKRIV...TNGPLRKDSWELPAWHEQ.......................................PWLSREF........
Q2TWH3_ASPOR/65-256SDLCV...IDGR..FS..NYTLHIGPGDE.................................DTDYCLRRAW........
A6RKM8_BOTFB/87-285ENACV...IDGA..FA..NTTEHIGPLLE.................................NTDYCFYRAF........
Q7NXK8_CHRVO/71-272................................................................................
A2QTR2_ASPNC/82-308GGGCV...TTGP..FS..NWSMHLGPFSLS.........QV.IP........YGDLPANAFAYNPRCLSRNF........
A2QUC2_ASPNC/107-337GGGCV...YGGP..FS..NYTVHMGPIDA...........P.G..........EQPVQYNLEYNPRCLSRDV........
A6RE01_AJECN/73-357....RERVENPLYQFKMSTNEPFL.....SEG......VGQ.VFDP....WAGEVVQFGPCIGTSRSPDI..EDS.....
A6SQE9_BOTFB/103-376.....QTISNPLFSYHFNPLDPSE..................L..........PDAPFSQFPQTLRYPTS..N.......
Q5AXC0_EMENI/55-404...IIESRPNPLYKYITPQLMGEFRDPYKIRG.....ETTEPDPNDKVQTPKFTLQWDKCNATTKYGLLDGFHESIWADG
Q8Y2J8_RALSO/71-266........TNPLYVPNRNELTG..........................................................
Q82V60_NITEU/28-223AGGVV...RTGP..FRSGQWTVINSSGLP...................................AGPLMRAF........
A6SST5_BOTFB/67-300GGGCV...TTGP..FK..NMTVHLGPVFGT.........IS.GT........PVNPQADGFGYNPRCLRRDV........
Q5AYZ4_EMENI/638-868GGGCV...TNGP..FA..NMTLNLPDLTF...........A.G.........DAEFPASAFNYSPHCFTRNL........
A3K3J4_9RHOB/68-259................................................................................
Q0UUJ6_PHANO/114-348GGGCI...KSGP..FK..DMKVNLGPVQLG.........LT.DG........TSVSNGDGLGFNPRCLKRDL........
Q564J1_APLCA/1731-1925....W...YKAKIEFE..NSVTERDVQGD....................................YLFKQGPH.......
Q2H2F5_CHAGB/109-341GGGLV...KTGP..FA..DMVVNLGPVGGL..........A.D.........TAPGPMGGLGHNPRGLKRDL........
A3JWQ9_9RHOB/119-304TLPQDLEQLDGNVKYKKGYATSRFSHAKI..................................KQELLDYDV........
A5X3N8_ORYRU/161-370..............YDPRRNQAHLPPFPV...........D.L..........DYSGTDTNIPKDQLIDQNL........
Q19VI0_SALSA/174-408LNPNL...ISPGSVFSSWKVICTQPEEYN.........................SRAALCPGTGEGPLLRNP........
A1IHF1_PINFU/134-334GRGAV...INSQ..FANWRLSDN..........................................TPLRRMI........
Q2TL94_9APHY/53-300....RTQVDNPLRRYRFHPIDPSF..............................PEPYSNWPATLRHPTS..D.......
Q287T6_PINFU/134-328SRGLV...RTGP..FANFPTPW...........................................GPLRRNF........
Q53IP9_MEGCR/1705-1901....F...IGSKIEFEGENVHTKRDINRD....................................RLFQGSTK.......
Q2U7F6_ASPOR/78-307GGGCV...YEGP..FS..NYTINMGPIDG...........A.G..........QKAVNYRFEHHPHCLKRDI........
Q27Q57_SEPOF/2142-2337....F...NHGHLSFISPETMTTRDVSE.....................................HLFEQPAL.......
Q1QPI1_NITHX/200-472VGQLW...ANPTQVYDAVSAACGADYVEG....................................ENRKRLIDALLEANS
Q8T777_BRAFL/161-422DEHGN...LGTESIFAAWRTICEHQVPFYN..........A.TH........TNHTKPCDVTKPTGRLKRNPG.......
A6S0E1_BOTFB/124-317DGHCV...IDGP..FAGLTAMFY....................................DNDYYPHCLSRGF........
A2Q9V3_ASPNC/114-348GGGCV...TSGP..FK..NYTVNMGPAALS.........LP.GG........STASVSNPLNYNPRCLKRSL........
Q7S218_NEUCR/78-316.........SSLASLSTPNSNGTG..............................GGSGAPSGATLRCKFEDF........
A1CDX9_ASPCL/62-270...CV...TNGP..FV..SMQTHFSDGSG...........V.S..........YGRPANKFDYTPHCLRRRL........
PPO1_AGABI/47-299....KTSVANPLMRYTFNSVNDGG.............................FYGPYNQWDTTLRQPDS..T.......
Q4W5X1_STRGR/29-261GDRRV...MTGPFARRNGWKLNISVIPEG...........P.E.........DPALNGNYTHDDRDYLVRDF........
Q2HEC0_CHAGB/91-343.....QRIANPLFSYNFKPLDRTA..................F..........SSGPWNVWTRTLRSPSS..S.......
Q2JGG6_FRASC/46-284QGTPI...PGGAFFFDPADPTSFRVRIST.............................SSSGALQQVVERGVR.......
Q2UHJ4_ASPOR/41-346.GQTI...PNPLFSFKLKQKIEDLTVGKE........................QHYSKPEGYETVRYPLSGM........
Q5LTK9_SILPO/37-259ANPLSQVRRNGMHVLGPQPWFPGDISLSA...................................................
Q0CYP3_ASPTN/93-321GGGCV...EMGP..FK..NWTVNLGPVNPT.........LQ.VP.......GVAAQNGSGLEYNPRCLRRDI........
Q21NZ9_SACD2/207-494VGRDF...NSGVELFDAAKIEGEEYKNNAAII.....VKKLEDLNPLWYNARYPNMFFKTESGNPNVYIRDKET......
A7UWM5_NEUCR/100-339GGGCV...TTGP..IA..GMQTHLGPVGLPK........YG.EP.......GNLTVAANVLADNRRCLKRDL........
Q2GZJ4_CHAGB/104-327GGGCL...TSGP..FS..NYTVNLGPVGS............................RNPLAYNPRCFKRDL........
Q54QT0_DICDI/95-368LVNSV...FTSENGFYVREELHKASKAEN.................................SLGNTVVRYL........
A0ZXZ4_HYPJE/71-313.STKTVDYTNPLKTYYFPRMSLTG................S.Y..........GEFTGGGNDHTVRCAAS..........
A1CVG0_NEOFI/71-291GGGCV...LSGP..FK..NHTVNMGPFYD...........V.P.........SGVFPPNAFAYNPHCLRRDL........
TYRO_ASPOR/53-346........PNPLYSYTFSERIVDRLAKFP.............D..........ADYSKPQGYKTCRYPYSGL........
Q3UFK6_MOUSE/182-417FDSTL...ISPNSVFSQWRVVCESLEEYD.........................TLGTLCNSTEGGPIRRNPA.......
Q876W6_GIBZA/69-281FQRCV...VDGP..FANTNLTLAMGWPDM.............................NTPGDRLHCFTREFN.......
Q0U1I9_PHANO/177-359GGRCI...TNGQ..FA..NQAINVGPGQG.................................NSLHCLARN.........
Q7S4R1_NEUCR/95-301QGRCV...LDGP..FADLRPIIYNHTYVT....................................HCLSRGFNDP....K
Q2YBN6_NITMU/117-305..............LPANDPDTGTPPPSR...................................................
A6R210_AJECN/53-380.PGFPQVIDNPLYQYVLKPQGGKATFGDFGV.......GTL.KVG......PDEDVEYKDCVGLSRCPENKYYLTKEEAE
Q41388_SPIOL/183-401..............FDPNRNTNHLDKMMN...........L.S.........FVSDEEGSDVNEDDQYEENIL.......
Q39ND4_BURS3/46-332.GETI...PNPLASFAFNRAIADNINGDN........................PNYSKPLPYTTVRYPLSGL........
Q5VM57_9GAMM/34-262........LKLPSEFGTNTPNPDFPGLWM...................................................
Q1MVA1_MEGCR/1716-1912....F...LKANIEFEGEGVTTERDVDAE....................................HLFAKGNL.......
Q5ATE5_EMENI/58-339.....ETLQNPLYQFRMPDGKAME.....HHG......VGD.VQAM....GEDIIYSYGKCKATSRCPKD..EQN.....
Q2IY37_RHOP2/143-320...SD...ESGHVVFRPGHSLEHWVAKDT....................................PGIVRVP........
Q2H5H1_CHAGB/120-347GGGCV...KSGP..FV..GYTINIGPVQPA..........M.QG........YTPVFTDVKHLNPRCQRRDL........
Q5DB10_SCHJA/171-406ERGIH...ISTGSPFHNLTEYCYEPIRDM.........................LCSGCQRGGNRGTITRNF........
PPO2_AGABI/47-295....KISVKNPILRYHFHPIDPSF..................K..........PYGDFATWRTTVRNPDR..........
B0UQY1_METS4/67-305NVAMN...AGGYMPFSLINYIPALSTKEM...................................................
A1CIU9_ASPCL/95-322GGGCV...TGGP..FA..DWPTHLGPFQLV.........SL.DQ.......LYRPLSQDAFRYNPRCLQRSF........
Q2U5S1_ASPOR/110-305GGRCV...IDGP..FAGLQPILYNHTYVR....................................HCIARGFR.......
Q9U5P3_HALTU/454-650....F...YQANIEFEGENITTEREVIAD....................................KLFVKGGH.......
A3RUW3_RALSL/143-320TVGFS...PANPLQFWATDGVQ...........................................GVLRRQL........
Q0TZT9_PHANO/73-288GGGCV...MNGP..FAPPNFMLNL......................................PTPHCLVRDF........
A7SSF6_NEMVE/299-492KFKYV...IDGPFRKGKWPIPKRAIKEAG....................................IWLSRDF........
A6SR72_BOTFB/76-338..NKPVQINNPLYSYKFNPLNPLK................G.D.........FPSAPESRWPTTLRYPTS..G.......
Q2GQI5_CHAGB/102-339GGGCV...TTGP..FA..NMTVHIGPVALA.........QY.GT.......TDSVSSENPLGDNSRCLKRDL........
Q093B2_STIAD/65-326PTQLQQMAARGYTHFKLLWDGVIGVNPGTG..........S.V.........DPGDAAFAANARARYLTRDNPK......
Q70KX7_SUBDO/179-430NAVNV...SGSLVNPQDWNTICDLSYWNSN..........L.N.........CSDYWRPCNPADDLALARPV........
A1CVX2_NEOFI/64-292GGGCV...TAGP..FTFPAWPANMGPLNFH.........DL.DE.......LYRPLDPSAFRYNPRCLMRSF........
Q868D0_HALRO/174-442SDDKL...LSEGSVFSQWDIICTKLDQYT.........................LNGQQCAGEKEGPLLRNF........
Q6PLR1_WHEAT/160-367..............YDANRDQAHVTAVMDL..........N.KG........PGAENDLPLCTDDACVKENN........
A7UX66_NEUCR/102-340GGGCV...TSGP..FA..NMSVNLGPIALDV........PG.GG.......PQQSNPAGPFAYNPRCLRRDL........
Q5DHS0_SCHJA/178-415GSTRL...IDSKSPFYLWPEYCSPPTVGS........................NCYSCHAGWPNFKVLTRYY........
Q2HF52_CHAGB/72-288GGGCV...QDGP..FAGIPDMVHLGPMDS...............................VTYNPQCLKRDF........
Q0U6S4_PHANO/81-292DPEADCTVTTGAFASSSGDFQLAWPIRHR......................................LRRNL........
Q2UP46_ASPOR/57-381....QLSKPNPLYRFQMQTLMGTLERPYAITS......QKT.EEHG....WSFDLPFDKCQSTTKYGLLENYNADVWADG
Q56N25_9BRYO/92-311.........KSNPLYDPNRNRFALPPHLI...........D.L..........NSGGGCSGMPDDYLRTEN.........
Q92LD3_RHIME/65-275................................................................................
A6UM82_SINMW/70-311SAQLQQQNLRGYLDFDALWSDAMASFANQ.................................PNARFLTAQNPK......
A6R858_AJECN/138-381GGGCV...MFGP..FS..DMTTNLGPVGM.............P..........GGNLNNPLRYNPRCLMRDM........
Q7YT36_SEPOF/122-301GHGLV...TSGP..FAGWLTGY...........................................GPLHRNY........
Q0C7G8_ASPTN/47-357NDGKITLKHNPLFSYKLQQGFFDNLARLVEG........KD.EST......KRVDYSKYKEYETVRCPYSGL........
A6R3Q4_AJECN/72-315.....KSYPNPLYDFAIRPSAQEG..................F..........PNDPLFKYRRTVRNPDK..........
Q2H5C8_CHAGB/79-307GGGCV...QKGP..FK..DMVVHLGPVSPS.........VD.PA.......PPRNPRTDGYGDNPRCLRRDI........
Q93HK5_STRAW/28-238SDRQV...TTGPFAYRHGGWPIKEGITDA....................................EYLMRDL........
A1C4G0_ASPCL/62-293GGGCV...NTGP..FA..GMTLNLPDLDS...........A.P.........GDVFPENAFAYTPRCLTRNL........
PPOA_SOLLC/170-383..............YDERRGDQIHNGNGI...........D.L..........GYFGDQVETTQLQLMTNNL........
Q9XUS8_CAEEL/185-376YYGNV...VTGP..FAYWRTIEGR.........................................STILRNL........
Q5AUW8_EMENI/94-328GGGYI...YDGP..LV..DWELHLGPVLYSY.......DNG.QYI.....PPNPRPDG..LGYNPRPLIRDF........
Q2Y722_NITMU/28-226PGGRV...MTGPFAFSTGEWTLTVLDPGD..................................TDNFLTRAF........
Q5BGU9_EMENI/69-304GGGCV...LDGP..FK..DWPVRMGPFSAA.........QA.YP........YAPVPENAFAHNPRCLQRNL........
A2QYL5_ASPNC/41-332...DIGEVDNPLYSYKLSQGFFDNLGRSVSD.......EAG.AWT......KKVDYSKPRHYETVRCPYSGL........
A2QFP6_ASPNC/96-325GGGCV...RNGP..FA..NMTVNLGPVDPT.........LQ.IP.......GLVAQNGSGLDYNPRCLRRDI........
A6RHX7_BOTFB/78-326....TTYVNNPLFRYNFQNKPLNQ.....Q.........QF.PP.......GDSDGYMAQYNWTVRNPDY..........
Q33CJ6_CYNPY/88-316DSQGV...LTSSSYFANWKSICSGYYFEY........................KYCPVAEDGCKMEPLQRSP........
Q2H7D7_CHAGB/62-379AASLTVTIDNPMYKFTIPGTAPMGSYGINDI.......QAK.TET.....GRFRTTPFSKSRSSSRWADF..VPQ.....
A3NMB3_BURP6/46-332.GTPI...DNPLRSFVLPDALSDRRPGDG........................SIYEKPKGYLTVRYPLSGL........
A1BB10_PARDP/150-379..GTGERRPNPLRYAAAKDGQSKLCAKDS..............................QPGPDCRYVQRNPLF......
Q5AQP2_EMENI/67-282GGGCV...KTGP..FTPDKFQLHH......................................SGGGCLKRDF........
Q5BDR2_EMENI/99-327GGGCV...TSGP..FK..NFTVNLGPLWVT.........LN.VP.......GVEKQNGTGLDYNPRCLRRDI........
Q7SFK3_NEUCR/96-354.....QRIANPLFSYSFKPLNATA..................F..........LQDPWDIWTTTLRSPTT..S.......

PF00372

HCYA_APHCL/112-375-----------------VISPTGEYIPLDEE-------------------------------------------------
HCYD_APHCL/110-371-----------------VTDSHGKEIKLTEE-------------------------------------------------
HCYE_APHCL/109-369-----------------YIDNEGHQVKLDIV-------------------------------------------------
HCYA_PANIN/136-393-----------------ITDSDGHTIDIRQP-------------------------------------------------
SSP1_BOMMO/164-442-----------------IERRDGTVISLKKS-------------------------------------------------
BJSB1_TRINI/162-439-----------------IERRDGTIINLKKA-------------------------------------------------
HCY2_LIMPO/110-373-----------------VISEDGSHKTLDEL-------------------------------------------------
BJSB2_TRINI/158-440-----------------IEIN.GMRLELTKT-------------------------------------------------
ARYB_MANSE/161-440-----------------FKAF.DQKIDFHDF-------------------------------------------------
ARYA_MANSE/164-443-----------------FKAF.DKEINFHDV-------------------------------------------------
SSP2_BOMMO/161-440-----------------FEAF.GQKIDFHDP-------------------------------------------------
HCY6_ANDAU/109-370-----------------IVDKDNNKIPLDIE-------------------------------------------------
ARY1_CALVI/140-479-----------------YVTYEGKTIDLRKP-------------------------------------------------
HCYC_PANIN/142-399-----------------IDALDGSHIDIMNS-------------------------------------------------

PF00264

HCY2E_RAPVE/39-233..................TWSFKQYIYALEQ.................................................
Q4WFT7_ASPFU/96-324...................SEDAASWTTTEH........................VLDLIEKQ.................
A7DZQ9_9PEZI/52-325..................KGISHPEIVDRQLRIPTVN............PTAGSSFRDPIYKLLT...............
TYRO_ASPFU/59-373..PH..............IQDAGQDVTKSNLALNEHPWYRPNKAGFPPLQTLTYEVHRLLSFKF................
TYRO_NEUCR/57-320..................GASRDERIAPILANE...................LASLRNNVSLLL................
TYRO_PHONA/48-300.NA.TD..........NVAKLRNVLRASQEN........................ITSNTYSML................
Q0UEG5_PHANO/69-233..................AGRNSTCWTKDSD........................IVSLIQSN.................
Q0U7P7_PHANO/109-364..................TRSNNNEMNGRFDSM...................RVSLRDRVFALF................
Q0UNZ8_PHANO/95-336.AN.AT..........SRNDEINVRLSKQQP.......................NLRDMVYKLL................
Q0U440_PHANO/111-339..................TNFASTKWFTTEN........................LYNVTLGPA................
Q0UXF5_PHANO/87-320...................SKDAAYGSRDEE........................IMALITGN.................
A1IHF0_PINFU/135-332..G.D............RFPGPPPSLTRPGI........................VDLIATDPSITSH............
Q9GP18_HALTU/1711-1908..D.G...........YHNWFFETVLFALEQ.................................................
Q9BJ58_ENTDO/1727-1922..G.K............QTWLFDNIALALEQ.................................................
Q1QJ90_NITHX/70-260..................TWPATKPMPANIVG.....................PSVLKTI....................
O49960_SACHY/160-403..................CTVYNQQVRKGPE..........................SFLGEKFCT..............
Q2KHE3_MAGO7/117-305...................NETKTALTGKAY........................CDLGNSY..................
Q96TI3_LENED/54-303..D.A............NASDNVPELKATLRSA...................GPQLKTKTYNLL................
Q6SS53_BACTU/28-187....................GANPFLPTRTQ........................VKEAIDTTPYDT.............
Q2HCB5_CHAGB/546-729......................TDFFSSQCG........................TSYVAAA..................
A7E8E8_SCLS1/81-336..T.A............AATSQNDQVESQLEAN...................LRNFRTQIMTLF................
Q2YAJ8_NITMU/75-337.LD.GK..........TTKAVSLQTLLDALAPRDFLTF.........ASPKTLGH.........................
A7RQY2_NEMVE/97-287..................NDCYKERLPNSHE........................VRDLLCMPR................
Q2TWH3_ASPOR/65-256..................DNENAIANANSTA........................LNNCNAY..................
A6RKM8_BOTFB/87-285...................DLTQVQYCTSEK........................VAECTQY..................
Q7NXK8_CHRVO/71-272.................NAGKNVTEGRSKLT.................................................
A2QTR2_ASPNC/82-308..................TTDWLAALNTQDK........................VDDMLAA..................
A2QUC2_ASPNC/107-337..................NPSVSRMSNSFRN........................TTKLILSY.................
A6RE01_AJECN/73-357QNP.ESE.......TWKNGVVNNNQVGIALKSPGWMG............DGKYGAASEMVYRLL................
A6SQE9_BOTFB/103-376..D.A............SATSQNNLVARQLDNS...................AASFRNRLYNLF................
Q5AXC0_EMENI/55-404GQNWLRANYA.LNEHSNFEKLGENPVPTLQD........................LVHRLFQYG................
Q8Y2J8_RALSO/71-266..................PYALTDAIVGQKE........................VMDKI....................
Q82V60_NITEU/28-223..................GQNGLPTLPTQAA........................INQVMAVTPYDTS............
A6SST5_BOTFB/67-300...................NVHSAAVTKTNY........................TYDLITKPS................
Q5AYZ4_EMENI/638-868..................NSHMAQLFTSQRD........................VDRLLNS..................
A3K3J4_9RHOB/68-259....................NDGTAVMNGLS.................................................
Q0UUJ6_PHANO/114-348..................TDYSNKNFANASS........................IASLILGT.................
Q564J1_APLCA/1731-1925..G.F............DTWLFNQALLALEQ.................................................
Q2H2F5_CHAGB/109-341..................GGAMNMRYANYST........................VLQLLTR..................
A3JWQ9_9RHOB/119-304..................NTHIDDALAAHWW.................................................
A5X3N8_ORYRU/161-370...................NIRYRQMISGAR.......................KAELFMGQPYRA..............
Q19VI0_SALSA/174-408..G.N............HDPNRVRRLPTSAD........................VEFVVGIETYETG............
A1IHF1_PINFU/134-334...................GENNSSLTRPGI........................VDLILTDPRINRHRWIV........
Q2TL94_9APHY/53-300..G.S............DAKDNVKDLTTTLKAD...................QPDITTKTYNLL................
Q287T6_PINFU/134-328...................GGEGGSLMRPHV........................VDMIASDPRIRSHG...........
Q53IP9_MEGCR/1705-1901..T.H............HNWFIEQALLALEQ.................................................
Q2U7F6_ASPOR/78-307..................NPTVTRASVTFRH........................ITELILSY.................
Q27Q57_SEPOF/2142-2337..G.K............QTWLFNNILLALEQ.................................................
Q1QPI1_NITHX/200-472LWYPLRYSGQ..FGKGTINTAIHYHYPAQED........................IDEILSLRT................
Q8T777_BRAFL/161-422.HQ.DP..........NRFGPSMTRLPLATE........................VDFALRFPVFDTP............
A6S0E1_BOTFB/124-317.................KSGAEMKDLGNLVRP.....................GVVEDIMRE..................
A2Q9V3_ASPNC/114-348..................TTALLQRYNTYPQ........................ITSLILDN.................
Q7S218_NEUCR/78-316..................AEDNKTVIKRWSEPWVAEEG..........MKEVGGQLRDSVYDLFV...............
A1CDX9_ASPCL/62-270..................NSTMTSVYSNADA........................VAQLLAS..................
PPO1_AGABI/47-299..G.V............NAKDNVNRLKSVLKNA...................QASLTRATYDMF................
Q4W5X1_STRGR/29-261...................GTLTPDLPTPQE........................LEQTLDLTVYDCPPW..........
Q2HEC0_CHAGB/91-343..G.A............DAQSNNSLVAMNLDQN...................RPSIAQRLYALF................
Q2JGG6_FRASC/46-284.RR.F...........GSATFGSSILPSNADI.....................TAAFDTVADPTLASYD...........
Q2UHJ4_ASPOR/41-346.................VGTQEDEENTKIHNARFSDAE.........SERLLNVNVTNWL....ITGPRHIPTRQGAKPP
Q5LTK9_SILPO/37-259.....................QTRSLPFTAA.................................................
Q0CYP3_ASPTN/93-321...................SADAARWTATPY........................VLDLIVNK.................
Q21NZ9_SACD2/207-494NKP.IPV........DNGLRGFHHHFPTKQD........................VDNLLALEY................
A7UWM5_NEUCR/100-339..................SEELGRKFATLRN........................TTELILQT.................
Q2GZJ4_CHAGB/104-327..................NTDICNRWATLRN........................TTEPILNG.................
Q54QT0_DICDI/95-368....................GPFDFLATPQS.......................EFKEFMCSNTFSPSAVIMD.......
A0ZXZ4_HYPJE/71-313..................KQSYPATANSNLAA.....................RPYKSWIYDVL................
A1CVG0_NEOFI/71-291..................NTRVSAYCNSPDV........................TAALLAA..................
TYRO_ASPOR/53-346..................CGQDDIAIAQQHNNFLDANFNQ.....EQITGLLNSNVTSWLNLGQFTDIEGKQVKA.....
Q3UFK6_MOUSE/182-417..G.N............VGRPAVQRLPEPQD........................VTQCLEVRVFDTP............
Q876W6_GIBZA/69-281..G.G...........LGRDENGDQILGDMQ........................IDAYNSKVMNTI.............
Q0U1I9_PHANO/177-359..................NDDSKTANCNQQM........................VDGCNNQ..................
Q7S4R1_NEUCR/95-301RNA.TTT.......ATGTGGEIPGDHYKPEA........................IGEILRV..................
Q2YBN6_NITMU/117-305..................KNASPPQKANATD........................VDIIVNQFSIQNT............
A6R210_AJECN/53-380KEGVVWSADF..PGKWREGEILSYEVYKNFTDSMPWFIPGI....KPEISKKEHDAAENVWRLF................
Q41388_SPIOL/183-401..L.M............RKAMVYPSVSDDPN.......................KAELFLGSPYRAG.............
Q39ND4_BURS3/46-332.................VGTDKDKAATEKHNAKFPNAKE........NVVILNRNIVDWLTSYIVVKGDVVPTN......
Q5VM57_9GAMM/34-262..................KERAQYQLSSQADAS....................CSVAMKLQNFTA...............
Q1MVA1_MEGCR/1716-1912..V.Y............NNWFCNQALYALEQ.................................................
Q5ATE5_EMENI/58-339KPD.SEA........WIKGVVNNDEVIKYMTMHSSVD............GKDYGAAAELVYRLL................
Q2IY37_RHOP2/143-320.................RFASDAPALVISED..........................DTIRLGGA...............
Q2H5H1_CHAGB/120-347..................TTAASTSTFTAAN........................LLNLTTGPA................
Q5DB10_SCHJA/171-406.....................YRSDLPDIDD........................LEFVLSIEKFYVP............
PPO2_AGABI/47-295.................NRREDIPGLIKKMRLE...................EGQIREKTYNML................
B0UQY1_METS4/67-305..F.P............SDTNAIPMGPSQPG.................................................
A1CIU9_ASPCL/95-322..................NQVLLRRYTNGSV........................VQDMLRS..................
Q2U5S1_ASPOR/110-305..D.G...........DQAGRISGEYYRPES........................IGGILRK..................
Q9U5P3_HALTU/454-650..V.F............DNWFFKQAILALEQ.................................................
A3RUW3_RALSL/143-320.................GVSPGDQANPNIRT........................ETQTLALG.................
Q0TZT9_PHANO/73-288..................MPWIINRLAAPKL........................VEEALAQ..................
A7SSF6_NEMVE/299-492..................NPCNSMYLPKASH........................VYGKMLHYP................
A6SR72_BOTFB/76-338..S.A............TAKSQEQQVFDAMESQ...................FDSYQSNVYLIMR...............
Q2GQI5_CHAGB/102-339..................NAGVASRYTSFLN........................TTTLILEN.................
Q093B2_STIAD/65-326.LD.PK..........TAHEVSWDVVGPGLLPVQFYNND........VTLSFTSSKTPSHVTMP................
Q70KX7_SUBDO/179-430.................QRGGGSSYLPNTVE........................VMISLAAPSYDASNL..........
A1CVX2_NEOFI/64-292..................NARPLHRFAGADA........................VQQILAA..................
Q868D0_HALRO/174-442..G.N............YDPQRSSDIPTREE........................VEQSLRFSTYDTF............
Q6PLR1_WHEAT/160-367..................LSVIYRQMAVDTA.........................LQFHGNKFC...............
A7UX66_NEUCR/102-340..................SDAVNQRFANASS........................VRHVLSQ..................
Q5DHS0_SCHJA/178-415.....................EATAFPTTDN........................LLFVLRKETFYLPQ...........
Q2HF52_CHAGB/72-288..................SPYFAGRYLAMNQ........................TQLTLAA..................
Q0U6S4_PHANO/81-292..T.L............ITGWYPHELPQNRTLG...................LESVRDLIEKTT................
Q2UP46_ASPOR/57-381GQNWLRANLALNEHPWYQNLDGWASVPTLQD........................MTFRLLTTG................
Q56N25_9BRYO/92-311..................NRLMYNQMVSGPT.......................TPSLFFGSTYRF..............
Q92LD3_RHIME/65-275..D.P............ALPIGAADASSSLS.................................................
A6UM82_SINMW/70-311.LN.PA..........TQTAVDIDTIKASLAPTTFANDAGA....PGLAFNSPVSSSHQ.....................
A6R858_AJECN/138-381..................NPFIGQHYTSFNW........................STWTIEES.................
Q7YT36_SEPOF/122-301....................AVFTHLLTREN........................VRTVFTQKS................
Q0C7G8_ASPTN/47-357..................VGPSDRDKTEQHNEREKSDN.........PIGKLNRNISDWLAKESNTHVPGMSA.......
A6R3Q4_AJECN/72-315.................QGVSQIDAIQKTLNAN...................GALIRVNTYQLI................
Q2H5C8_CHAGB/79-307..................SNQLSSKYARTQD........................IVSLITSS.................
Q93HK5_STRAW/28-238.................GRSRDPIALPTARD........................LQGALDDPVYDTA............
A1C4G0_ASPCL/62-293..................NSFIAQSFTSQTD........................IDRLLSS..................
PPOA_SOLLC/170-383...................TLMYRQLVTNSP.......................CPLMSLVDLTL...............
Q9XUS8_CAEEL/185-376....................GAEGQLFNENQ........................VNTIVAQNT................
Q5AUW8_EMENI/94-328..................NNTLLQQGASWDI........................ILNMLVNV.................
Q2Y722_NITMU/28-226....................GAMGALPTQQG........................VNAAINIVPYDSAP...........
Q5BGU9_EMENI/69-304..................DVARIQYYNNPSV........................LESLLAA..................
A2QYL5_ASPNC/41-332..................VGPNDKAATTMHNAAIDEAA.........ASNALNASVRAWLRNPAENGVPGMRQ.......
A2QFP6_ASPNC/96-325..................SPWTALGWTKSSD........................VMSLIEKC.................
A6RHX7_BOTFB/78-326..S.G............DGQSDFNAANMNLEN.....................AGLGDQVWTAI................
Q33CJ6_CYNPY/88-316.................GADPGIPRLPTVKD........................VEDTIQWGSYDTP............
Q2H7D7_CHAGB/62-379QGE.INS.......NWVDGTVNNALVAEALQTAPWYN...........SDADGVPLADMVYRLYQ...............
A3NMB3_BURP6/46-332.................VGTPEALEQTKLHNAKFPLPEK........NTELLNGNVRAWLRGDSPTPDDPDPTRN.....
A1BB10_PARDP/150-379.YT.TG..........DDHRAERQALFAMTEIF...................QQQVVDALQFDSFSVPQG..........
Q5AQP2_EMENI/67-282..................IPWIMNSFAAQSL........................VDWVQSQ..................
Q5BDR2_EMENI/99-327...................NPDAARWTTVEE........................VVDLINNY.................
Q7SFK3_NEUCR/96-354..D.N............KAQSNNSLVAVNFDQN...................LDSIGQRLYILF................

PF00372

HCYA_APHCL/112-375----------------HGADILGALI---ES-----------------....SYESKNRGY.YGSLHNWGHV-MMAYIHD
HCYD_APHCL/110-371----------------NGLNILGALI---ES-----------------....SHDSVNKPF.YGTLHNWGHV-MIARIHD
HCYE_APHCL/109-369----------------DGINVLGALI---ES-----------------....SFETKNKLY.YGSLHNWGHV-MMARLQD
HCYA_PANIN/136-393----------------KGIELLGDII---ES-----------------....SKYSSNVQY.YGSLHNTAHV-MLGRQGD
SSP1_BOMMO/164-442----------------EDIENLARLV---LG-----------------GLEIVGDDAKVIH....LTNLMKK-MLSYGQY
BJSB1_TRINI/162-439----------------EDVEHLARLL---LG-----------------GMGLVGDDAKFMH....MMHLMKR-LLSYNVY
HCY2_LIMPO/110-373----------------HGTDILGALV---ES-----------------....SYESVNHEY.YGNLHNWGHV-TMARIHD
BJSB2_TRINI/158-440----------------DDIETLGKLI---FG-----------------KIDKVDLDKTLVDSYRYLLIVMKA-ALGLNTF
ARYB_MANSE/161-440----------------KAINFVGNYW---QD-----------------NADLYGEEVTKDY.QRSYEIIARQ-VLGAAPK
ARYA_MANSE/164-443----------------KAVNFVGNYW---QA-----------------NADLYNEEVTKLY.QRSYEINARH-VLGAAPK
SSP2_BOMMO/161-440----------------KAINFVGNYW---QD-----------------NADLYGEEVTKDY.QRSYEVFARR-VLGAAPM
HCY6_ANDAU/109-370----------------HGTDILGDII---ES-----------------....SDESKNVEY.YGSLHNWGHV-MMANITD
ARY1_CALVI/140-479----------------ESIEYIGSIM---QG-----------------.....NVDTFDNYFFKYRYMFAHM-YFGDVN.
HCYC_PANIN/142-399----------------HGIEFLGDII---ES-----------------....SGYSANPGF.YGSLHNTAHI-MLGRQGD

PF00264

HCY2E_RAPVE/39-233................EDYCDFEVQF...EI..................................AHNAIHA.WVG....
Q4WFT7_ASPFU/96-324................NNILDFQNRM...QG..........................DFPNGFLGVHSGGHY.TIG....
A7DZQ9_9PEZI/52-325..............LVGSYGAFGNTG...WQTG.........RP............GPNNISLEHYHNIIHT.FTGTNYI
TYRO_ASPFU/59-373................SSWGAFASTK...WCNEENK..PPASQQ............TRDILSLEYIHNNVHN.WVGGTDY
TYRO_NEUCR/57-320................LSYKDFDAFS...YNRW........DP.N.........TNPGDFGSLEDVHNEIHD.RTGG...
TYRO_PHONA/48-300................TRVHTWKAFS...NHTV.........G.D..........GGSTSNSLEAIHDGIHV.DVGG...
Q0UEG5_PHANO/69-233................PDFLSFSTRM...QG..........................DFPNGFLGVHTGGHF.TVG....
Q0U7P7_PHANO/109-364................ASKQSWGYAS...TSQIG.......VR.TD........LSGSGTDSFESVHDAVHN.AAGG...
Q0UNZ8_PHANO/95-336................TTYQPFNEVS...NKA.......................NGGTIGNFETLHDGVHN.VFG....
Q0U440_PHANO/111-339...............SKNIATFQNEL...QG..........................RFDQGFLGMHIAGHL.AIG....
Q0UXF5_PHANO/87-320................NNILDFQNRM...QG..........................DFANKYIGVHTAGHY.TIG....
A1IHF0_PINFU/135-332............TQIVRGGTGFTDPD...TG...........................RVHTWEQEHDNTHV.WVG....
Q9GP18_HALTU/1711-1908................EDYCDFEIQF...EI..................................AHNGIHT.WIG....
Q9BJ58_ENTDO/1727-1922................TDYCDFEIQL...EI..................................VHNAIHS.WIG....
Q1QJ90_NITHX/70-260................LNASPYEIFG...TSRPAGQ...NSLD.PHWI....TGGGGVQGTLEASPHNQVHN.NIG....
O49960_SACHY/160-403..............AIDGTSGMGSLE...RM..................................AHTAMHV.WVGKAG.
Q2KHE3_MAGO7/117-305................SDFWKMAVTQ..EEG..................................MHANGHE.GVG....
Q96TI3_LENED/54-303................TRVHTWPAFS...NHTP.........D.D..........GGSTSNSLEGIHDSVHV.DVGG...
Q6SS53_BACTU/28-187............APWRQVTSGFRSAL...EE..................................LHNGPHN.WVG....
Q2HCB5_CHAGB/546-729................LNHTTYETAL...DG..............................IYSGPHLLGHM.ALA....
A7E8E8_SCLS1/81-336................ANWQPYNHFS...NKG..........S............GSSGFGNIESIHDTVHT.LTGG...
Q2YAJ8_NITMU/75-337................SALTGFGVLE...GQ..................................PHNRVHN.CVGGIFT
A7RQY2_NEMVE/97-287................EKFVKFEDTV...RD.................................VMHNDFHN.AIG....
Q2TWH3_ASPOR/65-256................NTFSPWWDCI...SN.................................IPHKGIHT.YIG....
A6RKM8_BOTFB/87-285................NDYYNFFNCMVIYPT.................................SPHVAGHA.AVG....
Q7NXK8_CHRVO/71-272................LDCMKSNLYS...GSA..........G.D..........AGFCANTDMNPHGALHV.DVGN...
A2QTR2_ASPNC/82-308................TDIEGFLELM...SP...........................SANGYAGAHEGGHA.SVG....
A2QUC2_ASPNC/107-337................DTIDWFQGVM...QADQ.........R.F..........TDPTAPFSYGVHGGGHL.TVG....
A6RE01_AJECN/73-357................THPLDYPSFA...TTFR........AK.GQ........DDISKDINLEYIHNNVHG.WVGG...
A6SQE9_BOTFB/103-376................TNYHDYSTFS...NEAW........IT.A.........SSPGDFDSIESLHDQIHG.LTGS...
Q5AXC0_EMENI/55-404...............LDSWGAFSSVRYTKDSTKAES..ASTGI.ETYSE..ELDGNVKNALSLDFIHNNVHN.FVGGSQF
Q8Y2J8_RALSO/71-266................YAETNFEVFG...TSRSVDRSVRPPLVQNSLDPKWVPMGGGNQGILERTPHNTVHN.NIG....
Q82V60_NITEU/28-223............PWNMNSNPSFRNQL...EG.............................WIGPNLHNRGHV.WVG....
A6SST5_BOTFB/67-300...............NADIYWFQTVM...QG..........................LFSIGEWGVHTGGHY.TVG....
Q5AYZ4_EMENI/638-868................HSITELQINI...DFS..........D.W..........PELRKAGIMGPHAVAHM.QLG....
A3K3J4_9RHOB/68-259................TAFMSRTAYL...GQI........................GFNRTLDNNPHGAVHV.MVGT...
Q0UUJ6_PHANO/114-348................KDITNFQNTM...QG..........................LPGSGSIGVHGGGHY.SMG....
Q564J1_APLCA/1731-1925................EDYCDFEIQF...EI..................................THNAVHS.WLG....
Q2H2F5_CHAGB/109-341................PDVDQFRIVS...EG..........................VPYTIEIGPHGGIHY.TIG....
A3JWQ9_9RHOB/119-304................EDFNGWSNGQGTHTG...............................IIRAHDGGHD.SIG....
A5X3N8_ORYRU/161-370..............GDQPEPGAGTVE...SV..................................PHNPVHR.WTGDP..
Q19VI0_SALSA/174-408............AMDRQANMSFRNSL...EGFA.........S.P.........ETGMAITGQSTMHNALHV.FMN....
A1IHF1_PINFU/134-334........NEGSRFNQSPRFGFIDPD...SG...........................MRHSWEREHDNTHV.WVG....
Q2TL94_9APHY/53-300................TRVHTWPAFS...NHTP.........G.D..........GGSSSNSLEAIHDHIHD.SVGG...
Q287T6_PINFU/134-328...........QIVDGQGATGFIDSM...TG...........................QRTSLEAEHNNAHV.AVG....
Q53IP9_MEGCR/1705-1901................TNYCDFEVQF...EI..................................MHNGVHT.WVG....
Q2U7F6_ASPOR/78-307................DTIEWFQGVM...QKD..........P............RFSVPSVPYGVHRGGHV.GVG....
Q27Q57_SEPOF/2142-2337................TDYCDFEVQF...EI..................................VHNAIHS.WLG....
Q1QPI1_NITHX/200-472...............FRDFGGGSLYV...DS...........................FGFLDQNPHNTMHI.WTGGMNP
Q8T777_BRAFL/161-422............PYSRTSNCNFRNLL...EGFADTS...TGKY.RGDR....THEDGTLVPGAHTLHNHVHL.YLN....
A6S0E1_BOTFB/124-317................GNFEAFAQRI...EH.................................NAHRFVSG.SIR....
A2Q9V3_ASPNC/114-348................DDVWDFEMTM...QG..........................VPGSGSIGVHGSGHY.SMG....
Q7S218_NEUCR/78-316...............RPDPRGWGAGG....................................FEDPHNTVHN.NAGC...
A1CDX9_ASPCL/62-270................PDIIAYQERN...DYY..........M............DPVKREETLGLHPAGHR.AVG....
PPO1_AGABI/47-299................NRVTTWPHFS...SHTP.........A.S..........GGSTSNSIEAIHDNIHV.LVGG...
Q4W5X1_STRGR/29-261.........NHTSGGTPPYESFRNHL...EGY..........T............KFAWEPRLGKLHGAAHV.WTG....
Q2HEC0_CHAGB/91-343................SSNDNYTTFS...NNA.......................AGGSAESVESLHDTIHS.LVGGFG.
Q2JGG6_FRASC/46-284...........EAPFNVSSRGFRNRL...EG.............................FIGTGLHNQVHR.WVG....
Q2UHJ4_ASPOR/41-346SDTTSILARYLKCLDTDTYTIFSNTT...SQTKLM.....EKL.CRE......RNEGHWLMSLESPHNGIHL.AIGGFFQ
Q5LTK9_SILPO/37-259................PGTEGYGGAI...SGFA.........Q.Q..........GSLTGAVEGDPHNRVHV.MVGGV..
Q0CYP3_ASPTN/93-321................TTITTFQGDL...QG..........................DFPKGLFGVHAGGHF.TIG....
Q21NZ9_SACD2/207-494...............WRDFAGGPAYN...QA...........................FGLVDMEPHNTIHI.WVGGFNP
A7UWM5_NEUCR/100-339................KNIFEFQTTL...EGD........................PRYHPGNLGIHTAGHF.MIG....
Q2GZJ4_CHAGB/104-327................KDIAVFQALV...QGD..........G.R..........WPEAARLGIAVHGGGHY.AIS....
Q54QT0_DICDI/95-368......PSTKRVKPADDTNRGFRIGV...EA...............................GLKAHNPTHD.WYGYGSG
A0ZXZ4_HYPJE/71-313................TNSQNFADFA...ST.........................SGPGINVEQIHNAIH..WDGA...
A1CVG0_NEOFI/71-291................PNITEFQTIV...DK.........................GLMGVHLNGPHGCAHA.SVG....
TYRO_ASPOR/53-346....DTRWKIRQCLLTEEYTVFSNTT...SAQRWNDE.QFHPL.ESGGK.ETEAKATSLAVPLESPHNDMHL.AIGGVQI
Q3UFK6_MOUSE/182-417............PFYSNSIDSFRNTV...EGYS.........A.P..........TGKYDPAVRSLHNLAHL.FLN....
Q876W6_GIBZA/69-281.............YGFDNYADMSGML...EG.................................LPHAQIHS.IIF....
Q0U1I9_PHANO/177-359................NDYASMASCS...EG.................................SVHAWGHN.GVG....
Q7S4R1_NEUCR/95-301................KGYEEFGKQV...EE.................................KLHNGLHQ.SVG....
Q2YBN6_NITMU/117-305...........GLNNENDYTKFTYGL...EGW.......................GRRPDGTSLPGHNHGHA.WVG....
A6R210_AJECN/53-380................NYSLTYPDFA...TNGDL......PKD.DDD......VKRGHWYQSLESIHNNVHL.FVGG...
Q41388_SPIOL/183-401............DKMEGDVSGAGILE...RM..................................PHNSVHV.WTRS...
Q39ND4_BURS3/46-332.....VKSKFEQCLNAPNYTVFSNTS...SAAQW.......NE.NL.......PADAIPVVPLESPHNDIHL.AVGGFDV
Q5VM57_9GAMM/34-262...............SSPATSFGGVQ...TGFS.........H.D..........SGTFGAVENNPHNLVHV.DIG....
Q1MVA1_MEGCR/1716-1912................ENYCDFEIQF...EI..................................LHNGIHS.WVG....
Q5ATE5_EMENI/58-339................TYPLEYEQFS...TTAI........FT.SE........PKVSADVNIEFIHNNIHW.WAGG...
Q2IY37_RHOP2/143-320...............TADFALFRQME...GG..................................PHGQAHN.SFA....
Q2H5H1_CHAGB/120-347...............SATVGHFQDEL...QG............................PYGTLRIHGAGHY.AMG....
Q5DB10_SCHJA/171-406...........GERNSKKCKSFHMAL...EGF..........C.G..........RPGAYPNMRWFHNKVHV.LID....
PPO2_AGABI/47-295................KFNDAWERFS...NHG..........I.S..........DDQHANSLESVHDDIHV.MVGY...
B0UQY1_METS4/67-305................YAALGMTGRL...EN.................................APHDMVHL.GVG....
A1CIU9_ASPCL/95-322................RTISELLRVL...DP...........................SVAGQVGAHPAGHI.ALG....
Q2U5S1_ASPOR/110-305................QSYVELVREV...EI.................................YLHNPLHQ.GVN....
Q9U5P3_HALTU/454-650................ENYCDFEIQF...EI..................................LHNGVHT.WVG....
A3RUW3_RALSL/143-320................SAYQNFRTMQ...GN..................................PHGSAHVNYFG....
Q0TZT9_PHANO/73-288................PDYFSFAKTV...EN..........................WPKPRLSSIHSSGHY.GVG....
A7SSF6_NEMVE/299-492...............FKNFFKFEDEV...RA..................................IHDEFHN.AVG....
A6SR72_BOTFB/76-338...............DPNYKQFDAFS...NHQW........AS.N.........NAPGTYGSIEDVHNSVHS.ETGG...
Q2GQI5_CHAGB/102-339................PGIERFQGVM...QGD........................PRYVRGELGVHGGGHF.TIG....
Q093B2_STIAD/65-326................GSATQFSVLE...GH..................................PHNKVHN.YIGGVG.
Q70KX7_SUBDO/179-430.........NGDFIRDGPRTSFRSRL...EGWNK......ICS.AV.......NCVGGMDVDQQHMHNNVHV.WVG....
A1CVX2_NEOFI/64-292................QTIQEFLAVL...DP...........................STAGRLGAHAAVHV.ALG....
Q868D0_HALRO/174-442............PYDNSSNQSFRNIL...EGFA.........D.S.........ENGTAPNHISTLHNAIHL.YMN....
Q6PLR1_WHEAT/160-367..............AGGTPGSPGSLE...NA..................................AHTAVHI.WVG....
A7UX66_NEUCR/102-340................ETVANFQMIM...QG..........................IPGSGDIGVHGGGHY.SLG....
Q5DHS0_SCHJA/178-415...........TTEDLGKCRGFHQAL...EGF..........R.S..........IPGSNTSYSFMHNKVHN.MVS....
Q2HF52_CHAGB/72-288................PDFGAFDKVV...EG..........................GPSFEASGVHGGGHY.GVG....
Q0U6S4_PHANO/81-292................GDFYKFQYAM...TQ..................................MHNHVHD.FVG....
Q2UP46_ASPOR/57-381...............GLNWGEFSSTRYDDKKEEA......QPK.NN.......EQAPKNWMNLEAIHNNVHN.WVGGFMF
Q56N25_9BRYO/92-311..............GWSGGMGGGTLE...GA..................................PHGTVHI.FTGNP..
Q92LD3_RHIME/65-275................QEQFGFFDVT.....A.......................LGFSLDLESNLHGTIHV.FTGT...
A6UM82_SINMW/70-311................VAPVGFSILE...GQ..................................PHNRVHM.SVGGQ..
A6R858_AJECN/138-381................RDIDEFQSRL...AGAP........GN.E.........DRKDFPLNFFGVHGGGHT.FLG....
Q7YT36_SEPOF/122-301...............LAQISQLTANE...QR.............................YIFELYHNNIHD.WIG....
Q0C7G8_ASPTN/47-357.......LYLEAAEKAPNYTVFSNTT...SAAKWN....DDNY.GRQ.....EKWNPLFAVSLEKPHNGVHL.AVGGYSM
A6R3Q4_AJECN/72-315................AGEANYTVFS...TDSL.........P.D..........RGASYNNLENIHGLIHV.SVGG...
Q2H5C8_CHAGB/79-307................ADIGTFQTVM...QGT..........G............GFGIGGGGMGVHGAGHF.TIA....
Q93HK5_STRAW/28-238............PWNSTSAKGFRNRL...EGW.......................GPGRGAASWRNHNRVHR.WVG....
A1C4G0_ASPCL/62-293................PNIKSLQHTM...DVS..........V.W..........PELSEAEIMGPHAAAHM.QLG....
PPOA_SOLLC/170-383..............FGSTVEDAGTVE...NI..................................PHSPVHI.WVGTRRG
Q9XUS8_CAEEL/185-376...............IENTLAYTAPQ...PGC..........P............YPNNYGAIEYSHSNIHL.WIG....
Q5AUW8_EMENI/94-328................TDMHEFHPLF..FQG..................................PHLAGHI.FIS....
Q2Y722_NITMU/28-226...........WNRNSSMNTSFRNHL...EG.................................IIHNPGHM.WVG....
Q5BGU9_EMENI/69-304................PSIAVFQDIL...DRT.......................IPGTWQQAIGAHGGGHI.SVG....
A2QYL5_ASPNC/41-332.......LYINAAWKAPNYTVFSNTT...SAAKWN....DDLF.ARE.....ADWNDDFVVSVERPHNGVHL.AVGGYFM
A2QFP6_ASPNC/96-325................DNISCFEWTM...QG..........................FFEEGFLGVHTAGHF.TIG....
A6RHX7_BOTFB/78-326................MKSSNFNSFA...TM.........................AVSGASIESPHGAVHV.LVGG...
Q33CJ6_CYNPY/88-316............PYDTRANKSFRNVL...EGF..........K.S..........PSDGVTGKLSMDSLVRS.FMG....
Q2H7D7_CHAGB/62-379...............PEYIKSFAQFA...TTRLAG.....VKK.DNS......LSDPASYLNLEFIHNNIHN.WTGGF..
A3NMB3_BURP6/46-332....GVYAKYVRCLSAPNYTVFSNTT...SASV........WS.S.........SNPGLVTAVESPHNDIHL.AVGGFDY
A1BB10_PARDP/150-379..........SPGFPWANIPAFDPPQ...PDDL........YP.Y.........RDQNFDGAYEQPHDNYHG.WIG....
Q5AQP2_EMENI/67-282................PDYTSFARAL...EN..........................IPDFSEPNIHGSGHF.GAG....
Q5BDR2_EMENI/99-327................RDISSFQDRL...QG..........................DFVNGYIGVHTGGHY.TIG....
Q7SFK3_NEUCR/96-354................SNYGNYSTFS...NNAW........IP.Y.........INNGSFDSLEAIHDTVHN.LAGGGG.

PF00372

HCYA_APHCL/112-375PDGRFRE--------------------------------------------TPGVMTDTATSLRDPIFYRYHRFIDNVFQ
HCYD_APHCL/110-371ADGRYRT--------------------------------------------NPGVMDDTSTSLRDPIFYRYHRWMDNIFQ
HCYE_APHCL/109-369PDHRFNE--------------------------------------------NPGVMSDTSTSLRDPIFYRYHRFIDNIFQ
HCYA_PANIN/136-393PHGKFNL--------------------------------------------PPGVMEHFETATRDPSFFRLHKYMDNIFK
SSP1_BOMMO/164-442NMDKYTY--------------------------------------------VPTSLDMYTTCLRDPVFWMIMKRVCNIFT
BJSB1_TRINI/162-439NFDKYTY--------------------------------------------VPTALDLYSTCLRDPVFWRLMKRVTDTFF
HCY2_LIMPO/110-373PDGRFHE--------------------------------------------EPGVMSDTSTSLRDPIFYNWHRFIDNIFH
BJSB2_TRINI/158-440HSDKYFV--------------------------------------------VPSILDQYQTALRDPVFYMLQKRIIDLVH
ARYB_MANSE/161-440PFDKYTF--------------------------------------------MPSALDFYQTSLRDPMFYQLYNRILKYIY
ARYA_MANSE/164-443PFNKYSF--------------------------------------------IPSALDFYQTSLRDPVFYQLYDRIINYIN
SSP2_BOMMO/161-440PFDKYTF--------------------------------------------MPSAMDFYQTSLRDPAFYQLYNRIVEYIV
HCY6_ANDAU/109-370PDHRFQE--------------------------------------------NPGVMSDTSTSLRDPIFYRWHRFIDNIFQ
ARY1_CALVI/140-479.THDFEV--------------------------------------------FPHIFLNYETMMRDPMFYMFYKKIASVYF
HCYC_PANIN/142-399PTGKFDL--------------------------------------------PPGVLEHFETSTRDPSFFRLHKYMDNIFR

PF00264

HCY2E_RAPVE/39-233..................................GTEE...........YSM....GHLHYASYDPVFILHHSNTDRLFA
Q4WFT7_ASPFU/96-324..................................GD...............P...GGDFFVSPGDPAFYLHHAAIDRVFW
A7DZQ9_9PEZI/52-325E......ENSKE......................GH...............M....SEVGVSAFDPIFWLHHCNVDRLYA
TYRO_ASPFU/59-373LGDPSKPDLQGA......................GH...............M....SSVPVAAFDPIFWLYHNNVDRLTA
TYRO_NEUCR/57-320.................................NGH...............M....SSLEVSAFDPLFWLHHVNVDRLWS
TYRO_PHONA/48-300.................................GGH...............M....GDPAVAAFDPIFFLHHCNVDRLLS
Q0UEG5_PHANO/69-233..................................GD...............P...GGDLFASPGDPFFFLHHAMIDRTYT
Q0U7P7_PHANO/109-364..........E.S....................GGH...............M....YYLDMSAFDPLFWLHHCNIDRLLN
Q0UNZ8_PHANO/95-336.................................LGH...............M....GIIEVSAFDPIFWMHHCSMDRLVA
Q0U440_PHANO/111-339..................................GD...............A....GDFFSSPNDPAFFLHHAMIDRLWW
Q0UXF5_PHANO/87-320..................................GD...............A...GSDFFNSPSDPAFFFHHAMIDRVWW
A1IHF0_PINFU/135-332..................................EI...............M....QDVVAAPGDPVFFFHHTFIDYGWE
Q9GP18_HALTU/1711-1908..................................GS...............AVYGMGHLHYASYDPIFYIHHSQTDRIWA
Q9BJ58_ENTDO/1727-1922..................................GK...............EEHSLNHLHYAAYDPIFYLHHSNVDRLWV
Q1QJ90_NITHX/70-260..................................GW...............M.....PTAASPRDPIFFMHHGNIDRIWA
O49960_SACHY/160-403.........AK.PCD................AAAGGVLSHKDNGAFNCNNDM....GFLGSVGNDPLFYSHHSNVDRMWH
Q2KHE3_MAGO7/117-305..................................SV...............M....GDMWASPADAIFYMHHTFTDRYFT
Q96TI3_LENED/54-303.................................NGQ...............M....SDPSVAGFDPIFFMHHAQVDRLLS
Q6SS53_BACTU/28-187..................................GV....................MAGAGSPEDPVFWLHHSNINRLWA
Q2HCB5_CHAGB/546-729...................................................MM..DGNSITSSGDPLFFMHHGFVDKMWA
A7E8E8_SCLS1/81-336..........L.I...................YPGH...............M....SIVPVAAFDPIFWFHHANVDRLLA
Q2YAJ8_NITMU/75-337........DPN.GNT...............TNNGGF...............M.....QANLSPVDPLFFLHHANIDRLWD
A7RQY2_NEMVE/97-287..................................GV...............M.....SLDASANAPEFWFHHGYIDKVWS
Q2TWH3_ASPOR/65-256..................................GV...............M....ADIKSSPGDPIFFMHHMYIDRVWW
A6RKM8_BOTFB/87-285..................................GM...............M....ADIDCSAGDPAFFMHHNYVDRMWW
Q7NXK8_CHRVO/71-272............S....................QG................M....AQVPWAANDPIFWIHHCNIDRIWA
A2QTR2_ASPNC/82-308....................................................A.NMLDTFSSAQDPVFFLHHAMVDRVWT
A2QUC2_ASPNC/107-337....................................................S.VLADIDTSPAEPMFWLHHAQIDRVWT
A6RE01_AJECN/73-357..........N.Y....................TGH...............M....SEIPVATFDPLFWLHHCNIDRMWA
A6SQE9_BOTFB/103-376.................................GGH...............M....AYIDYSAFDPLFFLHHAMIDRCFA
Q5AXC0_EMENI/55-404.......LRPP.KEGI.............HLWGAGH...............M....SSVAMAAFDPIFFIYHNNIDRLTA
Q8Y2J8_RALSO/71-266..................................AF...............M.....PTAASPRDPVFMMHHGNIDRVWA
Q82V60_NITEU/28-223..................................GS....................MLPMTSPNDPVFFMHHCMVDKIWH
A6SST5_BOTFB/67-300..................................G................DP..GGDFFTSSGDPAFYLHHGMIDRVWW
Q5AYZ4_EMENI/638-868....................................................R.TMDDFWTAPQDPSFFLHHAQVDRVWT
A3K3J4_9RHOB/68-259.................................TTN...............M....GNVPTAANDPVFWVHHAQIDRCWA
Q0UUJ6_PHANO/114-348..................................G................DP..GRDLFTSPGDPLFYLHHGGIDRAWW
Q564J1_APLCA/1731-1925..................................GT...............KVHSMGHLHYASYDPAFYVHHSNTDRLWA
Q2H2F5_CHAGB/109-341..................................G................DP..GGDLFTSPGDPAFWVHHGQMDRVWT
A3JWQ9_9RHOB/119-304..................................PT...............M....ADQDVAAFDPIFWFFHSNWDRLWW
A5X3N8_ORYRU/161-370..........R.Q...................PNGE..............DM....GIFYSAARDPVFFAHHGNVDRMWH
Q19VI0_SALSA/174-408..................................GT...............M....SSVQGSANDPIFLLHHTFIDSIYE
A1IHF1_PINFU/134-334..................................GI...............M....VNVERSPEDPVFWFHHLYIDYVWE
Q2TL94_9APHY/53-300.................................GGQ...............M....GDPSVAGFDPIFFLHHCQVDRLLA
Q287T6_PINFU/134-328..................................AL...............M....AVIPNAAWDPLFYFHHCYIDYVWQ
Q53IP9_MEGCR/1705-1901..................................GK...............EPYGIGHLHYASYDPLFYIHHSQTDRIWA
Q2U7F6_ASPOR/78-307....................................................M.VMGDAAGSPGDPMFYLHHAQIDRVWT
Q27Q57_SEPOF/2142-2337..................................GK...............EIYSLNHLHYAAYDPAFYLHHSNVDRLWV
Q1QPI1_NITHX/200-472AFT.TDAPANRNSAVRVAGRKFHQRDDLYSEPQFGD...............M....FSNLTASYDPIFWPVHANIDRLWW
Q8T777_BRAFL/161-422..................................GT...............M...STGVITAANDPIFLLHHSNVDRLFE
A6S0E1_BOTFB/124-317..................................GE....................FSKFTGPYDPVFFLHHTNLDRLWW
A2Q9V3_ASPNC/114-348..................................G................DP..GRDVYVSPGDPAFWHHHGMIDRVWW
Q7S218_NEUCR/78-316............G....................NGT...............M....ANIAWSAFDPLFMLHHANTDRLIA
A1CDX9_ASPCL/62-270....................................................L.TMADFFSSPQDPVFMLHHAMLDRVWA
PPO1_AGABI/47-299.................................NGH...............M....SDPSVAPFDPIFFLHHANVDRLIA
Q4W5X1_STRGR/29-261..................................GH...............M.....MYIGSPNDPVFFLNHCMIDRCWA
Q2HEC0_CHAGB/91-343.........TS.QST................TQPGH...............M....AYIQWSAFDPVFFLHHCMVDRILA
Q2JGG6_FRASC/46-284.................................GGR...............D....MSLASSPNDPVFFVHHCNVDRVWE
Q2UHJ4_ASPOR/41-346Q......GEDG.TNADE............IDDANGD...............M....GDNETAGFDPIFFLHHCFIDYMFW
Q5LTK9_SILPO/37-259..........Q.P...................VPGW...............M....SDPDFAALDPIFWVHHCNIDRFWA
Q0CYP3_ASPTN/93-321..................................G................DP..GGDFFASPGDPVFFLHHAAIDRLYW
Q21NZ9_SACD2/207-494NY...DAEKAQ.NDNAKD.........LLDTNMPGD...............M....LDNLTAGFDPIFWPHHVNIDRIFT
A7UWM5_NEUCR/100-339..................................G................DP..GADMYISPGDPVFWLHHGQIDRLWW
Q2GZJ4_CHAGB/104-327..................................G................DP..GSDFYFSSLEPGFYLHHGNIDRMHF
Q54QT0_DICDI/95-368AQM.PQQLQVDQGKVQGEDPANVVWKTQEIYSSIST...............M....TNVACSNNDPIFWLHHCNIDRLWA
A0ZXZ4_HYPJE/71-313............C....................GSQ...............F....LAPDYSGFDPLFFMHHAQVDRMWA
A1CVG0_NEOFI/71-291....................................................S.VMGDLWAAVADPSFFLHHANLDRMWA
TYRO_ASPOR/53-346.......PGFN.VDQY..............AGANGD...............M....GENDTASFDPIFYFHHCFIDYLFW
Q3UFK6_MOUSE/182-417..................................GT...............G....GQTHLSPNDPIFVLLHTFTDAVFD
Q876W6_GIBZA/69-281..................................GD....................MGPATSPNEPLFFLHHANVDRVWA
Q0U1I9_PHANO/177-359..................................AV...............M....QDTWASPADAFFFLHHAFIDRNFR
Q7S4R1_NEUCR/95-301..................................GD....................FRAMTAANDPLFYVHHASLDRMWW
Q2YBN6_NITMU/117-305..................................GI...............M....NNTMSSPTDPVFWLHHAEVDRLWH
A6R210_AJECN/53-380..........G.N....................NGH...............M....TQVPVASFDPFFWLHHANVERFYS
Q41388_SPIOL/183-401..........N.T...................IKGNQ.............DM....GAFWSAGRDPLFYCHHSNVDRMWS
Q39ND4_BURS3/46-332P.....HGPNK.GDFSP............IPGANGD...............M....GENDTAGLDPIFYFHHCFIDRVFW
Q5VM57_9GAMM/34-262..................................GA...............M....GDPNTAALDPIFWLHHANIDRLWQ
Q1MVA1_MEGCR/1716-1912..................................GS...............KTHSIGHLHYASYDPLFYIHHSQTDRIWA
Q5ATE5_EMENI/58-339............E....................GGH...............M....SQIPVATFDPIFWLHHCNIDRLFA
Q2IY37_RHOP2/143-320...................................................APSPLRYPALAVYDPLFFLLHCNVDRLWT
Q2H5H1_CHAGB/120-347..................................G................D...GSDVFTSLNDPAFYLHHAMVDRLYW
Q5DB10_SCHJA/171-406..................................GS...............M....CCTGTASNDPIFVLHHALTDKIFD
PPO2_AGABI/47-295..........G.K...................IEGH...............M....DHPFFAAFDPIFWLHHTNVDRLLS
B0UQY1_METS4/67-305..................................GW...............M....GNIPSAAGDPIFFVHHCQVDRLYA
A1CIU9_ASPCL/95-322....................................................P.TMTDVFSSVQDPVFFLHHGMVDRIWT
Q2U5S1_ASPOR/110-305..................................GD....................FLAMTAANDPLFYVHHAQLDRLWW
Q9U5P3_HALTU/454-650..................................GS...............RTYSIGHLHYAFYDPLFYLHHSQTDRIWA
A3RUW3_RALSL/143-320..................................GS...............I....SSIPTAAKDPLFFLLHCNVDRLWA
Q0TZT9_PHANO/73-288..................................G................IQGTMADAEESPGDPLFYCHHGNIDRIFW
A7SSF6_NEMVE/299-492..................................GT...............M.....MLACSSNAPEFWFHHGFLDKLWS
A6SR72_BOTFB/76-338.................................NGQ...............M....GDPDYAAFDPLFWGHHTNVDRQFA
Q2GQI5_CHAGB/102-339..................................G................DP..GADPFISSGDPAFFLHHSQIDRVYW
Q093B2_STIAD/65-326.........PW.NP.................GPFGS...............M.....TNFLSPVDPIFFLHHANMDRLWD
Q70KX7_SUBDO/179-430..................................GQ...............M....DVVPAAVNDPIFNLHHCNVDRIFE
A1CVX2_NEOFI/64-292....................................................P.TMGDVFSSVQDPAFFLHHAMVDRLWG
Q868D0_HALRO/174-442..................................GT...............M....SLVPSSANDPLFLVHHVFIDSIYE
Q6PLR1_WHEAT/160-367..................................GD...............M....GVLGTAGRDPVFYSHHANVDRMWH
A7UX66_NEUCR/102-340..................................G................DP..GRDVSTSPGDPAFYLHHAMIDRVWW
Q5DHS0_SCHJA/178-415..................................GT...............F....CRSATAANDPLFLVHHTQIDRIFQ
Q2HF52_CHAGB/72-288..................................G................TYGQIGDLYTSPADPIFYLHHANLDRVWW
Q0U6S4_PHANO/81-292..................................GDLAGDCPDTLPEADCQG....MAMSFTPNDPLFWLHHVQLDRLWS
Q2UP46_ASPOR/57-381.......SRPG.RHDL.............KLWGAGH...............M....SSVPVAAFDPIFWLHH....WLTA
Q56N25_9BRYO/92-311.........YS.RN..................PYDD...............M....GNLNVAALDPLFYAHHANIDRLWE
Q92LD3_RHIME/65-275.................................AGG...............M....ADPSYAARDPIFYLHHSAIDRLWE
A6UM82_SINMW/70-311..........S.A...................PYGL...............M.....SQNLSPLDPIFFLHHCNIDRLWD
A6R858_AJECN/138-381..................................G................MTGQHSDFYSSPQEPAFFLHHGQIDRLWS
Q7YT36_SEPOF/122-301..................................GT...............V....SVQAWASFDPAFMLIHGYVDYIWY
Q0C7G8_ASPTN/47-357P......DRDT.SRPT.............FEGSNGD...............M....GENDTASFDPIFYFHHCFVDYIFW
A6R3Q4_AJECN/72-315............N....................AGH...............M....TYTPWSAYDPVFWLHHTNVDRIVA
Q2H5C8_CHAGB/79-307..................................G................DP..GGDFYTSPNDPAFWVHHGMIDRTWT
Q93HK5_STRAW/28-238..................................GH...............M.....VSGASVNDPVFWMHHAFVDLLWS
A1C4G0_ASPCL/62-293....................................................R.AMDDFWTAPQEPAFMLHHAMVDRVWT
PPOA_SOLLC/170-383........SVL.PVG...............KISNGE..............DM....GNFYSAGLDPLFYCHHSNVDRMWN
Q9XUS8_CAEEL/185-376..................................GD...............M....KPPSTSANEPIFFMHHSFVDYLWE
Q5AUW8_EMENI/94-328..................................GV...............D....NDIFTSPGDPLFWFHHAQVDRIWT
Q2Y722_NITMU/28-226..................................GS....................MMAMSSPNDPVFWLHHCNIDRLWA
Q5BGU9_EMENI/69-304....................................................P.TLADVFASPQDPVFMLHHGFIDLLWD
A2QYL5_ASPNC/41-332P......DMRY.DRPF.............YPGANGD...............M....GENDTAAFDPIFFFHHCFIDMVFH
A2QFP6_ASPNC/96-325..................................G................DP..GGDLYTSPGDPAFYVHHAMIDRVFW
A6RHX7_BOTFB/78-326............S....................YGH...............M....SFLSYSGFDPIFWLHHANVDRVLS
Q33CJ6_CYNPY/88-316..................................GS...............M....SQDTVCGADPLFLFHHAYIDKIFE
Q2H7D7_CHAGB/62-379..........G.E...................HTGH...............M....AEVPVAGFDPIFFMHHCNVDRQFA
A3NMB3_BURP6/46-332.......GGRE.TGQI..............AGANGD...............M....GENNTAGMDPIFFFHHCNVDRMFW
A1BB10_PARDP/150-379..................................PD...............M....ADNAYTAFDPIFLCYHANIDRMLE
Q5AQP2_EMENI/67-282..................................G................VLGTLGNQYESPGDPLFYLHHGNLDRILW
Q5BDR2_EMENI/99-327..................................G................DP..AGDFYASPGDPAFFLHHAAIDRVFW
Q7SFK3_NEUCR/96-354.........LG.QPN................AQGGH...............M....AYIPYSSFDPIFFLHHAMVDRIFA

PF00372

HCYA_APHCL/112-375E----
HCYD_APHCL/110-371E----
HCYE_APHCL/109-369K----
HCYA_PANIN/136-393K----
SSP1_BOMMO/164-442V----
BJSB1_TRINI/162-439L----
HCY2_LIMPO/110-373E----
BJSB2_TRINI/158-440L----
ARYB_MANSE/161-440E----
ARYA_MANSE/164-443E----
SSP2_BOMMO/161-440E----
HCY6_ANDAU/109-370E----
ARY1_CALVI/140-479Q----
HCYC_PANIN/142-399E----

PF00264

HCY2E_RAPVE/39-233LWQEL
Q4WFT7_ASPFU/96-324TWQNQ
A7DZQ9_9PEZI/52-325IWQAI
TYRO_ASPFU/59-373IWQVL
TYRO_NEUCR/57-320IWQDL
TYRO_PHONA/48-300LWAAI
Q0UEG5_PHANO/69-233NWQHL
Q0U7P7_PHANO/109-364MYQYI
Q0UNZ8_PHANO/95-336LYQTR
Q0U440_PHANO/111-339IWQAL
Q0UXF5_PHANO/87-320IWQNQ
A1IHF0_PINFU/135-332LFRQK
Q9GP18_HALTU/1711-1908IWQEL
Q9BJ58_ENTDO/1727-1922IWQEL
Q1QJ90_NITHX/70-260LWNLK
O49960_SACHY/160-403LWSTR
Q2KHE3_MAGO7/117-305AWQNA
Q96TI3_LENED/54-303LWSAL
Q6SS53_BACTU/28-187IWQRE
Q2HCB5_CHAGB/546-729NWQAE
A7E8E8_SCLS1/81-336IWQAV
Q2YAJ8_NITMU/75-337VWTRK
A7RQY2_NEMVE/97-287DWQKR
Q2TWH3_ASPOR/65-256KWQKE
A6RKM8_BOTFB/87-285QWQQA
Q7NXK8_CHRVO/71-272SWNLA
A2QTR2_ASPNC/82-308LWQLG
A2QUC2_ASPNC/107-337IWQGL
A6RE01_AJECN/73-357IWQAL
A6SQE9_BOTFB/103-376IWQTL
Q5AXC0_EMENI/55-404IWQIL
Q8Y2J8_RALSO/71-266TWNAL
Q82V60_NITEU/28-223EWQLR
A6SST5_BOTFB/67-300IWQLQ
Q5AYZ4_EMENI/638-868LWQSK
A3K3J4_9RHOB/68-259SWNAA
Q0UUJ6_PHANO/114-348IWQQL
Q564J1_APLCA/1731-1925LWQAL
Q2H2F5_CHAGB/109-341MWQAL
A3JWQ9_9RHOB/119-304RWQQE
A5X3N8_ORYRU/161-370IRRGL
Q19VI0_SALSA/174-408QWLRR
A1IHF1_PINFU/134-334LFRRK
Q2TL94_9APHY/53-300LWSAL
Q287T6_PINFU/134-328LFRRK
Q53IP9_MEGCR/1705-1901IWQSL
Q2U7F6_ASPOR/78-307IWQGL
Q27Q57_SEPOF/2142-2337IWQEL
Q1QPI1_NITHX/200-472RWQQD
Q8T777_BRAFL/161-422TWIRR
A6S0E1_BOTFB/124-317IWQMM
A2Q9V3_ASPNC/114-348IWQNL
Q7S218_NEUCR/78-316LWQVI
A1CDX9_ASPCL/62-270IWQAQ
PPO1_AGABI/47-299LWSAI
Q4W5X1_STRGR/29-261LWQAR
Q2HEC0_CHAGB/91-343LWQTI
Q2JGG6_FRASC/46-284GWMRR
Q2UHJ4_ASPOR/41-346QWQLR
Q5LTK9_SILPO/37-259AWMSD
Q0CYP3_ASPTN/93-321TWQNQ
Q21NZ9_SACD2/207-494MWQQR
A7UWM5_NEUCR/100-339IWQNL
Q2GZJ4_CHAGB/104-327IWQNL
Q54QT0_DICDI/95-368DWQDQ
A0ZXZ4_HYPJE/71-313FWEAI
A1CVG0_NEOFI/71-291LWQEK
TYRO_ASPOR/53-346TWQTM
Q3UFK6_MOUSE/182-417EWLRR
Q876W6_GIBZA/69-281KWQGR
Q0U1I9_PHANO/177-359IWQNK
Q7S4R1_NEUCR/95-301RWQWE
Q2YBN6_NITMU/117-305IWQQA
A6R210_AJECN/53-380IWQYL
Q41388_SPIOL/183-401LWTDV
Q39ND4_BURS3/46-332LWQKR
Q5VM57_9GAMM/34-262CWIDQ
Q1MVA1_MEGCR/1716-1912IWQAL
Q5ATE5_EMENI/58-339IWQDL
Q2IY37_RHOP2/143-320KWQWI
Q2H5H1_CHAGB/120-347IWQVL
Q5DB10_SCHJA/171-406CWLRT
PPO2_AGABI/47-295LWKAI
B0UQY1_METS4/67-305SWEAL
A1CIU9_ASPCL/95-322LWQDQ
Q2U5S1_ASPOR/110-305RWQQE
Q9U5P3_HALTU/454-650IWQEL
A3RUW3_RALSL/143-320KWQSQ
Q0TZT9_PHANO/73-288QWQQK
A7SSF6_NEMVE/299-492DWQNR
A6SR72_BOTFB/76-338IWQAL
Q2GQI5_CHAGB/102-339IWQML
Q093B2_STIAD/65-326VWTRK
Q70KX7_SUBDO/179-430SWLKQ
A1CVX2_NEOFI/64-292MWQDA
Q868D0_HALRO/174-442RWLQD
Q6PLR1_WHEAT/160-367LWTTA
A7UX66_NEUCR/102-340MWQMV
Q5DHS0_SCHJA/178-415LWYEY
Q2HF52_CHAGB/72-288SWQKL
Q0U6S4_PHANO/81-292EWQHH
Q2UP46_ASPOR/57-381IWQTV
Q56N25_9BRYO/92-311VWKGM
Q92LD3_RHIME/65-275SWRRN
A6UM82_SINMW/70-311VWTRK
A6R858_AJECN/138-381IWQWL
Q7YT36_SEPOF/122-301RFQEM
Q0C7G8_ASPTN/47-357LWQQK
A6R3Q4_AJECN/72-315LWQAV
Q2H5C8_CHAGB/79-307IWQSQ
Q93HK5_STRAW/28-238RWQQR
A1C4G0_ASPCL/62-293LWQAQ
PPOA_SOLLC/170-383EWKAT
Q9XUS8_CAEEL/185-376LWRQL
Q5AUW8_EMENI/94-328IWQAL
Q2Y722_NITMU/28-226VWQRE
Q5BGU9_EMENI/69-304AWQRS
A2QYL5_ASPNC/41-332LWQRH
A2QFP6_ASPNC/96-325IWQNL
A6RHX7_BOTFB/78-326MYQAI
Q33CJ6_CYNPY/88-316TWIQK
Q2H7D7_CHAGB/62-379LWQAL
A3NMB3_BURP6/46-332VWQKQ
A1BB10_PARDP/150-379VWIRA
Q5AQP2_EMENI/67-282EWQQQ
Q5BDR2_EMENI/99-327TWQNL
Q7SFK3_NEUCR/96-354IWQSL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window