Sequence alignment for CL0210

PF07700

D6W9P2_TRICA/2-164YG..MLL.ESVQHFVQL.EYGE----------------EIWQKALHLS....ECK...YTVFSTHQVYPDH........I
D6W9P2_TRICA/657-819YG..MLL.ESVQYFIQL.EYGE----------------EIWQRVLEQA....NCK...YISFETHKVYSDN........V
G7YDL4_CLOSI/2-164YG..LLL.EGLKQYLVR.EYGV----------------EVWQTAVQQL....SGE...VTGIQIKRVYPES........L
B3RIY3_TRIAD/1-164YG..IIN.HVFQVLVEE.RFGK----------------DTWQQLRNKI....DCI...PEKFIMKHPYDDN........I
T2G861_DESGI/430-584RG..VLP.KMIQEWIKR.QYPP----------------HVVERVKEET....G.....NVTFLPTASYPDQ........V
C3XW68_BRAFL/2-165YG..FVN.HALELLVVK.NFGE----------------EKWEEIKREA....GVD..IDGQFLVRQIYGDD........K
A7S7B2_NEMVE/2-170YG..LLL.ESIRHFIVG.KYGE----------------ELWSEIVNIA....GTS...SHEFVTHRLYDEN........W
H2UDL7_TAKRU/2-163YG..FIN.TCLKSMVVE.TFGE----------------ETWLKLREEA....GV....QDSFLTYEVYEDD........I
K0CAD4_ALCDB/2-162HG..VIL.AHLRHFVTD.RYGQ----------------SVWDDVNHRA....GLT...DCLHVPIQLYPDS........H
F4B0A3_DOKS4/2-162KG..IVF.TEFLDLVET.KFGL----------------EMVDTILNES....ELP..SNGVYTAVGTYSFT........E
F2UP57_SALR5/2-165YG..LLH.KALTAWISSLPDGE----------------DLLTQVMAEV....DFD...GRPDDFFRFYSND........Q
C3YJ22_BRAFL/2-164YG..LLL.ENIHDFFKR.VYGV----------------DVWKQIRNRG....GIK...ATSFVLNQSYPET........F
B3RTK0_TRIAD/1-164YG..IIN.HIIQLLVEE.KFGQ----------------EYWNDVKNRA....GDI...PETFIMKQNYDDK........I
W4XRE1_STRPU/2-164YG..LLI.ESVCEFIKE.KFGE----------------NSWLQIRDKS....RVH...EYTFVTHRMYSEK........I
D3F0L8_CONWI/2-160KG..IVF.NLLEALVVR.EHGE----------------DAWDELLDRA....GV....DGAYTTLGSYPDA........E
A4XK74_CALS8/2-160KG..TVV.LTWLETIGN.IWGD----------------DVKRYAEKGI....GLD..DSTIISPTDDIDDS........L
F2JRL4_CELLD/2-160KG..TVV.STWIKTCRK.LYNE----------------QHIDEAMELV....NWK..RDRVFSPIETVDDT........Q
H9JIF1_BOMMO/5-169YG..FVN.YALELLVIK.TFDE----------------ETWETIKKKA....DVA..MEGSFLVRQIYEDE........I
H2ZHQ6_CIOSA/2-167YG..LVL.KSVVECVEM.EWGV----------------TIWNQMVKKI....GIG...GVGFSIHKVYDEN........L
A6M0J2_CLOB8/2-160KG..TVV.STWMKTNRK.LFGD----------------SIVNEAMDYI....GWG..KTKIFSPIENVDDG........E
Q899J9_CLOTE/21-179KG..TIV.ATWMRTCRK.LYND----------------DVVNKAMSSV....GWD..SNKIFKPTENVEDS........D
G7YSC7_CLOSI/2-164YG..ILI.EGLHHYLTE.KFGE----------------EFWLTATENV....MGA...RKVIQTQQVYSET........L
B0C2H7_ACAM1/2-163YG..LVN.KAIEKMVRS.HFND----------------ATWEAIKQKA....EIK...TEAFISMEGYPDE........L
C5ARV9_METEA/2-162KG..VVF.TEFLDFVSE.ALGS----------------DVADDIIDDA....DVP..NGGAYTAVGTYPYT........E
A7RZH8_NEMVE/3-165YG..LLI.ENVSSLLTS.RYGE----------------DTWHKIRENA....GVQ...QHTFAIHNIYSDS........I
D3SA24_THISK/2-160KG..IVF.NVLEEIVTE.HYGE----------------EGWEDLLDRA....QV....TGAYTSLGNYEDD........E
I1FML3_AMPQE/2-163YG..LLL.DSIQKFLRE.KYGE----------------HYWIVIRRRA....KLT...NHWFVTHEVYSDS........V
K6YZX2_9ALTE/2-163YG..MVN.KAVEDMVCT.QFGE----------------SVWEDIKSCA....GVD...IDVFMSNEAYPDE........M
F8DBD3_HALXS/2-162HG..IVL.KGLKDFVTE.EYGA----------------DVWTDLHEAA....GFR...TRLYVPVTEYPDE........I
Q8RBX6_CALS4/2-160KG..TIV.GTWIKTLRD.LYGN----------------DVVDESLKSV....GWE..PDRVITPLEDIDDD........E
F7YXL0_9THEM/2-160KG..FVV.NVWFQTWSK.MFGK----------------DFVDKIKAKY....GIS..PDHVYSPIDDVPDD........L
W4XH19_STRPU/14-176YG..FIN.ICVKALVTE.KFGE----------------EAWIKIKTLA....GV....DDSFISHTTYTDQ........I
R4KI66_CLOPA/3-161KG..TVV.ATWVRTCRK.LYGD----------------SIINEAMNQA....GFG..SEKIFSPLENVNDD........Q
W5KMY4_ASTMX/2-163YG..FIN.TCLRTLVVE.KFGE----------------ETWEKLRLLA....EV....QDTFMTYEIYDDV........I
A9KIK0_CLOPH/2-160KG..TVV.SSWIESCRK.LFGS----------------EVVDSALKAY....AIP..TNYIFSPLEDVEDK........T
B7VPN5_VIBTL/2-162KG..IIF.TEFLELVED.KFGL----------------ELLEEVLEMS....ED....EGIYTSVGSYDHK........D
T1ITQ9_STRMM/2-166YG..FVH.CCLEDLVLK.LFGD----------------EKWHEILEFC....KFTD.ENASFIIHRVYKDE........E
G4LU97_SCHMA/2-164YG..ILL.EAAKHYILD.NYGE----------------NTWIWLCKKS....TGK...EFDIETRKIYHDN........L
F2UQW4_SALR5/2-164YG..FIT.TATLEWIESLDDGE----------------RLLKELYAEL....GE....DPKNNFYKKYSDE........Y
H2ZCI7_CIOSA/2-166YG..FVN.YALEQLVLR.NFGE----------------EIWNEIKQEA....DLH..MQGQFIQRIVYDDV........C
A7HJF4_FERNB/2-160KS..FVM.NIWLSTWKK.IYGE----------------SIVDNLVQEF....NID..RTKLLIPTNDVPDE........L
K1R2B8_CRAGI/26-188YG..LLL.ESVENYIKE.KYGE----------------DVWEKIRKMS....HVE...TMAFSTHKRYSEN........I
W5L1E6_ASTMX/2-163YG..FIN.TCLKSLVID.KFGE----------------DTWNKLRDAA....CV....QDTFMTYEVYKDE........I
Q15VN4_PSEA6/2-162KG..IIF.VKLNQFVDE.LWGD----------------EFWDELLQDA....ELP..SDGIYTSVATYDDA........E
C3Y563_BRAFL/2-164YG..LLL.ESINDYLKG.AYGE----------------AVWKLIRERA....NVP...HHSFVTHQVYSET........V
Q7MJS8_VIBVY/2-162KG..IIF.TEFLELVEE.KFGL----------------TVLDDILDRA....GD....EGVYTAVGSYDHR........K
C3XXH9_BRAFL/2-165YG..MLV.ESVQHYVRK.KYGE----------------EKWLQILELS....GFK...NTVFATQRVYKDD........V
S0ESS7_CHTCT/2-160KG..IVF.NFLEDVVSN.RFGD----------------DTWDDILEDA....QV....EGVYTTLGNYPDD........E
H3CKY4_TETNG/2-164YG..LYL.EAVNDYINE.SYGE----------------DVWRLIENRA....EIP...HLKFVRHQMYNDN........L
A7RN69_NEMVE/100-264YG..FVN.HALELLVVR.NFGV----------------AKWEEIKRAA....ELE..IEGHFLQRIIYDDV........M
F1NZB6_CHICK/2-163YG..FIN.TCLKSLVVE.KYGE----------------EIWEKLRLQA....GV....EDSFLTFGVYKDE........I
F7YL52_VIBA7/2-161QG..IIY.TVLSDLVIE.KFGA----------------LFWDQMLEDL....KPS..SQGIYTAGEQYSDD........E
J9K961_ACYPI/2-175YG..MLL.ESVQHFIQL.EYGE----------------SAWREVVRLA....RCK...WYVFNTHQIYPDG........L
E2AD43_CAMFO/2-164YG..MLL.ESVQYFVQL.EFGE----------------EVWLHILEKA....DCK...HMVFNTRQIYSDE........L
F2UCB7_SALR5/2-165YG..VLH.KALTAWLTSLPDGQ----------------QLLHMVLAEV....NFD...GSADDFFRHYSSS........Q
A2U1J5_9FLAO/2-162KG..IVF.TEFLELVEE.KFGM----------------EMVDSIIEAS....ELE..SEGVYTAIGTYNFS........E
Q97E73_CLOAB/2-160KG..TVV.GTWVKTCKR.LYGE----------------TVVENALEKV....GFE..RKKIFSPFEDVEDS........K
Q9A451_CAUCR/2-160KG..VIF.NLLQEVVSA.AHGA----------------DAWDDILDEA....GV....SGAYTSLGSYDDE........E
B3RYQ3_TRIAD/1-165YG..FIH.RALQDLIVR.QYGE----------------KEWKRIIDKA....GIQE.ESRAFLLHQSYDDA........L
T1IYK0_STRMM/2-165YG..MLL.ESVQHYVTE.EYGE----------------ETWLNVLKRA....GYH...NLIITHNLAYSDA........I
F3Z380_DESAF/437-596KG..VLP.KLMVDYIGR.TYGD----------------GVRRKLLEEL....G.....NPVFMIQNSYPDA........V
I3LMI1_PIG/2-166YG..FVN.HALELLVIR.NYGP----------------EVWEDIKKEA....QLD..EEGQFLVRIIYDDS........K
B2IZ76_NOSP7/2-163YG..LVN.KAIQDMVCS.RFGE----------------ETWKQIKHKA....EVD...VDVFLSMEGYPDD........I
G4QEK6_GLANF/2-166IG..IIQ.KVLMDLLVS.TGGE----------------SLKQSVLQHA....GLP..PDMHFRIDQNYSDI........D
G4VI29_SCHMA/12-176YNVWFII.GRITYFYIT.KWSS----------------EIWIEICTQA....NSH...EIQFETRKVYDEA........L
B7PJ68_IXOSC/2-166YG..FIH.CALEDLVTK.KFGA----------------ETWKLLLEKS....GITM.HGASFLMHKVYTDE........V
GCY33_CAEEL/2-164YG..LVI.EGVRFMIQE.NWGP----------------QVLLQVQKLT....SLS...EKSVSTHDQYSEH........V
M1MBZ2_9CLOT/2-160KG..TVV.ATWMRTNRK.LFGD----------------ATVNDAMDYV....GWG..AEKIFSPIENIDDA........E
D3Z022_MOUSE/2-163YG..FIN.TCLQSLVTE.KFGE----------------ETWEKLKASA....EV....QDVFMTYTVYDDT........I
Q8YUQ7_NOSS1/2-164YG..LVN.KAIQDMISK.HHGE----------------DTWEAIKQKA....GLE..DIDFFVGMEAYSDD........V
E3PR11_CLOSD/2-160KG..TVV.GTWVKTLSR.MYPE----------------DIVKEKMKVA....GMD..PNKAISPLDDIEDA........K
F4EW09_SELS3/2-160KG..TVV.ATWMDTAQK.LWDG----------------TAVQESCREA....GWA..PGRIFTPLEDVPDS........E
H3EBU1_PRIPA/15-180FG..FIH.ESVRVLIVR.TYGE----------------EMWSNVLVRS....GFE..SGKENIVNHYYKDS........D
B7PID1_IXOSC/2-165YG..MLL.ESVQHFVRA.EFGE----------------SLWQAALSDL....GMR...NCVFSTHRTYPDD........S
H2ZQM8_CIOSA/2-166YG..IIL.DSLMDCIKQ.KYGE----------------QVWKRAIGPC....GIS...NSLFTAHKIYHEE........L
E3MCF9_CAERE/2-167FG..FIH.ESIRQLMIR.TYGE----------------AFWAKVLERS....GFE..AGKENIINHYYSDQ........D
G7YSC6_CLOSI/2-164YG..LLI.EGLKQYLTK.SYGE----------------ELWWDAFQEV....CGK...QKVIQTHGVYPES........W
X5E3Q9_9BACT/2-162KG..LVF.REFLEMVEK.EYGY----------------ETVDTIIEKS....KVP..SEGIYTSVGTYHHS........E
F2TX50_SALR5/2-165YG..FVE.EALNAYVLSLPDGK----------------EKLDLIRREA....NVT...HTAVNFHHAYSDE........H
H2J852_MARPK/2-160KR..LLV.FTWIETWEK.LFGE----------------DTVKKILERN....NVN..INEKGSPLEDFDEN........L
D5BKH5_ZUNPS/2-162KG..IVF.TGFLDMVEK.KFGI----------------EIVDHIITES....KLQ..SEGVYTSVGTYDFV........E
G8X8N8_FLACA/2-163YG..IVN.KAIQDLIIS.NFGE----------------QKWNEIRNKS....GIN...HDYFISGQSYDDD........V
K1S3W9_CRAGI/2-166YG..FVN.YALELLVVR.NFGD----------------EAWENIKKEA....GLE..MDGHFLVRQVYEDA........K
H0PYD0_9RHOO/2-161YG..LVN.QAVREMVLT.HYGE----------------EKWEAIREHA....GT....DDVFIAMDQYPDD........V
Q47Y43_COLP3/2-162QG..SIY.TAFSDMIVE.QMGM----------------EQWNELIEQT....KPP..SHGIYTSGEQYQDS........E
K8GF64_9CYAN/2-163YG..LVN.KAIEDMVCK.YFGE----------------ATWKEIKQKA....DLE...VDSFISMEGYPDD........V
G0NDJ7_CAEBE/2-167FG..WIH.ESFRQLVTR.KYGK----------------DIWEKIVHMA....KFE..LGTESEIAHYYNDD........E
K4IJS2_PSYTT/2-161KG..IIF.TEFLELLEN.KFGL----------------EIVQKIIDEC....DLT..TNGVYTSVGTYSHK........D
K1PH87_CRAGI/2-166YG..LLL.ESIQHYIIE.KYGR----------------DHWNKILEHV....QQK...NIVFTTHQIYTDD........L
F8EFN5_RUNSL/2-162KG..IVF.TEFFDMIEQ.EFGY----------------EMVDTLLNES....ELP..SGGTYTAVGTYSHI........E
A6TMH7_ALKMQ/2-160KG..TVV.STWLQSLRD.LFDH----------------DVVDRAVESI....GWS..KERMITPLEDIKDE........E
K9VYK2_9CYAN/2-163YG..LVN.KAIQDMVCD.RFGE----------------ETWETIKQKA....EIE...ESVFLSMEAYPDD........L
G6CKQ3_DANPL/2-164YG..LLL.ENMAEYIRQ.TYGE----------------ERWEDIRRQA....GVE...QPSFSVHQVYPEN........L
E6VZ54_DESAO/523-677KG..ILP.KLAQAFVKK.KYGN----------------SVYDFMQKEL....G.....NPVFLPTESYSDK........A
E0VW08_PEDHC/2-166YG..MLL.ESVQHFLQL.EYGE----------------ETWNEIIKES....GCE...FTVFMTHQTYPDN........L
F2U5L4_SALR5/2-172YG..LLH.QSLTAWVRTLEDGE----------------ALLQQVESRFRNNLEDTDGSFACDEFHRRYTDA........Q
G3PRL3_GASAC/2-163YG..FIN.SCLQSLVME.RFGQ----------------DTWDKLSSLP....GV....QNSFMTYTVYDDQ........L
F4A1A5_MAHA5/7-165KG..TVV.STWISTLRE.LYGE----------------DAVNAALERL....GWD..ANRIIAPLDDIADE........Q
H2YUP4_CIOSA/2-167YG..FVL.ESIVDCVHE.EWGE----------------RVWMELVEEM....GFD...TVGFSIHTVYEES........M
C5BIN2_TERTT/2-162KG..IIF.TVFSDFVAS.SYGA----------------DQLDYLLDTC....DLP..SGAAYTSVGNYPFA........E
E3DMW8_HALPG/2-160KG..TVV.ATWLTTLKK.TYGE----------------EVVNKAKKKA....GFK..EDLIISPMTTIEDQ........K
Q5E1F5_VIBF1/2-160KG..IIF.SEFLELVED.KFGL----------------EVCQQMLDEN....ND....EGAYTAVGTYDHK........H
Q2SFY7_HAHCH/2-160KG..IVF.TEFLQLVED.KFGL----------------EEVDALIEES....GV....SGIYTSVGTYDHS........E
F6GI89_LACS5/2-162KG..IVF.TEFLELVED.KFGL----------------EMVDNIISSS....NLE..SGGAYTAVGTYSFS........E
D8U0R1_VOLCA/59-223LSSPFAHQYAVEAFICD.SFGR----------------DAWLKIIKQA....HV....DCNWVSSCPYPDK........V
A3HWD6_9BACT/2-163YG..LVN.KSIQELITT.NFGK----------------EKWEIIKLKS....DIN...IDYFISTEPYDDS........V
C3Y428_BRAFL/2-164YG..LYL.DTIHRYLRG.TYGD----------------DVWKLVRHRA....GIK...VWTFHLNQTYSDQ........Y
B8D0K8_HALOH/2-160KG..TVV.STWINTLNE.IYGE----------------DLVNQAKADS....SWN..EELIITSLMDIEDK........K
A7RN72_NEMVE/2-166YG..FIH.CALADLVIG.KFGE----------------EAWKDIIKKA....GVEL.DGGSYLIHKIYDDE........E
T1ITQ7_STRMM/2-166YG..FVN.HALELLVLR.KYGP----------------EVWEEIKKEA....KVM..IEGQFLVRLIYDDE........I
B3RYQ5_TRIAD/10-174HG..LIN.HALSLLVKR.NFGD----------------EAWDSIREKI....GMS..NSSYFIQRKVYADD........V
L0JGE2_NATP1/2-161HG..IIL.QTLQSFVVD.TYGE----------------DAWLAIQNEA....DIE...EKVYVPVTVYPDG........D
A8F5S3_PSELT/2-160KG..FVV.NMWFETWGK.LYGK----------------EVVEKLKTQF....GLK..PDHTYSPLDDVPDE........L
B0CD92_ACAM1/2-163YG..LVN.KAIQEMVCD.HFGE----------------DAWKAIRELS....ETK...SENFISLESYPDD........L
A5I7T3_CLOBH/2-159KG..TVV.ATWVKTCRK.LYGE----------------EAVDKAMNAV....GWQ...GKIFSPMENVEDT........K
F2U0N3_SALR5/2-164YG..FIP.AAALAFVKQLPNSE----------------DLLDKISRRL....DG....NINTNFYTQYDDK........E
W4XR28_STRPU/4-177VG..IVS.LTFRRVFST.FGHD----------------DIIDDFLDNE....GLD..SKFSIESLTNYYDSRPNSCLEDL
G1KLN8_ANOCA/2-162YG..FIN.TCLKSLLIE.KYGE----------------ETWENLRTNA....GI....EDTFMTYTVYDDT........V
D9SRG3_CLOC7/2-160KG..TVV.STWVRTLRR.FYGD----------------ELIDSAMTKA....GWE..NGKIFSPIETVDDN........K
K9X5Q3_9NOST/2-163YG..LIN.KAIQDMVCE.RFGK----------------EAWQAIKQKA....EVK...VDSFLRMEKYPDD........L
G7YQF8_CLOSI/2-164YG..LLL.EGLRHYFTS.HHSV----------------ALWNTVLAKS....GCD...IKQFEIKKVYDED........L
F0RGN9_CELLC/2-162KG..VVF.TEFLEMVES.KFGL----------------ETVDTIIENS....NLP..SEGIYTSVGTYNFN........E
F6YJD6_XENTR/8-169YG..FIN.TCLKSLVIE.KFGE----------------ETWDLLRIQT....GV....QDTFMTYEVYKDE........I
Q5ZWM9_LEGPH/2-162KG..IVF.TSLNDMIIE.QFGI----------------ETWDQLVSSL....DLP..SGGSYTAGGTYSDT........E
E3N9U4_CAERE/2-167IG..WTH.VCVSQLILR.KYGP----------------EVLEEILRKA....GYT..EDVQFDIQCYYDDT........E
B8DKJ8_DESVM/531-685RG..VLP.KLMQEFAVG.NYGR----------------DVVAKMLEAM....G.....NPVFLATANYPDQ........V
B3RYQ6_TRIAD/11-175YG..FIN.YALELLVVR.KYGQ----------------ETWNEIKKKA....EVD..IEKHFLLRMIYDDQ........V
E9GML5_DAPPU/2-166YG..MIF.ETIQNIFQL.EYGE----------------QLWHALLEKT....NYR...NTVFCTHQTYPDD........L
F0LTC6_VIBFN/2-162KG..IIF.TEFLELVED.KFGL----------------AVLDQVLEQA....KD....SGVYTSVGSYDHQ........A
D5XA10_THEPJ/2-162KG..TIV.NCLGELVSS.KFGK----------------DKWEQALEIA....GLN..KNAMFMVFADIDDA........Q
H2Y4L1_CIOSA/2-168YG..LIL.DSMADHIKK.LYGD----------------KIWHSVVGSN....DI....SNTFTTHKVYDEQ........L
F2TZE3_SALR5/2-165YG..LLH.KALTSWVESLPDGD----------------ELLQEIMKVI....NFS...GHPDDFFRYYSDE........Q
F2UN82_SALR5/2-165YG..TLH.KALSAWVQSLPDGD----------------TLMSMVLAEV....NFA...GSANDFFRFYTDE........Q
A6GYD7_FLAPJ/2-163YG..IVN.KAIEDLVIA.NFGE----------------AKWNAIKDRT....GID...IDFFISNEPYDDE........I
A0PXJ5_CLONN/2-160KG..TIV.ATWINTCRK.IYDK----------------NTVALAMQSV....GWK..ENRIFSPIEDVDDR........Y
B3S7Q2_TRIAD/2-165YG..LIN.HIIQALLKT.KFGN----------------EFWEKIRNKM....GHL...PDEFEIQKLYDDK........V
Q21E20_SACD2/2-162KG..AVL.IALNDMVEE.VFSM----------------AVWDQVLAKV....KPD..SEGIYISAESYDDA........E
K0ATP4_CLOA9/2-160KG..TMV.SVWVKTSRK.LYGD----------------DLIDEALNSV....NIS..SDKVFKPTEDIDDS........S
T1KFI6_TETUR/2-166YG..FVN.HALELLVIR.NFGN----------------EVWEKIKKEA....EIE..MEGSFLVRLIYDDE........N
F2UR64_SALR5/2-165YG..FMH.QALKSWLLSMDNGE----------------YLLQEVYEEL....NLD...TAPDDFFRYYSDA........Q
A6LK33_THEM4/2-160KS..FVM.NIWINTWKK.LYGE----------------KVVNELIESF....NLN..TEVLLNPINDVEDN........F
G3Q1S5_GASAC/2-164YG..LLC.ESLHDFIKE.SYGD----------------DVWKLVRERA....DVR...LHSFVTHQVYSES........V
C3ZF94_BRAFL/7-169YG..VIN.LAFRGYLVA.TYGE----------------EKWENIRQLA....GV....EDSYFMNTSYDDA........I
B8HJS1_CYAP4/2-164YG..LVN.KAIQDMVCR.YHGE----------------ETWEQIKQLA....DLE..DLDFFISMEAYPDD........V
B7PFU6_IXOSC/2-164YG..LIF.ENLSQYVCA.VYGA----------------ERWEEIRRRS....RIE...MSTFSTHEVYPDH........V
W4Z032_STRPU/9-171YG..SVN.VSIKDLVTE.KWGN----------------ETWEKIRIKA....GV....DDRFVKFDMYPDS........I
G4VA36_SCHMA/2-164YG..LIV.IGIQNYVES.VYGE----------------NVWLRILEKS....NTG...LLTFQTHNIYSDT........V
Q310U7_DESAG/727-881RG..ILP.KIFMNFIKE.IYGD----------------DVFAHVSKTM....G.....EPVFMPGNSYPDQ........V
A8MIN2_ALKOO/2-160KG..TIV.STWLNSLRN.IFDS----------------NTVSTALKRA....SWD..EHRIITPLEDIPDE........E
F2TZ95_SALR5/2-165YG..FLH.QALTAWLRSQDGGE----------------QTLKDVYEQL....NIT...GSPDDFFRHYSDT........Q
E9GML8_DAPPU/2-166YG..MLL.ESVQHFIQL.EYGE----------------ETWLAILESV....GYR...NTVFRTHHIYPDE........L
K9UD61_9CYAN/2-163FG..LVN.KGLEDMICS.QYGE----------------EIWEKIKSKA....EVE...IEAFISMDSYPDD........I
G3RZQ8_GORGO/2-166YG..FIN.TCLQSLVIE.KFGE----------------ETWEKLKTSA....EV....QDALMTYTMYDDV........I
E9GML7_DAPPU/2-166YG..IIF.VTVGSVIQT.EYGN----------------DVWFSLLDRV....GYR...NTTFCTHSIYPDD........L
G8R6C6_OWEHD/2-162KG..IVF.TEFLQMVED.AHDY----------------ELVDQIINDV....DPE..SEGVYTAVGTYSHT........E
K7AQ34_9ALTE/2-162KG..IVL.VKFNEFIEE.LWGE----------------GFWDKLINEA....DLP..SEGAYTTVVTYDDQ........E
Q21ER7_SACD2/2-162KG..AVF.VTLKTMIEE.SHGP----------------TAWAALVDKV....APE..CEGVYDANENYPDA........D
I7CPA5_NATSJ/2-161HG..IVH.KTLKEYVVE.RTDD----------------GTWDTIVEQS....GFE...PKLYLPVSHYDDR........E
Q7Q9W6_ANOGA/2-164YG..MLL.ESVQHFVQL.EYGE----------------FVWRQALLTT....GCK...NTVFNTHQLYPDN........L
E9FT54_DAPPU/24-187YG..FVN.YALELLVLE.NYGK----------------DVWEQIKKEA....EVN..MEGHFLVRQIYEDE........V
A7RN70_NEMVE/2-168YG..FVN.RALQDLVIQ.GYGP----------------DVWKEILEKA....NLDLGDSREFNERRIYDDQ........N
I2EZ72_EMTOG/2-162KG..IVF.TEFIEMVEE.KFSY----------------SMMDEIIESL....NLP..SKGIYTSVGTYDHS........E
B2A8E6_NATTJ/2-160KG..TVV.LAWINSLKD.LYGE----------------DQVTQVLSEL....GWE..GDEIITPTMNVSDR........D
I0K9V5_9BACT/2-162KG..FVF.TEFLEMVEE.AHGY----------------ELVDKLLLES....HLP..SGGNYTSVGTYDHA........E
M1MRY0_9CLOT/2-160IG..LVV.STWIKTSVN.LYGK----------------EKVNIALDKV....GIK..TDKKFSPMEVVDDE........K
A9V7H3_MONBE/2-165YG..FLQ.SSLISLLKQYPDFE----------------ERMRQIKDSL....GYE...GNLDDFFLHYDDT........T
K9UZY1_9CYAN/2-164YG..LVN.KAIQDMICQ.NHGE----------------EVWENIKQKA....GLE..DVDFFISMDAYSDD........I
Q87NJ1_VIBPA/2-162KG..IIF.TEFMELVES.KFGL----------------EVLDQVLELS....DD....EGVYTSVGSYDHR........D
Q5ZSQ8_LEGPH/4-164KG..IIF.NEFLNFVEK.SESY----------------TLVDQIIMDS....HLK..SHGAYTSIGTYSPK........E
G7Y7K2_CLOSI/23-185YG..LVI.EGFKSYVSD.QYSH----------------SIWEEILKQS....GYE...SYTFDSKQVYDEA........I
A3UA30_CROAH/2-162KG..IVF.TEFLELVEQ.KFGL----------------EVVDEIIEKS....DLE..SNGAYTSIGTYKFS........E
B4IBU8_DROSE/2-164YG..MLY.ESVQHYIQQ.EYGM----------------ETWRKVCQIV....DCK...HQSFKTHQIYPDK........L
W4X9S3_STRPU/2-166YG..FVN.HALELLVLR.EHGQ----------------DKWEEIKREA....AVE..IEGSFLVRIVYDDV........L
A8WS03_CAEBR/2-164YG..LII.DHIATYIKE.KYGE----------------STWQEVKFVS....GVT...DDAFQMDKKYSEG........L
Q8EF49_SHEON/2-161KG..IIF.NVLEDMVVA.QCGM----------------SVWNELLEKH....APK...DRVYVSAKSYAES........E
T1JJL9_STRMM/2-164YG..LLI.ESLSEYLVA.TYGE----------------EAWDNVRKSA....EIT...TATFSVQQVYPET........V
GCY34_CAEEL/2-167FG..FIH.ESIRQLVIR.KYGE----------------DVWLQVLERS....GFE..NGKENIVNHYYSDT........D
A5N4H2_CLOK5/2-160KG..TVI.ATWMRTCRK.LYND----------------EIVNDAMNSV....GWG..ASKIFSPAENVNDG........E
B9JYX7_AGRVS/2-166KG..MVF.TEMLEFVAA.TWNE----------------DMADDIIEASLLTNGLA..SGGAYTSVGTYDHR........E

PF02830

A4XDS4_NOVAD/122-182----.HD-SIEAAIHLS---------------------------------------------------------------
A9WB66_CHLAA/138-197----WRL-TLADSVEAR---------------------------------------------------------------
B2UJH2_RALPJ/152-211----..D-SSEAEAHIA---------------------------------------------------------------
D0J206_COMT2/112-172----WEH-SWEAEIHLR---------------------------------------------------------------
E4PKW5_MARAH/128-189----WFD-SFEVEICQT---------------------------------------------------------------
O26930_METTH/130-191----MDV-RVYECIECA---------------------------------------------------------------
O27403_METTH/188-249----LVI-RAYECFECG---------------------------------------------------------------
O67571_AQUAE/116-177----MEI-KIEGSILVE---------------------------------------------------------------
BCHJ_RHOCB/140-199----LTF-RIDDNPLRA---------------------------------------------------------------
P74443_SYNY3/170-231----LFV-DIFDSAVAR---------------------------------------------------------------
P74446_SYNY3/202-263----IVA-EVVNSPFVA---------------------------------------------------------------
Y745_METJA/119-179----LVL-KVENCSFCE---------------------------------------------------------------
Y1460_METJA/95-156----PPY-KIKLSNPPY---------------------------------------------------------------
Q881E3_PSESM/120-181----WHN-SCEADEHLA---------------------------------------------------------------
Q8DGL5_THEEB/132-193----VVK-TWDSPFAAA---------------------------------------------------------------
Q8DKK3_THEEB/150-211----MFI-NIFDSVVAR---------------------------------------------------------------
Q8R5R6_CALS4/52-113----IIV-KWHECLTCS---------------------------------------------------------------
Q8TIU0_METAC/206-264----..I-IVKDSFIAD---------------------------------------------------------------
Q8TQT2_METAC/185-246----PAL-QVEDDFKAR---------------------------------------------------------------
Q8TV82_METKA/104-164----IEI-TMRESATAA---------------------------------------------------------------
Q8TWC8_METKA/86-147----NYV-AIESCPECL---------------------------------------------------------------
Q8TX90_METKA/68-129----TVE-FYEENPEVK---------------------------------------------------------------
Q8TXN0_METKA/66-127----DVV-TVRNYPECA---------------------------------------------------------------
Q8TXN0_METKA/224-288----NRM-SIEPCPECA---------------------------------------------------------------
Q8TXW7_METKA/177-236----VVV-EIEGCHECS---------------------------------------------------------------
Q8U209_PYRFU/331-392----DII-VIEGKNLFP---------------------------------------------------------------
Q8XT87_RALSO/150-211----WHN-SSEDDEHLE---------------------------------------------------------------
Q8XTP9_RALSO/107-174----IEL-C.HSSFVLA---------------------------------------------------------------
Q9KLM3_VIBCH/129-188----FEN-RVEEKTLTM---------------------------------------------------------------
BCHJ_RHOS4/143-203----LSF-EIARNPVVA---------------------------------------------------------------

PF04051

T1JVG1_TETUR/7-153LD--LLH-IELVNTLVT...............................................................
E5SJ80_TRISP/8-152FE--YLH-SEIVQFLLT...YA..........................................................
M0RYG7_MUSAM/13-175..--.VI-IEMVSAY.................................................................
X6NU62_RETFI/84-239FS--HLF-CGLLQYCRE...GI........K.......D.VGTLE...................................
E4WZM5_OIKDI/17-163LA--LTY-GAVVARVLK...DY........E.......R.TDEVN...................................
A7T063_NEMVE/19-166FT--LTY-GALVAQLVK...DY........E.......S.PEEVN...................................
U3IS73_ANAPL/19-165FV--LTY-GALVAQLCK...DY........E.......K.DEDVN...................................
G0RJ43_HYPJQ/25-253LD--FLL-IELVPLAHR...VT........S.......Q.RDFSSPISSSLSPSTAAAAA.....SQLSPQANQQHPDSN
A8BA91_GIAIC/27-185MV--CLL-NEYFQYAQR...TC........K.......T.VEEIE...................................
I2H4M5_TETBL/53-262MA--FLF-QEMVSTIYK...NS........K.......T.MAEFE...................................
A0A0D2UGE9_CAPO3/18-164FT--LTY-GSLVAQLIK...DF........E.......D.DEEVN...................................
C1MS22_MICPC/30-175FT--LTY-GAIVRQVLA...DY........E.......DCVPEAN...................................
D7FQV7_ECTSI/36-189FS--FLF-SEMVQYFQD...RV........T.......S.IADLE...................................
E7NGB5_YEASO/62-271MA--FLF-QEMISQLHR...TC........K.......T.AGDFE...................................
A7TQ02_VANPO/35-184FT--MTY-GAIVSQLCT...DF.......QR.......D.YNKVN...................................
R9AMQ2_WALI9/26-174FV--MTY-GALVKQLWE...DY........E.......D.IGAVN...................................
G8ZPV8_TORDC/45-260FQ--MLL-NEMVPLAVS...VE........N.......K.L.....................INSEIKGTPKRNSS..EL
Q38DI4_TRYB2/28-190FS--FLF-SELCTRAHSTPTKA........R.......D.IEEIE...................................
M2YLM3_DOTSN/24-219LD--FLL-IELVPLAQR...IT........D.......Q.LHAREQALVDEFKSTNSVKDSSFV................
N4VA41_COLOR/25-174..--LTY-GTIVAQLCK...DY.......DS.......D.YSEVN...................................
U4LDL1_PYROM/26-177VT--LTY-GSIVAQLCK...DY.......EG.......D.YMEVN...................................
N1Q0J8_DOTSN/59-215FS--YLF-NTLITYHHS...KS........G.......S.VSEIE...................................
I1EHD1_AMPQE/31-180FA--FLF-SEVVQYNQQ...RV........T.......S.LAQLH...................................
E9I9Q7_SOLIN/5-151FT--LTY-GALVAQLLQ...DY........E.......N.VDDVN...................................
E1ZPW5_CHLVA/28-181FS--YLF-GEVVQYCQS...RV........S.......N.IGELE...................................
K0R7X6_THAOC/23-249YE--FLL-SEILQWVQR...DE........K.......R.VAEQARQV.........QQAASGQDG....SPERNLSPNN
Q5KMH2_CRYNJ/70-228WA--FMF-AEIVAYSQS...RA........D.......S.VSDLE...................................
G8YS93_PICSO/81-235FS--FLF-CEIVNWTRN...NS........K.......G.IQDLE...................................
K3XAK0_PYTUL/47-201FS--FLF-SEMVQYFQG...RV........Q.......N.ISDLE...................................
I1JRI0_SOYBN/10-175ID--SLL-TEMVACY.................................................................
L8FYS8_PSED2/51-210FA--YLF-GEMVSYAQR...RV........T.......D.IQDLE...................................
F1QMV3_DANRE/7-155FQ--FLH-SEIIQYVNS...............................................................
C1MRP2_MICPC/11-162FA--FLF-SEIVQYHRT...RA........S.......S.VAELE...................................
E6ZN37_SPORE/79-291.H--TLA-TEMVATLIH...SS........S.......F.VSRKQAFARQELQLAGIQLPALNKAPSTSTAPGPASASTS
G2QD82_MYCTT/25-217LD--FLL-IELVPMAYR...VT........N.......E.LGAAAREQEGL.............................
L8FNC8_PSED2/24-220LD--FLL-IELVPLAYR...LA........H.......D.IDSVKRDGVAG...........................LP
A8JFB7_CHLRE/26-178LE--LLC-AESVRL..................................................................
T1JCC7_STRMM/19-164FT--LTY-GSLVAQLIK...DY........E.......N.NEDVN...................................
W4ZHN1_STRPU/7-154FD--FLH-MEIVNFVQR...............................................................
I2H1V3_TETBL/54-297FR--ALI-NEIVPLAMS...ME................K.IKDNSDTNELVEQEADTNESVKKDSDSKDS........IE
U1HTW2_ENDPU/68-231FA--FLF-MEMVIYAQN...RV........K.......G.IQELE...................................
G9NKV9_HYPAI/25-220LD--FLL-IELVPLANR...IT........A.......E.RDFA.......SPSTTA.............DALQSPPHSA
H0XNR3_OTOGA/7-161FE--FLH-AEMVAELGT...RD........P.......D.PDPDP.........GPG.......................
K0KYJ5_WICCF/14-204LD--LLM-NEIVPLAIR...TT........E.......E.QSNPI..........DQPTNDESELI..KKLDISPITAGG
K0KLU0_WICCF/62-215LS--FLF-SAMIEQTQQ...TS........K.......G.VQQLE...................................
Q5AH42_CANAL/17-209LQ--FLL-QELVPTSIR...VS........H.......K.LLDPTVST...FAEESEQTRIDQQLS..TIKSDFP...GT
M7SMZ2_EUTLA/56-213FA--YLF-SEMVSYARK...GI........Q.......S.IQDLE...................................
B7QH45_IXOSC/19-163FT--LTY-GSLVAQMLK...DY........E.......S.DEEVN...................................
S8AJT6_PENO1/24-183FD--FLL-IELVPMAER...LA........K.......E.LASHEN..................................
Q6BJ77_DEBHA/81-235LS--FLF-CEIVNWSHK...NS........K.......G.IQDLE...................................
B9REX0_RICCO/10-174ID--SLL-TEMVSSY.................................................................
A7TDQ9_VANPO/62-283MA--FLF-KEMISQIYN...NS........K.......S.SSEFE...................................
B0WI08_CULQU/33-179YA--LLF-SEVVQYCQS...RV........N.......T.IPDLQ...................................
K0THW2_THAOC/54-215FA--LTY-GSLVTELVR...DH........E.......D.PIEVN...................................
M2LVJ4_BAUCO/27-183LT--LTY-GTLVAQLCR...DLTLPSTTSKP.......D.YAAVN...................................
C1E3Y1_MICCC/27-178FA--FLF-SEIVQYHRT...RA........S.......S.IAELE...................................
N1PWF2_DOTSN/25-183VT--LTY-GTIVAQLCR...DLTLPNTSQRT.......D.YAAVN...................................
K1R003_CRAGI/7-154LE--YLH-MEIISQFYR...............................................................
G6CTZ1_DANPL/27-173YA--LLF-SEIVQYCQN...RS........H.......S.INELQ...................................
H3AV40_LATCH/7-156FE--FLH-MEMITYVYK...............................................................
B8BY05_THAPS/56-299YE--FLL-AEILQWVER...DE........K.......R.IAEEARRVQLAVQEMKQQQPTPGADGRESTGGEAQQQSTA
G0W6Q4_NAUDC/35-267YE--MLL-NEIIPMTVS...VE........N.......Q.L.............EMIASEDTSKGDLKEVPIEKLA..LE
E9H4K9_DAPPU/19-165FT--LTY-GALVSQLLK...DY........E.......N.AEDVN...................................
M3JAQ1_CANMX/81-235LS--FLF-CEVINWTHS...NS........K.......G.IQDLE...................................
E0VWU3_PEDHC/35-181FA--LLF-SEVVQYCQN...RV........F.......T.VPELQ...................................
TPPC5_CHICK/29-175FA--LLF-CELVQYCQR...RV........Y.......S.VAELQ...................................
U5GZ24_USTV1/149-310.S--YLL-AEIVQYTQK...RV........S.......G.IGEFE...................................
G3BDP0_CANTC/25-175FI--LTY-GSVVSQLCK...DY.......NQ.......E.YAQVN...................................
A3FPW1_CRYPI/6-158FA--FLF-SEMVQYSLS...CL........K.......P.GIRLE...................................
A0A068Y1Y0_ECHMU/29-182FM--YLF-SEIVKYAMQ...TS........K.......N.LDDAQ...................................
E0VBE5_PEDHC/18-159FT--LTY-GTLVTQLLR...DY........E.......N.VEDVN...................................
Q229D2_TETTS/19-169LT--LTY-GAIVSQIVK...DT........D.......N.IKEAN...................................
Q5ARJ4_EMENI/23-173VT--LTY-GTIVAQLCQ...DY.......DG.......N.YPEVN...................................
D2VAM4_NAEGR/13-161FE--FLH-MEMIEYVVN...............................................................
A5E6K8_LODEL/83-237LS--FLF-CEIVSWAHK...QS........K.......G.IQDLE...................................
G3PGZ9_GASAC/12-159FQ--FLH-NEVLQYIYK...............................................................
K3WA95_PYTUL/9-188FQ--QLY-GEIVRSMIQ...RY........P.......L.FDAAKLAGGSDDPTGNNNANLESG................
E0V955_PEDHC/7-159IE--FLH-AEIVKYVID...S....................NDDK...................................
F0YEM0_AURAN/27-173FC--LTY-GTMVVQLMK...DF........E.......D.VREVN...................................
I2FPM0_USTH4/86-296..--SLA-TEMVHTLIQ...SS........R.......F.VSRKQSLARENLRLAGINIPPPTRPVSIATTTGPNTTAST
C5FQV7_ARTOC/73-244FG--YLF-SEMVIYAQR...RV........T.......G.IQDLE...................................
D8S611_SELML/22-168FT--LTY-GAMVRQLLT...DF........E.......D.VEEVN...................................
C3Z0P3_BRAFL/26-172FA--FLF-SEMVQYCQN...RV........H.......T.VPELQ...................................
A8J2W3_CHLRE/37-190FA--YLF-SEYIQYLVD...RA........N.......S.ITELE...................................
N1J5N2_BLUG1/51-211FA--YLF-GEMVGYAQK...RV........T.......G.IQDLE...................................
N1QHC0_SPHMS/25-275LD--FLL-IELVPLAQR...IT........D.......Q.LHAREQALIEEFRKSKILNNASASTTPAAAAAAPASSSAT
D7ELH8_TRICA/28-174FA--LLF-SEVVQYCQN...KS........H.......T.VPELQ...................................
B9PH75_TOXGV/34-184FA--FLF-SEIVQYCLS...SA........K.......K.GYRME...................................
G8Y8F7_PICSO/26-179FT--LTY-GSVVSQLCR...DF.......NN.......N.YQEVN...................................
G7YIU1_CLOSI/20-169FA--YLF-VEMVRYSMR...NV........P.......N.MDCVQ...................................
H2AYQ1_KAZAF/33-182FT--LTY-GTIVSQLCQ...DY.......DR.......D.FEKIN...................................
A5DAF5_PICGU/11-206LD--FLV-QELVPTAVR...VS........S.......R.LSETSGRD....SDADIATRVDSKLS..SIPNDFP...GS
W5NBF1_LEPOC/14-166FE--FLH-MEMVAHVYK...............................................................
K5XGY5_AGABU/26-191FA--LTY-GALVVQLIQ...DY........E.......D.YDQVN...................................
Q4N4M8_THEPA/26-173YS--FLF-SEIVQYSLT...NS........S..........KDLP...................................
B0CQU1_LACBS/73-229FA--FLF-SEVVQYTQK...RV........N.......G.INDLE...................................
E2AMW5_CAMFO/32-178FA--LLF-SELVQYCQN...RV........Y.......T.VPELQ...................................
G8ZMF5_TORDC/62-270TT--FLF-QGMVSYIHS...HS........K.......S.STEFE...................................
U9V6Y8_RHIID/25-174FT--LTY-GSVVAQLVK...DY........E.......D.YQEVN...................................
F2ULX4_SALR5/17-165..--.LV-AEICRGSKD...............................................................
J5PUV7_SACK1/30-179FT--LTY-GSIVAQLCQ...DY.......ER.......D.FNKVN...................................
G4TPC2_SERID/27-219FT--MAY-GSLVVQLIQ...DY........E.......D.YAEVN...................................
A2DFH3_TRIVA/11-155.A--LVY-GSFVASLLE...MT........E.......D.VEEVN...................................
A4H8R9_LEIBR/29-178LA--LTY-GALVQQLVE...EL.....MQED.......D.VEQVN...................................
D8M290_BLAHO/13-159VS--LTF-GAFVSQIVR...DY........E.......D.EVEIN...................................
F7DY97_XENTR/7-161FE--LLH-MEMVSHVYE...H....................VEED...................................
H2XLK9_CIOIN/10-155FD--LLH-SQLVAYIYS...............................................................
T0MD09_COLGC/45-203FA--YLF-SEMVSYAQR...NV........K.......D.ISELE...................................
A0A068XM21_HYMMI/29-182FM--YLF-SEMVKYAMH...SS........K.......N.VDDAQ...................................
F9X1V4_ZYMTI/54-212FA--HLF-NTLITYHHT...RS........G.......S.VAEIE...................................
A2FQV8_TRIVA/8-151FS--LTY-GSLVRSIVA...ET........N.......N.ISDAN...................................
B3S2G2_TRIAD/32-178FA--FLF-SELVQYCQN...RS........S.......S.VVDLQ...................................
F7AEP2_CIOIN/19-166FT--LTY-GALVSQLIK...DY........E.......K.DEEVN...................................
F4PUP7_DICFS/116-262FE--FLY-IELVDYIIK...SS........N.................................................
F2U9W2_SALR5/24-172YA--LLF-SEVVRYTTN...RV........N.......S.VPELE...................................
A9STP5_PHYPA/24-171FT--LTY-GAIVRQLLT...DY........E.......E.IDEVN...................................
C5DT91_ZYGRC/62-268MA--FLF-QEMIATIHR...AS........S.......S.AQDFE...................................
T1JN97_STRMM/27-173FG--FLF-SEMVQYCQN...RV........Y.......T.VPEFQ...................................
W5MI51_LEPOC/29-175FA--LLF-SEMVQYCQS...RV........Y.......S.VSELQ...................................
A0A068YAR7_ECHMU/19-165FT--LTY-GSLVAQIVK...DF........E.......S.DDAIN...................................
C4QV75_KOMPG/64-226FS--FLF-CELVSWSRE...RA........N.......G.IQELE...................................
B3MSU3_DROAN/7-150FD--CLH-AEIVNYCLD...............................................................
YA95_SCHPO/16-173LD--FLL-IELVHTAKR...LA........E.......D.RK......................................
F4NUA2_BATDJ/28-180YA--FLF-SEMLQYAQK...RV........N.......G.IQDLE...................................
C4QV63_KOMPG/25-176FT--LTY-GSVVAQLCR...DY.......NN.......D.YKKVN...................................
B6K0U0_SCHJY/46-198FA--FLF-SELIQRTQS...RV........T.......G.IQDFE...................................
A8J304_CHLRE/23-167FT--LTY-GSIVRQLIS...DY........E.......D.IEEVN...................................
Q5CYM1_CRYPI/33-178FS--LMY-GSLVAQFVK...DL........D.......N.AELIN...................................
A0C1N5_PARTE/23-175FN--YVF-AEYICYLKR...KH........G......ND.YNEMN...................................
I1FWR8_AMPQE/23-171FT--LTY-GALVAQLVR...DY........E.......S.DDEIN...................................
E3KIT7_PUCGT/25-194FA--LSY-GSLVVQLVK...DY........E.......D.YSQVN...................................
I1IIL5_BRADI/13-174..--.VV-MEMVSAY.................................................................
E1ZCI6_CHLVA/12-169ID--YLA-LALVHHYRT...QG........Q.......G.PSLQ....................................
C4Y011_CLAL4/81-235LS--FLF-CEIVNWAHS...KS........K.......G.IQDLE...................................
M9M538_PSEA3/137-321LS--FLF-GEIVSYTQN...RV........T.......G.VTDLE...................................
T1G2G3_HELRO/30-176FA--LLF-SEIVQYCHN...RV........N.......T.IPELQ...................................
B8BSU9_THAPS/34-187FA--YIY-SELVQYHQG...RA........A.......S.ISELE...................................
G0SHA4_CHATD/46-206FA--YLF-SEMVSYAQK...RS........T.......G.IQELE...................................
A4S1Q7_OSTLU/26-177FA--LTH-GAFVRQILR...DH.......ED.......D.VECAN...................................
G4UMV3_NEUT9/25-221LD--FLL-IELVPMAYR...IT........N.......Q.LDSSSAE.............................PSAS
Q4N8Y2_THEPA/23-170FC--LTY-GSMISQLVR...DK........E.......H.SDAVN...................................
Q6FQX3_CANGA/31-265FN--MLL-NELVPLSMA...VE........N.......D.I................HDMAVKDSNAEDVTVEVLAGDVD
U5D335_AMBTC/11-175VN--SLV-TEMVSSY.................................................................
Q9CAW4_ARATH/10-172VD--TML-MEMVAMY.................................................................
A0A0H5S8A4_BRUMA/12-192FE--FLH-AEIIRYEKQ...RE........I.......K.RTDKRKIW...IEQMRS.......................
V5EZN4_KALBG/139-299LS--FLF-AEMVSYTQN...RV........T.......G.VTDLE...................................
C5DJK5_LACTC/39-188FT--LTY-GSIVSQLCT...DF.......ER.......D.FKKVN...................................
Q6CFM1_YARLI/100-269FA--FLF-SELVQYLLR...QR........KEAGANAGS.LPDLE...................................
T1G6X9_HELRO/19-166FA--LTY-GSIVAQLVN...DY........E.......E.DDEIN...................................
M7XQX5_RHOT1/47-279.E--FFV-QETIRMLID...ST........K.......A.ASER.....RKREHD.SIEAELASLGLSGS.GNGAKGK..
E9HC76_DAPPU/27-173FA--LLF-SEIVQYCQN...RV........S.......T.VPELQ...................................
B3S9Y0_TRIAD/20-167FA--LTY-GALVAQLLK...DY........E.......N.DDDVN...................................
W1QG52_OGAPD/46-210LS--FLF-MEMVSMNLN...QA........K.......S.LIELE...................................
W1QKQ7_OGAPD/25-176FT--LTY-GSIVAQLCR...DF.......NN.......N.YEEVN...................................
B8NLT0_ASPFN/68-238FA--FLF-AEMVIYAQR...RV........T.......G.IQDLE...................................
F8QEM7_SERL3/28-191FA--LTY-GALVVQLIQ...DY........E.......D.YAEVN...................................
C4WXG1_ACYPI/18-164FT--LTY-GAIVSQLMK...DY........E.......N.VEDVN...................................
A0DEI2_PARTE/22-171LT--LTY-GAIVSQIIK...DS........D.......T.VIEAN...................................
Q5BKN1_XENTR/19-166FT--LTY-GALVTQLCK...DY........E.......N.DEDVN...................................
F4NUX8_BATDJ/18-169.D--YFY-MEVVSVEQR...L...........................................................
X6NME0_RETFI/27-208FV--MTY-GALVTQLIK...DL........K.......D.IDEVN...................................
C5LHW2_PERM5/39-200LA--LLY-GATVRQLLV...DF........E.......GDFDKVN...................................
D8LQV4_ECTSI/27-175FT--LTY-GAMVMQLIQ...DF........E.......D.VGAVN...................................
S3CL82_OPHP1/25-222LD--FLL-IELVPMAYR...VT........N.......E.LEAGARARSLV............................Q
B6TBL7_MAIZE/8-172VD--AVV-MEMVAVY.................................................................
G2X4J4_VERDV/43-207FA--YLF-SEMINYAQR...RV........K.......G.VGELE...................................
E1FZ82_LOALO/46-192FA--LLF-AEMIRYANN...RS........N.......T.VSDLQ...................................
A0A023BA01_GRENI/25-169.H--YMF-GSILQYCMA...SS........N.......P.....M...................................
Q4Y963_PLACH/24-168FS--ILF-CEIVQYCLY...KS........K.......K.GYRIE...................................
R9PED1_PSEHS/82-292..--SLA-TEMVATLIH...SS........G.......F.VSRKQTRARQELQRAGIILPTLTKTPSTSTAPGPGSTPTS
H2SS24_TAKRU/7-156FQ--FLH-QELIQYIYK...............................................................
C5M680_CANTT/23-177FT--LTY-GSVVAQLCR...DF.......QN.......N.YHEVN...................................
B4KNN6_DROMO/35-181VA--LLF-SEIVQYSQS...RV........F.......T.VPELQ...................................
D5GMV6_TUBMM/70-223FA--FLF-GEMVQYAQK...RV........N.......G.IADLE...................................
Q57UH5_TRYB2/27-175FA--ITY-GALVQQMIT...DL.....PQAD.......D.VEVVN...................................
G0NYX4_CAEBE/5-183FD--ILH-SEIIRTALE...GE........K.......D.RCEAREQFGTIIENLNG.......................
W1QFA9_OGAPD/15-208LD--YLV-NECVALSVR...VD........E.......L.L...........ASESAPGTLAGDVAGLKLKEDKP...GT
V2X627_MONRO/28-195FA--LTY-GALVVQLIQ...DY........E.......D.YSEVN...................................
V8NPD8_OPHHA/12-161FL--LLH-NEMVSGLYR...............................................................
E1FS68_LOALO/12-192FE--FLH-AEIIRYEKQ...RE........K.......E.QIDKRKSW...IEQMRN.......................
E9FYX1_DAPPU/7-155FD--FLH-MEIVSQVTK...............................................................
B9SBX8_RICCO/30-183FA--FLF-SELVQYNQT...QV........D.......N.IAELE...................................
G4VMI7_SCHMA/18-164FT--LTY-GALVANIVR...DF........D.......T.DAEIN...................................
C5DSC4_ZYGRC/30-179FT--LTY-GAIVSQLCA...DY.......DR.......D.FQKVN...................................
A0A0C4E4C9_MAGP6/42-202FA--YLF-SEMVTYAQR...RI........T.......N.IQDLE...................................
E4UYX6_ARTGP/25-214LD--LLL-IELVPMAER...LV........Q.......E.LELGEKD.................................
TPPC5_PLAF7/24-172FS--ILF-SEMVQYCLY...KS........K.......R.GYRIE...................................
R1GJ88_BOTPV/25-232MD--FLL-IELVPMAYR...MA........A.......E.LAAREDEYVTP....................GNPGATTGR
G8BPN1_TETPH/36-270FQ--LLL-NEVVPLSMA...VE........E.......K.VFDDKIQVNESEDQTNQKAEDVDNSDASNITKD.....IE
I7LU45_TETTS/24-174FG--FLF-SSIIQYHSS...KK........R......NV.EDELK...................................
K7J974_NASVI/23-174FE--YLH-GEMVNYVIG...............................................................
C4WU32_ACYPI/8-151FD--MLH-SEIVSYLVP...............................................................
G3BB76_CANTC/11-168FK--LLI-MEMIPTIIE...VS........R.................................................
Q74ZA3_ASHGO/45-194FT--LTY-GSVVSQLCS...DY.......GR.......D.FTKVN...................................
Q2GUE9_CHAGB/23-174VV--LTY-GAMVAQLCK...DF.......DS.......D.YGKVN...................................
C4WVR1_ACYPI/32-178FA--LMF-SELVQYCQG...KA........H.......T.VNELQ...................................
W4YXQ6_STRPU/27-174FT--LTY-GALVAQLVK...DY........E.......G.DEEVN...................................
J7RXA7_KAZNA/87-338MC--FLY-QGIIAHFHK...RS........K.......T.LQEFE...................................
Q0IEU7_AEDAE/18-164LT--LTY-GALVSQMLR...DF........E.......N.VEDVN...................................
H2AWC3_KAZAF/48-262.Q--MLL-NEIIPTSIS...VQ........N.......R.L.................DESDDNSDAEQL..KKLS..IS
A7SRF2_NEMVE/30-176FA--LLF-SEMTQYCQN...RV........F.......T.VPELQ...................................
F9X8Z0_ZYMTI/25-182VT--LTY-GTIVAQLCR...DLLLPTSSTQT.......D.YAAVN...................................
G0SUM5_RHOT2/32-186FT--LTY-GALVVQLVK...DY........E.......D.YEEVN...................................
D6WJE6_TRICA/18-164VT--LTY-GALVTQMIK...DL........D.......N.TDDVS...................................
S9W187_SCHCR/46-198FA--FLF-SELIQRIQS...QV........S.......G.IQEFE...................................
E9CS20_COCPS/26-194LD--LLL-IELVPMAER...LV........Q.......E.LEANNAPDGANGAKV.........................
G2YWQ0_BOTF4/25-194LD--LLL-IELVPLAYR...TV........H.......A.LDA......PS...........................PP
Q6CJT3_KLULA/45-194FT--LTY-GSIVSQLCQ...DY.......QR.......D.FKKVN...................................
F6PI56_XENTR/22-168FV--LSY-GALVAQLCK...DY........E.......R.DEDVN...................................
J9P7K2_CANLF/40-190FE--FLH-TEMVAELWA...H....................HSDP.........GPG.......................
R4XC32_TAPDE/22-184FV--LTY-GSIVAQLCN...DC........D.......E.YTEVN...................................
E7KII5_YEASA/45-265YQ--MLL-NEMVPLAMG...IE........R.......Q.I........SGDVISSDSNVTSENGNINNM.IKRLK..IE
B6AFL0_CRYMR/33-177FS--LLY-GSLVAQLVK...DL........E.......H.ADIIN...................................
Q6NUY4_DANRE/7-159FE--FLH-MEIVAHVYK...............................................................
U9U2P9_RHIID/42-194FA--FLF-SEMLQYAQK...RV........H.......G.IQDLE...................................
V5GF24_KALBG/79-284.H--TLA-TEMVTTLIH...SS........R.......V.VHRKQTLAREELQQAGITLPTLTK.PSSAPTPAPG.....
M2LT53_BAUCO/23-245LD--FLL-IELVPLAQR...VT........E.......Q.VNARHKALREQYERTRT...............SIRTTAST
A9VBF9_MONBE/9-149..--...-...VAQLLE...DY........E.......D.DEDVN...................................
B6JXV2_SCHJY/22-166FV--LTY-GSIVAQLCK...EM................P.YDQVN...................................
M3YXR2_MUSPF/13-162FL--LLH-NEMVSGVYK...............................................................
F0XPM8_GROCL/25-250LD--FLF-IELVPMAYR...VT........N.......E.LQADAQARSLAVAAAVAGIPGAGPPPRGSMAASVSAARGS
K1RC27_CRAGI/28-174FA--LLF-SEMVQYCQN...RV........Y.......S.VSELQ...................................
G4M1E3_SCHMA/643-797FA--YLF-VELVKYSMR...NV........S.......S.MDLVQ...................................
H0XQ40_OTOGA/31-176FA--LLF-SELVQHCQS...CV........F.......L.VAELQ...................................
Q54TK7_DICDI/133-280FE--FFY-IEMIDCIMK...SS........S.................................................
F6R0S8_MONDO/5-160FS--FLH-SSFISSFWG...G....................GRNS.........GEG.......................
B7G9P1_PHATC/27-178FA--LTY-GALVAELVR...DL........E.......T.NDKIQ...................................
N4UR67_COLOR/25-234LD--FLL-IELVPMAYR...VT........K.......Q.LDIAPVE.GAG..............TPGDAASSSVSHSQA
I2G5Q2_USTH4/26-174FT--LTY-GALVIQLIK...DY........E.......D.YTEVN...................................
M7NLF3_PNEMU/15-189MD--LLL-IEMIPIMKR...LT..........................................................
A3LWB7_PICST/17-213LQ--LLL-QELVPTSIR...VS........H.......R.LHDSTSTTGASLANSTEPTQADTQLS..SVRNDLP...GT
B0DXI4_LACBS/36-240MD--YFL-IEMVNTLKQ...SA........A.......F.ATARSKKIEQEMIEAGLI.........PPPAPLPLNLKKE
Q6C4X8_YARLI/7-176LE--LLL-AEVVPAALR...VS........Q.......E.LTEPE.......................EGSKMAP.....
M2RGY3_CERS8/28-198FS--LTY-GALVVQLVQ...DY........E.......D.YAAVN...................................
G1KP89_ANOCA/19-164FV--LTY-GALVAQLCK...DY........E.......H.DEDVN...................................
F6ZPU3_CIOIN/28-174FA--LLF-SEMIQYSQN...RV........R.......S.VAELQ...................................
H3G610_PHYRM/6-148FA--LTY-GSLVTQLIK...DF........E.......D.LKVVN...................................
TPPC3_CAEBR/20-166FC--LTY-GAMVTEMLK...DY........E.......D.PKDVT...................................
D3BR33_POLPA/141-287FE--FLY-IEMIDYIVK...SS........R.................................................
E4XK01_OIKDI/26-172YT--LLF-AEMVRYCQD...RA........N.......S.LDDVA...................................
F6U759_MACMU/13-160FE--FLH-TEMVAELWA...H....................DPDP.........GPG.......................
G6CHQ2_DANPL/18-161LT--LTY-GALVSQMLK...EI........D.......N.PEDVN...................................
G1XT68_ARTOA/25-235ID--LLL-IELVPLVQR...MA........E.......S.APSLDYPIPTS..............YSNKLNEIENLPSTP
E2ATA3_CAMFO/23-173FE--YLH-AELVNYVLS...............................................................
E9AFF6_LEIMA/35-197FS--FLF-SELCVRAYTFPTKV........K.......N.VEEVE...................................
K1QH85_CRAGI/19-166FS--LTY-GALVAQLLK...DY........E.......D.DEEVN...................................
S8FDP6_FOMPI/33-233MD--YFV-IEMVSALRA...SS........A.......V.AAARAKKLEHDMIEAGLV.........PAPSHVPPTLK.D
D8R4W7_SELML/16-172..--.IT-MEMVATY.................................................................
Q6CPP3_KLULA/68-235YA--FLF-QSIVSYHRD...SS........K.......N.VQEIE...................................
Q4D5L3_TRYCC/27-174FA--ITY-GALVQQMVA...DL.....VQEE.......D.VEVVN...................................
E3L3N3_PUCGT/89-270FE--LLF-AEIVRYTQQ...RV........D.......G.IGEFE...................................
A5DI63_PICGU/78-232LS--FLF-CEIVSWAHR...QS........K.......G.ISDLE...................................
I4Y7D2_WALMC/18-172WA--FLF-SEIINYNLK...RV........D.......G.IAELE...................................
C8V0H5_EMENI/25-184LD--FLL-IELVPMAER...IA........K.......D.LAADERL.................................
TPPC5_DICDI/25-178FA--FLF-SEMIQYCQD...RI........K.......A.GHELE...................................
V2WY43_MONRO/33-234MD--YLL-IEVVNTLRE...SS........A.......V.ATARSKKIEQEMLEAGLI.........PPA...PAVTQPS
A8N0N0_COPC7/32-255.E--YFL-IEMVSTLRE...SA........A.......Y.ATARSKAIEKEMADAGLIVPTPTTVTGPPAASGSRGSQPP
F0YNA2_AURAN/14-167FA--HLF-SEIVQYQST...RI........Q.......T.AADLE...................................
R7YXJ3_CONA1/25-225LD--FLL-IELVPLAQR...MA........T.......E.IAEREEEW.TR....................GSLTAS...
T1ELP2_HELRO/7-152YD--FLL-LEMVDTMLQ...............................................................
Q6FMN4_CANGA/21-208MT--FLY-QEMISNIHN...DC........K.......D.INEFE...................................
G0VDG8_NAUCC/35-184FA--LTY-GALVAQLFE...DY.......DN.......D.YSLIN...................................
E9E9Y1_METAQ/640-835LD--FLL-IELVPLAYR...IA........N.......E.RD.............................STQDLPEPA
I4Y6T3_WALMC/34-192.D--LLT-IELIPTLRT...ST........E.......E.EMKRDD..................................
R4FKT2_RHOPR/29-175FA--LLF-SELVQYCQN...KV........H.......T.VPELQ...................................
G3P0A2_GASAC/7-161FD--FLH-MEIVSHIYK...............................................................
R4FPN5_RHOPR/18-161FT--LTY-GALVSQLMR...DY........E.......N.VEDVN...................................
G6CLX9_DANPL/7-155FE--LLH-SEIINYSLE...............................................................
S9W2C4_SCHCR/22-169FV--LTY-GSIVAQLCR...DM................N.YEYVN...................................
B6AG61_CRYMR/12-186VT--LLR-YEYLNYCVE...VA........R.......E..VSSKAQFQEDENGNDIIDEKGL.................
B7G7P9_PHATC/18-194FE--FLV-TELTHYSRA...HCAPASDSQRD.................................................
G4TBB1_SERID/92-248FT--FLF-SEMIQYTQK...RV........N.......G.VADFE...................................
H2B1V9_KAZAF/63-287MA--FLF-QQMIIHFHK...DS........K.......T.VHEFE...................................
G1WYZ0_ARTOA/60-213FA--FLF-GEMVQYAQK...KV........Y.......G.VQDLE...................................
J7S6F2_KAZNA/43-192FH--LTY-GTIVAQLCE...EY.......AG.......D.YARVN...................................
M7X5P9_RHOT1/76-239WA--YLF-AELVQYTQK...RV........S.......G.ISEFE...................................
D0MS35_PHYIT/9-170FQ--QLF-GEIVRSMVE.............................GAAATTPTAEEEA.....................
G3AVF7_SPAPN/17-209LD--FLL-QELIPTSIR...VS........H.......K.LMNSQQSS...VEEQDVPTTIDQQLS..SIEGDLP...GT
C4Y593_CLAL4/16-205LD--LLL-QEVIPTSVR...VS........S.......R.LSDSS.......AAPEQNTTITTPLS..SVPNDLP...GS
H2ZW82_LATCH/19-167FV--LTY-GALVAQLCK...DL........Q.......N.DEDIN...................................
T1KX51_TETUR/32-178FA--FLF-SEVVQYCHS...KV........Y.......T.VPELQ...................................
F0V9N6_NEOCL/25-171LS--LTY-GTLVTQLLK...DF........E.......Q.IDAIN...................................
S2JN73_MUCC1/38-191MD--LFL-IEMVDTICR...TT........T.................................................
C4M937_ENTHI/26-176LT--MTY-GGIVLQLLK...EN........E.......FDGEKVN...................................
E1ZNY8_CHLVA/9-156FT--LTY-GSMVRQLIA...DH........E.......D.VEEVN...................................
M7PDJ0_PNEMU/34-186FS--FLF-GEIVRYTQK...RV........Q.......G.IYELE...................................
G3AII8_SPAPN/79-233LS--FLF-CEIVNWTHG...QS........R.......G.IHDLE...................................
U5H198_USTV1/33-186FS--LTY-GALVVQLIK...DY........E.......D.YQQVN...................................
G1XR36_ARTOA/26-178VT--LTY-GSVVAQLCK...DL.......DG.......D.YVEVN...................................
Q8I1Q2_PLAF7/25-167FS--FTY-GALVSQLLK...DL........E.......L.VDEVN...................................
S2JY55_MUCC1/30-178FT--LTY-GSMVVQLVK...DF........E.......D.YGEVN...................................
S2JN70_MUCC1/45-196.T--FLF-SEMLQYAQK...RV........N.......G.IQDLE...................................
S8C0P6_DACHA/25-225ID--LLL-IELVPLVQR...MA........E.......S.APTLEFPTP.S..............YA......RSAPAAD
U9SP50_RHIID/54-206LE--FLI-MEMVDLMYR...TT..........................................................
E5SI08_TRISP/1-145..--MTY-GALVLQLLD...DF........D.......R.DEEVN...................................
Q013E9_OSTTA/27-181FA--LVF-SELVQYHRA...RV........R.......D.VGELE...................................
B5Y485_PHATC/37-194FS--YLY-SEIVQYHQN...RV........D.......S.ISELE...................................
D2W234_NAEGR/23-174LA--MTY-GSLVTQMLK...DF........E.......D.VAAVN...................................
Q4WDM1_ASPFU/25-185LD--FLL-IELVPMAER...LT........R.......E.LALNDKA.................................
G0WER0_NAUDC/44-292MT--FLY-QEMISYLHQ...SS........T.......T.MAEFE...................................
R0KDH4_SETT2/38-201FA--YLF-IEMIAYAQK...GA........K.......D.VGDLE...................................
K2SHS1_MACPH/53-225FA--YLF-VEMITYAQR...KV........T.......G.VADLE...................................
TRS31_ENCCU/10-152MS--YLV-CGMIEYLME.....................Q.RSDIE...................................
G8JU67_ERECY/59-227FT--FLF-QEMVAQQRD...SS........K.......T.VVEIE...................................
I2GX78_TETBL/27-183FT--LTY-GSIVTQLVD...EL.......ND.......D.YHLVN...................................
C7Z9W5_NECH7/25-227LD--FLL-IELVPLAYR...VT........H.......E.RD............................TALSDPSSTP
F6T488_ORNAN/102-268FQ--LLH-TEMVIQASR...R....................DPDPQGTIPAQCRGPG.......................
B8BZL3_THAPS/26-186FA--LTY-GSLVTELVR...DY........E.......D.PIEVN...................................
Q6CCJ8_YARLI/25-176FK--LTY-GSIVAQLCK...DY.......NG.......D.YLAVN...................................
M7NS17_PNEMU/22-171FV--LTY-GSIVAQLCK...EY........D.......D.YAQVN...................................
S9W411_SCHCR/16-172FD--FLL-IEMVHMARR...LS........E.......K.QE......................................
A3FQ35_CRYPI/12-189LT--FLR-YEYLNYCIN...KS........S.......E.LISDEKNFQTVKHSKK.LSISGL.................
G3AXG1_CANTC/75-229LS--FLF-CEIVNWSHK...KS........K.......G.IQDLE...................................
G0V7A4_NAUCC/49-256MT--FLF-QEMINYLHQ...SS........S.......T.MSEFE...................................
H2VJ79_CAEJA/24-170FA--VLF-SEMVLYAQN...RS........E.......T.VTDIH...................................
A8Q0V9_MALGO/24-202FS--LTY-GALVVQLIK...DF........E.......D.YEQVN...................................
G0SHJ8_CHATD/26-235LD--FLL-IELVPMAYR...VT........N.......D.LEQAAREKELS................SSSNTSSNPTPIP
A8NES9_COPC7/27-191FA--LTY-GALVVQLIQ...DY........E.......D.YDEVN...................................
I1LSM6_SOYBN/24-171FT--LTY-GAIVRQLLT...DL........E.......E.AEEVN...................................
F4RQH4_MELLP/2-196FE--FLF-SEIIRYTQS...RV........D.......G.IQEFE...................................
U4L5M6_PYROM/25-185LD--LLL-IELVPLAKR...MA........E.......Q.L.......................................
Q6BKS7_DEBHA/16-206FH--LLV-SELVPTSIR...VS........K.......Q.VNETRIGA....DTEFEPTTMETPLS..DAGDDKP...GT
E3RF54_PYRTT/20-170VT--LTY-GTIVAQLCK...DY.......EY.......N.YMDVN...................................
J9F2R2_WUCBA/21-167FT--LTY-GALVAELLR...DL........E.......S.PLAVN...................................
F1A4T0_DICPU/24-172FT--LTY-GALVTQLIK...DY........E.......D.IEQVN...................................
Q17E67_AEDAE/7-152FE--YLH-SEIVNYTLT...............................................................
C5DM27_LACTC/105-310YA--FLF-QEMVSQARN...AS........K.......T.VSEIE...................................
B9MZL8_POPTR/10-169MD--GLV-TEMVSSY.................................................................
F2UT79_SALR5/14-156FT--MTY-GALVAQLLE...DY........E.......S.DDEVN...................................
A2DKK6_TRIVA/18-173YA--LLF-SEIVQYCHQ...KS........E.......S.SEQFS...................................
G8YIQ3_PICSO/12-197FH--LLV-MELVPSTIR...MD........D.......M.LKQRQ.......EREFEPTRIDTQLS..SSKKDLP...GS
F9XI11_ZYMTI/25-225LD--FLL-IELVPLAQR...IT........D.......Q.LHAREQALIDDFRRKGA.......................
S0DWK2_GIBF5/51-208FA--YLF-GEMVTYAQR...RV........K.......G.IQELE...................................
D8PVM2_SCHCM/27-195FA--MTY-GALVAQLVQ...DY........E.......D.YQEVN...................................
I1FYD4_AMPQE/18-164FE--FLH-MEMVSYLVS...............................................................
G8BSU5_TETPH/62-267MA--FLY-QELISQIYK...NS........K.......T.STEFE...................................
G0VA51_NAUCC/38-275FQ--MLL-NEIVPQAMA...VE........N.......E.LNDLNSLEQTGDRTSAVEGERKGEGEAENIPINDLS..LQ
U5GYW5_USTV1/49-283FE--YMM-QEVIRTIIT...SE........S.......V.ARERRIAYERQVEHDLKLARATSSVTLNTSNGNGKTSAAM
F4NWB8_BATDJ/26-174FT--LTY-GSLVAQLIK...DF........E.......D.YSQVN...................................
T1KC63_TETUR/18-164FS--LTY-GSLVFQLIK...DY........E.......N.PEDVN...................................
A7AQG4_BABBO/23-170LA--LTY-GSIVSQLIK...DI........E.......F.TDGVN...................................
I4YJW3_WALMC/26-173FV--MTY-GALVMQLVQ...DY........E.......D.YSAVN...................................
R4XFR7_TAPDE/28-211.E--LLM-IEMTSLAHR...LT........E.......R.TVLARSQSKQIVSSS.........................
TPC3L_MOUSE/19-165FV--LTY-GALVAQLCK...DY........E.......K.DEDVN...................................

PF06505

H0PV77_9RHOO/7-107DF------HSLVEFAPE---------------------RGAIQFSG----------------------------------
Q5P0J1_AROAE/9-107..------FSLVELRPN---------------------EGAIEFCG----------------------------------
R4KI47_9FIRM/12-108..------..LLTVNKD---------------------EGLIRFNQ----------------------------------
A4XDS4_NOVAD/9-109DI------ASKLQFSPE---------------------MGRIWHDG----------------------------------
D8IX14_HERSS/38-138DL------SECLFFSPG---------------------DGRIWLND----------------------------------
A7HF91_ANADF/7-100DL------RELLSFEPG---------------------GGVIRFGG----------------------------------
A1K8A8_AZOSB/11-111DL------RQLLRFSDK---------------------DGLIWLGE----------------------------------
I2B6U1_SHIBC/10-108DL------ATQLRLIPE---------------------QGHIWLGE----------------------------------
R4KRR0_9FIRM/9-106.L------EKMLSLQPE---------------------AGKNYLKN----------------------------------
F2JW36_MARM1/38-138DL------TESLHFSPG---------------------DGRIWLED----------------------------------
Q5NZX3_AROAE/20-120DL------ATRLRFEFT---------------------EGNIWLGE----------------------------------
A4XEH5_NOVAD/4-104DL------FSQLHFDHA---------------------QGHIWLAG----------------------------------
A2SEH5_METPP/23-116.L------TEHLRFSPD---------------------AGHIVLFE----------------------------------
Q5P8R7_AROAE/38-136DI------SACLSFSPD---------------------DGYIWLND----------------------------------
Q1LMF9_CUPMC/12-114.L------ASLLTIDAK---------------------AAQIRLGQ----------------------------------
Q1D007_MYXXD/8-108DL------SELLSFDPG---------------------GGLIHFGG----------------------------------
C4KBD8_THASP/11-110DL------RSLLRFAAE---------------------DGLIWLGE----------------------------------
B2UJH4_RALPJ/12-112DL------RRLLRFDPE---------------------SGTIWLGE----------------------------------
A6VSL2_MARMS/38-138EL------TECLFFSPG---------------------DGRIWLDD----------------------------------
H0Q4U8_9RHOO/14-114DL------RARVHFCAD---------------------TGQIWLHE----------------------------------
B3E548_GEOLS/7-99DL------RELLSFAPG---------------------GGIIRFMG----------------------------------
R4KCK2_9FIRM/5-98NL------RDLLEFRPE---------------------EGVISLKE----------------------------------
A2SI53_METPP/6-104SL------...LRFSAA---------------------SGHIWLDE----------------------------------
Q12HA0_POLSJ/50-149DI------SECLFFSPG---------------------DGRIWLQD----------------------------------
Q0K3T9_CUPNH/18-118DL------ARRLRFAME---------------------EGAIWLDE----------------------------------
R4KSH1_9FIRM/5-97DL------KELFEFKPE---------------------QGIVFLKD----------------------------------
M4WWY6_PSEDE/17-117EL------AETVAFSPQ---------------------DGSIWLCG----------------------------------
X4ZFX6_9BACL/9-108.L------KDLVHFSKE---------------------EGDFFLRD----------------------------------
B9M8I2_GEODF/18-118DL------RARVHFCME---------------------SGHIWLHE----------------------------------
S6ACH6_PSERE/16-116DL------TDRVRFLGN---------------------EGKIWLDE----------------------------------
A5VBE2_SPHWW/29-129DL------LETFHFDPD---------------------KAEIFLNG----------------------------------
C4ZM82_THASP/8-107.F------HALIDFMPD---------------------SGAIRFCG----------------------------------
A1K6K4_AZOSB/13-113NL------RSRLRFDID---------------------GGNIWLDE----------------------------------
F6A9L0_PSEF1/37-137DL------TECLFFSPG---------------------DGRIWLND----------------------------------
B2UJH2_RALPJ/38-138DL------AKRLRFAPQ---------------------QGRIWLDD----------------------------------
F6IM12_9SPHN/9-109DL------TNRLRFSPE---------------------QGRIWRDS----------------------------------
D4Z0A6_SPHJU/14-114DL------WSKLRFDPG---------------------TGTVWLDE----------------------------------
C1DMU8_AZOVD/16-116DL------TGQIRFVEK---------------------EGKIWLGQ----------------------------------
V5UEH6_9BURK/33-133DL------AERLRFNPA---------------------DGRIWLDD----------------------------------
A2SED5_METPP/49-149EL------AEWLTFDPD---------------------TGRIWLDD----------------------------------
G8MIU1_9BURK/19-119DL------MSRLHFSPG---------------------DGRIWLDE----------------------------------
A2SL24_METPP/19-119DL------VSRIHFDAR---------------------EGRIWLDE----------------------------------
N0AQH3_9BACI/27-119..------......QSN---------------------NGKLMLNN----------------------------------
Q479F4_DECAR/11-111DL------RNLVKFCEK---------------------DGTIWLAE----------------------------------
Q088E6_SHEFN/7-101DL------RELLAFKPR---------------------GGTMSFLG----------------------------------
Q2G887_NOVAD/24-124DL------RKSLHFMPD---------------------EASIWLDG----------------------------------
B3E5G9_GEOLS/7-102DL------REMLSFNPE---------------------GGIIHLLG----------------------------------
D0J206_COMT2/2-100..------RSQVRFSTE---------------------DGLIWLSG----------------------------------
A1WLM8_VEREI/12-112DL------RKLLRFEPD---------------------SGAIWLGE----------------------------------
R4KJN7_9FIRM/7-106.L------TELLDINKE---------------------DGIINFRG----------------------------------
D4Z086_SPHJU/33-133DL------RDSFHFDPA---------------------RAEIRLGK----------------------------------
B3E5J6_GEOLS/7-101DF------RELLSFNPQ---------------------GGVIRFLG----------------------------------
D0LSA1_HALO1/10-102DL------...LELDPG---------------------GGVYRFGG----------------------------------
A9GJU8_SORC5/7-100DI------RKLLDVDAR---------------------GGVVRFAG----------------------------------
B3E546_GEOLS/15-108DL------RRILSFRPK---------------------GGTIQFMG----------------------------------
D5WW71_KYRT2/9-107D.------.QLLEINPR---------------------TGIITLNG----------------------------------
X2H462_9BACI/11-106..------..AIDINPR---------------------SGIIKFNG----------------------------------
B9M024_GEODF/20-120NL------RSQLRFSSE---------------------TGEIWLHE----------------------------------
A1W2I5_ACISJ/16-116DL------RRLVHFSPV---------------------DGRIWLAD----------------------------------
Q15NZ0_PSEA6/36-137DL------SDRLRFIPE---------------------EGRVVLGD----------------------------------
Q39TS9_GEOMG/18-118DL------RSRLRFCVE---------------------TGQIWLHE----------------------------------
E4PKW5_MARAH/16-116DL------TEQIRFQST---------------------EGKIWFGE----------------------------------
C1DN78_AZOVD/11-111NL------RSRLRFDID---------------------AGQIWLDE----------------------------------
E1QE48_DESB2/9-101..------AELIQRDAS---------------------TGFPVIND----------------------------------
Q39TT1_GEOMG/18-118DL------RSLVHFCAE---------------------TGQIWLHE----------------------------------
G7UPC2_PSEUP/14-114DL------RRLVQFSAG---------------------DGRIWLAG----------------------------------
B9M014_GEODF/21-120.M------RSQLRFSSE---------------------TGQIWLHE----------------------------------
H8MRM3_CORCM/8-104DL------KELLAFEPK---------------------GGVIRFAG----------------------------------

PF03500

Q76KJ6_KOMHA/10-153FT--LFL-QTLSWEIDD---------------------QVGIEVRN----------------------------------
G2I1Y6_KOMMN/10-153FS--LFL-QALSWEIDD---------------------QAGIEVRN----------------------------------

PF07700

D6W9P2_TRICA/2-164MG-----------------------------------------------------------------------------A
D6W9P2_TRICA/657-819MA-----------------------------------------------------------------------------S
G7YDL4_CLOSI/2-164LP-----------------------------------------------------------------------------S
B3RIY3_TRIAD/1-164TV-----------------------------------------------------------------------------D
T2G861_DESGI/430-584MH-----------------------------------------------------------------------------Q
C3XW68_BRAFL/2-165TY-----------------------------------------------------------------------------D
A7S7B2_NEMVE/2-170IF-----------------------------------------------------------------------------K
H2UDL7_TAKRU/2-163TM-----------------------------------------------------------------------------Q
K0CAD4_ALCDB/2-162LE-----------------------------------------------------------------------------D
F4B0A3_DOKS4/2-162MV-----------------------------------------------------------------------------S
F2UP57_SALR5/2-165TG-----------------------------------------------------------------------------S
C3YJ22_BRAFL/2-164LL-----------------------------------------------------------------------------R
B3RTK0_TRIAD/1-164TY-----------------------------------------------------------------------------D
W4XRE1_STRPU/2-164IP-----------------------------------------------------------------------------R
D3F0L8_CONWI/2-160LL-----------------------------------------------------------------------------G
A4XK74_CALS8/2-160VH-----------------------------------------------------------------------------K
F2JRL4_CELLD/2-160IF-----------------------------------------------------------------------------K
H9JIF1_BOMMO/5-169TY-----------------------------------------------------------------------------N
H2ZHQ6_CIOSA/2-167MA-----------------------------------------------------------------------------I
A6M0J2_CLOB8/2-160VK-----------------------------------------------------------------------------K
Q899J9_CLOTE/21-179LK-----------------------------------------------------------------------------K
G7YSC7_CLOSI/2-164LP-----------------------------------------------------------------------------R
B0C2H7_ACAM1/2-163TY-----------------------------------------------------------------------------R
C5ARV9_METEA/2-162MQ-----------------------------------------------------------------------------A
A7RZH8_NEMVE/3-165FQ-----------------------------------------------------------------------------R
D3SA24_THISK/2-160MM-----------------------------------------------------------------------------R
I1FML3_AMPQE/2-163MS-----------------------------------------------------------------------------D
K6YZX2_9ALTE/2-163TF-----------------------------------------------------------------------------Q
F8DBD3_HALXS/2-162VL-----------------------------------------------------------------------------E
Q8RBX6_CALS4/2-160VR-----------------------------------------------------------------------------R
F7YXL0_9THEM/2-160PL-----------------------------------------------------------------------------S
W4XH19_STRPU/14-176TL-----------------------------------------------------------------------------N
R4KI66_CLOPA/3-161VN-----------------------------------------------------------------------------N
W5KMY4_ASTMX/2-163TL-----------------------------------------------------------------------------R
A9KIK0_CLOPH/2-160AM-----------------------------------------------------------------------------G
B7VPN5_VIBTL/2-162LV-----------------------------------------------------------------------------R
T1ITQ9_STRMM/2-166TL-----------------------------------------------------------------------------K
G4LU97_SCHMA/2-164MA-----------------------------------------------------------------------------R
F2UQW4_SALR5/2-164TQ-----------------------------------------------------------------------------T
H2ZCI7_CIOSA/2-166TF-----------------------------------------------------------------------------D
A7HJF4_FERNB/2-160VV-----------------------------------------------------------------------------R
K1R2B8_CRAGI/26-188IP-----------------------------------------------------------------------------D
W5L1E6_ASTMX/2-163TV-----------------------------------------------------------------------------R
Q15VN4_PSEA6/2-162LF-----------------------------------------------------------------------------T
C3Y563_BRAFL/2-164IP-----------------------------------------------------------------------------R
Q7MJS8_VIBVY/2-162LV-----------------------------------------------------------------------------S
C3XXH9_BRAFL/2-165LP-----------------------------------------------------------------------------R
S0ESS7_CHTCT/2-160LF-----------------------------------------------------------------------------K
H3CKY4_TETNG/2-164IL-----------------------------------------------------------------------------R
A7RN69_NEMVE/100-264TY-----------------------------------------------------------------------------S
F1NZB6_CHICK/2-163TM-----------------------------------------------------------------------------Q
F7YL52_VIBA7/2-161LL-----------------------------------------------------------------------------A
J9K961_ACYPI/2-175MP-----------------------------------------------------------------------------E
E2AD43_CAMFO/2-164MT-----------------------------------------------------------------------------N
F2UCB7_SALR5/2-165TA-----------------------------------------------------------------------------A
A2U1J5_9FLAO/2-162ML-----------------------------------------------------------------------------S
Q97E73_CLOAB/2-160VN-----------------------------------------------------------------------------N
Q9A451_CAUCR/2-160WE-----------------------------------------------------------------------------T
B3RYQ3_TRIAD/1-165TV-----------------------------------------------------------------------------K
T1IYK0_STRMM/2-165ML-----------------------------------------------------------------------------T
F3Z380_DESAF/437-596MG-----------------------------------------------------------------------------Q
I3LMI1_PIG/2-166TY-----------------------------------------------------------------------------D
B2IZ76_NOSP7/2-163TH-----------------------------------------------------------------------------K
G4QEK6_GLANF/2-166CL-----------------------------------------------------------------------------K
G4VI29_SCHMA/12-176LP-----------------------------------------------------------------------------N
B7PJ68_IXOSC/2-166TL-----------------------------------------------------------------------------K
GCY33_CAEEL/2-164VP-----------------------------------------------------------------------------Q
M1MBZ2_9CLOT/2-160VN-----------------------------------------------------------------------------K
D3Z022_MOUSE/2-163TV-----------------------------------------------------------------------------K
Q8YUQ7_NOSS1/2-164TY-----------------------------------------------------------------------------H
E3PR11_CLOSD/2-160VF-----------------------------------------------------------------------------R
F4EW09_SELS3/2-160IR-----------------------------------------------------------------------------T
H3EBU1_PRIPA/15-180TY-----------------------------------------------------------------------------L
B7PID1_IXOSC/2-165MT-----------------------------------------------------------------------------R
H2ZQM8_CIOSA/2-166VP-----------------------------------------------------------------------------N
E3MCF9_CAERE/2-167TY-----------------------------------------------------------------------------T
G7YSC6_CLOSI/2-164LP-----------------------------------------------------------------------------R
X5E3Q9_9BACT/2-162MF-----------------------------------------------------------------------------A
F2TX50_SALR5/2-165TL-----------------------------------------------------------------------------N
H2J852_MARPK/2-160LE-----------------------------------------------------------------------------K
D5BKH5_ZUNPS/2-162MQ-----------------------------------------------------------------------------S
G8X8N8_FLACA/2-163TY-----------------------------------------------------------------------------K
K1S3W9_CRAGI/2-166TY-----------------------------------------------------------------------------D
H0PYD0_9RHOO/2-161TV-----------------------------------------------------------------------------G
Q47Y43_COLP3/2-162LI-----------------------------------------------------------------------------N
K8GF64_9CYAN/2-163TH-----------------------------------------------------------------------------K
G0NDJ7_CAEBE/2-167TL-----------------------------------------------------------------------------R
K4IJS2_PSYTT/2-161MF-----------------------------------------------------------------------------K
K1PH87_CRAGI/2-166VK-----------------------------------------------------------------------------R
F8EFN5_RUNSL/2-162MV-----------------------------------------------------------------------------N
A6TMH7_ALKMQ/2-160IF-----------------------------------------------------------------------------S
K9VYK2_9CYAN/2-163TH-----------------------------------------------------------------------------R
G6CKQ3_DANPL/2-164IT-----------------------------------------------------------------------------R
E6VZ54_DESAO/523-677LL-----------------------------------------------------------------------------Q
E0VW08_PEDHC/2-166MT-----------------------------------------------------------------------------K
F2U5L4_SALR5/2-172SN-----------------------------------------------------------------------------N
G3PRL3_GASAC/2-163TL-----------------------------------------------------------------------------S
F4A1A5_MAHA5/7-165AK-----------------------------------------------------------------------------A
H2YUP4_CIOSA/2-167IP-----------------------------------------------------------------------------L
C5BIN2_TERTT/2-162LQ-----------------------------------------------------------------------------T
E3DMW8_HALPG/2-160TK-----------------------------------------------------------------------------D
Q5E1F5_VIBF1/2-160LV-----------------------------------------------------------------------------K
Q2SFY7_HAHCH/2-160MV-----------------------------------------------------------------------------E
F6GI89_LACS5/2-162ML-----------------------------------------------------------------------------Q
D8U0R1_VOLCA/59-223TY-----------------------------------------------------------------------------D
A3HWD6_9BACT/2-163TY-----------------------------------------------------------------------------Q
C3Y428_BRAFL/2-164IL-----------------------------------------------------------------------------R
B8D0K8_HALOH/2-160VF-----------------------------------------------------------------------------D
A7RN72_NEMVE/2-166TL-----------------------------------------------------------------------------R
T1ITQ7_STRMM/2-166TY-----------------------------------------------------------------------------N
B3RYQ5_TRIAD/10-174TF-----------------------------------------------------------------------------E
L0JGE2_NATP1/2-161VY-----------------------------------------------------------------------------E
A8F5S3_PSELT/2-160PI-----------------------------------------------------------------------------N
B0CD92_ACAM1/2-163TH-----------------------------------------------------------------------------R
A5I7T3_CLOBH/2-159VK-----------------------------------------------------------------------------N
F2U0N3_SALR5/2-164TL-----------------------------------------------------------------------------L
W4XR28_STRPU/4-177LI-----------------------------------------------------------------------------H
G1KLN8_ANOCA/2-162TL-----------------------------------------------------------------------------K
D9SRG3_CLOC7/2-160PK-----------------------------------------------------------------------------I
K9X5Q3_9NOST/2-163TH-----------------------------------------------------------------------------R
G7YQF8_CLOSI/2-164LP-----------------------------------------------------------------------------K
F0RGN9_CELLC/2-162MV-----------------------------------------------------------------------------S
F6YJD6_XENTR/8-169TL-----------------------------------------------------------------------------Q
Q5ZWM9_LEGPH/2-162FQ-----------------------------------------------------------------------------Q
E3N9U4_CAERE/2-167TM-----------------------------------------------------------------------------R
B8DKJ8_DESVM/531-685LK-----------------------------------------------------------------------------Q
B3RYQ6_TRIAD/11-175TF-----------------------------------------------------------------------------D
E9GML5_DAPPU/2-166VM-----------------------------------------------------------------------------E
F0LTC6_VIBFN/2-162LV-----------------------------------------------------------------------------K
D5XA10_THEPJ/2-162VM-----------------------------------------------------------------------------K
H2Y4L1_CIOSA/2-168IP-----------------------------------------------------------------------------M
F2TZE3_SALR5/2-165TA-----------------------------------------------------------------------------L
F2UN82_SALR5/2-165TA-----------------------------------------------------------------------------A
A6GYD7_FLAPJ/2-163TF-----------------------------------------------------------------------------K
A0PXJ5_CLONN/2-160VQ-----------------------------------------------------------------------------D
B3S7Q2_TRIAD/2-165TY-----------------------------------------------------------------------------D
Q21E20_SACD2/2-162VV-----------------------------------------------------------------------------G
K0ATP4_CLOA9/2-160AK-----------------------------------------------------------------------------G
T1KFI6_TETUR/2-166TY-----------------------------------------------------------------------------N
F2UR64_SALR5/2-165TM-----------------------------------------------------------------------------K
A6LK33_THEM4/2-160VV-----------------------------------------------------------------------------K
G3Q1S5_GASAC/2-164IP-----------------------------------------------------------------------------R
C3ZF94_BRAFL/7-169ME-----------------------------------------------------------------------------K
B8HJS1_CYAP4/2-164TH-----------------------------------------------------------------------------R
B7PFU6_IXOSC/2-164IL-----------------------------------------------------------------------------K
W4Z032_STRPU/9-171TY-----------------------------------------------------------------------------Q
G4VA36_SCHMA/2-164PE-----------------------------------------------------------------------------R
Q310U7_DESAG/727-881LR-----------------------------------------------------------------------------Q
A8MIN2_ALKOO/2-160IF-----------------------------------------------------------------------------K
F2TZ95_SALR5/2-165TM-----------------------------------------------------------------------------L
E9GML8_DAPPU/2-166IM-----------------------------------------------------------------------------K
K9UD61_9CYAN/2-163TY-----------------------------------------------------------------------------R
G3RZQ8_GORGO/2-166TI-----------------------------------------------------------------------------K
E9GML7_DAPPU/2-166VM-----------------------------------------------------------------------------K
G8R6C6_OWEHD/2-162IV-----------------------------------------------------------------------------A
K7AQ34_9ALTE/2-162LF-----------------------------------------------------------------------------M
Q21ER7_SACD2/2-162AI-----------------------------------------------------------------------------A
I7CPA5_NATSJ/2-161ID-----------------------------------------------------------------------------A
Q7Q9W6_ANOGA/2-164IP-----------------------------------------------------------------------------D
E9FT54_DAPPU/24-187TY-----------------------------------------------------------------------------N
A7RN70_NEMVE/2-168TS-----------------------------------------------------------------------------D
I2EZ72_EMTOG/2-162MV-----------------------------------------------------------------------------Q
B2A8E6_NATTJ/2-160AR-----------------------------------------------------------------------------G
I0K9V5_9BACT/2-162MI-----------------------------------------------------------------------------A
M1MRY0_9CLOT/2-160IN-----------------------------------------------------------------------------T
A9V7H3_MONBE/2-165SF-----------------------------------------------------------------------------S
K9UZY1_9CYAN/2-164TY-----------------------------------------------------------------------------R
Q87NJ1_VIBPA/2-162LV-----------------------------------------------------------------------------K
Q5ZSQ8_LEGPH/4-164LF-----------------------------------------------------------------------------Q
G7Y7K2_CLOSI/23-185LP-----------------------------------------------------------------------------N
A3UA30_CROAH/2-162ML-----------------------------------------------------------------------------Q
B4IBU8_DROSE/2-164MP-----------------------------------------------------------------------------D
W4X9S3_STRPU/2-166SY-----------------------------------------------------------------------------D
A8WS03_CAEBR/2-164SH-----------------------------------------------------------------------------K
Q8EF49_SHEON/2-161LF-----------------------------------------------------------------------------S
T1JJL9_STRMM/2-164LP-----------------------------------------------------------------------------R
GCY34_CAEEL/2-167TY-----------------------------------------------------------------------------V
A5N4H2_CLOK5/2-160VK-----------------------------------------------------------------------------K
B9JYX7_AGRVS/2-166MM-----------------------------------------------------------------------------A

PF02830

A4XDS4_NOVAD/122-182--------------------------------------------------------------------------------
A9WB66_CHLAA/138-197--------------------------------------------------------------------------------
B2UJH2_RALPJ/152-211--------------------------------------------------------------------------------
D0J206_COMT2/112-172--------------------------------------------------------------------------------
E4PKW5_MARAH/128-189--------------------------------------------------------------------------------
O26930_METTH/130-191--------------------------------------------------------------------------------
O27403_METTH/188-249--------------------------------------------------------------------------------
O67571_AQUAE/116-177--------------------------------------------------------------------------------
BCHJ_RHOCB/140-199--------------------------------------------------------------------------------
P74443_SYNY3/170-231--------------------------------------------------------------------------------
P74446_SYNY3/202-263--------------------------------------------------------------------------------
Y745_METJA/119-179--------------------------------------------------------------------------------
Y1460_METJA/95-156--------------------------------------------------------------------------------
Q881E3_PSESM/120-181--------------------------------------------------------------------------------
Q8DGL5_THEEB/132-193--------------------------------------------------------------------------------
Q8DKK3_THEEB/150-211--------------------------------------------------------------------------------
Q8R5R6_CALS4/52-113--------------------------------------------------------------------------------
Q8TIU0_METAC/206-264--------------------------------------------------------------------------------
Q8TQT2_METAC/185-246--------------------------------------------------------------------------------
Q8TV82_METKA/104-164--------------------------------------------------------------------------------
Q8TWC8_METKA/86-147--------------------------------------------------------------------------------
Q8TX90_METKA/68-129--------------------------------------------------------------------------------
Q8TXN0_METKA/66-127--------------------------------------------------------------------------------
Q8TXN0_METKA/224-288--------------------------------------------------------------------------------
Q8TXW7_METKA/177-236--------------------------------------------------------------------------------
Q8U209_PYRFU/331-392--------------------------------------------------------------------------------
Q8XT87_RALSO/150-211--------------------------------------------------------------------------------
Q8XTP9_RALSO/107-174--------------------------------------------------------------------------------
Q9KLM3_VIBCH/129-188--------------------------------------------------------------------------------
BCHJ_RHOS4/143-203--------------------------------------------------------------------------------

PF04051

T1JVG1_TETUR/7-153......................................................P..SSNKSELNV.............T
E5SJ80_TRISP/8-152............................................................DEASVL.............K
M0RYG7_MUSAM/13-175...................................................CKRF..YATKPELAA.............R
X6NU62_RETFI/84-239...............................................................................N
E4WZM5_OIKDI/17-163...............................................................................A
A7T063_NEMVE/19-166...............................................................................K
U3IS73_ANAPL/19-165...............................................................................T
G0RJ43_HYPJQ/25-253NNNDSSATHPQAQNSSTASASADHAS....KR...................IDDD..E..HLDAVH.............Y
A8BA91_GIAIC/27-185...............................................................................N
I2H4M5_TETBL/53-262...............................................................................A
A0A0D2UGE9_CAPO3/18-164...............................................................................K
C1MS22_MICPC/30-175...............................................................................A
D7FQV7_ECTSI/36-189...............................................................................R
E7NGB5_YEASO/62-271...............................................................................T
A7TQ02_VANPO/35-184...............................................................................D
R9AMQ2_WALI9/26-174...............................................................................S
G8ZPV8_TORDC/45-260EEMI.........TNVHITAPLDKPSHKLCQQL..................YEAN..DGTR.EKIL.............E
Q38DI4_TRYB2/28-190...............................................................................Q
M2YLM3_DOTSN/24-219..............GGMGSTALGTATV........................MD.D..E..TREAVF.............W
N4VA41_COLOR/25-174...............................................................................K
U4LDL1_PYROM/26-177...............................................................................K
N1Q0J8_DOTSN/59-215...............................................................................T
I1EHD1_AMPQE/31-180...............................................................................E
E9I9Q7_SOLIN/5-151...............................................................................K
E1ZPW5_CHLVA/28-181...............................................................................R
K0R7X6_THAOC/23-249...................................................EEAA..AVMAAERSA.............A
Q5KMH2_CRYNJ/70-228...............................................................................A
G8YS93_PICSO/81-235...............................................................................Q
K3XAK0_PYTUL/47-201...............................................................................N
I1JRI0_SOYBN/10-175...................................................CNRF..YANKPELAA.............R
L8FYS8_PSED2/51-210...............................................................................K
F1QMV3_DANRE/7-155....................................................AET..GESENGRCV.............S
C1MRP2_MICPC/11-162...............................................................................N
E6ZN37_SPORE/79-291ASSPHSQVVRSISGPD...................................TFSD..TLTEIETLLT............A
G2QD82_MYCTT/25-217.....LQGGSSGSAPAGAGAGAGTGTGTETTV...................MDEQ..E..EREAVF.............W
L8FNC8_PSED2/24-220DDEVKALAAAKGGSVSTKAAGTAGTGALRESR...................MDED..E..ERDAVF.............Y
A8JFB7_CHLRE/26-178...................................................FHAK..Q..SGPAAA.............A
T1JCC7_STRMM/19-164...............................................................................K
W4ZHN1_STRPU/7-154.....................................................TT..SPDDKDKVI.............S
I2H1V3_TETBL/54-297QE..VDEVSKQLDTRLTLNTGKGEASDKLIREL..................CDSE..EDVH.ERVM.............N
U1HTW2_ENDPU/68-231...............................................................................K
G9NKV9_HYPAI/25-220ATAKSEAT.....SGTVVGGAAGDTP....KR...................IDDE..E..HLDAVH.............Y
H0XNR3_OTOGA/7-161............................................................GQKRSL.............S
K0KYJ5_WICCF/14-204VE.................................................IFDS..EYIQSEDVY.............Y
K0KLU0_WICCF/62-215...............................................................................A
Q5AH42_CANAL/17-209VN.................................................VLDS..PLLDNDEVT.............I
M7SMZ2_EUTLA/56-213...............................................................................K
B7QH45_IXOSC/19-163...............................................................................K
S8AJT6_PENO1/24-183...................................................PEDP..E..VRESTY.............F
Q6BJ77_DEBHA/81-235...............................................................................S
B9REX0_RICCO/10-174...................................................CNRF..DANKPELAG.............R
A7TDQ9_VANPO/62-283...............................................................................S
B0WI08_CULQU/33-179...............................................................................N
K0THW2_THAOC/54-215...............................................................................K
M2LVJ4_BAUCO/27-183...............................................................................T
C1E3Y1_MICCC/27-178...............................................................................R
N1PWF2_DOTSN/25-183...............................................................................H
K1R003_CRAGI/7-154.....................................................SC..EKSDQDQCI.............A
G6CTZ1_DANPL/27-173...............................................................................T
H3AV40_LATCH/7-156...................................................SLGQ..DDQEHGKCI.............S
B8BY05_THAPS/56-299...................................................GEAA..AVMAAERSA.............A
G0W6Q4_NAUDC/35-267DKEIKEEKSDRISTNYNTNGPL.YQSHKMLWEL..................SEME..DEEKCNNIS.............E
E9H4K9_DAPPU/19-165...............................................................................R
M3JAQ1_CANMX/81-235...............................................................................N
E0VWU3_PEDHC/35-181...............................................................................N
TPPC5_CHICK/29-175...............................................................................S
U5GZ24_USTV1/149-310...............................................................................K
G3BDP0_CANTC/25-175...............................................................................K
A3FPW1_CRYPI/6-158...............................................................................D
A0A068Y1Y0_ECHMU/29-182...............................................................................S
E0VBE5_PEDHC/18-159...............................................................................K
Q229D2_TETTS/19-169...............................................................................D
Q5ARJ4_EMENI/23-173...............................................................................K
D2VAM4_NAEGR/13-161.....................................................DL..CKNSKEKAY.............S
A5E6K8_LODEL/83-237...............................................................................N
G3PGZ9_GASAC/12-159...................................................SAEN..GETDNGRNI.............A
K3WA95_PYTUL/9-188...................................................AIEL..AKNKKEELT.............I
E0V955_PEDHC/7-159...................................................VN....TKCSLQKYI.............S
F0YEM0_AURAN/27-173...............................................................................K
I2FPM0_USTH4/86-296SSSAHNQVVRSVSCID...................................DS.E..TLTEVETLLT............T
C5FQV7_ARTOC/73-244...............................................................................R
D8S611_SELML/22-168...............................................................................K
C3Z0P3_BRAFL/26-172...............................................................................Q
A8J2W3_CHLRE/37-190...............................................................................E
N1J5N2_BLUG1/51-211...............................................................................K
N1QHC0_SPHMS/25-275HQQQGQQQQQLLTPAASTTTPAAAATIERSAPATTTTTSIATGAANTTTSHMDND..E..TREAVF.............W
D7ELH8_TRICA/28-174...............................................................................N
B9PH75_TOXGV/34-184...............................................................................D
G8Y8F7_PICSO/26-179...............................................................................Q
G7YIU1_CLOSI/20-169...............................................................................R
H2AYQ1_KAZAF/33-182...............................................................................D
A5DAF5_PICGU/11-206VA.................................................AVNS..QLVNSDDVT.............L
W5NBF1_LEPOC/14-166................................................KHTSREE..TEQERGKCI.............S
K5XGY5_AGABU/26-191...............................................................................K
Q4N4M8_THEPA/26-173...............................................................................F
B0CQU1_LACBS/73-229...............................................................................R
E2AMW5_CAMFO/32-178...............................................................................N
G8ZMF5_TORDC/62-270...............................................................................S
U9V6Y8_RHIID/25-174...............................................................................K
F2ULX4_SALR5/17-165.........................................................IATTHDARY.............K
J5PUV7_SACK1/30-179...............................................................................D
G4TPC2_SERID/27-219...............................................................................K
A2DFH3_TRIVA/11-155...............................................................................K
A4H8R9_LEIBR/29-178...............................................................................Q
D8M290_BLAHO/13-159...............................................................................K
F7DY97_XENTR/7-161...................................................EEKI..HRKDHGKHT.............R
H2XLK9_CIOIN/10-155.........................................................TIDNKNKGV.............S
T0MD09_COLGC/45-203...............................................................................Q
A0A068XM21_HYMMI/29-182...............................................................................A
F9X1V4_ZYMTI/54-212...............................................................................T
A2FQV8_TRIVA/8-151...............................................................................N
B3S2G2_TRIAD/32-178...............................................................................Q
F7AEP2_CIOIN/19-166...............................................................................K
F4PUP7_DICFS/116-262............................................................DKTQTF.............K
F2U9W2_SALR5/24-172...............................................................................Q
A9STP5_PHYPA/24-171...............................................................................K
C5DT91_ZYGRC/62-268...............................................................................T
T1JN97_STRMM/27-173...............................................................................T
W5MI51_LEPOC/29-175...............................................................................A
A0A068YAR7_ECHMU/19-165...............................................................................E
C4QV75_KOMPG/64-226...............................................................................K
B3MSU3_DROAN/7-150...........................................................GNKEHDL.............A
YA95_SCHPO/16-173...................................................KKSS..SEKSIESDF.............Q
F4NUA2_BATDJ/28-180...............................................................................K
C4QV63_KOMPG/25-176...............................................................................E
B6K0U0_SCHJY/46-198...............................................................................E
A8J304_CHLRE/23-167...............................................................................K
Q5CYM1_CRYPI/33-178...............................................................................S
A0C1N5_PARTE/23-175...............................................................................S
I1FWR8_AMPQE/23-171...............................................................................K
E3KIT7_PUCGT/25-194...............................................................................Q
I1IIL5_BRADI/13-174...................................................CGRF..YAAKPELAA.............G
E1ZCI6_CHLVA/12-169...............................................................................A
C4Y011_CLAL4/81-235...............................................................................N
M9M538_PSEA3/137-321...............................................................................K
T1G2G3_HELRO/30-176...............................................................................Q
B8BSU9_THAPS/34-187...............................................................................R
G0SHA4_CHATD/46-206...............................................................................K
A4S1Q7_OSTLU/26-177...............................................................................A
G4UMV3_NEUT9/25-221SVGDDAQRLVGGGGGGGGGGGGSVTGSVSAKK...................MDED..E..ERDAVF.............A
Q4N8Y2_THEPA/23-170...............................................................................E
Q6FQX3_CANGA/31-265KKVVLKDDDTEEEKEQAPKYKIGEQSHKLIQQI..................YNLD..DEYRSNSVA.............E
U5D335_AMBTC/11-175...................................................CNRF..YSTKPELAA.............R
Q9CAW4_ARATH/10-172...................................................SGRF..YANKPELAA.............R
A0A0H5S8A4_BRUMA/12-192...................................................NPQM..EISLLDEQLKSVKQLFIQGNAET
V5EZN4_KALBG/139-299...............................................................................K
C5DJK5_LACTC/39-188...............................................................................S
Q6CFM1_YARLI/100-269...............................................................................T
T1G6X9_HELRO/19-166...............................................................................K
M7XQX5_RHOT1/47-279.....NKADGAEPA.....................................KEDE..DEVVDEEVR.............K
E9HC76_DAPPU/27-173...............................................................................A
B3S9Y0_TRIAD/20-167...............................................................................K
W1QG52_OGAPD/46-210...............................................................................R
W1QKQ7_OGAPD/25-176...............................................................................A
B8NLT0_ASPFN/68-238...............................................................................K
F8QEM7_SERL3/28-191...............................................................................K
C4WXG1_ACYPI/18-164...............................................................................K
A0DEI2_PARTE/22-171...............................................................................E
Q5BKN1_XENTR/19-166...............................................................................K
F4NUX8_BATDJ/18-169...................................................YKVD..S..DADAAY.............S
X6NME0_RETFI/27-208...............................................................................S
C5LHW2_PERM5/39-200...............................................................................K
D8LQV4_ECTSI/27-175...............................................................................K
S3CL82_OPHP1/25-222DEATPTSQTAASVAPSTAAAASTVGSAGAGKV...................LDDD..D..ERDAVF.............Y
B6TBL7_MAIZE/8-172...................................................CGGL..YAAKPELAA.............R
G2X4J4_VERDV/43-207...............................................................................Q
E1FZ82_LOALO/46-192...............................................................................D
A0A023BA01_GRENI/25-169...............................................................................E
Q4Y963_PLACH/24-168...............................................................................D
R9PED1_PSEHS/82-292ASSPHSQVVRSVTGSD...................................TI.D..TLTDIESLLT............A
H2SS24_TAKRU/7-156...................................................SKEQ..GEVESGRNI.............T
C5M680_CANTT/23-177...............................................................................N
B4KNN6_DROMO/35-181...............................................................................T
D5GMV6_TUBMM/70-223...............................................................................K
Q57UH5_TRYB2/27-175...............................................................................Q
G0NYX4_CAEBE/5-183...................................................PADI..EKY...ESL..VRKAFLHSNAET
W1QFA9_OGAPD/15-208VD.................................................FASN..PKFVGLNNL.............Y
V2X627_MONRO/28-195...............................................................................K
V8NPD8_OPHHA/12-161...................................................AAEQ..GDGENGRCI.............T
E1FS68_LOALO/12-192...................................................NPQM..EVSLLDEQLKSVKQVFIQGNAET
E9FYX1_DAPPU/7-155....................................................SDP..GSLQDGVTM.............S
B9SBX8_RICCO/30-183...............................................................................R
G4VMI7_SCHMA/18-164...............................................................................E
C5DSC4_ZYGRC/30-179...............................................................................N
A0A0C4E4C9_MAGP6/42-202...............................................................................K
E4UYX6_ARTGP/25-214..SPVKQGEALDAKNKERGKGEEKDSKSSVAV...................MDDE..E..YREAIY.............F
TPPC5_PLAF7/24-172...............................................................................D
R1GJ88_BOTPV/25-232RASAVAATNGAGSTPKSGTTPRIAEGGV.VGS...................ADEE..E..LKDAVL.............Y
G8BPN1_TETPH/36-270DK.............LHITPELDLPSHVLIHQI..................STTN..AEKR.EGVI.............K
I7LU45_TETTS/24-174...............................................................................S
K7J974_NASVI/23-174...................................................KTSN..DGNDKEEDL.............S
C4WU32_ACYPI/8-151..........................................................KSSEDEDL.............S
G3BB76_CANTC/11-168......................................................S..HGLSTDQVN.............L
Q74ZA3_ASHGO/45-194...............................................................................D
Q2GUE9_CHAGB/23-174...............................................................................Q
C4WVR1_ACYPI/32-178...............................................................................M
W4YXQ6_STRPU/27-174...............................................................................K
J7RXA7_KAZNA/87-338...............................................................................G
Q0IEU7_AEDAE/18-164...............................................................................K
H2AWC3_KAZAF/48-262EKPV...................VPSHKLVSQM..................HEIK..NEGRYNNIL.............E
A7SRF2_NEMVE/30-176...............................................................................T
F9X8Z0_ZYMTI/25-182...............................................................................A
G0SUM5_RHOT2/32-186...............................................................................K
D6WJE6_TRICA/18-164...............................................................................K
S9W187_SCHCR/46-198...............................................................................E
E9CS20_COCPS/26-194...................................................LEEE..E..LREATF.............Y
G2YWQ0_BOTF4/25-194SSSPNPSAAPK........................................MEEE..E..ERERVF.............F
Q6CJT3_KLULA/45-194...............................................................................D
F6PI56_XENTR/22-168...............................................................................K
J9P7K2_CANLF/40-190............................................................GQKMSL.............S
R4XC32_TAPDE/22-184...............................................................................K
E7KII5_YEASA/45-265EHHT...............VDI.IRSHNLIHEL..................YKAD..EEEK.EKVL.............A
B6AFL0_CRYMR/33-177...............................................................................E
Q6NUY4_DANRE/7-159................................................EQATRDD..IDKERVTCV.............S
U9U2P9_RHIID/42-194...............................................................................R
V5GF24_KALBG/79-284ALSSNSEVVRTISGVD...................................SP.E..TLTEVETLLT............T
M2LT53_BAUCO/23-245PINQDEQQGANAENGAIGRE..AKRSVDDQEPALTSLGFPV..........MT.E..Q..TREGVF.............W
A9VBF9_MONBE/9-149...............................................................................Q
B6JXV2_SCHJY/22-166...............................................................................A
M3YXR2_MUSPF/13-162...................................................SAEQ..GEVENGRCI.............T
F0XPM8_GROCL/25-250STAAAAAGGASLSEAGRTAGSGSLSGAGSRRV...................LDDD..E..EQDAVS.............F
K1RC27_CRAGI/28-174...............................................................................T
G4M1E3_SCHMA/643-797...............................................................................K
H0XQ40_OTOGA/31-176...............................................................................V
Q54TK7_DICDI/133-280............................................................DKQQAH.............K
F6R0S8_MONDO/5-160.....................................................RR..PELGQRTGL.............T
B7G9P1_PHATC/27-178...............................................................................A
N4UR67_COLOR/25-234AGGGGGGGGGPAGGAPASTASGAVAAAGSGRK...................MDED..E..ERDAVF.............Y
I2G5Q2_USTH4/26-174...............................................................................K
M7NLF3_PNEMU/15-189.........LTTMSSPQVRRDLSFEASSLVAI...................QHED..D..EREAIY.............G
A3LWB7_PICST/17-213VN.................................................VLES..SLLNNDEVT.............L
B0DXI4_LACBS/36-240GARDSVTSLAS....R.SGSAA.............................GKGG..VDEEEEAVR.............V
Q6C4X8_YARLI/7-176FG.................................................YLVD..SESHLDNVY.............F
M2RGY3_CERS8/28-198...............................................................................T
G1KP89_ANOCA/19-164...............................................................................K
F6ZPU3_CIOIN/28-174...............................................................................T
H3G610_PHYRM/6-148...............................................................................Q
TPPC3_CAEBR/20-166...............................................................................V
D3BR33_POLPA/141-287............................................................DKTQIS.............K
E4XK01_OIKDI/26-172...............................................................................D
F6U759_MACMU/13-160............................................................GQKMSL.............S
G6CHQ2_DANPL/18-161...............................................................................K
G1XT68_ARTOA/25-235TTPGPNTNTNSTITTTTTTTTTATTATAAEPP...................TDED..T..AREDLF.............N
E2ATA3_CAMFO/23-173...................................................KSSN..TA.EGEEEL.............S
E9AFF6_LEIMA/35-197...............................................................................A
K1QH85_CRAGI/19-166...............................................................................K
S8FDP6_FOMPI/33-233THRDSVGSTTS....KASGGKV.............................A.....LDDEEEAVR.............S
D8R4W7_SELML/16-172...................................................CDRL..HSSKPDLAA.............R
Q6CPP3_KLULA/68-235...............................................................................R
Q4D5L3_TRYCC/27-174...............................................................................Q
E3L3N3_PUCGT/89-270...............................................................................K
A5DI63_PICGU/78-232...............................................................................S
I4Y7D2_WALMC/18-172...............................................................................S
C8V0H5_EMENI/25-184...................................................LDDE..E..TKETAF.............S
TPPC5_DICDI/25-178...............................................................................K
V2WY43_MONRO/33-234TPRDSVTSLNS....RNTGKAV.............................AM....VDEEEEAIR.............I
A8N0N0_COPC7/32-255GPRDSVTSLQSTTRPKSSASGA.............................GGDA..DDPTLDPLR.............H
F0YNA2_AURAN/14-167...............................................................................C
R7YXJ3_CONA1/25-225.SSQSQRQGGGGESIRGSGADGGSSGGVRAGG...................LDEE..E..LREAMF.............Y
T1ELP2_HELRO/7-152.........................................................TDLDKDICL.............S
Q6FMN4_CANGA/21-208...............................................................................T
G0VDG8_NAUCC/35-184...............................................................................E
E9E9Y1_METAQ/640-835STQTAEAASTSHRAASLASGGAHHVSNPGTRK...................LDDE..E..ELDAVH.............F
I4Y6T3_WALMC/34-192...................................................RDIT..EESVDEELT.............K
R4FKT2_RHOPR/29-175...............................................................................N
G3P0A2_GASAC/7-161................................................EQQSGKEEMDNKDRAVCV.............S
R4FPN5_RHOPR/18-161...............................................................................K
G6CLX9_DANPL/7-155......................................................QNKSSNGKEVDL.............S
S9W2C4_SCHCR/22-169...............................................................................E
B6AG61_CRYMR/12-186...................................................PISI..NSIIREAAM.............S
B7G7P9_PHATC/18-194...................................................EEEA..LAMASEMVQ.............A
G4TBB1_SERID/92-248...............................................................................R
H2B1V9_KAZAF/63-287...............................................................................E
G1WYZ0_ARTOA/60-213...............................................................................K
J7S6F2_KAZNA/43-192...............................................................................G
M7X5P9_RHOT1/76-239...............................................................................K
D0MS35_PHYIT/9-170...........................................................AHREAVI.............I
G3AVF7_SPAPN/17-209VN.................................................VLDS..SLIHNDEVT.............I
C4Y593_CLAL4/16-205VA.................................................VFSA..ENLASDDVA.............L
H2ZW82_LATCH/19-167...............................................................................K
T1KX51_TETUR/32-178...............................................................................K
F0V9N6_NEOCL/25-171...............................................................................A
S2JN73_MUCC1/38-191...................................................AETD..G..DSDAIF.............Y
C4M937_ENTHI/26-176...............................................................................N
E1ZNY8_CHLVA/9-156...............................................................................A
M7PDJ0_PNEMU/34-186...............................................................................K
G3AII8_SPAPN/79-233...............................................................................M
U5H198_USTV1/33-186...............................................................................T
G1XR36_ARTOA/26-178...............................................................................K
Q8I1Q2_PLAF7/25-167...............................................................................E
S2JY55_MUCC1/30-178...............................................................................K
S2JN70_MUCC1/45-196...............................................................................R
S8C0P6_DACHA/25-225STSPAASPPDSSASQPPAATATATT...VETI...................SDEE..A..TREDIY.............T
U9SP50_RHIID/54-206...................................................VDSE..N..DKEAVY.............Y
E5SI08_TRISP/1-145...............................................................................M
Q013E9_OSTTA/27-181...............................................................................R
B5Y485_PHATC/37-194...............................................................................R
D2W234_NAEGR/23-174...............................................................................T
Q4WDM1_ASPFU/25-185...................................................LDDD..E..IRESTF.............F
G0WER0_NAUDC/44-292...............................................................................K
R0KDH4_SETT2/38-201...............................................................................Q
K2SHS1_MACPH/53-225...............................................................................K
TRS31_ENCCU/10-152...............................................................................A
G8JU67_ERECY/59-227...............................................................................G
I2GX78_TETBL/27-183...............................................................................K
C7Z9W5_NECH7/25-227ADVASTSHAVSSNAAGVVAGTA........TR...................KDQE..E..DLDAVH.............H
F6T488_ORNAN/102-268...................................................LNSS..NRTEQRPAL.............T
B8BZL3_THAPS/26-186...............................................................................A
Q6CCJ8_YARLI/25-176...............................................................................K
M7NS17_PNEMU/22-171...............................................................................K
S9W411_SCHCR/16-172...................................................TALS..NDEQMERGY.............T
A3FQ35_CRYPI/12-189...................................................QVCK..DSLIRELSM.............S
G3AXG1_CANTC/75-229...............................................................................N
G0V7A4_NAUCC/49-256...............................................................................L
H2VJ79_CAEJA/24-170...............................................................................D
A8Q0V9_MALGO/24-202...............................................................................I
G0SHJ8_CHATD/26-235GNGVEGEVKNGGWRIERDFHALENEPGAPGSV...................MDEE..E..EREAVF.............W
A8NES9_COPC7/27-191...............................................................................K
I1LSM6_SOYBN/24-171...............................................................................K
F4RQH4_MELLP/2-196...............................................................................K
U4L5M6_PYROM/25-185..........................ATNDGP...................LEDE..E..KREAMF.............F
Q6BKS7_DEBHA/16-206VG.................................................ILDS..ADAGSDDVT.............L
E3RF54_PYRTT/20-170...............................................................................K
J9F2R2_WUCBA/21-167...............................................................................R
F1A4T0_DICPU/24-172...............................................................................I
Q17E67_AEDAE/7-152.........................................................KDSNKENDL.............S
C5DM27_LACTC/105-310...............................................................................L
B9MZL8_POPTR/10-169...................................................CTRF..YSNKPELAA.............R
F2UT79_SALR5/14-156...............................................................................K
A2DKK6_TRIVA/18-173...............................................................................Q
G8YIQ3_PICSO/12-197IQ.................................................ALEA..DV..TDDVL.............I
F9XI11_ZYMTI/25-225..............RAAGTKPGSTQTATGPVPSA.................LD.D..E..TREAMF.............W
S0DWK2_GIBF5/51-208...............................................................................Q
D8PVM2_SCHCM/27-195...............................................................................K
I1FYD4_AMPQE/18-164.....................................................SK..EKEDQGELI.............S
G8BSU5_TETPH/62-267...............................................................................T
G0VA51_NAUCC/38-275EKEV.........SSYNTNLKI.QPSHKLIMEL..................AELE..DEEKYNNIL.............K
U5GYW5_USTV1/49-283APSVPSKSSTFPPP.....................................NQDE.....ADEAVR.............S
F4NWB8_BATDJ/26-174...............................................................................V
T1KC63_TETUR/18-164...............................................................................K
A7AQG4_BABBO/23-170...............................................................................T
I4YJW3_WALMC/26-173...............................................................................K
R4XFR7_TAPDE/28-211...................................................LDED..DLSERELLE.............S
TPC3L_MOUSE/19-165...............................................................................K

PF06505

H0PV77_9RHOO/7-107-------------------------------------------------------------------------------R
Q5P0J1_AROAE/9-107-------------------------------------------------------------------------------R
R4KI47_9FIRM/12-108-------------------------------------------------------------------------------N
A4XDS4_NOVAD/9-109-------------------------------------------------------------------------------E
D8IX14_HERSS/38-138-------------------------------------------------------------------------------Q
A7HF91_ANADF/7-100-------------------------------------------------------------------------------E
A1K8A8_AZOSB/11-111-------------------------------------------------------------------------------H
I2B6U1_SHIBC/10-108-------------------------------------------------------------------------------Q
R4KRR0_9FIRM/9-106-------------------------------------------------------------------------------M
F2JW36_MARM1/38-138-------------------------------------------------------------------------------Q
Q5NZX3_AROAE/20-120-------------------------------------------------------------------------------E
A4XEH5_NOVAD/4-104-------------------------------------------------------------------------------R
A2SEH5_METPP/23-116-------------------------------------------------------------------------------Q
Q5P8R7_AROAE/38-136-------------------------------------------------------------------------------Q
Q1LMF9_CUPMC/12-114-------------------------------------------------------------------------------S
Q1D007_MYXXD/8-108-------------------------------------------------------------------------------Q
C4KBD8_THASP/11-110-------------------------------------------------------------------------------H
B2UJH4_RALPJ/12-112-------------------------------------------------------------------------------R
A6VSL2_MARMS/38-138-------------------------------------------------------------------------------Q
H0Q4U8_9RHOO/14-114-------------------------------------------------------------------------------H
B3E548_GEOLS/7-99-------------------------------------------------------------------------------K
R4KCK2_9FIRM/5-98-------------------------------------------------------------------------------S
A2SI53_METPP/6-104-------------------------------------------------------------------------------Q
Q12HA0_POLSJ/50-149-------------------------------------------------------------------------------Q
Q0K3T9_CUPNH/18-118-------------------------------------------------------------------------------Q
R4KSH1_9FIRM/5-97-------------------------------------------------------------------------------K
M4WWY6_PSEDE/17-117-------------------------------------------------------------------------------Q
X4ZFX6_9BACL/9-108-------------------------------------------------------------------------------R
B9M8I2_GEODF/18-118-------------------------------------------------------------------------------H
S6ACH6_PSERE/16-116-------------------------------------------------------------------------------Q
A5VBE2_SPHWW/29-129-------------------------------------------------------------------------------Q
C4ZM82_THASP/8-107-------------------------------------------------------------------------------R
A1K6K4_AZOSB/13-113-------------------------------------------------------------------------------S
F6A9L0_PSEF1/37-137-------------------------------------------------------------------------------Q
B2UJH2_RALPJ/38-138-------------------------------------------------------------------------------Q
F6IM12_9SPHN/9-109-------------------------------------------------------------------------------E
D4Z0A6_SPHJU/14-114-------------------------------------------------------------------------------Q
C1DMU8_AZOVD/16-116-------------------------------------------------------------------------------Q
V5UEH6_9BURK/33-133-------------------------------------------------------------------------------R
A2SED5_METPP/49-149-------------------------------------------------------------------------------E
G8MIU1_9BURK/19-119-------------------------------------------------------------------------------Q
A2SL24_METPP/19-119-------------------------------------------------------------------------------Q
N0AQH3_9BACI/27-119-------------------------------------------------------------------------------Q
Q479F4_DECAR/11-111-------------------------------------------------------------------------------N
Q088E6_SHEFN/7-101-------------------------------------------------------------------------------Q
Q2G887_NOVAD/24-124-------------------------------------------------------------------------------R
B3E5G9_GEOLS/7-102-------------------------------------------------------------------------------E
D0J206_COMT2/2-100-------------------------------------------------------------------------------Q
A1WLM8_VEREI/12-112-------------------------------------------------------------------------------R
R4KJN7_9FIRM/7-106-------------------------------------------------------------------------------H
D4Z086_SPHJU/33-133-------------------------------------------------------------------------------R
B3E5J6_GEOLS/7-101-------------------------------------------------------------------------------Q
D0LSA1_HALO1/10-102-------------------------------------------------------------------------------Q
A9GJU8_SORC5/7-100-------------------------------------------------------------------------------E
B3E546_GEOLS/15-108-------------------------------------------------------------------------------H
D5WW71_KYRT2/9-107-------------------------------------------------------------------------------S
X2H462_9BACI/11-106-------------------------------------------------------------------------------N
B9M024_GEODF/20-120-------------------------------------------------------------------------------H
A1W2I5_ACISJ/16-116-------------------------------------------------------------------------------Q
Q15NZ0_PSEA6/36-137-------------------------------------------------------------------------------N
Q39TS9_GEOMG/18-118-------------------------------------------------------------------------------H
E4PKW5_MARAH/16-116-------------------------------------------------------------------------------Q
C1DN78_AZOVD/11-111-------------------------------------------------------------------------------S
E1QE48_DESB2/9-101-------------------------------------------------------------------------------N
Q39TT1_GEOMG/18-118-------------------------------------------------------------------------------H
G7UPC2_PSEUP/14-114-------------------------------------------------------------------------------Q
B9M014_GEODF/21-120-------------------------------------------------------------------------------H
H8MRM3_CORCM/8-104-------------------------------------------------------------------------------Q

PF03500

Q76KJ6_KOMHA/10-153-------------------------------------------------------------------------------E
G2I1Y6_KOMMN/10-153-------------------------------------------------------------------------------D

PF07700

D6W9P2_TRICA/2-164L--AAALA.EIT------AQ...........STDAFMNF-----------------------------------------
D6W9P2_TRICA/657-819L--AAACA.EVT------TA...........SYDSFMNF-----------------------------------------
G7YDL4_CLOSI/2-164I--VRLVA.KST------GH...........PEDEIYFA-----------------------------------------
B3RIY3_TRIAD/1-164V--AEECS.KLL------GI...........SVDQFLET-----------------------------------------
T2G861_DESGI/430-584M--VETVA.RAM------GK...........PARDIFIE-----------------------------------------
C3XW68_BRAFL/2-165L--VGAAT.KIL------QI...........DANSILEL-----------------------------------------
A7S7B2_NEMVE/2-170I--ANAAT.TVL------GDLD......EHITVDDCMRL-----------------------------------------
H2UDL7_TAKRU/2-163L--VADAC.KLL------GV...........EPQVVLRQ-----------------------------------------
K0CAD4_ALCDB/2-162L--VAALQ.SVT------GL...........HRDDLLEE-----------------------------------------
F4B0A3_DOKS4/2-162L--LTNLS.KET------GL...........VIDDLLLV-----------------------------------------
F2UP57_SALR5/2-165F--LTAVA.KVT------GR...........SQEDCKFE-----------------------------------------
C3YJ22_BRAFL/2-164L--STAAC.EYT------GE...........TQDDLMYD-----------------------------------------
B3RTK0_TRIAD/1-164L--VRAIM.DKT------GM...........SIHQVFHA-----------------------------------------
W4XRE1_STRPU/2-164L--AQAVY.DVT------GY...........SREQFMDE-----------------------------------------
D3F0L8_CONWI/2-160L--VGAAS.ELL------GQ...........PPADLVRW-----------------------------------------
A4XK74_CALS8/2-160M--IERAC.EKA------NI...........LPQQMWRE-----------------------------------------
F2JRL4_CELLD/2-160V--IHAIA.EKE------KV...........NEKELWKI-----------------------------------------
H9JIF1_BOMMO/5-169L--ITAAV.EVL------QI...........PADAILEL-----------------------------------------
H2ZHQ6_CIOSA/2-167I--AESVA.CEV------DC...........PESDIMFK-----------------------------------------
A6M0J2_CLOB8/2-160I--ISYIA.KSQ------NI...........EVGTLWRK-----------------------------------------
Q899J9_CLOTE/21-179V--IEYIA.KSE------KL...........ELGHLWRQ-----------------------------------------
G7YSC7_CLOSI/2-164L--VTYIA.EVT------GL...........QEENVYFE-----------------------------------------
B0C2H7_ACAM1/2-163L--VGAAS.EVL------EL...........SPADVMHA-----------------------------------------
C5ARV9_METEA/2-162L--VTALS.RRT------GK...........PVPDLLTL-----------------------------------------
A7RZH8_NEMVE/3-165L--VSSAE.EIT------GE...........DRNSLLES-----------------------------------------
D3SA24_THISK/2-160L--VGAAC.EVT------GL...........NTADCLQW-----------------------------------------
I1FML3_AMPQE/2-163L--VDAAA.ATL------GE...........PRDMVMKM-----------------------------------------
K6YZX2_9ALTE/2-163L--VSAAS.EVL------KI...........PAEAVLEA-----------------------------------------
F8DBD3_HALXS/2-162L--VDAAT.DLT------GL...........EEPTLLAA-----------------------------------------
Q8RBX6_CALS4/2-160I--FAKVS.EKT------GK...........NVNEIWRE-----------------------------------------
F7YXL0_9THEM/2-160I--SRDIA.AAK------NM...........TFDDLWYQ-----------------------------------------
W4XH19_STRPU/14-176L--VKAAS.EVA------GQ...........PIPVILEL-----------------------------------------
R4KI66_CLOPA/3-161L--IIHIS.KKT------NT...........DVKNLWGK-----------------------------------------
W5KMY4_ASTMX/2-163L--VQEAC.KML------DV...........SSEVVLKL-----------------------------------------
A9KIK0_CLOPH/2-160V--VEHIG.NSV------GK...........DKDEIWVI-----------------------------------------
B7VPN5_VIBTL/2-162L--IINLS.KKT------DI...........DAASLQRV-----------------------------------------
T1ITQ9_STRMM/2-166L--VGACC.KVL------GI...........DLNACLEA-----------------------------------------
G4LU97_SCHMA/2-164I--ATILSDRIF------TD............KDIILFD-----------------------------------------
F2UQW4_SALR5/2-164V--VQAAA.KVT------GK...........TAEQVIAG-----------------------------------------
H2ZCI7_CIOSA/2-166L--VKAAV.KVL------KT...........DSDKILEL-----------------------------------------
A7HJF4_FERNB/2-160F--SEKLA.QKV------GK...........KYEELWEE-----------------------------------------
K1R2B8_CRAGI/26-188I--ARACA.IVL------DL...........PEEEIMDS-----------------------------------------
W5L1E6_ASTMX/2-163L--VTEAC.RLL------DV...........EASVVLKL-----------------------------------------
Q15VN4_PSEA6/2-162L--VGLIM.GKK------GL...........TGQQAQMA-----------------------------------------
C3Y563_BRAFL/2-164L--AKAAS.EVT------GM...........NHDELMDV-----------------------------------------
Q7MJS8_VIBVY/2-162L--IVHLS.QVT------GL...........SVEQLQEV-----------------------------------------
C3XXH9_BRAFL/2-165L--AENCS.AVV------MD..........KSTEDFLLF-----------------------------------------
S0ESS7_CHTCT/2-160I--VSAAS.KIL------HM...........PCQEVIRF-----------------------------------------
H3CKY4_TETNG/2-164L--AKAAG.EVL------GK...........THDELMYA-----------------------------------------
A7RN69_NEMVE/100-264L--VGAAT.RVL------DI...........ETSAILEK-----------------------------------------
F1NZB6_CHICK/2-163L--VDKAC.KIL------GV...........PADMVLRE-----------------------------------------
F7YL52_VIBA7/2-161M--VAYLS.EQK------NI...........PTDDLVRL-----------------------------------------
J9K961_ACYPI/2-175L--AAAAA.ELL------TDPTDRPGARVQPTADGFMRY-----------------------------------------
E2AD43_CAMFO/2-164L--AAALA.IYT------GD...........SMDNIMQF-----------------------------------------
F2UCB7_SALR5/2-165F--LAAIA.KVT------GR...........TEDECKYE-----------------------------------------
A2U1J5_9FLAO/2-162L--LTNLS.ERT------NI...........SIDDLLLV-----------------------------------------
Q97E73_CLOAB/2-160F--IEDIS.KKV------NE...........EKSIIWEK-----------------------------------------
Q9A451_CAUCR/2-160L--VETAS.ARL------SL...........SRGELLRW-----------------------------------------
B3RYQ3_TRIAD/1-165L--VATAC.EVL------GS...........RMEDMLEK-----------------------------------------
T1IYK0_STRMM/2-165V--AETCA.QYI------GT..........MDADGFLRF-----------------------------------------
F3Z380_DESAF/437-596M--AGIVS.RLT------GD...........TKRKILFD-----------------------------------------
I3LMI1_PIG/2-166L--VAAAS.KVL------NL...........NAGEILQM-----------------------------------------
B2IZ76_NOSP7/2-163L--VKAAS.VIL------SL...........SPKQIMQA-----------------------------------------
G4QEK6_GLANF/2-166L--IDAAV.VET------GL...........SANEVYAL-----------------------------------------
G4VI29_SCHMA/12-176L--FQISS.KLL------DT...........PEDEIKFG-----------------------------------------
B7PJ68_IXOSC/2-166L--VGAAC.EVL------GL...........DLDTCLEA-----------------------------------------
GCY33_CAEEL/2-164M--FKAIH.EIT------GT...........PYEQIGVL-----------------------------------------
M1MBZ2_9CLOT/2-160I--MNYIA.DKE------NM...........KVGELWRK-----------------------------------------
D3Z022_MOUSE/2-163L--IQEAC.KAL------DV...........SMEAILKL-----------------------------------------
Q8YUQ7_NOSS1/2-164L--VGAAS.EVL------GK...........PAEELLIA-----------------------------------------
E3PR11_CLOSD/2-160F--TNEIS.KQF------SI...........KEEDLWRE-----------------------------------------
F4EW09_SELS3/2-160F--VDALA.RHT------GQ...........TPDDVWYE-----------------------------------------
H3EBU1_PRIPA/15-180L--IDSVS.VLT------KM...........TREQVWET-----------------------------------------
B7PID1_IXOSC/2-165L--AQACATRVT------GW...........SADSFLFF-----------------------------------------
H2ZQM8_CIOSA/2-166L--AKAVA.ETT------GK...........TFESIMEA-----------------------------------------
E3MCF9_CAERE/2-167L--VDAVS.VIL------KV...........TREQVWEM-----------------------------------------
G7YSC6_CLOSI/2-164V--VTAVS.QLT------DI...........PEEDIYFE-----------------------------------------
X5E3Q9_9BACT/2-162L--ITELS.KLT------KL...........NTDKLLFA-----------------------------------------
F2TX50_SALR5/2-165M--VVSAA.KVL------GI...........DAEECLSQ-----------------------------------------
H2J852_MARPK/2-160I--IREIA.DSA------GI...........SRFEMMKR-----------------------------------------
D5BKH5_ZUNPS/2-162L--LVSLS.KKV------AI...........PLDDLIYN-----------------------------------------
G8X8N8_FLACA/2-163L--ANTTA.QEL------NL...........TVDDVLTT-----------------------------------------
K1S3W9_CRAGI/2-166L--VGAAS.KVL------NL...........PAADILQY-----------------------------------------
H0PYD0_9RHOO/2-161L--VGGAC.AVL------GA...........QPAQVLEA-----------------------------------------
Q47Y43_COLP3/2-162M--VKALS.IKT------GI...........EVDQLIEK-----------------------------------------
K8GF64_9CYAN/2-163L--VNAAS.AVL------GL...........STSEIMQA-----------------------------------------
G0NDJ7_CAEBE/2-167L--VNSMA.NVI------GI...........PIEEIWEA-----------------------------------------
K4IJS2_PSYTT/2-161M--VGKLS.QIK------EI...........PVPKLLTI-----------------------------------------
K1PH87_CRAGI/2-166I--AKGCC.HVF------NEQ.........KREDDYMLF-----------------------------------------
F8EFN5_RUNSL/2-162L--LVTLN.HKT------EV...........PIPHLLQA-----------------------------------------
A6TMH7_ALKMQ/2-160I--FDYIS.KET------NE...........PVDTIWRK-----------------------------------------
K9VYK2_9CYAN/2-163L--VKAAS.MVL------GL...........SASDIMQA-----------------------------------------
G6CKQ3_DANPL/2-164L--AKKAQ.EVL------GI...........SEREFMDQ-----------------------------------------
E6VZ54_DESAO/523-677M--AEIAA.AKS------NI...........KVRDFFIE-----------------------------------------
E0VW08_PEDHC/2-166I--AESCV.KII------GQN.........TSVDYFMNF-----------------------------------------
F2U5L4_SALR5/2-172L--IRICS.EVT------GV...........SEDECKLR-----------------------------------------
G3PRL3_GASAC/2-163L--VQEAC.SLL------DV...........SAEVFLKL-----------------------------------------
F4A1A5_MAHA5/7-165I--IEHVA.HDV------GR...........EPANVWRD-----------------------------------------
H2YUP4_CIOSA/2-167I--AQTLS.KML------QI...........TEDDIMFQ-----------------------------------------
C5BIN2_TERTT/2-162L--FDGLC.QAQ------NI...........ELSEAHRL-----------------------------------------
E3DMW8_HALPG/2-160L--MKFVG.REV------GK...........KPGEIWHD-----------------------------------------
Q5E1F5_VIBF1/2-160L--IISLS.KVT------GV...........SIEDLQQV-----------------------------------------
Q2SFY7_HAHCH/2-160L--LQTLS.ARH------SA...........PIPDLLKT-----------------------------------------
F6GI89_LACS5/2-162L--LQHLS.SNT------GI...........SIDNLLLV-----------------------------------------
D8U0R1_VOLCA/59-223L--VITGA.SIL------GV...........TVPQALEA-----------------------------------------
A3HWD6_9BACT/2-163L--AIAAS.EEL------NI...........SVDEVLFT-----------------------------------------
C3Y428_BRAFL/2-164I--ARAAS.ELI------GK...........PQETLLRE-----------------------------------------
B8D0K8_HALOH/2-160L--INTVA.NLV------DK...........SPGELWQE-----------------------------------------
A7RN72_NEMVE/2-166L--VGAAC.EAT------GL...........ELDTVLEV-----------------------------------------
T1ITQ7_STRMM/2-166L--VAAAE.VVL------KL...........SAEEILEM-----------------------------------------
B3RYQ5_TRIAD/10-174L--VKTAS.EVL------GI...........QVNDLLET-----------------------------------------
L0JGE2_NATP1/2-161I--ARTAG.DLT------DQ...........SPRTILTQ-----------------------------------------
A8F5S3_PSELT/2-160V--SRKLA.TLK------NL...........SFDEIWYR-----------------------------------------
B0CD92_ACAM1/2-163L--VKSAS.QVL------GI...........SAAEIMED-----------------------------------------
A5I7T3_CLOBH/2-159M--INEIA.SNV------NK...........DVKTLWGQ-----------------------------------------
F2U0N3_SALR5/2-164V--LNTVA.AVT------NL...........SLEDLLAN-----------------------------------------
W4XR28_STRPU/4-177V--STKGA.KIL------GL...........EYTVFMER-----------------------------------------
G1KLN8_ANOCA/2-162L--IQEAC.KTL------KV...........SKETTLKL-----------------------------------------
D9SRG3_CLOC7/2-160M--IEYIA.KEK------NI...........QVKDLWRK-----------------------------------------
K9X5Q3_9NOST/2-163L--VKVTS.EIV------GL...........STVEVMEA-----------------------------------------
G7YQF8_CLOSI/2-164L--FHTAS.KVL------QI...........PEDKIKMD-----------------------------------------
F0RGN9_CELLC/2-162L--ITSLS.SEV------KT...........PVGDLIYA-----------------------------------------
F6YJD6_XENTR/8-169L--VEKVC.NML------DV...........SPEAVLRQ-----------------------------------------
Q5ZWM9_LEGPH/2-162L--IKAIA.KRT------NQ...........HASVFLEA-----------------------------------------
E3N9U4_CAERE/2-167I--FRVAA.SVL------GL...........SVDDMWEM-----------------------------------------
B8DKJ8_DESVM/531-685M--AHELS.RIT------GD...........SSREVFRK-----------------------------------------
B3RYQ6_TRIAD/11-175L--VNVAC.DVL------GL...........SQNEILEQ-----------------------------------------
E9GML5_DAPPU/2-166L--ATAAA.EVV------GNR.........LTELDFLNY-----------------------------------------
F0LTC6_VIBFN/2-162L--IVELS.QVT------GI...........DANELQRV-----------------------------------------
D5XA10_THEPJ/2-162V--VQSVC.KVL------NI...........TLEQAADA-----------------------------------------
H2Y4L1_CIOSA/2-168I--ANSTE.ELT------GV...........TANRIMEG-----------------------------------------
F2TZE3_SALR5/2-165F--LSTVA.KIT------GR...........SEEDCKYE-----------------------------------------
F2UN82_SALR5/2-165F--LRAIA.NVT------GH...........TVEECKYH-----------------------------------------
A6GYD7_FLAPJ/2-163L--ALAVS.QEM------NM...........TINQVLIT-----------------------------------------
A0PXJ5_CLONN/2-160I--MKYIS.ESR------NI...........SINELWRA-----------------------------------------
B3S7Q2_TRIAD/2-165M--VKKTA.RDT------GL...........TVDEIFEL-----------------------------------------
Q21E20_SACD2/2-162L--VVALS.ELT------GV...........PVNELVRS-----------------------------------------
K0ATP4_CLOA9/2-160I--VTYIS.KKI------GK...........SEYDTWKE-----------------------------------------
T1KFI6_TETUR/2-166L--IGAAE.KVL------KI...........PANEILEL-----------------------------------------
F2UR64_SALR5/2-165F--LELVA.KAA------DT...........SVDRCMYE-----------------------------------------
A6LK33_THEM4/2-160F--SQELS.KKV------GK...........TYEQLWEE-----------------------------------------
G3Q1S5_GASAC/2-164I--AKAAS.GVT------GT...........PYNELMNS-----------------------------------------
C3ZF94_BRAFL/7-169M--IMAAS.RIL------GL...........DDSTVLQQ-----------------------------------------
B8HJS1_CYAP4/2-164L--VGAAC.KVL------GM...........SGEEVLKA-----------------------------------------
B7PFU6_IXOSC/2-164L--IAKAC.KVL------RV...........SEREFLEG-----------------------------------------
W4Z032_STRPU/9-171I--VGAAS.EVL------GV...........DGNVVLET-----------------------------------------
G4VA36_SCHMA/2-164L--FLAFS.NET------GE...........TIENVTYE-----------------------------------------
Q310U7_DESAG/727-881M--AEIVC.QRT------GE...........QPKLFFEK-----------------------------------------
A8MIN2_ALKOO/2-160V--FEEIS.KLT------NV...........PTNEIWRK-----------------------------------------
F2TZ95_SALR5/2-165F--LDLAS.KAT------GL...........TLEECMYE-----------------------------------------
E9GML8_DAPPU/2-166L--ADAAV.TLV------ANG.........STRQDFLRF-----------------------------------------
K9UD61_9CYAN/2-163L--VDAAS.VVM------AM...........PATDILEA-----------------------------------------
G3RZQ8_GORGO/2-166L--IQEAC.NIL------EQ...........STESILKL-----------------------------------------
E9GML7_DAPPU/2-166L--ANAAV.TII------ANG.........WTVQDFLAY-----------------------------------------
G8R6C6_OWEHD/2-162L--VVAYA.QRS------EQ...........EVGEVLRK-----------------------------------------
K7AQ34_9ALTE/2-162L--IGLVA.YKQ------NI...........SVRDVQFA-----------------------------------------
Q21ER7_SACD2/2-162Y--IGAVA.ELL------NS...........SASAVTEI-----------------------------------------
I7CPA5_NATSJ/2-161I--LETLS.TMA------TQ...........DRRAIERD-----------------------------------------
Q7Q9W6_ANOGA/2-164L--AAALS.AIT------GK...........PFDEFMIF-----------------------------------------
E9FT54_DAPPU/24-187I--VGAAE.RVL------KV...........PANLLLEK-----------------------------------------
A7RN70_NEMVE/2-168L--LIVAE.DVI------GL...........SKNAILER-----------------------------------------
I2EZ72_EMTOG/2-162L--VSSLS.VRT------QL...........PVSTLLND-----------------------------------------
B2A8E6_NATTJ/2-160L--IEKMA.EKQ------GS...........SSSHVFRK-----------------------------------------
I0K9V5_9BACT/2-162L--VNKLS.EHL------NL...........PTGQLLRT-----------------------------------------
M1MRY0_9CLOT/2-160I--IKELA.EVN------NT...........TVEKIWAD-----------------------------------------
A9V7H3_MONBE/2-165F--LGKVA.ESL------GM...........SQEECLSK-----------------------------------------
K9UZY1_9CYAN/2-164L--VEAAC.EVF------KM...........PAEDILKA-----------------------------------------
Q87NJ1_VIBPA/2-162L--IVNLS.KVS------DI...........PPEQLQEV-----------------------------------------
Q5ZSQ8_LEGPH/4-164L--VKALA.MKN------GK...........PTSVILQE-----------------------------------------
G7Y7K2_CLOSI/23-185L--FTTAS.RML------QI...........PEEEIKYA-----------------------------------------
A3UA30_CROAH/2-162L--LSHLS.TKT------SI...........SIDELLLV-----------------------------------------
B4IBU8_DROSE/2-164F--AAALS.AST------GE...........SFDFCMNF-----------------------------------------
W4X9S3_STRPU/2-166L--VGAAV.KVL------EI...........SANDLLEA-----------------------------------------
A8WS03_CAEBR/2-164L--IWACH.DVT------GD...........QVDELMSN-----------------------------------------
Q8EF49_SHEON/2-161I--VQDVA.QRL------NM...........PIQDVVKA-----------------------------------------
T1JJL9_STRMM/2-164I--VSCAS.KLF------EV...........DERTLMEA-----------------------------------------
GCY34_CAEEL/2-167L--VDSVS.IVL------KV...........TKDQIWEM-----------------------------------------
A5N4H2_CLOK5/2-160V--IEYIA.KVN------NE...........DTKELWKK-----------------------------------------
B9JYX7_AGRVS/2-166L--LAALS.QRS------GL...........GVDALMQA-----------------------------------------

PF02830

A4XDS4_NOVAD/122-182---------ATG------YS-----------TDPVCWMQ-----------------------------------------
A9WB66_CHLAA/138-197---------G.V------RA-----------TEPVCAYY-----------------------------------------
B2UJH2_RALPJ/152-211---------SYG------IG-----------NEAVCWML-----------------------------------------
D0J206_COMT2/112-172---------EWG------PQ-----------DQPSCWML-----------------------------------------
E4PKW5_MARAH/128-189---------ELG------QM-----------DEPACWSL-----------------------------------------
O26930_METTH/130-191---------GLP------NI-----------GHPICFFE-----------------------------------------
O27403_METTH/188-249---------LLH------QI-----------GESACALD-----------------------------------------
O67571_AQUAE/116-177---------AIP------KS-----------DKPVCEPM-----------------------------------------
BCHJ_RHOCB/140-199---------D..------AA-----------ERPSCFWH-----------------------------------------
P74443_SYNY3/170-231---------TLG------DV-----------GKPVCHIY-----------------------------------------
P74446_SYNY3/202-263---------CAP------QG-----------KCPMGFLE-----------------------------------------
Y745_METJA/119-179---------DL.------SF-----------EEPICYFD-----------------------------------------
Y1460_METJA/95-156---------QWV------SK-----------EEPIHDFI-----------------------------------------
Q881E3_PSESM/120-181---------ACG------TG-----------QDPVCWTE-----------------------------------------
Q8DGL5_THEEB/132-193---------APK------NT-----------GQPQCAAE-----------------------------------------
Q8DKK3_THEEB/150-211---------TLG------DV-----------GKPVCYIY-----------------------------------------
Q8R5R6_CALS4/52-113---------HLL------PI-----------GEPQCYLE-----------------------------------------
Q8TIU0_METAC/206-264---------VYG------AS-----------DQPVCAFM-----------------------------------------
Q8TQT2_METAC/185-246---------VMP------AI-----------GKPLCVLR-----------------------------------------
Q8TV82_METKA/104-164---------GY.------DI-----------GKKLCYYQ-----------------------------------------
Q8TWC8_METKA/86-147---------GYV------NA-----------EGAVCNFL-----------------------------------------
Q8TX90_METKA/68-129---------EEM------GF-----------TEPACELE-----------------------------------------
Q8TXN0_METKA/66-127---------GYP------GA-----------RGPVCHFM-----------------------------------------
Q8TXN0_METKA/224-288---------GFP------RE-----------HEPVCHGV-----------------------------------------
Q8TXW7_METKA/177-236---------DLP------Y.-----------.GPACHLE-----------------------------------------
Q8U209_PYRFU/331-392---------RLK------NF-----------PYPAHVNY-----------------------------------------
Q8XT87_RALSO/150-211---------AYG------VG-----------TAPACWRQ-----------------------------------------
Q8XTP9_RALSO/107-174---------Q.P------GK-----------EGKLCYMF-----------------------------------------
Q9KLM3_VIBCH/129-188---------SY.------YS-----------KRQLCAAA-----------------------------------------
BCHJ_RHOS4/143-203---------G.E------SS-----------DTPLCHWH-----------------------------------------

PF04051

T1JVG1_TETUR/7-153E..LENVGHSTG......YR-----------LIE.RITK...............DS.H......................
E5SJ80_TRISP/8-152K..LEDMGVRVG......LA-----------LAE.FLSM...............DM.L......................
M0RYG7_MUSAM/13-175R..IEAIGYQVG......HQ-----------LIE.RYTV...............ER.P......................
X6NU62_RETFI/84-239R..LSGIGYQIG......IK-----------QLELITHR...............LRPM......................
E4WZM5_OIKDI/17-163Q..LDKMGYNIG......VR-----------IIDDFLAKN.R.HG.....R.C...........................
A7T063_NEMVE/19-166Q..LNKMGYNIG......VR-----------LIEDFLARS.N.VG.....R.C...........................
U3IS73_ANAPL/19-165C..LDRMGYAIG......IR-----------LIDDFLARS.S.VK.....R.C...........................
G0RJ43_HYPJQ/25-253R..LEAQGYRVG......QG-----------LVE.RFSR...............DR.P......................
A8BA91_GIAIC/27-185K..MSKLGVDAGRPLWTYVR-----------MLDRMRSK...............TQDTVC....................
I2H4M5_TETBL/53-262K..LNKHGFGIG......VR-----------LLELLNFR...............ASLPVTT...................
A0A0D2UGE9_CAPO3/18-164Q..LEKMGYNIG......IR-----------LIEEFLART.N.TG.....K.C...........................
C1MS22_MICPC/30-175K..LDAMGRSIG......GR-----------LIEEFNAKNEQ........QRC...........................
D7FQV7_ECTSI/36-189K..LEEAGYGMG......LR-----------VLELQTFR...............ERLQ......................
E7NGB5_YEASO/62-271K..LSDYGHNIG......IR-----------LLELLNFR...............ASVSPSS...................
A7TQ02_VANPO/35-184Q..LFSMGYNIG......VR-----------LIEDFLART.A.LP.....R.C...........................
R9AMQ2_WALI9/26-174A..LDRMGYGIG......VR-----------LIEEFLAKHSPGLA.....K.C...........................
G8ZPV8_TORDC/45-260R..LRSMGNQIG......NK-----------LTELLVFS...............NN.P......................
Q38DI4_TRYB2/28-190R..LTSLGAIVG......AK-----------LMMLSSLK...............DPLELQ....................
M2YLM3_DOTSN/24-219R..LDGLGYRVG......QG-----------LVE.RFSA...............GK.P......................
N4VA41_COLOR/25-174Q..LDKMGYNIG......LR-----------LIEDYLAKS.NTMK.....R.C...........................
U4LDL1_PYROM/26-177Q..LDKMGYNIG......LR-----------LIEDFLAKT.N.TG.....R.C...........................
N1Q0J8_DOTSN/59-215R..LNRAGYPIG......IK-----------LLDLLLYR...............Q.........................
I1EHD1_AMPQE/31-180K..LADLGRHVG......FR-----------MIDLLCVR...............DRAP......................
E9I9Q7_SOLIN/5-151Q..LERMGYNIG......IR-----------LIEDFLART.G.SG.....R.C...........................
E1ZPW5_CHLVA/28-181K..LDEVGYGVG......LR-----------LLEVLCYR...............ERAQ......................
K0R7X6_THAOC/23-249R..IERMGYDVG......YR-----------LCE.RLAQ...............HR.P......................
Q5KMH2_CRYNJ/70-228R..LSSLGYDAG......QR-----------LLPLLLLR...............N.........................
G8YS93_PICSO/81-235R..LNTLGYQIG......QR-----------FLELVKTR...............E.........................
K3XAK0_PYTUL/47-201R..LDDAGFGVG......VR-----------VGELLCHR...............EKSG......................
I1JRI0_SOYBN/10-175R..IEAIGYQVG......HQ-----------LSE.RYTM...............DR.P......................
L8FYS8_PSED2/51-210R..LNVQGHPIG......LK-----------LLDVLIWR...............E.........................
F1QMV3_DANRE/7-155K..LENMGFRVG......QG-----------LIE.RFTK...............DT.P......................
C1MRP2_MICPC/11-162K..LSEAGQGVG......SR-----------MLEVLACR...............DKSN......................
E6ZN37_SPORE/79-291R..LEGIGYHVG......YH-----------MTE.SLAR...............DR.A......................
G2QD82_MYCTT/25-217R..LERIGYRVG......QG-----------LVESRFSR...............DR.P......................
L8FNC8_PSED2/24-220R..LETLGYRVG......QG-----------MVE.RFSI...............DR.P......................
A8JFB7_CHLRE/26-178A..LEAVGYRVG......QQ-----------LAE.RYTR...............DK.P......................
T1JCC7_STRMM/19-164Q..LDKMGYNIG......VR-----------LIEDFLARS.G.SG.....R.C...........................
W4ZHN1_STRPU/7-154K..LEQMGYRVG......QS-----------LIE.KFTR...............ES.P......................
I2H1V3_TETBL/54-297R..VRSMGLQIG......CN-----------LTELLVFS...............NN.P......................
U1HTW2_ENDPU/68-231R..LNEQGHPLG......LK-----------LLDLLLYR...............S.........................
G9NKV9_HYPAI/25-220R..LEAQGYRVG......QG-----------LVE.RFSR...............DR.P......................
H0XNR3_OTOGA/7-161I..LEGIGFRVG......QA-----------LGE.RLPQ...............ET.L......................
K0KYJ5_WICCF/14-204K..VEQYGFSIG......IR-----------ISEILIYK............NSNNEIL......................
K0KLU0_WICCF/62-215K..LNSYGYGVG......NK-----------FLELITLR...............E.........................
Q5AH42_CANAL/17-209R..VESYGYSLG......LK-----------IAEVLLYK............SSGNKV.......................
M7SMZ2_EUTLA/56-213G..LNTQGHPIG......VK-----------LLDLLLYR...............E.........................
B7QH45_IXOSC/19-163Q..LDRMGYNIG......LR-----------LIEDFLART.N.VG.....R.C...........................
S8AJT6_PENO1/24-183R..LESLGYRVG......QG-----------LAE.RFSR...............DR.P......................
Q6BJ77_DEBHA/81-235R..LNGLGYQIG......QR-----------FLELVKLQ...............E.........................
B9REX0_RICCO/10-174R..IEAIGYQVG......HQ-----------LAE.RYTM...............ER.P......................
A7TDQ9_VANPO/62-283K..LLNYGSSIG......LR-----------LLELLNIR...............ASVPSNT...................
B0WI08_CULQU/33-179K..LHDLGKDIG......CR-----------IIDLYFVR...............ERNS......................
K0THW2_THAOC/54-215Q..LDKIGKSIG......VR-----------CVDEFLAKA.DVAGLGLASQ.C...........................
M2LVJ4_BAUCO/27-183E..LDRMGYAIG......LR-----------LIEDFLART.N.SG.....T.C...........................
C1E3Y1_MICCC/27-178R..LEDAGTGVG......VR-----------MLEILSYR...............EKGN......................
N1PWF2_DOTSN/25-183E..LDRMGYNVG......LR-----------LVEDFLAKS.N.TG.....T.C...........................
K1R003_CRAGI/7-154K..LESLGFRIG......QS-----------LVE.RFTK...............ES.P......................
G6CTZ1_DANPL/27-173K..LSEMGYDVG......TR-----------LLDLYFVR...............ERNS......................
H3AV40_LATCH/7-156V..LEGMGFRVG......QG-----------LIE.RYTK...............DT.P......................
B8BY05_THAPS/56-299R..IERMGYDVG......YR-----------LCE.RLAQ...............HR.P......................
G0W6Q4_NAUDC/35-267R..LRNIGFQLG......KK-----------LSELLVFT...............NN.P......................
E9H4K9_DAPPU/19-165Q..LDRMGYNIG......VR-----------IIEDFLART.S.TA.....R.C...........................
M3JAQ1_CANMX/81-235R..LNGLGYSIG......QR-----------YLELCKIR...............E.........................
E0VWU3_PEDHC/35-181K..LSEIGYDIG......TK-----------FIDILMVR...............EKNY......................
TPPC5_CHICK/29-175K..LAQLGHQVG......LR-----------LLDPLVSR...............ERGG......................
U5GZ24_USTV1/149-310R..LNILGYRIG......VR-----------LLELLPLR...............DHLYPLS...................
G3BDP0_CANTC/25-175E..LEKMGYNIG......IR-----------LIEEFLAKT.G.IQ.....R.C...........................
A3FPW1_CRYPI/6-158K..LHEMGISVG......FK-----------IVELISIR...............DKAHQ.....................
A0A068Y1Y0_ECHMU/29-182K..LASFGAPIG......RQ-----------MLDLVFLR...............ERLQ......................
E0VBE5_PEDHC/18-159Q..LERMGYNIG......VR-----------LIEDFLART.S.SG.....R.C...........................
Q229D2_TETTS/19-169Q..LEKLGFDIG......SR-----------LIDEFVAKSEG........KLC...........................
Q5ARJ4_EMENI/23-173Q..LEKMGYNIG......MR-----------LIEDFLAKS.N.AQ.....R.C...........................
D2VAM4_NAEGR/13-161I..VERMGYNVG......LR-----------IAE.KLTK...............DRTT......................
A5E6K8_LODEL/83-237R..LNGLGYQIG......QR-----------YLELIKLR...............E.........................
G3PGZ9_GASAC/12-159K..LENMGFRVG......QG-----------LME.RLTK...............DT.A......................
K3WA95_PYTUL/9-188K..LEAMGYDVG......YR-----------FAE.RSAK...............DR.P......................
E0V955_PEDHC/7-159T..LEYLGYITG......FR-----------IIE.RLTR...............EW.S......................
F0YEM0_AURAN/27-173K..LESMGHGIG......MR-----------LIDEFLAKS.G.IN.....N.C...........................
I2FPM0_USTH4/86-296R..LESIGYHVG......YH-----------LTQ.TLAR...............DR.A......................
C5FQV7_ARTOC/73-244R..LNEQGYPLG......LR-----------LLDLLLYR...............SLTGSST...................
D8S611_SELML/22-168Q..LDTMGYNIG......IR-----------LIDDFLSKA.N.VT.....R.C...........................
C3Z0P3_BRAFL/26-172K..LSDLGQHVG......FR-----------ILDTLFLR...............EKNY......................
A8J2W3_CHLRE/37-190R..LERVGYDVG......VR-----------VLELLSYR...............EKSL......................
N1J5N2_BLUG1/51-211R..LNVQGYPIG......LK-----------LLDLLLYR...............E.........................
N1QHC0_SPHMS/25-275R..LDGLGYRVG......QG-----------LVE.RHSI...............LK.P......................
D7ELH8_TRICA/28-174R..LHELGRRVG......VK-----------LIDLYFLR...............ERNG......................
B9PH75_TOXGV/34-184R..LHELGLRVG......YK-----------ILDLLVYR...............ERHK......................
G8Y8F7_PICSO/26-179Q..LDRMGYNIG......MR-----------LIEEFLAKT.G.AQ.....R.C...........................
G7YIU1_CLOSI/20-169R..LAEFGRHVG......ER-----------MVDVVYVR...............EKPQ......................
H2AYQ1_KAZAF/33-182E..LYKMGYNIG......VR-----------IIEDFLART.A.LP.....R.C...........................
A5DAF5_PICGU/11-206R..IENCGYNLG......IR-----------LADLLAYKAFS........GPSSGKV.......................
W5NBF1_LEPOC/14-166V..LERMGFRVG......QG-----------LIE.RFTK...............DT.P......................
K5XGY5_AGABU/26-191E..LEKMGYNIG......TR-----------LIEDFLAKS.N.VS.....R.C...........................
Q4N4M8_THEPA/26-173TQILSGMGVEIG......NR-----------ILDYLTVR...............EKIT......................
B0CQU1_LACBS/73-229R..LNTLGYRIG......TR-----------VLELMVWR...............A.........................
E2AMW5_CAMFO/32-178K..LAEMGAEVG......HR-----------ITDLLVMR...............EKNG......................
G8ZMF5_TORDC/62-270T..LNEHGFSIG......SK-----------LLELLNLR...............ASIPATA...................
U9V6Y8_RHIID/25-174Q..LEKMGYNIG......VR-----------LIEDFLARA.S.LG.....R.C...........................
F2ULX4_SALR5/17-165H..VEAIGYRTG......LA-----------LFE..............................................
J5PUV7_SACK1/30-179H..LYSMGYNIG......CR-----------LIEDFLART.A.LP.....R.C...........................
G4TPC2_SERID/27-219Q..LEKMGYNIG......TR-----------LIEDFLARS.S.LG.....R.C...........................
A2DFH3_TRIVA/11-155K..LDEIGYRIG......LR-----------LAHDFGR..........................................
A4H8R9_LEIBR/29-178Q..LYNMGHRIG......AR-----------LIEEYSVRSGA........APC...........................
D8M290_BLAHO/13-159Q..IELLGYNIG......VR-----------LIEEYLAKTRT........RSL...........................
F7DY97_XENTR/7-161V..LEGMGFRVG......QG-----------LIE.RLTK...............DS.P......................
H2XLK9_CIOIN/10-155Q..LESLGFRVG......VS-----------LGE.QLTK...............DL.P......................
T0MD09_COLGC/45-203R..LNVQGHSIG......LK-----------LLDLLLFR...............E.........................
A0A068XM21_HYMMI/29-182K..LAAFGAPIG......KQ-----------MLDLIFLR...............DKLQ......................
F9X1V4_ZYMTI/54-212R..LNRAGYPLG......LK-----------LLDLHLHR...............S.........................
A2FQV8_TRIVA/8-151K..LSKIGVNIG......NR-----------ITDEFVVHADK..........CRF.........................
B3S2G2_TRIAD/32-178K..LASLGHHVG......TR-----------ILDALYLR...............ERGS......................
F7AEP2_CIOIN/19-166Q..LDKMGYNIG......VR-----------LVEDFMARS.N.LG.....K.C...........................
F4PUP7_DICFS/116-262K..LEKMGFKVG......YK-----------MVE.RLCL...............DL.P......................
F2U9W2_SALR5/24-172K..LAVIGRRVG......VR-----------LVEVMAMR...............DRTS......................
A9STP5_PHYPA/24-171Q..LDTMGYNIG......AR-----------LVDDFLAKA.N.IT.....K.C...........................
C5DT91_ZYGRC/62-268R..LNGYGYGIG......TR-----------LVELLNLR...............NSVPPNY...................
T1JN97_STRMM/27-173K..LSEMGYNVG......VR-----------IVDILFVR...............EKNY......................
W5MI51_LEPOC/29-175R..LAELGQQVG......AR-----------VLDVLVLR...............EKNG......................
A0A068YAR7_ECHMU/19-165Q..LDNIGFNIG......QK-----------LAEDFVAKG.N.PG.....R.C...........................
C4QV75_KOMPG/64-226R..LNGLGYTIG......LK-----------YLELLGLR...............E.........................
B3MSU3_DROAN/7-150T..LEYIGFTTG......YR-----------LIE.RLTR...............ES.P......................
YA95_SCHPO/16-173M..LESIGFQVG......RK-----------ITE.RLLL...............NR.N......................
F4NUA2_BATDJ/28-180K..LSDFGYRVG......VR-----------MLEFILWR...............D.........................
C4QV63_KOMPG/25-176Q..LESMGYNIG......IR-----------LIEEFLAKT.N.FG.....R.C...........................
B6K0U0_SCHJY/46-198R..LNEHGFRVG......QR-----------LVELVVWR...............E.........................
A8J304_CHLRE/23-167Q..LEQMGYNMG......IR-----------LVDEFLAKA.K.IS.....R.C...........................
Q5CYM1_CRYPI/33-178K..LEKIGYNIG......IR-----------LVDEFLAKS.G.IS.....K.C...........................
A0C1N5_PARTE/23-175K..MEQLGVSVG......IR-----------LYEVVSLR...............ERN.......................
I1FWR8_AMPQE/23-171Q..LDKMGYNIG......VR-----------LIEDFLARSPE.VG.....R.C...........................
E3KIT7_PUCGT/25-194Q..LDKMGYNIG......TR-----------LIEDLLARS.S.LP.....R.C...........................
I1IIL5_BRADI/13-174R..IEAIGFQVG......HQ-----------LSE.RYTM...............DR.P......................
E1ZCI6_CHLVA/12-169A..LDAVGERTG......RQ-----------LAE.RYAR...............DR.P......................
C4Y011_CLAL4/81-235R..LNGLGYQVG......QR-----------YLELVKLR...............E.........................
M9M538_PSEA3/137-321R..LSLIGYRVG......QR-----------VLGMAMHR...............QEMLQ.....................
T1G2G3_HELRO/30-176K..LSDLGFHVG......QR-----------YLDLIVLR...............EKGH......................
B8BSU9_THAPS/34-187R..LESAGYGVG......LK-----------VLEMVAYR...............AKET......................
G0SHA4_CHATD/46-206R..LNEQGHPIG......LK-----------LLDLLLIR...............E.........................
A4S1Q7_OSTLU/26-177A..LERVGRAMG......AR-----------MVEEFLSRT.NASG.....GAC...........................
G4UMV3_NEUT9/25-221R..LEGLGYRVG......QG-----------LVE.RFSR...............DR.P......................
Q4N8Y2_THEPA/23-170H..LILMGKNIG......SK-----------LVDELLAKL.G.CV.....P.C...........................
Q6FQX3_CANGA/31-265R..IQNVGFQIG......SK-----------LCELLVFS...............NN.P......................
U5D335_AMBTC/11-175R..IEAIGFQVG......LQ-----------LSE.RYTM...............DG.S......................
Q9CAW4_ARATH/10-172R..IEAIGYQVG......HQ-----------LSE.RYTM...............ER.P......................
A0A0H5S8A4_BRUMA/12-192R..LEALGYRVG......FV-----------LVE.KIAK...............DL.P......................
V5EZN4_KALBG/139-299R..LSLLGYGIG......QR-----------LLGLTLHR...............QEMTG.....................
C5DJK5_LACTC/39-188Q..LYAMGYNIG......VR-----------LIEDFLART.A.LP.....R.C...........................
Q6CFM1_YARLI/100-269R..LNTLGYHVG......QR-----------ALELVTIR...............E.........................
T1G6X9_HELRO/19-166Q..LDKMGYNIG......IR-----------IIEDFLARS.G.IG.....R.C...........................
M7XQX5_RHOT1/47-279K..LEGLGFKVG......WA-----------TAE.RLTR...............DR.P......................
E9HC76_DAPPU/27-173K..LSEFGQQVG......IR-----------MLDLLIVR...............EKNG......................
B3S9Y0_TRIAD/20-167Q..LDKMGYSMG......VR-----------MIEDFLARN.N.IG.....R.C...........................
W1QG52_OGAPD/46-210K..LNNLGYSIG......TK-----------VLELASLR...............ENFSNNL...................
W1QKQ7_OGAPD/25-176Q..TYKMGYNIG......VR-----------LIDEFLQKT.Q.LS.....R.C...........................
B8NLT0_ASPFN/68-238R..LNEQGYPLG......LR-----------LLDLLYYR...............TIT.SST...................
F8QEM7_SERL3/28-191Q..LEKMGYNIG......TR-----------LIEDFLAKS.S.LG.....R.C...........................
C4WXG1_ACYPI/18-164Q..LDRMGYNIG......VR-----------MVEDFLART.N.AG.....R.C...........................
A0DEI2_PARTE/22-171Q..LEKMGFNIG......QR-----------IIDEYLSKAEI........KQC...........................
Q5BKN1_XENTR/19-166Q..LEKMGYNIG......VR-----------LIEDFLARS.S.IG.....R.C...........................
F4NUX8_BATDJ/18-169K..LELLGFRVG......HG-----------IAE.RSTK...............DR.P......................
X6NME0_RETFI/27-208K..LEEMGYSIG......CR-----------LIDEFLSKSQT........RNC...........................
C5LHW2_PERM5/39-200E..LYRMGTDIG......AR-----------LLDEFLIKSRA........PPC...........................
D8LQV4_ECTSI/27-175Q..LESMGYNIG......VR-----------LIDEFLAKA.G.VS.....TPC...........................
S3CL82_OPHP1/25-222R..LEMLGYRVG......QG-----------LVE.RFSR...............DR.P......................
B6TBL7_MAIZE/8-172R..IEAIGFQVG......HQ-----------LSE.RYTM...............ER.P......................
G2X4J4_VERDV/43-207RPQLNNQGHPLG......LK-----------LLDLLLHR...............E.........................
E1FZ82_LOALO/46-192K..LLGYGKFVG......SR-----------LLDVIVLR...............EKGY......................
A0A023BA01_GRENI/25-169K..QYEIGHRIG......SR-----------VLLLLTFR...............DK..L.....................
Q4Y963_PLACH/24-168C..LHEMGIRVG......YK-----------LNEYLCYR...............NKA.......................
R9PED1_PSEHS/82-292R..LEGIGYHVG......YH-----------MTE.ILAR...............DR.A......................
H2SS24_TAKRU/7-156K..LENLGFRVG......QG-----------LIE.RLTK...............DT.A......................
C5M680_CANTT/23-177Q..LDKMGYNIG......LR-----------LIEEFLAKT.G.IR.....R.C...........................
B4KNN6_DROMO/35-181R..LHDLGQDVG......TR-----------IIDLYFVR...............ERSS......................
D5GMV6_TUBMM/70-223K..LNLHGYSIG......QR-----------LLELLLWR...............E.........................
Q57UH5_TRYB2/27-175Q..LDTMGRRIG......SR-----------LVEEYSARSGA........PAC...........................
G0NYX4_CAEBE/5-183K..LESIGFRVG......RQ-----------LVE.KVSK...............EA.P......................
W1QFA9_OGAPD/15-208R..LEKYGYEIG......YK-----------ITDCIIYKKSV........QEGVNIQ.......................
V2X627_MONRO/28-195Q..LEKMGYNIG......TR-----------LIEDFLAKS.G.LG.....R.C...........................
V8NPD8_OPHHA/12-161K..LENMGFRVG......QG-----------LIE.RFTK...............DT.A......................
E1FS68_LOALO/12-192R..LEALGYRVG......FV-----------LVE.KIAK...............DL.P......................
E9FYX1_DAPPU/7-155K..LEQIGYSTG......YR-----------FIE.RLTK...............DL.S......................
B9SBX8_RICCO/30-183R..LEDAGYAVG......AR-----------VLELLCHR...............EKGN......................
G4VMI7_SCHMA/18-164Q..LDKIGFNIG......LK-----------LVEDYLARG.N.SG.....R.C...........................
C5DSC4_ZYGRC/30-179H..LFSMGYNIG......VR-----------LVEDFLART.A.LP.....R.C...........................
A0A0C4E4C9_MAGP6/42-202R..LNMQGHPIG......IK-----------LLDLLLYR...............E.........................
E4UYX6_ARTGP/25-214R..LESLGYRVG......LG-----------LGE.RFSR...............DR.P......................
TPPC5_PLAF7/24-172C..LHEMGLRVG......YK-----------LNEYLTYK...............NKV.......................
R1GJ88_BOTPV/25-232R..LEMLGYRVG......LG-----------ITE.RFSR...............DK.P......................
G8BPN1_TETPH/36-270R..LQSIGFNIG......SK-----------LTELLVFK...............NN.P......................
I7LU45_TETTS/24-174......MGEGIG......VR-----------LLELIYFR...............NNKL......................
K7J974_NASVI/23-174S..LEWMGFSVG......YR-----------IIE.RLTR...............EW.P......................
C4WU32_ACYPI/8-151I..LEHLGYSCG......WR-----------LIE.RITK...............EL.P......................
G3BB76_CANTC/11-168K..IELLGYKLG......IK-----------LNELLLFKLAD........QFSKNNE.......................
Q74ZA3_ASHGO/45-194Q..LYSMGRSIG......VR-----------LIEDFVARA.A.LP.....R.C...........................
Q2GUE9_CHAGB/23-174Q..LDKMGYNIG......LR-----------LIEDYLAKS.NTFK.....R.C...........................
C4WVR1_ACYPI/32-178R..LSDLGQEVG......TK-----------LIDLHFLR...............EKNS......................
W4YXQ6_STRPU/27-174Q..LDKMGYNIG......IR-----------LVEDFLARS.G.IG.....R.C...........................
J7RXA7_KAZNA/87-338M..LSEFGAKIG......LR-----------LLELLNFR...............SSISPTS..ASAASAANTARSNVYSS
Q0IEU7_AEDAE/18-164Q..LERIGYNMG......MR-----------LIEDFLSRT.N.SP.....R.C...........................
H2AWC3_KAZAF/48-262R..IRTIGFKLG......CK-----------IADLLVFA...............NN.P......................
A7SRF2_NEMVE/30-176K..LSDLGQHVG......AR-----------ILDVLVLR...............EKGL......................
F9X8Z0_ZYMTI/25-182E..LDRMGYNMG......LR-----------LIEDFLAKS.N.TG.....A.C...........................
G0SUM5_RHOT2/32-186Q..LDKMGYNIG......VR-----------LIEDFLART.G.LA.....R.C...........................
D6WJE6_TRICA/18-164Q..LERLGYNMG......VR-----------LIEDFLAKT.G.TG.....R.C...........................
S9W187_SCHCR/46-198K..LNEHGYRVG......QR-----------LIELVIWR...............E.........................
E9CS20_COCPS/26-194R..LESLGYRVG......LG-----------LAE.RFSR...............DR.P......................
G2YWQ0_BOTF4/25-194R..LESLGYRVG......LG-----------LVE.RFSK...............DR.P......................
Q6CJT3_KLULA/45-194Q..LFSMGYNIG......IR-----------LIEDFLART.A.IP.....R.C...........................
F6PI56_XENTR/22-168Y..LDAMGYNIG......IR-----------LIEDFLANT.G.IK.....K.C...........................
J9P7K2_CANLF/40-190V..LEGMGFRVG......QA-----------LGE.RLPQ...............ET.L......................
R4XC32_TAPDE/22-184Q..LDRMGFNIG......VR-----------LIEDFLART.G.QG.....K.C...........................
E7KII5_YEASA/45-265R..LRNIGFQIG......LK-----------LSELLIFS...............NN.P......................
B6AFL0_CRYMR/33-177R..LEKIGYNIG......IR-----------LVDEFLAKS.G.IS.....N.C...........................
Q6NUY4_DANRE/7-159T..LELMGFRVG......QG-----------LIE.RFTK...............DC.P......................
U9U2P9_RHIID/42-194K..LNDFGYRVG......TR-----------LLELIVWR...............D.........................
V5GF24_KALBG/79-284R..LESIGYHVG......YH-----------IAE.NLAR...............ER.A......................
M2LT53_BAUCO/23-245R..LDGMGYRVG......QG-----------LVE.RFSV...............NK.P......................
A9VBF9_MONBE/9-149Q..LDRMGFNIG......VR-----------IVDDFFSHT.NQDY.....R.C...........................
B6JXV2_SCHJY/22-166E..LEKMGENIG......VR-----------LIEEFLAKT.E.CE.....R.C...........................
M3YXR2_MUSPF/13-162K..LENMGFRVG......QG-----------LIE.RFTK...............DT.A......................
F0XPM8_GROCL/25-250R..LDMLGYRVG......QG-----------LVE.RFSR...............ER.P......................
K1RC27_CRAGI/28-174K..LSELGQHVG......TH-----------MLDLLFVR...............EKGY......................
G4M1E3_SCHMA/643-797R..LSDFGKFIG......ER-----------IIDIVYLR...............DKPN......................
H0XQ40_OTOGA/31-176H..LAALGRQVG......AH-----------VLDALVAS...............EKGA......................
Q54TK7_DICDI/133-280K..LDKLGFKVG......HR-----------LVE.RLSL...............DT.A......................
F6R0S8_MONDO/5-160V..LEGMGFRVG......QG-----------LAE.RLPR...............GA.L......................
B7G9P1_PHATC/27-178E..LDRMGHSMG......IR-----------SVEEFLAKA.SLEPQSQTAVTC...........................
N4UR67_COLOR/25-234R..LETLGYRVG......QG-----------LVE.RFSR...............DR.P......................
I2G5Q2_USTH4/26-174Q..LEKMGYNIG......TR-----------LIEDFLART.N.LS.....K.C...........................
M7NLF3_PNEMU/15-189R..LELLGFKVG......QR-----------LVE.RFSQ...............NK.S......................
A3LWB7_PICST/17-213R..IETYGYSLG......LK-----------LAEVLLYKN..........TTSGTKL.......................
B0DXI4_LACBS/36-240R..LEAIGMHVG......GN-----------YTE.RLCR...............DR.P......................
Q6C4X8_YARLI/7-176R..VEGYGYRVG......RG-----------IAE.................SFSNERP......................
M2RGY3_CERS8/28-198Q..LEKMGYNIG......TR-----------LIEDFLARA.A.LG.....R.C...........................
G1KP89_ANOCA/19-164S..LETMGHSIG......IR-----------LVEDFLARS.A.VK.....K.C...........................
F6ZPU3_CIOIN/28-174K..LSDFGFSVG......SR-----------LVDLLIVR...............EKGN......................
H3G610_PHYRM/6-148Q..LDKMGYNIG......VR-----------LVDEFLAKS.G.VS.....S.C...........................
TPPC3_CAEBR/20-166Q..LDKMGFNMG......TR-----------LADDFLAKNAN.VP.....R.C...........................
D3BR33_POLPA/141-287K..LEKLGYKVG......HK-----------LVE.KLTI...............EQ.Q......................
E4XK01_OIKDI/26-172M..LAEMGKDVG......WR-----------SIDLLYHR...............EKKN......................
F6U759_MACMU/13-160V..LESMGFRVG......QA-----------LGE.RLPR...............ET.L......................
G6CHQ2_DANPL/18-161Q..LERIGYNMG......VR-----------LIEDFLART.P.ST.....R.C...........................
G1XT68_ARTOA/25-235R..LESLGYKVG......IG-----------LVE.RFSR...............DR.S......................
E2ATA3_CAMFO/23-173R..LEWMGFSVG......YR-----------IIE.RLTR...............EW.S......................
E9AFF6_LEIMA/35-197R..LTSLGAHVG......TR-----------LIMLSSVR...............DPVDLQ....................
K1QH85_CRAGI/19-166Q..LEKMGYNIG......VR-----------LIEDFLARS.N.VG.....R.C...........................
S8FDP6_FOMPI/33-233R..LEAIGMHVG......AN-----------VAE.RLCH...............DR.G......................
D8R4W7_SELML/16-172R..IEAIGFQVG......QQ-----------LAE.RYTR...............DR.P......................
Q6CPP3_KLULA/68-235K..LNSSGYTIG......MR-----------LTEILNFR...............DSVPNKT...................
Q4D5L3_TRYCC/27-174Q..LDAMGRRIG......SR-----------LIEEYSVRSGV........PAC...........................
E3L3N3_PUCGT/89-270K..LNILGYQVG......SR-----------LLSLLSLR...............D.........................
A5DI63_PICGU/78-232R..LNGLGYQVG......QR-----------YLELVKVR...............E.........................
I4Y7D2_WALMC/18-172K..LNWLGYRVG......QR-----------ELELYKFR...............Q.........................
C8V0H5_EMENI/25-184R..LESLGYRVG......QG-----------LAE.RFSR...............DR.P......................
TPPC5_DICDI/25-178K..LSDMGYSIG......PR-----------LLELLCVR...............EKNS......................
V2WY43_MONRO/33-234R..LEAIGMHVG......AN-----------FAE.RLCR...............DR.P......................
A8N0N0_COPC7/32-255R..LLAIGSHTG......AN-----------LSE.RLCL...............HR.P......................
F0YNA2_AURAN/14-167R..LEECGHSVG......LR-----------ILELLSHR...............ERRV......................
R7YXJ3_CONA1/25-225R..LEMLGYRVG......LG-----------VVE.RFSR...............DK.P......................
T1ELP2_HELRO/7-152K..LELLGFRVG......HS-----------IVE.RLTK...............DS.P......................
Q6FMN4_CANGA/21-208R..LSKMGYNIG......LR-----------LIELLNFR...............ASATFTS...................
G0VDG8_NAUCC/35-184R..LFSMGYNIG......VR-----------LIEDFLART.A.LP.....R.C...........................
E9E9Y1_METAQ/640-835R..LESLGYRVG......QG-----------LVE.RFSR...............DR.P......................
I4Y6T3_WALMC/34-192K..LKHVGTSIG......HT-----------VAE.RIKQ...............TREP......................
R4FKT2_RHOPR/29-175K..LCEMGQEVG......IK-----------LIDLYYMR...............EKNG......................
G3P0A2_GASAC/7-161V..LESMGFRVG......QG-----------LIE.RLTR...............DS.P......................
R4FPN5_RHOPR/18-161Q..LERMGYNIG......VR-----------LIEDFLAKT.G.SG.....R.C...........................
G6CLX9_DANPL/7-155V..VEYIGFAAG......YK-----------IME.RLTR...............EW.P......................
S9W2C4_SCHCR/22-169E..LEKMGYNIG......IR-----------LIEDFLART.E.WH.....R.C...........................
B6AG61_CRYMR/12-186T..LEENGFYLG......IR-----------FVE.RLSL...............ERS.......................
B7G7P9_PHATC/18-194K..VERMGYSVG......YR-----------ITE.RLAL...............N.........................
G4TBB1_SERID/92-248K..LNTLGYRMG......LK-----------MLELHAWR...............T.........................
H2B1V9_KAZAF/63-287K..LLTNGFQIG......SK-----------LLELLNFR...............SSINPTN...................
G1WYZ0_ARTOA/60-213K..LNLHGYAVG......QR-----------FLELLLWR...............E.........................
J7S6F2_KAZNA/43-192E..LFQIGYNLG......VR-----------LIEDFLART.A.LP.....R.C...........................
M7X5P9_RHOT1/76-239R..LSIIGYRVG......AR-----------LLELLPLR...............DYLYPVS...................
D0MS35_PHYIT/9-170K..LEAMGYDVG......CR-----------FAE.RSAR...............DR.P......................
G3AVF7_SPAPN/17-209R..VENYGYNLG......VK-----------IAEVLLYR............AGGNKI.......................
C4Y593_CLAL4/16-205R..IDAIGFSLG......LR-----------LTEVLMYKA...........PTQTKA.......................
H2ZW82_LATCH/19-167E..LDNMGYNIG......VR-----------LIEDFLAHS.D.VR.....R.C...........................
T1KX51_TETUR/32-178K..LSEMGYHVG......QR-----------LVDLTFIR...............EKNY......................
F0V9N6_NEOCL/25-171Q..LEKMGYNIG......IR-----------LVDEFLAKT.GMGG.......C...........................
S2JN73_MUCC1/38-191K..LETLGYAVG......QR-----------LVE.RFTK...............DR.P......................
C4M937_ENTHI/26-176E..LDEMGYNIG......TR-----------IVEEYLAKVEGKMS.....TKC...........................
E1ZNY8_CHLVA/9-156Q..LDKMGFSIG......QR-----------LIDEYLAKS.K.TQ.....R.C...........................
M7PDJ0_PNEMU/34-186R..LNIQGYRVG......QK-----------LLELISWR...............E.........................
G3AII8_SPAPN/79-233K..LNKLGYSIG......QR-----------YLELIKLR...............D.........................
U5H198_USTV1/33-186Q..LERMGYNIG......VR-----------LIEDFLART.G.LT.....R.C...........................
G1XR36_ARTOA/26-178Q..LDKMGYNIG......LR-----------LIEDFLAKS.NMQQ.....K.C...........................
Q8I1Q2_PLAF7/25-167Q..LEKMGFNIG......TR-----------LIEEFLAKS.D.IS.....F.C...........................
S2JY55_MUCC1/30-178Q..LEKMGYNIG......QR-----------MIEDFLARS.G.IG.....R.C...........................
S2JN70_MUCC1/45-196K..LNEFGYRVG......SR-----------VLELLAWR...............E.........................
S8C0P6_DACHA/25-225R..LENLGYKVG......IG-----------LVE.RFSR...............DR.S......................
U9SP50_RHIID/54-206K..LEMLGYQVG......QS-----------LVE.RFTR...............DR.P......................
E5SI08_TRISP/1-145H..LDKIGYNIG......LR-----------IIDDFFSKNPN.VG.....K.C...........................
Q013E9_OSTTA/27-181A..LDEAGEMVG......RR-----------AFEAQAFR...............ERGSG.....................
B5Y485_PHATC/37-194K..LEATGYGVG......LR-----------VLELLTFR...............TKDY......................
D2W234_NAEGR/23-174Q..LEKMGYKMG......MR-----------LIDEFMSKS.GLGS.....GAC...........................
Q4WDM1_ASPFU/25-185R..LESIGYRVG......QG-----------LAE.RFSR...............DR.P......................
G0WER0_NAUDC/44-292K..LSNYGESIG......LR-----------LLELLNFR...............ASLSPKSFIDSSSSATTTTATTTTTS
R0KDH4_SETT2/38-201R..LNSQGYPIG......LR-----------LLDLLLSR.........................................
K2SHS1_MACPH/53-225R..LNAQGYPLG......LK-----------LLDLLSAR...............S.........................
TRS31_ENCCU/10-152D..LKSIGYEVG......IK-----------LLELCNFE.........................................
G8JU67_ERECY/59-227K..LNALGYTIG......IR-----------LIELLNFR...............ESVPAKV...................
I2GX78_TETBL/27-183Q..LYEMGYNIG......IR-----------LIEDFLART.A.LP.....R.C...........................
C7Z9W5_NECH7/25-227R..LEMLGYRVG......QG-----------LVE.RFSR...............DR.P......................
F6T488_ORNAN/102-268A..LEGVGFRVG......QS-----------LAE.RLPR...............EA.G......................
B8BZL3_THAPS/26-186Q..LDRIGHSIG......VR-----------CVDEFLSKA.DVAGMSLATQ.C...........................
Q6CCJ8_YARLI/25-176Q..LDKMGYNIG......LR-----------LIEDYFAKT.N.TG.....R.C...........................
M7NS17_PNEMU/22-171E..LDNMGYNIG......VR-----------LIEDFLART.N.IG.....R.C...........................
S9W411_SCHCR/16-172F..LENIGFQVG......RK-----------LTE.RLLL...............TR.N......................
A3FQ35_CRYPI/12-189T..LEESGFYLG......IR-----------LVE.RLSV...............FRH.......................
G3AXG1_CANTC/75-229R..LNGLGYQIG......QK-----------FLELSKTR...............E.........................
G0V7A4_NAUCC/49-256K..LSRYGQSIG......LR-----------LLELLNFR...............ASLPASL...................
H2VJ79_CAEJA/24-170K..IASYGKQVG......LR-----------MFDLITLR...............EKGY......................
A8Q0V9_MALGO/24-202Q..LEKMGYNIG......TR-----------IIEDFLART.N.LP.....R.C...........................
G0SHJ8_CHATD/26-235R..LERIGYRVG......QG-----------LVE.RFSK...............DR.P......................
A8NES9_COPC7/27-191Q..LEKMGYNIG......TR-----------LIEDFLARS.S.LG.....R.C...........................
I1LSM6_SOYBN/24-171Q..LDQMGYNIG......IR-----------LIDEFLAKS.N.VS.....R.C...........................
F4RQH4_MELLP/2-196K..LTILGYHIG......IR-----------FLSLLNIR...............E.........................
U4L5M6_PYROM/25-185R..LEQLGYRVG......QG-----------LVE.RFSR...............ER.P......................
Q6BKS7_DEBHA/16-206R..VENYGFDIG......LR-----------ISELIMFK............SSNQKM.......................
E3RF54_PYRTT/20-170Q..LERMGYNMG......IR-----------LIEDFLAKS.S.AP.....A.C...........................
J9F2R2_WUCBA/21-167Q..LDKMGYNIG......LR-----------LADDLLAKNSQ.IQ.....R.C...........................
F1A4T0_DICPU/24-172K..LEQMGYNIG......IR-----------LIEEFLAKS.G.IG.....R.C...........................
Q17E67_AEDAE/7-152A..LEYIGYSTG......YR-----------IIE.RLTR...............EW.P......................
C5DM27_LACTC/105-310R..LHRHGYHIG......LR-----------LLELLKFR...............SSVTPGS...................
B9MZL8_POPTR/10-169R..IEAIGYQVG......HQ-----------LSE.RYTI...............ER.P......................
F2UT79_SALR5/14-156Q..LDKMGYNIG......VR-----------MVDDFIANT.N.TE.....R.C...........................
A2DKK6_TRIVA/18-173Q..LADMGYPIG......CT-----------ILEVLEQS...............SSTGY.....................
G8YIQ3_PICSO/12-197R..IESYGYTLG......LK-----------LAEVLAFQK.............QTKL.......................
F9XI11_ZYMTI/25-225R..LDGLGYRVG......QG-----------LVE.RFSI...............NK.P......................
S0DWK2_GIBF5/51-208R..LNLQGHSIG......LK-----------LLDLLLFR...............E.........................
D8PVM2_SCHCM/27-195Q..LERMGYNIG......TR-----------LIEDFLAKS.G.LG.....R.C...........................
I1FYD4_AMPQE/18-164K..LEALGYGVG......AR-----------MME.RSCR...............DV.P......................
G8BSU5_TETPH/62-267K..LSNHGSNIG......FK-----------LLDLLNLR...............ASVPSSA...................
G0VA51_NAUCC/38-275R..LRNIGFEMG......KK-----------MCEMLVFS...............NN.P......................
U5GYW5_USTV1/49-283R..LDKMGFKVG......WA-----------MAE.KLAR...............DR.P......................
F4NWB8_BATDJ/26-174Q..LDKMGYNIG......MR-----------LIDDYLAKT.A.SG.....R.C...........................
T1KC63_TETUR/18-164Q..LERIGYNIG......LR-----------LIEDFLAKT.N.TP.....R.C...........................
A7AQG4_BABBO/23-170Q..LLSMGRNIG......VR-----------LVDEVLAKL.G.CT.....P.C...........................
I4YJW3_WALMC/26-173E..LDKMGYNIG......TR-----------LIEEFLSKNPE..V.....K.C...........................
R4XFR7_TAPDE/28-211K..LESIGYRVG......HG-----------LVE.RLSK...............DR.P......................
TPC3L_MOUSE/19-165Y..LDKMGYNIG......TR-----------LVEDFLARS.C.VR.....R.C...........................

PF06505

H0PV77_9RHOO/7-107R--AILLHTDAM------GA-----------LRKELVET-----------------------------------------
Q5P0J1_AROAE/9-107R--AILLHTDAM------GA-----------LRKELVET-----------------------------------------
R4KI47_9FIRM/12-108R--LLLMESETI------FQ-----------LREELIQN-----------------------------------------
A4XDS4_NOVAD/9-109R--CVLLSQAAL------AS-----------WRSRLVAE-----------------------------------------
D8IX14_HERSS/38-138R--MLLIHSRSM------GT-----------LRRELIDQ-----------------------------------------
A7HF91_ANADF/7-100R--VLLFDAVAL------GI-----------LRRELIDD-----------------------------------------
A1K8A8_AZOSB/11-111R--MVLLHSAAL------SE-----------LRKELIDS-----------------------------------------
I2B6U1_SHIBC/10-108R--AFLLQLPAF------AA-----------FRKRLIHA-----------------------------------------
R4KRR0_9FIRM/9-106R--VLILNAEAI------GV-----------LRKDLISS-----------------------------------------
F2JW36_MARM1/38-138R--MLLIHSSSF------GF-----------MRSELIDT-----------------------------------------
Q5NZX3_AROAE/20-120R--MVLLHMKAL------GS-----------LRKELADT-----------------------------------------
A4XEH5_NOVAD/4-104R--MMMIHARAF------GL-----------LRHEVVEA-----------------------------------------
A2SEH5_METPP/23-116R--MLLMHASSF------AE-----------LRRELIEQ-----------------------------------------
Q5P8R7_AROAE/38-136R--MLLLHGNVF------GA-----------LRRELIDS-----------------------------------------
Q1LMF9_CUPMC/12-114R--MVLMHTEAL------SY-----------LRKEILDT-----------------------------------------
Q1D007_MYXXD/8-108R--VLLMDPVAL------GL-----------LRKELIKL-----------------------------------------
C4KBD8_THASP/11-110R--MLLLHAGAM------AE-----------LRKELIES-----------------------------------------
B2UJH4_RALPJ/12-112R--MLLLHTAAL------SG-----------LRQDLINS-----------------------------------------
A6VSL2_MARMS/38-138R--MLLIHSSSF------GL-----------LRREMIDS-----------------------------------------
H0Q4U8_9RHOO/14-114R--MLLVHAEAQ------SS-----------LRKELIDT-----------------------------------------
B3E548_GEOLS/7-99R--ALLFDAVAL------GL-----------LRKELIDT-----------------------------------------
R4KCK2_9FIRM/5-98R--MVLLEATAL------SY-----------LKHDLIYT-----------------------------------------
A2SI53_METPP/6-104R--MLLLHARAL------AA-----------LRKELFDS-----------------------------------------
Q12HA0_POLSJ/50-149R--MVLLHTEAL------GS-----------LRREMIDS-----------------------------------------
Q0K3T9_CUPNH/18-118R--MILIHTAAL------GA-----------LRKELVDT-----------------------------------------
R4KSH1_9FIRM/5-97Q--MILFHDIAI------DF-----------LKDELIRT-----------------------------------------
M4WWY6_PSEDE/17-117R--MVLMQTSTL------GT-----------LRRELVEN-----------------------------------------
X4ZFX6_9BACL/9-108R--MMLISSDAF------GM-----------LCRDLIVA-----------------------------------------
B9M8I2_GEODF/18-118R--MLLVHAEAQ------AT-----------LRRELIET-----------------------------------------
S6ACH6_PSERE/16-116R--MLLLQASAM------GS-----------FRRELVEM-----------------------------------------
A5VBE2_SPHWW/29-129R--MVLTDNAGL------AI-----------MRRELISA-----------------------------------------
C4ZM82_THASP/8-107R--AILVHADSM------GA-----------LRKELVET-----------------------------------------
A1K6K4_AZOSB/13-113R--MLLLHAQAM------GA-----------LRTELFRS-----------------------------------------
F6A9L0_PSEF1/37-137R--MVLLHCEAL------GA-----------LRRELIDS-----------------------------------------
B2UJH2_RALPJ/38-138R--MMLMHISSL------GA-----------LRQELIES-----------------------------------------
F6IM12_9SPHN/9-109R--CVLLSQSAL------TT-----------LRSQLVAQ-----------------------------------------
D4Z0A6_SPHJU/14-114R--MLLLHAGSL------GA-----------LRAEMVRT-----------------------------------------
C1DMU8_AZOVD/16-116R--MLLLQLSAL------SA-----------VRREMIES-----------------------------------------
V5UEH6_9BURK/33-133R--MVLIHTDAF------AS-----------LRQELIEA-----------------------------------------
A2SED5_METPP/49-149R--MVMLNHQTL------GS-----------LRSELIQG-----------------------------------------
G8MIU1_9BURK/19-119R--MLLVHTGAM------GT-----------MRRELIES-----------------------------------------
A2SL24_METPP/19-119R--MLLMHVSGQ------GV-----------LRQELIES-----------------------------------------
N0AQH3_9BACI/27-119R--IVVTPSSGI------GT-----------LRKNLIET-----------------------------------------
Q479F4_DECAR/11-111R--MVLMHTSAL------GA-----------LRRELVGS-----------------------------------------
Q088E6_SHEFN/7-101R--TYLTDMVSH------GI-----------LRKELLST-----------------------------------------
Q2G887_NOVAD/24-124R--MILTEHDAQ------GI-----------MRRELIVA-----------------------------------------
B3E5G9_GEOLS/7-102R--VLIHNANVS------GL-----------LKKELIDS-----------------------------------------
D0J206_COMT2/2-100R--MLLLHLASL------HA-----------LRREMMNT-----------------------------------------
A1WLM8_VEREI/12-112R--MVLLHTAAL------SA-----------LRRDLITS-----------------------------------------
R4KJN7_9FIRM/7-106R--MLVFLSSYF------YE-----------LRKEMIDS-----------------------------------------
D4Z086_SPHJU/33-133R--MLLVDDIVL------GQ-----------LRRELVRA-----------------------------------------
B3E5J6_GEOLS/7-101R--AYLVDATAQ------GL-----------QRKEFIDA-----------------------------------------
D0LSA1_HALO1/10-102R--VLLLDAVAL------GL-----------LRKQLVEA-----------------------------------------
A9GJU8_SORC5/7-100R--AVILDAGAL------GT-----------LREELVRL-----------------------------------------
B3E546_GEOLS/15-108R--AMIVDALAM------GL-----------LRKELIEN-----------------------------------------
D5WW71_KYRT2/9-107R--MALMETSAL------GL-----------LRRDLVAT-----------------------------------------
X2H462_9BACI/11-106R--MILKSAEAL------GF-----------FRRDIIQT-----------------------------------------
B9M024_GEODF/20-120R--MLLVHADSH------AK-----------LRRELIES-----------------------------------------
A1W2I5_ACISJ/16-116R--MLLVHAAAF------QA-----------LRRELVAS-----------------------------------------
Q15NZ0_PSEA6/36-137R--LLIANLAFF------SV-----------MRQEHLNS-----------------------------------------
Q39TS9_GEOMG/18-118R--MLLIHAEVQ------AS-----------LRKELIDT-----------------------------------------
E4PKW5_MARAH/16-116R--MLLMQVSAM------AA-----------FRREMVNT-----------------------------------------
C1DN78_AZOVD/11-111R--MLLFHAKAV------GA-----------LRRELFDS-----------------------------------------
E1QE48_DESB2/9-101R--LMMIGLGAL------GR-----------VNQEMIQG-----------------------------------------
Q39TT1_GEOMG/18-118R--MLLVHANAQ------GG-----------MRKELIDT-----------------------------------------
G7UPC2_PSEUP/14-114R--MLLLHAASL------AS-----------LRRELLST-----------------------------------------
B9M014_GEODF/21-120R--MLLVHADAH------AL-----------MRRELIDA-----------------------------------------
H8MRM3_CORCM/8-104R--ALLMDPVTL------GL-----------LRKELIGM-----------------------------------------

PF03500

Q76KJ6_KOMHA/10-153L--LREVGRGMG------TR-----------IMPPPCQT-----------------------------------------
G2I1Y6_KOMMN/10-153L--LREVGRGMA------GR-----------LQPPLCNT-----------------------------------------

PF07700

D6W9P2_TRICA/2-164--------------------------------------------------------------------------------
D6W9P2_TRICA/657-819--------------------------------------------------------------------------------
G7YDL4_CLOSI/2-164--------------------------------------------------------------------------------
B3RIY3_TRIAD/1-164--------------------------------------------------------------------------------
T2G861_DESGI/430-584--------------------------------------------------------------------------------
C3XW68_BRAFL/2-165--------------------------------------------------------------------------------
A7S7B2_NEMVE/2-170--------------------------------------------------------------------------------
H2UDL7_TAKRU/2-163--------------------------------------------------------------------------------
K0CAD4_ALCDB/2-162--------------------------------------------------------------------------------
F4B0A3_DOKS4/2-162--------------------------------------------------------------------------------
F2UP57_SALR5/2-165--------------------------------------------------------------------------------
C3YJ22_BRAFL/2-164--------------------------------------------------------------------------------
B3RTK0_TRIAD/1-164--------------------------------------------------------------------------------
W4XRE1_STRPU/2-164--------------------------------------------------------------------------------
D3F0L8_CONWI/2-160--------------------------------------------------------------------------------
A4XK74_CALS8/2-160--------------------------------------------------------------------------------
F2JRL4_CELLD/2-160--------------------------------------------------------------------------------
H9JIF1_BOMMO/5-169--------------------------------------------------------------------------------
H2ZHQ6_CIOSA/2-167--------------------------------------------------------------------------------
A6M0J2_CLOB8/2-160--------------------------------------------------------------------------------
Q899J9_CLOTE/21-179--------------------------------------------------------------------------------
G7YSC7_CLOSI/2-164--------------------------------------------------------------------------------
B0C2H7_ACAM1/2-163--------------------------------------------------------------------------------
C5ARV9_METEA/2-162--------------------------------------------------------------------------------
A7RZH8_NEMVE/3-165--------------------------------------------------------------------------------
D3SA24_THISK/2-160--------------------------------------------------------------------------------
I1FML3_AMPQE/2-163--------------------------------------------------------------------------------
K6YZX2_9ALTE/2-163--------------------------------------------------------------------------------
F8DBD3_HALXS/2-162--------------------------------------------------------------------------------
Q8RBX6_CALS4/2-160--------------------------------------------------------------------------------
F7YXL0_9THEM/2-160--------------------------------------------------------------------------------
W4XH19_STRPU/14-176--------------------------------------------------------------------------------
R4KI66_CLOPA/3-161--------------------------------------------------------------------------------
W5KMY4_ASTMX/2-163--------------------------------------------------------------------------------
A9KIK0_CLOPH/2-160--------------------------------------------------------------------------------
B7VPN5_VIBTL/2-162--------------------------------------------------------------------------------
T1ITQ9_STRMM/2-166--------------------------------------------------------------------------------
G4LU97_SCHMA/2-164--------------------------------------------------------------------------------
F2UQW4_SALR5/2-164--------------------------------------------------------------------------------
H2ZCI7_CIOSA/2-166--------------------------------------------------------------------------------
A7HJF4_FERNB/2-160--------------------------------------------------------------------------------
K1R2B8_CRAGI/26-188--------------------------------------------------------------------------------
W5L1E6_ASTMX/2-163--------------------------------------------------------------------------------
Q15VN4_PSEA6/2-162--------------------------------------------------------------------------------
C3Y563_BRAFL/2-164--------------------------------------------------------------------------------
Q7MJS8_VIBVY/2-162--------------------------------------------------------------------------------
C3XXH9_BRAFL/2-165--------------------------------------------------------------------------------
S0ESS7_CHTCT/2-160--------------------------------------------------------------------------------
H3CKY4_TETNG/2-164--------------------------------------------------------------------------------
A7RN69_NEMVE/100-264--------------------------------------------------------------------------------
F1NZB6_CHICK/2-163--------------------------------------------------------------------------------
F7YL52_VIBA7/2-161--------------------------------------------------------------------------------
J9K961_ACYPI/2-175--------------------------------------------------------------------------------
E2AD43_CAMFO/2-164--------------------------------------------------------------------------------
F2UCB7_SALR5/2-165--------------------------------------------------------------------------------
A2U1J5_9FLAO/2-162--------------------------------------------------------------------------------
Q97E73_CLOAB/2-160--------------------------------------------------------------------------------
Q9A451_CAUCR/2-160--------------------------------------------------------------------------------
B3RYQ3_TRIAD/1-165--------------------------------------------------------------------------------
T1IYK0_STRMM/2-165--------------------------------------------------------------------------------
F3Z380_DESAF/437-596--------------------------------------------------------------------------------
I3LMI1_PIG/2-166--------------------------------------------------------------------------------
B2IZ76_NOSP7/2-163--------------------------------------------------------------------------------
G4QEK6_GLANF/2-166--------------------------------------------------------------------------------
G4VI29_SCHMA/12-176--------------------------------------------------------------------------------
B7PJ68_IXOSC/2-166--------------------------------------------------------------------------------
GCY33_CAEEL/2-164--------------------------------------------------------------------------------
M1MBZ2_9CLOT/2-160--------------------------------------------------------------------------------
D3Z022_MOUSE/2-163--------------------------------------------------------------------------------
Q8YUQ7_NOSS1/2-164--------------------------------------------------------------------------------
E3PR11_CLOSD/2-160--------------------------------------------------------------------------------
F4EW09_SELS3/2-160--------------------------------------------------------------------------------
H3EBU1_PRIPA/15-180--------------------------------------------------------------------------------
B7PID1_IXOSC/2-165--------------------------------------------------------------------------------
H2ZQM8_CIOSA/2-166--------------------------------------------------------------------------------
E3MCF9_CAERE/2-167--------------------------------------------------------------------------------
G7YSC6_CLOSI/2-164--------------------------------------------------------------------------------
X5E3Q9_9BACT/2-162--------------------------------------------------------------------------------
F2TX50_SALR5/2-165--------------------------------------------------------------------------------
H2J852_MARPK/2-160--------------------------------------------------------------------------------
D5BKH5_ZUNPS/2-162--------------------------------------------------------------------------------
G8X8N8_FLACA/2-163--------------------------------------------------------------------------------
K1S3W9_CRAGI/2-166--------------------------------------------------------------------------------
H0PYD0_9RHOO/2-161--------------------------------------------------------------------------------
Q47Y43_COLP3/2-162--------------------------------------------------------------------------------
K8GF64_9CYAN/2-163--------------------------------------------------------------------------------
G0NDJ7_CAEBE/2-167--------------------------------------------------------------------------------
K4IJS2_PSYTT/2-161--------------------------------------------------------------------------------
K1PH87_CRAGI/2-166--------------------------------------------------------------------------------
F8EFN5_RUNSL/2-162--------------------------------------------------------------------------------
A6TMH7_ALKMQ/2-160--------------------------------------------------------------------------------
K9VYK2_9CYAN/2-163--------------------------------------------------------------------------------
G6CKQ3_DANPL/2-164--------------------------------------------------------------------------------
E6VZ54_DESAO/523-677--------------------------------------------------------------------------------
E0VW08_PEDHC/2-166--------------------------------------------------------------------------------
F2U5L4_SALR5/2-172--------------------------------------------------------------------------------
G3PRL3_GASAC/2-163--------------------------------------------------------------------------------
F4A1A5_MAHA5/7-165--------------------------------------------------------------------------------
H2YUP4_CIOSA/2-167--------------------------------------------------------------------------------
C5BIN2_TERTT/2-162--------------------------------------------------------------------------------
E3DMW8_HALPG/2-160--------------------------------------------------------------------------------
Q5E1F5_VIBF1/2-160--------------------------------------------------------------------------------
Q2SFY7_HAHCH/2-160--------------------------------------------------------------------------------
F6GI89_LACS5/2-162--------------------------------------------------------------------------------
D8U0R1_VOLCA/59-223--------------------------------------------------------------------------------
A3HWD6_9BACT/2-163--------------------------------------------------------------------------------
C3Y428_BRAFL/2-164--------------------------------------------------------------------------------
B8D0K8_HALOH/2-160--------------------------------------------------------------------------------
A7RN72_NEMVE/2-166--------------------------------------------------------------------------------
T1ITQ7_STRMM/2-166--------------------------------------------------------------------------------
B3RYQ5_TRIAD/10-174--------------------------------------------------------------------------------
L0JGE2_NATP1/2-161--------------------------------------------------------------------------------
A8F5S3_PSELT/2-160--------------------------------------------------------------------------------
B0CD92_ACAM1/2-163--------------------------------------------------------------------------------
A5I7T3_CLOBH/2-159--------------------------------------------------------------------------------
F2U0N3_SALR5/2-164--------------------------------------------------------------------------------
W4XR28_STRPU/4-177--------------------------------------------------------------------------------
G1KLN8_ANOCA/2-162--------------------------------------------------------------------------------
D9SRG3_CLOC7/2-160--------------------------------------------------------------------------------
K9X5Q3_9NOST/2-163--------------------------------------------------------------------------------
G7YQF8_CLOSI/2-164--------------------------------------------------------------------------------
F0RGN9_CELLC/2-162--------------------------------------------------------------------------------
F6YJD6_XENTR/8-169--------------------------------------------------------------------------------
Q5ZWM9_LEGPH/2-162--------------------------------------------------------------------------------
E3N9U4_CAERE/2-167--------------------------------------------------------------------------------
B8DKJ8_DESVM/531-685--------------------------------------------------------------------------------
B3RYQ6_TRIAD/11-175--------------------------------------------------------------------------------
E9GML5_DAPPU/2-166--------------------------------------------------------------------------------
F0LTC6_VIBFN/2-162--------------------------------------------------------------------------------
D5XA10_THEPJ/2-162--------------------------------------------------------------------------------
H2Y4L1_CIOSA/2-168--------------------------------------------------------------------------------
F2TZE3_SALR5/2-165--------------------------------------------------------------------------------
F2UN82_SALR5/2-165--------------------------------------------------------------------------------
A6GYD7_FLAPJ/2-163--------------------------------------------------------------------------------
A0PXJ5_CLONN/2-160--------------------------------------------------------------------------------
B3S7Q2_TRIAD/2-165--------------------------------------------------------------------------------
Q21E20_SACD2/2-162--------------------------------------------------------------------------------
K0ATP4_CLOA9/2-160--------------------------------------------------------------------------------
T1KFI6_TETUR/2-166--------------------------------------------------------------------------------
F2UR64_SALR5/2-165--------------------------------------------------------------------------------
A6LK33_THEM4/2-160--------------------------------------------------------------------------------
G3Q1S5_GASAC/2-164--------------------------------------------------------------------------------
C3ZF94_BRAFL/7-169--------------------------------------------------------------------------------
B8HJS1_CYAP4/2-164--------------------------------------------------------------------------------
B7PFU6_IXOSC/2-164--------------------------------------------------------------------------------
W4Z032_STRPU/9-171--------------------------------------------------------------------------------
G4VA36_SCHMA/2-164--------------------------------------------------------------------------------
Q310U7_DESAG/727-881--------------------------------------------------------------------------------
A8MIN2_ALKOO/2-160--------------------------------------------------------------------------------
F2TZ95_SALR5/2-165--------------------------------------------------------------------------------
E9GML8_DAPPU/2-166--------------------------------------------------------------------------------
K9UD61_9CYAN/2-163--------------------------------------------------------------------------------
G3RZQ8_GORGO/2-166--------------------------------------------------------------------------------
E9GML7_DAPPU/2-166--------------------------------------------------------------------------------
G8R6C6_OWEHD/2-162--------------------------------------------------------------------------------
K7AQ34_9ALTE/2-162--------------------------------------------------------------------------------
Q21ER7_SACD2/2-162--------------------------------------------------------------------------------
I7CPA5_NATSJ/2-161--------------------------------------------------------------------------------
Q7Q9W6_ANOGA/2-164--------------------------------------------------------------------------------
E9FT54_DAPPU/24-187--------------------------------------------------------------------------------
A7RN70_NEMVE/2-168--------------------------------------------------------------------------------
I2EZ72_EMTOG/2-162--------------------------------------------------------------------------------
B2A8E6_NATTJ/2-160--------------------------------------------------------------------------------
I0K9V5_9BACT/2-162--------------------------------------------------------------------------------
M1MRY0_9CLOT/2-160--------------------------------------------------------------------------------
A9V7H3_MONBE/2-165--------------------------------------------------------------------------------
K9UZY1_9CYAN/2-164--------------------------------------------------------------------------------
Q87NJ1_VIBPA/2-162--------------------------------------------------------------------------------
Q5ZSQ8_LEGPH/4-164--------------------------------------------------------------------------------
G7Y7K2_CLOSI/23-185--------------------------------------------------------------------------------
A3UA30_CROAH/2-162--------------------------------------------------------------------------------
B4IBU8_DROSE/2-164--------------------------------------------------------------------------------
W4X9S3_STRPU/2-166--------------------------------------------------------------------------------
A8WS03_CAEBR/2-164--------------------------------------------------------------------------------
Q8EF49_SHEON/2-161--------------------------------------------------------------------------------
T1JJL9_STRMM/2-164--------------------------------------------------------------------------------
GCY34_CAEEL/2-167--------------------------------------------------------------------------------
A5N4H2_CLOK5/2-160--------------------------------------------------------------------------------
B9JYX7_AGRVS/2-166--------------------------------------------------------------------------------

PF02830

A4XDS4_NOVAD/122-182--------------------------------------------------------------------------------
A9WB66_CHLAA/138-197--------------------------------------------------------------------------------
B2UJH2_RALPJ/152-211--------------------------------------------------------------------------------
D0J206_COMT2/112-172--------------------------------------------------------------------------------
E4PKW5_MARAH/128-189--------------------------------------------------------------------------------
O26930_METTH/130-191--------------------------------------------------------------------------------
O27403_METTH/188-249--------------------------------------------------------------------------------
O67571_AQUAE/116-177--------------------------------------------------------------------------------
BCHJ_RHOCB/140-199--------------------------------------------------------------------------------
P74443_SYNY3/170-231--------------------------------------------------------------------------------
P74446_SYNY3/202-263--------------------------------------------------------------------------------
Y745_METJA/119-179--------------------------------------------------------------------------------
Y1460_METJA/95-156--------------------------------------------------------------------------------
Q881E3_PSESM/120-181--------------------------------------------------------------------------------
Q8DGL5_THEEB/132-193--------------------------------------------------------------------------------
Q8DKK3_THEEB/150-211--------------------------------------------------------------------------------
Q8R5R6_CALS4/52-113--------------------------------------------------------------------------------
Q8TIU0_METAC/206-264--------------------------------------------------------------------------------
Q8TQT2_METAC/185-246--------------------------------------------------------------------------------
Q8TV82_METKA/104-164--------------------------------------------------------------------------------
Q8TWC8_METKA/86-147--------------------------------------------------------------------------------
Q8TX90_METKA/68-129--------------------------------------------------------------------------------
Q8TXN0_METKA/66-127--------------------------------------------------------------------------------
Q8TXN0_METKA/224-288--------------------------------------------------------------------------------
Q8TXW7_METKA/177-236--------------------------------------------------------------------------------
Q8U209_PYRFU/331-392--------------------------------------------------------------------------------
Q8XT87_RALSO/150-211--------------------------------------------------------------------------------
Q8XTP9_RALSO/107-174--------------------------------------------------------------------------------
Q9KLM3_VIBCH/129-188--------------------------------------------------------------------------------
BCHJ_RHOS4/143-203--------------------------------------------------------------------------------

PF04051

T1JVG1_TETUR/7-153................................................................................
E5SJ80_TRISP/8-152................................................................................
M0RYG7_MUSAM/13-175................................................................................
X6NU62_RETFI/84-239................................................................................
E4WZM5_OIKDI/17-163................................................................................
A7T063_NEMVE/19-166................................................................................
U3IS73_ANAPL/19-165................................................................................
G0RJ43_HYPJQ/25-253................................................................................
A8BA91_GIAIC/27-185................................................................................
I2H4M5_TETBL/53-262.........NSRSSIFPSSSSTSAQNPSNSTVSASGSGAAGGN.............SGSGSTTDRHSNGPESLTSLINTM
A0A0D2UGE9_CAPO3/18-164................................................................................
C1MS22_MICPC/30-175................................................................................
D7FQV7_ECTSI/36-189................................................................................
E7NGB5_YEASO/62-271.........LPRASAFLSQSESSSKLSNASNSPGMLANSSTAT..............SASANERLQEKQTESLSNYITKM
A7TQ02_VANPO/35-184................................................................................
R9AMQ2_WALI9/26-174................................................................................
G8ZPV8_TORDC/45-260................................................................................
Q38DI4_TRYB2/28-190................................................................................
M2YLM3_DOTSN/24-219................................................................................
N4VA41_COLOR/25-174................................................................................
U4LDL1_PYROM/26-177................................................................................
N1Q0J8_DOTSN/59-215....................................................................SPRNA.......
I1EHD1_AMPQE/31-180................................................................................
E9I9Q7_SOLIN/5-151................................................................................
E1ZPW5_CHLVA/28-181................................................................................
K0R7X6_THAOC/23-249................................................................................
Q5KMH2_CRYNJ/70-228................................................................TQAAGTKEP.......
G8YS93_PICSO/81-235....................................................................RIKYS.......
K3XAK0_PYTUL/47-201................................................................................
I1JRI0_SOYBN/10-175................................................................................
L8FYS8_PSED2/51-210....................................................................PPRTQ.......
F1QMV3_DANRE/7-155................................................................................
C1MRP2_MICPC/11-162................................................................................
E6ZN37_SPORE/79-291................................................................................
G2QD82_MYCTT/25-217................................................................................
L8FNC8_PSED2/24-220................................................................................
A8JFB7_CHLRE/26-178................................................................................
T1JCC7_STRMM/19-164................................................................................
W4ZHN1_STRPU/7-154................................................................................
I2H1V3_TETBL/54-297................................................................................
U1HTW2_ENDPU/68-231.........................................TPAGSS..................SSSSSAQA.......
G9NKV9_HYPAI/25-220................................................................................
H0XNR3_OTOGA/7-161................................................................................
K0KYJ5_WICCF/14-204................................................................................
K0KLU0_WICCF/62-215....................................................................G.KSA.......
Q5AH42_CANAL/17-209................................................................................
M7SMZ2_EUTLA/56-213....................................................................PARTQ.......
B7QH45_IXOSC/19-163................................................................................
S8AJT6_PENO1/24-183................................................................................
Q6BJ77_DEBHA/81-235....................................................................GIKYG.......
B9REX0_RICCO/10-174................................................................................
A7TDQ9_VANPO/62-283.........YSRSSTFLSSNASNPSSSNNVNSISNTSNPNSTN.LNDISNATNVGINSSTNINDKNYESSESLASLVSHM
B0WI08_CULQU/33-179................................................................................
K0THW2_THAOC/54-215................................................................................
M2LVJ4_BAUCO/27-183................................................................................
C1E3Y1_MICCC/27-178................................................................................
N1PWF2_DOTSN/25-183................................................................................
K1R003_CRAGI/7-154................................................................................
G6CTZ1_DANPL/27-173................................................................................
H3AV40_LATCH/7-156................................................................................
B8BY05_THAPS/56-299................................................................................
G0W6Q4_NAUDC/35-267................................................................................
E9H4K9_DAPPU/19-165................................................................................
M3JAQ1_CANMX/81-235....................................................................GFKNS.......
E0VWU3_PEDHC/35-181................................................................................
TPPC5_CHICK/29-175................................................................................
U5GZ24_USTV1/149-310.........................................SLR........................SSPPP.......
G3BDP0_CANTC/25-175................................................................................
A3FPW1_CRYPI/6-158................................................................................
A0A068Y1Y0_ECHMU/29-182................................................................................
E0VBE5_PEDHC/18-159................................................................................
Q229D2_TETTS/19-169................................................................................
Q5ARJ4_EMENI/23-173................................................................................
D2VAM4_NAEGR/13-161................................................................................
A5E6K8_LODEL/83-237....................................................................GFKLS.......
G3PGZ9_GASAC/12-159................................................................................
K3WA95_PYTUL/9-188................................................................................
E0V955_PEDHC/7-159................................................................................
F0YEM0_AURAN/27-173................................................................................
I2FPM0_USTH4/86-296................................................................................
C5FQV7_ARTOC/73-244.........................................TSTLTS..................QSSSSNQP.......
D8S611_SELML/22-168................................................................................
C3Z0P3_BRAFL/26-172................................................................................
A8J2W3_CHLRE/37-190................................................................................
N1J5N2_BLUG1/51-211....................................................................PSRSQ.......
N1QHC0_SPHMS/25-275................................................................................
D7ELH8_TRICA/28-174................................................................................
B9PH75_TOXGV/34-184................................................................................
G8Y8F7_PICSO/26-179................................................................................
G7YIU1_CLOSI/20-169................................................................................
H2AYQ1_KAZAF/33-182................................................................................
A5DAF5_PICGU/11-206................................................................................
W5NBF1_LEPOC/14-166................................................................................
K5XGY5_AGABU/26-191................................................................................
Q4N4M8_THEPA/26-173................................................................................
B0CQU1_LACBS/73-229..................................................................ESSSKTP.......
E2AMW5_CAMFO/32-178................................................................................
G8ZMF5_TORDC/62-270.........HSRTSNFLGTSASSNNALNETAGSATGSGANSLG..............ASEHIYHNHENGSDSIASLITNT
U9V6Y8_RHIID/25-174................................................................................
F2ULX4_SALR5/17-165.....................................................................SHSACISEAKK
J5PUV7_SACK1/30-179................................................................................
G4TPC2_SERID/27-219................................................................................
A2DFH3_TRIVA/11-155................................................................................
A4H8R9_LEIBR/29-178................................................................................
D8M290_BLAHO/13-159................................................................................
F7DY97_XENTR/7-161................................................................................
H2XLK9_CIOIN/10-155................................................................................
T0MD09_COLGC/45-203....................................................................APRTQ.......
A0A068XM21_HYMMI/29-182................................................................................
F9X1V4_ZYMTI/54-212....................................................................QGRTI.......
A2FQV8_TRIVA/8-151................................................................................
B3S2G2_TRIAD/32-178................................................................................
F7AEP2_CIOIN/19-166................................................................................
F4PUP7_DICFS/116-262................................................................................
F2U9W2_SALR5/24-172................................................................................
A9STP5_PHYPA/24-171................................................................................
C5DT91_ZYGRC/62-268........SKSSTSNFLSNSSSASINESHGSSGTGTGTISSAS.................DHTHYHENGTESLAAVINNM
T1JN97_STRMM/27-173................................................................................
W5MI51_LEPOC/29-175................................................................................
A0A068YAR7_ECHMU/19-165................................................................................
C4QV75_KOMPG/64-226....................................................................NYITNTTTSKNG
B3MSU3_DROAN/7-150................................................................................
YA95_SCHPO/16-173................................................................................
F4NUA2_BATDJ/28-180......................................................................RTA.......
C4QV63_KOMPG/25-176................................................................................
B6K0U0_SCHJY/46-198......................................................................RSP.......
A8J304_CHLRE/23-167................................................................................
Q5CYM1_CRYPI/33-178................................................................................
A0C1N5_PARTE/23-175................................................................................
I1FWR8_AMPQE/23-171................................................................................
E3KIT7_PUCGT/25-194................................................................................
I1IIL5_BRADI/13-174................................................................................
E1ZCI6_CHLVA/12-169................................................................................
C4Y011_CLAL4/81-235....................................................................GMKYG.......
M9M538_PSEA3/137-321....................................................................NPKNP.......
T1G2G3_HELRO/30-176................................................................................
B8BSU9_THAPS/34-187................................................................................
G0SHA4_CHATD/46-206....................................................................PARSQ.......
A4S1Q7_OSTLU/26-177................................................................................
G4UMV3_NEUT9/25-221................................................................................
Q4N8Y2_THEPA/23-170................................................................................
Q6FQX3_CANGA/31-265................................................................................
U5D335_AMBTC/11-175................................................................................
Q9CAW4_ARATH/10-172................................................................................
A0A0H5S8A4_BRUMA/12-192................................................................................
V5EZN4_KALBG/139-299....................................................................NAKNP.......
C5DJK5_LACTC/39-188................................................................................
Q6CFM1_YARLI/100-269....................................................................ATAGASAKGAAG
T1G6X9_HELRO/19-166................................................................................
M7XQX5_RHOT1/47-279................................................................................
E9HC76_DAPPU/27-173................................................................................
B3S9Y0_TRIAD/20-167................................................................................
W1QG52_OGAPD/46-210.........................................TSSGKSNMS..............................
W1QKQ7_OGAPD/25-176................................................................................
B8NLT0_ASPFN/68-238.........................................SSSISS..................SSTSAAPP.......
F8QEM7_SERL3/28-191................................................................................
C4WXG1_ACYPI/18-164................................................................................
A0DEI2_PARTE/22-171................................................................................
Q5BKN1_XENTR/19-166................................................................................
F4NUX8_BATDJ/18-169................................................................................
X6NME0_RETFI/27-208................................................................................
C5LHW2_PERM5/39-200................................................................................
D8LQV4_ECTSI/27-175................................................................................
S3CL82_OPHP1/25-222................................................................................
B6TBL7_MAIZE/8-172................................................................................
G2X4J4_VERDV/43-207....................................................................PPRTQ.......
E1FZ82_LOALO/46-192................................................................................
A0A023BA01_GRENI/25-169................................................................................
Q4Y963_PLACH/24-168................................................................................
R9PED1_PSEHS/82-292................................................................................
H2SS24_TAKRU/7-156................................................................................
C5M680_CANTT/23-177................................................................................
B4KNN6_DROMO/35-181................................................................................
D5GMV6_TUBMM/70-223.....................................................................GRSA.......
Q57UH5_TRYB2/27-175................................................................................
G0NYX4_CAEBE/5-183................................................................................
W1QFA9_OGAPD/15-208................................................................................
V2X627_MONRO/28-195................................................................................
V8NPD8_OPHHA/12-161................................................................................
E1FS68_LOALO/12-192................................................................................
E9FYX1_DAPPU/7-155................................................................................
B9SBX8_RICCO/30-183................................................................................
G4VMI7_SCHMA/18-164................................................................................
C5DSC4_ZYGRC/30-179................................................................................
A0A0C4E4C9_MAGP6/42-202....................................................................PAKTQ.......
E4UYX6_ARTGP/25-214................................................................................
TPPC5_PLAF7/24-172................................................................................
R1GJ88_BOTPV/25-232................................................................................
G8BPN1_TETPH/36-270................................................................................
I7LU45_TETTS/24-174................................................................................
K7J974_NASVI/23-174................................................................................
C4WU32_ACYPI/8-151................................................................................
G3BB76_CANTC/11-168................................................................................
Q74ZA3_ASHGO/45-194................................................................................
Q2GUE9_CHAGB/23-174................................................................................
C4WVR1_ACYPI/32-178................................................................................
W4YXQ6_STRPU/27-174................................................................................
J7RXA7_KAZNA/87-338NISTPNLTKPSANSVAVRDSANLSDPQLDHSSSSMSAATPVTQ.EKRTSNTTANTASTVATGTTTPHNKNEYLSEHITKM
Q0IEU7_AEDAE/18-164................................................................................
H2AWC3_KAZAF/48-262................................................................................
A7SRF2_NEMVE/30-176................................................................................
F9X8Z0_ZYMTI/25-182................................................................................
G0SUM5_RHOT2/32-186................................................................................
D6WJE6_TRICA/18-164................................................................................
S9W187_SCHCR/46-198......................................................................RNP.......
E9CS20_COCPS/26-194................................................................................
G2YWQ0_BOTF4/25-194................................................................................
Q6CJT3_KLULA/45-194................................................................................
F6PI56_XENTR/22-168................................................................................
J9P7K2_CANLF/40-190................................................................................
R4XC32_TAPDE/22-184................................................................................
E7KII5_YEASA/45-265................................................................................
B6AFL0_CRYMR/33-177................................................................................
Q6NUY4_DANRE/7-159................................................................................
U9U2P9_RHIID/42-194......................................................................KNS.......
V5GF24_KALBG/79-284................................................................................
M2LT53_BAUCO/23-245................................................................................
A9VBF9_MONBE/9-149................................................................................
B6JXV2_SCHJY/22-166................................................................................
M3YXR2_MUSPF/13-162................................................................................
F0XPM8_GROCL/25-250................................................................................
K1RC27_CRAGI/28-174................................................................................
G4M1E3_SCHMA/643-797................................................................................
H0XQ40_OTOGA/31-176................................................................................
Q54TK7_DICDI/133-280................................................................................
F6R0S8_MONDO/5-160................................................................................
B7G9P1_PHATC/27-178................................................................................
N4UR67_COLOR/25-234................................................................................
I2G5Q2_USTH4/26-174................................................................................
M7NLF3_PNEMU/15-189................................................................................
A3LWB7_PICST/17-213................................................................................
B0DXI4_LACBS/36-240................................................................................
Q6C4X8_YARLI/7-176................................................................................
M2RGY3_CERS8/28-198................................................................................
G1KP89_ANOCA/19-164................................................................................
F6ZPU3_CIOIN/28-174................................................................................
H3G610_PHYRM/6-148................................................................................
TPPC3_CAEBR/20-166................................................................................
D3BR33_POLPA/141-287................................................................................
E4XK01_OIKDI/26-172................................................................................
F6U759_MACMU/13-160................................................................................
G6CHQ2_DANPL/18-161................................................................................
G1XT68_ARTOA/25-235................................................................................
E2ATA3_CAMFO/23-173................................................................................
E9AFF6_LEIMA/35-197................................................................................
K1QH85_CRAGI/19-166................................................................................
S8FDP6_FOMPI/33-233................................................................................
D8R4W7_SELML/16-172................................................................................
Q6CPP3_KLULA/68-235.................................................................GLTNMDSVAGTITNM
Q4D5L3_TRYCC/27-174................................................................................
E3L3N3_PUCGT/89-270.........................................ALSGSPNALSLSTGKSISLGGGSISSASSAVP.......
A5DI63_PICGU/78-232....................................................................GFKYG.......
I4Y7D2_WALMC/18-172..................................................................EGTAKNP.......
C8V0H5_EMENI/25-184................................................................................
TPPC5_DICDI/25-178................................................................................
V2WY43_MONRO/33-234................................................................................
A8N0N0_COPC7/32-255................................................................................
F0YNA2_AURAN/14-167................................................................................
R7YXJ3_CONA1/25-225................................................................................
T1ELP2_HELRO/7-152................................................................................
Q6FMN4_CANGA/21-208.............KNFLSSGSNTSNGSSDATITA................................SDQESSLTSFINRM
G0VDG8_NAUCC/35-184................................................................................
E9E9Y1_METAQ/640-835................................................................................
I4Y6T3_WALMC/34-192................................................................................
R4FKT2_RHOPR/29-175................................................................................
G3P0A2_GASAC/7-161................................................................................
R4FPN5_RHOPR/18-161................................................................................
G6CLX9_DANPL/7-155................................................................................
S9W2C4_SCHCR/22-169................................................................................
B6AG61_CRYMR/12-186................................................................................
B7G7P9_PHATC/18-194................................................................................
G4TBB1_SERID/92-248..................................................................EGTSKAP.......
H2B1V9_KAZAF/63-287.........SSRTSTFLSSNTNLPTPKMQSQTSYDTTSGNSSIPSNNAVISKTTTQNTISNQEAASTSHYSSIANTINKM
G1WYZ0_ARTOA/60-213.....................................................................GRTA.......
J7S6F2_KAZNA/43-192................................................................................
M7X5P9_RHOT1/76-239.........................................SLR........................SPPPP.......
D0MS35_PHYIT/9-170................................................................................
G3AVF7_SPAPN/17-209................................................................................
C4Y593_CLAL4/16-205................................................................................
H2ZW82_LATCH/19-167................................................................................
T1KX51_TETUR/32-178................................................................................
F0V9N6_NEOCL/25-171................................................................................
S2JN73_MUCC1/38-191................................................................................
C4M937_ENTHI/26-176................................................................................
E1ZNY8_CHLVA/9-156................................................................................
M7PDJ0_PNEMU/34-186......................................................................KKY.......
G3AII8_SPAPN/79-233....................................................................GIKLN.......
U5H198_USTV1/33-186................................................................................
G1XR36_ARTOA/26-178................................................................................
Q8I1Q2_PLAF7/25-167................................................................................
S2JY55_MUCC1/30-178................................................................................
S2JN70_MUCC1/45-196......................................................................KVA.......
S8C0P6_DACHA/25-225................................................................................
U9SP50_RHIID/54-206................................................................................
E5SI08_TRISP/1-145................................................................................
Q013E9_OSTTA/27-181................................................................................
B5Y485_PHATC/37-194................................................................................
D2W234_NAEGR/23-174................................................................................
Q4WDM1_ASPFU/25-185................................................................................
G0WER0_NAUDC/44-292NITTTSATTGTGTAKIISENRTRSKSTTSKLANDTRTSSNSAL.R.....DHNTHHHHHHHTLEREKNLDVSLCKYITKM
R0KDH4_SETT2/38-201..................................................................TANPLAS.......
K2SHS1_MACPH/53-225...........................................PSAA..................LTSNP.NP.......
TRS31_ENCCU/10-152................................................................................
G8JU67_ERECY/59-227................................................................SQSDSQDSVASSIPNM
I2GX78_TETBL/27-183................................................................................
C7Z9W5_NECH7/25-227................................................................................
F6T488_ORNAN/102-268................................................................................
B8BZL3_THAPS/26-186................................................................................
Q6CCJ8_YARLI/25-176................................................................................
M7NS17_PNEMU/22-171................................................................................
S9W411_SCHCR/16-172................................................................................
A3FQ35_CRYPI/12-189................................................................................
G3AXG1_CANTC/75-229....................................................................GLKYS.......
G0V7A4_NAUCC/49-256......TSIPTRSSILFSSSAPLTDQANSNSTNTPDAIRKREE......................ESSTNADLAKHITKM
H2VJ79_CAEJA/24-170................................................................................
A8Q0V9_MALGO/24-202................................................................................
G0SHJ8_CHATD/26-235................................................................................
A8NES9_COPC7/27-191................................................................................
I1LSM6_SOYBN/24-171................................................................................
F4RQH4_MELLP/2-196............................SLVPNLSSIQSNQSINQRSSTLLLNSNHSNSSHLTPLTIQTNNLP.......
U4L5M6_PYROM/25-185................................................................................
Q6BKS7_DEBHA/16-206................................................................................
E3RF54_PYRTT/20-170................................................................................
J9F2R2_WUCBA/21-167................................................................................
F1A4T0_DICPU/24-172................................................................................
Q17E67_AEDAE/7-152................................................................................
C5DM27_LACTC/105-310...........GRSFFHKAGGPAAATAGDAASGAGNASGAVGA................SGASSLGNAQDESLASNITTM
B9MZL8_POPTR/10-169................................................................................
F2UT79_SALR5/14-156................................................................................
A2DKK6_TRIVA/18-173................................................................................
G8YIQ3_PICSO/12-197................................................................................
F9XI11_ZYMTI/25-225................................................................................
S0DWK2_GIBF5/51-208....................................................................PARTQ.......
D8PVM2_SCHCM/27-195................................................................................
I1FYD4_AMPQE/18-164................................................................................
G8BSU5_TETPH/62-267...........RSSTFLPSNASLTGGNTGETGGASTNTNTSTI...............LTGYIDKSYESNESLSNMISQL
G0VA51_NAUCC/38-275................................................................................
U5GYW5_USTV1/49-283................................................................................
F4NWB8_BATDJ/26-174................................................................................
T1KC63_TETUR/18-164................................................................................
A7AQG4_BABBO/23-170................................................................................
I4YJW3_WALMC/26-173................................................................................
R4XFR7_TAPDE/28-211................................................................................
TPC3L_MOUSE/19-165................................................................................

PF06505

H0PV77_9RHOO/7-107--------------------------------------------------------------------------------
Q5P0J1_AROAE/9-107--------------------------------------------------------------------------------
R4KI47_9FIRM/12-108--------------------------------------------------------------------------------
A4XDS4_NOVAD/9-109--------------------------------------------------------------------------------
D8IX14_HERSS/38-138--------------------------------------------------------------------------------
A7HF91_ANADF/7-100--------------------------------------------------------------------------------
A1K8A8_AZOSB/11-111--------------------------------------------------------------------------------
I2B6U1_SHIBC/10-108--------------------------------------------------------------------------------
R4KRR0_9FIRM/9-106--------------------------------------------------------------------------------
F2JW36_MARM1/38-138--------------------------------------------------------------------------------
Q5NZX3_AROAE/20-120--------------------------------------------------------------------------------
A4XEH5_NOVAD/4-104--------------------------------------------------------------------------------
A2SEH5_METPP/23-116--------------------------------------------------------------------------------
Q5P8R7_AROAE/38-136--------------------------------------------------------------------------------
Q1LMF9_CUPMC/12-114--------------------------------------------------------------------------------
Q1D007_MYXXD/8-108--------------------------------------------------------------------------------
C4KBD8_THASP/11-110--------------------------------------------------------------------------------
B2UJH4_RALPJ/12-112--------------------------------------------------------------------------------
A6VSL2_MARMS/38-138--------------------------------------------------------------------------------
H0Q4U8_9RHOO/14-114--------------------------------------------------------------------------------
B3E548_GEOLS/7-99--------------------------------------------------------------------------------
R4KCK2_9FIRM/5-98--------------------------------------------------------------------------------
A2SI53_METPP/6-104--------------------------------------------------------------------------------
Q12HA0_POLSJ/50-149--------------------------------------------------------------------------------
Q0K3T9_CUPNH/18-118--------------------------------------------------------------------------------
R4KSH1_9FIRM/5-97--------------------------------------------------------------------------------
M4WWY6_PSEDE/17-117--------------------------------------------------------------------------------
X4ZFX6_9BACL/9-108--------------------------------------------------------------------------------
B9M8I2_GEODF/18-118--------------------------------------------------------------------------------
S6ACH6_PSERE/16-116--------------------------------------------------------------------------------
A5VBE2_SPHWW/29-129--------------------------------------------------------------------------------
C4ZM82_THASP/8-107--------------------------------------------------------------------------------
A1K6K4_AZOSB/13-113--------------------------------------------------------------------------------
F6A9L0_PSEF1/37-137--------------------------------------------------------------------------------
B2UJH2_RALPJ/38-138--------------------------------------------------------------------------------
F6IM12_9SPHN/9-109--------------------------------------------------------------------------------
D4Z0A6_SPHJU/14-114--------------------------------------------------------------------------------
C1DMU8_AZOVD/16-116--------------------------------------------------------------------------------
V5UEH6_9BURK/33-133--------------------------------------------------------------------------------
A2SED5_METPP/49-149--------------------------------------------------------------------------------
G8MIU1_9BURK/19-119--------------------------------------------------------------------------------
A2SL24_METPP/19-119--------------------------------------------------------------------------------
N0AQH3_9BACI/27-119--------------------------------------------------------------------------------
Q479F4_DECAR/11-111--------------------------------------------------------------------------------
Q088E6_SHEFN/7-101--------------------------------------------------------------------------------
Q2G887_NOVAD/24-124--------------------------------------------------------------------------------
B3E5G9_GEOLS/7-102--------------------------------------------------------------------------------
D0J206_COMT2/2-100--------------------------------------------------------------------------------
A1WLM8_VEREI/12-112--------------------------------------------------------------------------------
R4KJN7_9FIRM/7-106--------------------------------------------------------------------------------
D4Z086_SPHJU/33-133--------------------------------------------------------------------------------
B3E5J6_GEOLS/7-101--------------------------------------------------------------------------------
D0LSA1_HALO1/10-102--------------------------------------------------------------------------------
A9GJU8_SORC5/7-100--------------------------------------------------------------------------------
B3E546_GEOLS/15-108--------------------------------------------------------------------------------
D5WW71_KYRT2/9-107--------------------------------------------------------------------------------
X2H462_9BACI/11-106--------------------------------------------------------------------------------
B9M024_GEODF/20-120--------------------------------------------------------------------------------
A1W2I5_ACISJ/16-116--------------------------------------------------------------------------------
Q15NZ0_PSEA6/36-137--------------------------------------------------------------------------------
Q39TS9_GEOMG/18-118--------------------------------------------------------------------------------
E4PKW5_MARAH/16-116--------------------------------------------------------------------------------
C1DN78_AZOVD/11-111--------------------------------------------------------------------------------
E1QE48_DESB2/9-101--------------------------------------------------------------------------------
Q39TT1_GEOMG/18-118--------------------------------------------------------------------------------
G7UPC2_PSEUP/14-114--------------------------------------------------------------------------------
B9M014_GEODF/21-120--------------------------------------------------------------------------------
H8MRM3_CORCM/8-104--------------------------------------------------------------------------------

PF03500

Q76KJ6_KOMHA/10-153--------------------------------------------------------------------------------
G2I1Y6_KOMMN/10-153--------------------------------------------------------------------------------

PF07700

D6W9P2_TRICA/2-164--------------------------------------------------FGKC--F.VRFFSNYGY..DLTI-------
D6W9P2_TRICA/657-819--------------------------------------------------FGRC--F.VRYFSNLGY..DVTV-------
G7YDL4_CLOSI/2-164--------------------------------------------------YGNF--H.KKFLSLMGY..ERII-------
B3RIY3_TRIAD/1-164--------------------------------------------------YGQF--F.VVWCHRTNY..VSMI-------
T2G861_DESGI/430-584--------------------------------------------------FGKF--T.AVEFH.RMY..KRYF-------
C3XW68_BRAFL/2-165--------------------------------------------------FGAL--F.FEFCQESGY..DKIL-------
A7S7B2_NEMVE/2-170--------------------------------------------------FGVC--F.VKFFSFYGY..DPII-------
H2UDL7_TAKRU/2-163--------------------------------------------------FGEY--F.FKFCKSSGY..DHML-------
K0CAD4_ALCDB/2-162--------------------------------------------------FGAW--V.IPPLI.NMY..RAMI-------
F4B0A3_DOKS4/2-162--------------------------------------------------YGEH--F.FSVVE.KSY..PSFL-------
F2UP57_SALR5/2-165--------------------------------------------------AGRF--F.LAGILETGY..GSSL-------
C3YJ22_BRAFL/2-164--------------------------------------------------LGIS--L.IKFYSRSGY..DKVL-------
B3RTK0_TRIAD/1-164--------------------------------------------------FGNF--W.VEWTERSNY..IIMM-------
W4XRE1_STRPU/2-164--------------------------------------------------TGVQ--F.VKFLNKYEY..DKML-------
D3F0L8_CONWI/2-160--------------------------------------------------FGRE--S.IPAFA.DSH..ASFF-------
A4XK74_CALS8/2-160--------------------------------------------------IGKN--N.IKTFS.KWF..PSYF-------
F2JRL4_CELLD/2-160--------------------------------------------------IGHE--N.IKTFH.HDF..PSFF-------
H9JIF1_BOMMO/5-169--------------------------------------------------FGKT--F.FEFCQDSGY..DKIL-------
H2ZHQ6_CIOSA/2-167--------------------------------------------------FGAH--F.MTFVTRYGY..DQIT-------
A6M0J2_CLOB8/2-160--------------------------------------------------IGQD--N.IKAFS.HDY..PAFF-------
Q899J9_CLOTE/21-179--------------------------------------------------IGKD--N.LVSFY.NDF..PAFF-------
G7YSC7_CLOSI/2-164--------------------------------------------------LGQS--F.ISYLSKVGY..ASLL-------
B0C2H7_ACAM1/2-163--------------------------------------------------FGKY--W.VQFTAQEGY..GELM-------
C5ARV9_METEA/2-162--------------------------------------------------FGRH--L.CRRFA.VRY..PEFF-------
A7RZH8_NEMVE/3-165--------------------------------------------------TGAL--F.VSFIGQFGY..DKIL-------
D3SA24_THISK/2-160--------------------------------------------------IGRE--M.LPRFE.QAY..PGVF-------
I1FML3_AMPQE/2-163--------------------------------------------------FGEY--F.VQTIGRYGY..ARLL-------
K6YZX2_9ALTE/2-163--------------------------------------------------FGEH--W.VLHTAQKGY..GGLM-------
F8DBD3_HALXS/2-162--------------------------------------------------FGRF--L.VPHLL.STY..GVHV-------
Q8RBX6_CALS4/2-160--------------------------------------------------VGRQ--N.IKTFS.EWF..PSYF-------
F7YXL0_9THEM/2-160--------------------------------------------------TGKQ--N.LFTFF.ENY..PDFF-------
W4XH19_STRPU/14-176--------------------------------------------------FGEF--F.FTFCQRSGY..DEML-------
R4KI66_CLOPA/3-161--------------------------------------------------IGRD--N.VISFF.NDF..PSFF-------
W5KMY4_ASTMX/2-163--------------------------------------------------FGEY--F.FSFCKMSGY..DTML-------
A9KIK0_CLOPH/2-160--------------------------------------------------MGEE--N.IKTFS.TLY..PGFF-------
B7VPN5_VIBTL/2-162--------------------------------------------------FGQS--V.FKNLL.ASL..PNKA-------
T1ITQ9_STRMM/2-166--------------------------------------------------FGTH--F.LHYCQGSGY..DRLL-------
G4LU97_SCHMA/2-164--------------------------------------------------IGRY--T.IQYLIKNGF..EKLL-------
F2UQW4_SALR5/2-164--------------------------------------------------MGFI--Q.INNFAAQGY..TPLV-------
H2ZCI7_CIOSA/2-166--------------------------------------------------FGSF--F.FQFCEESGY..DVIL-------
A7HJF4_FERNB/2-160--------------------------------------------------TGYH--N.IRSFH.SFY..PNYF-------
K1R2B8_CRAGI/26-188--------------------------------------------------FGVS--F.VTFVGQYGY..DKIL-------
W5L1E6_ASTMX/2-163--------------------------------------------------FGEY--F.FEFCKRSGY..DHMM-------
Q15VN4_PSEA6/2-162--------------------------------------------------FGQW--M.FKQLLEAAPPEAHKF-------
C3Y563_BRAFL/2-164--------------------------------------------------FGIS--F.VTFVGQYGY..DRIL-------
Q7MJS8_VIBVY/2-162--------------------------------------------------FGEA--V.FDNLL.ASI..SNRS-------
C3XXH9_BRAFL/2-165--------------------------------------------------FGTC--F.VNFWSHYGY..DRVV-------
S0ESS7_CHTCT/2-160--------------------------------------------------FGQN--S.IPLMA.TAH..PEFF-------
H3CKY4_TETNG/2-164--------------------------------------------------FGVY--M.VKRIGNYGY..ERIL-------
A7RN69_NEMVE/100-264--------------------------------------------------FGEM--F.FDFCQESGY..DRIL-------
F1NZB6_CHICK/2-163--------------------------------------------------FGEY--F.FEFCKRSGY..DHML-------
F7YL52_VIBA7/2-161--------------------------------------------------YGQY--L.FSRLY.NSL..PENY-------
J9K961_ACYPI/2-175--------------------------------------------------FGRC--F.VRFFSNLGY..DAPI-------
E2AD43_CAMFO/2-164--------------------------------------------------FGKC--F.VRFFSNLGY..DCTV-------
F2UCB7_SALR5/2-165--------------------------------------------------AGKN--F.LVGLLESGY..GDAL-------
A2U1J5_9FLAO/2-162--------------------------------------------------YGEH--F.FGVIE.RSY..MGLV-------
Q97E73_CLOAB/2-160--------------------------------------------------IGED--N.VIAFH.KDF..PAFF-------
Q9A451_CAUCR/2-160--------------------------------------------------FGQE--A.MPHLA.RAY..PVFF-------
B3RYQ3_TRIAD/1-165--------------------------------------------------FGEH--F.FQYCVDNGY..DRIL-------
T1IYK0_STRMM/2-165--------------------------------------------------FGRC--F.VRYFSHYGY..DRIV-------
F3Z380_DESAF/437-596--------------------------------------------------LGSY--T.PGEFA.KLY..KKHI-------
I3LMI1_PIG/2-166--------------------------------------------------FGKM--F.FVFCQESGY..DTIL-------
B2IZ76_NOSP7/2-163--------------------------------------------------FGEF--W.VQYTAQEGY..GEML-------
G4QEK6_GLANF/2-166--------------------------------------------------YATA--F.INQVR.DLF..PRFF-------
G4VI29_SCHMA/12-176--------------------------------------------------MGIS--F.VEYVGSKGY..QGIL-------
B7PJ68_IXOSC/2-166--------------------------------------------------FGEH--F.LYFCQQHGY..DHIL-------
GCY33_CAEEL/2-164--------------------------------------------------AGRF--F.VQFLIRNGY..GDLM-------
M1MBZ2_9CLOT/2-160--------------------------------------------------IGQD--N.IVSFS.HDY..PAFF-------
D3Z022_MOUSE/2-163--------------------------------------------------FGEY--F.FKFCKMSGY..DRML-------
Q8YUQ7_NOSS1/2-164--------------------------------------------------FGEY--W.VTYTSEEGY..GELL-------
E3PR11_CLOSD/2-160--------------------------------------------------IGRD--N.IKAFY.EGY..SSFF-------
F4EW09_SELS3/2-160--------------------------------------------------LGRD--N.VLTFA.AVY..PSFF-------
H3EBU1_PRIPA/15-180--------------------------------------------------YGGF--L.IEYTMEVGW..DELV-------
B7PID1_IXOSC/2-165--------------------------------------------------FGRC--F.VRFFSHYGY..DQLI-------
H2ZQM8_CIOSA/2-166--------------------------------------------------AGEH--F.ITYITNIKN..DTVT-------
E3MCF9_CAERE/2-167--------------------------------------------------YGCF--L.IQYTMETGW..DDLI-------
G7YSC6_CLOSI/2-164--------------------------------------------------YGYF--F.TNFLSFMGY..EKLL-------
X5E3Q9_9BACT/2-162--------------------------------------------------FGAY--V.FDVFV.KAY..PVFF-------
F2TX50_SALR5/2-165--------------------------------------------------IGFF--Q.VGVLVEKGY..LPLV-------
H2J852_MARPK/2-160--------------------------------------------------TGKA--N.IQTFS.KWY..PLFF-------
D5BKH5_ZUNPS/2-162--------------------------------------------------YGLY--F.FDTLV.NIH..PGIF-------
G8X8N8_FLACA/2-163--------------------------------------------------FGEW--W.ILKTTQEKY..QGLM-------
K1S3W9_CRAGI/2-166--------------------------------------------------FGKM--F.FEFCQESGY..DKIL-------
H0PYD0_9RHOO/2-161--------------------------------------------------FGEF--W.VDFTVRT.Y..GELF-------
Q47Y43_COLP3/2-162--------------------------------------------------FGRY--L.FKKLY.DTS..PVDI-------
K8GF64_9CYAN/2-163--------------------------------------------------FGEF--W.VKYTAQEGY..GEMM-------
G0NDJ7_CAEBE/2-167--------------------------------------------------YGGF--L.IQFTMETGW..DELL-------
K4IJS2_PSYTT/2-161--------------------------------------------------FGEY--F.FVTLS.NDY..PHFM-------
K1PH87_CRAGI/2-166--------------------------------------------------FGQC--F.VKFFNHCGY..DQIV-------
F8EFN5_RUNSL/2-162--------------------------------------------------FGRY--L.FQRFT.KTY..SHLI-------
A6TMH7_ALKMQ/2-160--------------------------------------------------VGKQ--N.IYSFQ.KWF..PSYF-------
K9VYK2_9CYAN/2-163--------------------------------------------------FGEY--W.VLYTAQEGY..GEMM-------
G6CKQ3_DANPL/2-164--------------------------------------------------MGVY--F.VGFVSQYGY..DRVL-------
E6VZ54_DESAO/523-677--------------------------------------------------FGKF--S.IRQFN.EMY..PRLF-------
E0VW08_PEDHC/2-166--------------------------------------------------FGRC--F.VRYFSNFGY..DQTI-------
F2U5L4_SALR5/2-172--------------------------------------------------AGRF--V.IQTLIKRGY..KDML-------
G3PRL3_GASAC/2-163--------------------------------------------------FGEH--F.FLFCKKAGY..DTML-------
F4A1A5_MAHA5/7-165--------------------------------------------------LGRH--N.IYTFS.KWF..PSYF-------
H2YUP4_CIOSA/2-167--------------------------------------------------FGCH--F.MTFVSSYGY..DQIT-------
C5BIN2_TERTT/2-162--------------------------------------------------YGHH--L.AGAFV.TQY..TVFF-------
E3DMW8_HALPG/2-160--------------------------------------------------MGIK--N.IETFS.QWF..PSYF-------
Q5E1F5_VIBF1/2-160--------------------------------------------------YGKS--V.FLTLF.QSM..PELD-------
Q2SFY7_HAHCH/2-160--------------------------------------------------FGEH--L.FGRFY.VLY..PQFF-------
F6GI89_LACS5/2-162--------------------------------------------------YAEH--F.FSVIE.HSY..PGLL-------
D8U0R1_VOLCA/59-223--------------------------------------------------YGQY--F.VNYVIKQGY..TRLL-------
A3HWD6_9BACT/2-163--------------------------------------------------FGEW--W.ILKTGNEKY..GGLM-------
C3Y428_BRAFL/2-164--------------------------------------------------FGAN--M.PSMYADNGY..EKTL-------
B8D0K8_HALOH/2-160--------------------------------------------------IGRH--N.IKSFS.KWF..PSYF-------
A7RN72_NEMVE/2-166--------------------------------------------------FGAH--F.FAYCEKSGY..DRIL-------
T1ITQ7_STRMM/2-166--------------------------------------------------FGGM--F.FEFCKESGY..DKIM-------
B3RYQ5_TRIAD/10-174--------------------------------------------------FGRF--F.VSFCEELGY..KRIL-------
L0JGE2_NATP1/2-161--------------------------------------------------YGRW--V.VPALL.ETY..DLHI-------
A8F5S3_PSELT/2-160--------------------------------------------------TGRE--N.LYTFF.EHY..PEFF-------
B0CD92_ACAM1/2-163--------------------------------------------------FGKY--W.VKFTGQEGY..GEMM-------
A5I7T3_CLOBH/2-159--------------------------------------------------IGQD--N.LKAFN.NDY..PAFF-------
F2U0N3_SALR5/2-164--------------------------------------------------MGTV--Q.LEQFEEKGY..GPLI-------
W4XR28_STRPU/4-177--------------------------------------------------FGEE--F.FCLCF.EQY..GTFL-------
G1KLN8_ANOCA/2-162--------------------------------------------------FGEY--F.FTFCKMSGY..DRML-------
D9SRG3_CLOC7/2-160--------------------------------------------------IGQD--N.LYSFA.KDY..PAFF-------
K9X5Q3_9NOST/2-163--------------------------------------------------FGEY--W.IQYTGKAGY..GEIM-------
G7YQF8_CLOSI/2-164--------------------------------------------------MGRL--F.VDFVSSKGY..HNLL-------
F0RGN9_CELLC/2-162--------------------------------------------------FGLF--L.FDGLA.KAH..PDVI-------
F6YJD6_XENTR/8-169--------------------------------------------------FGEY--F.FEFCKKSGY..DHML-------
Q5ZWM9_LEGPH/2-162--------------------------------------------------FGEY--M.FPILS.SKC..AIFL-------
E3N9U4_CAERE/2-167--------------------------------------------------YGEF--L.ITHACETGW..QKML-------
B8DKJ8_DESVM/531-685--------------------------------------------------LGRY--T.MDGFY.RMY..RRYF-------
B3RYQ6_TRIAD/11-175--------------------------------------------------FGAM--F.FKFCQESNY..DKIL-------
E9GML5_DAPPU/2-166--------------------------------------------------FGRC--F.IRSFDQYGY..DKII-------
F0LTC6_VIBFN/2-162--------------------------------------------------FGAS--V.FQSLY.RTV..PASA-------
D5XA10_THEPJ/2-162--------------------------------------------------FGDY--W.VNVYSQKLY..GHYY-------
H2Y4L1_CIOSA/2-168--------------------------------------------------AGRH--FYYTWLTFYCFRNDRII-------
F2TZE3_SALR5/2-165--------------------------------------------------AGGF--F.LTGILESGY..GHAL-------
F2UN82_SALR5/2-165--------------------------------------------------AGRY--F.LVGLLESGY..GDAL-------
A6GYD7_FLAPJ/2-163--------------------------------------------------FGEW--W.VIKTTSEKY..PGLM-------
A0PXJ5_CLONN/2-160--------------------------------------------------IGKD--N.IKTFF.KDF..PAFF-------
B3S7Q2_TRIAD/2-165--------------------------------------------------IGPC--W.LDWIETSPY..ATLI-------
Q21E20_SACD2/2-162--------------------------------------------------FGTY--L.FHQLN.SKF..PIFC-------
K0ATP4_CLOA9/2-160--------------------------------------------------IGID--N.VITFA.EDY..PAFF-------
T1KFI6_TETUR/2-166--------------------------------------------------FGRM--F.FDFCQESGY..DKIL-------
F2UR64_SALR5/2-165--------------------------------------------------AGKV--S.MGTFTRNGY..EPVL-------
A6LK33_THEM4/2-160--------------------------------------------------TGFE--N.IFTFR.SYY..PGYF-------
G3Q1S5_GASAC/2-164--------------------------------------------------WGVY--F.LGFVGKYGY..DRIL-------
C3ZF94_BRAFL/7-169--------------------------------------------------YGEY--F.IDFCMEAGY..DAIL-------
B8HJS1_CYAP4/2-164--------------------------------------------------FGEY--W.VTYTAEEGY..GELL-------
B7PFU6_IXOSC/2-164--------------------------------------------------MGVF--F.VSFLAQYGY..DRVL-------
W4Z032_STRPU/9-171--------------------------------------------------FGVY--W.VVWCMRCGY..DALF-------
G4VA36_SCHMA/2-164--------------------------------------------------TGLS--F.AKFISDYGY..GNLL-------
Q310U7_DESAG/727-881--------------------------------------------------AGRA--S.LQAFN.RMY..RQYF-------
A8MIN2_ALKOO/2-160--------------------------------------------------VGRQ--N.IISFN.KWF..PSYF-------
F2TZ95_SALR5/2-165--------------------------------------------------AGKM--S.MGTFVRNGY..EPVL-------
E9GML8_DAPPU/2-166--------------------------------------------------FGRC--F.VRYFSHYGY..EKFI-------
K9UD61_9CYAN/2-163--------------------------------------------------FGRY--W.LLFTATEGF..GSLM-------
G3RZQ8_GORGO/2-166--------------------------------------------------FGEY--F.FQFCKMSGY..DRML-------
E9GML7_DAPPU/2-166--------------------------------------------------FGRC--F.IRAAGTFGY..EKLI-------
G8R6C6_OWEHD/2-162--------------------------------------------------FGHH--L.LMVFH.KSY..PEFF-------
K7AQ34_9ALTE/2-162--------------------------------------------------FGKW--V.FKEFYNIAPSGAHDF-------
Q21ER7_SACD2/2-162--------------------------------------------------FGRY--L.FDALN.SMS..PQYA-------
I7CPA5_NATSJ/2-161--------------------------------------------------FGTT--L.APKLL.STF..SAHI-------
Q7Q9W6_ANOGA/2-164--------------------------------------------------FGRC--F.VRFFSNFGY..DELI-------
E9FT54_DAPPU/24-187--------------------------------------------------FGEK--F.LDFCQDSGY..DRIL-------
A7RN70_NEMVE/2-168--------------------------------------------------FGDA--F.FEHCIGSGY..DSMI-------
I2EZ72_EMTOG/2-162--------------------------------------------------FGKH--L.LQLFS.KKY..SHFF-------
B2A8E6_NATTJ/2-160--------------------------------------------------LGRK--N.IWSFA.ELF..PSYF-------
I0K9V5_9BACT/2-162--------------------------------------------------YGRY--M.FGSFK.RDY..GLFI-------
M1MRY0_9CLOT/2-160--------------------------------------------------IGEE--N.LKVFT.KRY..PLFF-------
A9V7H3_MONBE/2-165--------------------------------------------------SGEL--A.LDTFISNGY..MPIL-------
K9UZY1_9CYAN/2-164--------------------------------------------------FGEY--W.VTYTAAEGY..GDLL-------
Q87NJ1_VIBPA/2-162--------------------------------------------------FGES--V.FLNLL.RSI..PSHA-------
Q5ZSQ8_LEGPH/4-164--------------------------------------------------YGEY--L.FEVFA.KKY..PQFF-------
G7Y7K2_CLOSI/23-185--------------------------------------------------TGKS--F.VRFMCNKGY..GGIL-------
A3UA30_CROAH/2-162--------------------------------------------------YAEH--F.FGVLV.KSY..PVLI-------
B4IBU8_DROSE/2-164--------------------------------------------------FGRC--F.VRFFSNFGY..DKMI-------
W4X9S3_STRPU/2-166--------------------------------------------------FGRM--F.FEFCVESGY..DNIL-------
A8WS03_CAEBR/2-164--------------------------------------------------IGTS--F.YKFLTKYEF..NKVL-------
Q8EF49_SHEON/2-161--------------------------------------------------FGQF--L.FNGLA.SRH..TDVV-------
T1JJL9_STRMM/2-164--------------------------------------------------VGVH--F.VNFVSRYGY..DQML-------
GCY34_CAEEL/2-167--------------------------------------------------YGGF--L.ITYSMEIGW..DELV-------
A5N4H2_CLOK5/2-160--------------------------------------------------IGLD--N.INAFY.KDY..PAFF-------
B9JYX7_AGRVS/2-166--------------------------------------------------FGLH--L.AGRFA.VLF..PGFF-------

PF02830

A4XDS4_NOVAD/122-182--------------------------------------------------TGFA--S------------GFAT.......
A9WB66_CHLAA/138-197--------------------------------------------------RAAF--E------------GLLR.......
B2UJH2_RALPJ/152-211--------------------------------------------------IGYA--C------------GYTS.......
D0J206_COMT2/112-172--------------------------------------------------LGYA--S------------GYSS.......
E4PKW5_MARAH/128-189--------------------------------------------------LGYA--C------------AYTS.......
O26930_METTH/130-191--------------------------------------------------AGII--A------------GALS.......
O27403_METTH/188-249--------------------------------------------------SGIL--E------------AVFS.......
O67571_AQUAE/116-177--------------------------------------------------AGFF--K------------GFLS.......
BCHJ_RHOCB/140-199--------------------------------------------------AAVF--E------------RLFG.......
P74443_SYNY3/170-231--------------------------------------------------AGLL--A------------GFFS.......
P74446_SYNY3/202-263--------------------------------------------------AGIL--T------------AFFS.......
Y745_METJA/119-179--------------------------------------------------AGLI--A------------GAYE.......
Y1460_METJA/95-156--------------------------------------------------AGIL--A------------GCLE.......
Q881E3_PSESM/120-181--------------------------------------------------IGYA--I------------GFVS.......
Q8DGL5_THEEB/132-193--------------------------------------------------AGIL--E------------SFFS.......
Q8DKK3_THEEB/150-211--------------------------------------------------AGLF--A------------GFFS.......
Q8R5R6_CALS4/52-113--------------------------------------------------TGLL--A------------GVLN.......
Q8TIU0_METAC/206-264--------------------------------------------------SGYF--A------------GYLT.......
Q8TQT2_METAC/185-246--------------------------------------------------EGIL--E------------GVLK.......
Q8TV82_METKA/104-164--------------------------------------------------AGFI--A------------GILH.......
Q8TWC8_METKA/86-147--------------------------------------------------RGFI--S------------RAAE.......
Q8TX90_METKA/68-129--------------------------------------------------QALF--R------------KLAE.......
Q8TXN0_METKA/66-127--------------------------------------------------RGLI--A------------GAHE.......
Q8TXN0_METKA/224-288--------------------------------------------------RGAL--H------------ETLG.......
Q8TXW7_METKA/177-236--------------------------------------------------AGII--A------------GVLS.......
Q8U209_PYRFU/331-392--------------------------------------------------AGSI--A------------GIVE.......
Q8XT87_RALSO/150-211--------------------------------------------------LGYA--I------------GYVS.......
Q8XTP9_RALSO/107-174--------------------------------------------------AGWF--A------------GAMDWVNDTTP
Q9KLM3_VIBCH/129-188--------------------------------------------------EGLI--L------------GAA........
BCHJ_RHOS4/143-203--------------------------------------------------AAVF--E------------RLFS.......

PF04051

T1JVG1_TETUR/7-153..RF..............................................KDEL--DIMKFICKDFW--SVIF-------
E5SJ80_TRISP/8-152..PL..............................................RAEI--DVVKFLCKEFW--CAIF-------
M0RYG7_MUSAM/13-175..RF..............................................SDHL--EAIKFICKDFW--SELF-------
X6NU62_RETFI/84-239.KRE..............................................TNHV--SMLEFITKDCW--KHIF-------
E4WZM5_OIKDI/17-163..................................................KNMQ--ETAEAI.QSAF--KQYI-------
A7T063_NEMVE/19-166..................................................HDFR--ETADVIAKLGF--KMFL-------
U3IS73_ANAPL/19-165..................................................RSYS--ETADMIAQVAF--KMYL-------
G0RJ43_HYPJQ/25-253..RF..............................................NDTL--DVIKFLCKDLW--SLVF-------
A8BA91_GIAIC/27-185..KL..............................................TRPD--TVLYYLKETVW--PILF-------
I2H4M5_TETBL/53-262KRRD..............................................LKIL--DILQFVHGTVW--AYLF-------
A0A0D2UGE9_CAPO3/18-164..................................................QDLK--ETAEVISKVGF--KMFL-------
C1MS22_MICPC/30-175..................................................VDFR--DTCETIAGVAL--RMFL-------
D7FQV7_ECTSI/36-189.KRR..............................................VRLL--PMLQWVSSNVW--KALF-------
E7NGB5_YEASO/62-271RRRD..............................................LKIL--DILQFIHGTLW--SYLF-------
A7TQ02_VANPO/35-184..................................................EDMI--RTSEVITKCAF--KIFL-------
R9AMQ2_WALI9/26-174..................................................RVFA--ETADVVASVGF--KVFL-------
G8ZPV8_TORDC/45-260..NLVFKD..........................................MDLL--SVMKFICRDVW--KQFY-------
Q38DI4_TRYB2/28-190.RRP..............................................TTID--EALKLLQEKFW--TRWF-------
M2YLM3_DOTSN/24-219..RP..............................................TTPL--EAIKFICKDLW--QLLF-------
N4VA41_COLOR/25-174..................................................SNFR--ETADMIARVGF--KIFL-------
U4LDL1_PYROM/26-177..................................................INFR--DTAETISKIGF--KVFL-------
N1Q0J8_DOTSN/59-215.QRP..............................................TRIL--DLLQFIHGTLW--RALF-------
I1EHD1_AMPQE/31-180.KRE..............................................TRIV--NILWFIQKTVW--KTLF-------
E9I9Q7_SOLIN/5-151..................................................YDFR--DTAEKI.QSGF--KIFL-------
E1ZPW5_CHLVA/28-181.RRE..............................................TRLL--DMLKFVHSTLW--KYLF-------
K0R7X6_THAOC/23-249..LMGPGSPSPEGGTASADASGN....SNI.DVNAPIIMGGGGHNTVMDPKTQL--EAVKFLCKEFW--TEVF-------
Q5KMH2_CRYNJ/70-228.KRE..............................................HRLV--PILQFIHTQVY--RYCF-------
G8YS93_PICSO/81-235.KRE..............................................IKIL--EILQFIHGAFW--KSIF-------
K3XAK0_PYTUL/47-201.RRE..............................................TRLI--SILQFIVSTCW--KALF-------
I1JRI0_SOYBN/10-175..RF..............................................TDHL--EAIKFICKDFW--SELF-------
L8FYS8_PSED2/51-210.LRP..............................................LNII--ALLNFIINVMW--KHLF-------
F1QMV3_DANRE/7-155..RF..............................................KDEL--DVMKFICKDFW--TSVF-------
C1MRP2_MICPC/11-162.RRE..............................................NRLQ--GILQFINTNVW--RSLF-------
E6ZN37_SPORE/79-291..KF..............................................TDTL--DVLKFICKEVW--TAVW-------
G2QD82_MYCTT/25-217..RF..............................................NDTL--DVIKFLCKDLW--TIVF-------
L8FNC8_PSED2/24-220..RF..............................................TDTL--DVIKFLCKDLW--MLVF-------
A8JFB7_CHLRE/26-178..RL..............................................GDTL--EIIKFVCKDFW--QALF-------
T1JCC7_STRMM/19-164..................................................QDFR--ETADKI.QLAF--RMFL-------
W4ZHN1_STRPU/7-154..RF..............................................SSEL--DIIKFVCKDLW--NGVY-------
I2H1V3_TETBL/54-297..NLHFRD..........................................MDIL--LIMKFICRDVW--KQLF-------
U1HTW2_ENDPU/68-231.TRP..............................................LRVL--PLLTLLTTKLY--PLLF-------
G9NKV9_HYPAI/25-220..RF..............................................NDTL--DVIKFLCKDLW--SLVF-------
H0XNR3_OTOGA/7-161..AL..............................................REEL--DVLKFLCKDLW--VSVF-------
K0KYJ5_WICCF/14-204..KN..............................................LELL--NIMKFICRDVW--KLIY-------
K0KLU0_WICCF/62-215.KRE..............................................TRIV--EVLQFIHSQVW--KTLF-------
Q5AH42_CANAL/17-209..................................................VDIL--DIMKFVCRDVW--KCLY-------
M7SMZ2_EUTLA/56-213.TRP..............................................LTII--ALLHLIKINAW--THLF-------
B7QH45_IXOSC/19-163..................................................HDFK--DTSDKL.QMAF--KMYL-------
S8AJT6_PENO1/24-183..RF..............................................TDNL--DVIKFLCKDLW--TVLF-------
Q6BJ77_DEBHA/81-235.KRE..............................................VKII--EILQFIHGSLW--KCVF-------
B9REX0_RICCO/10-174..RF..............................................SDHL--EAIKFICKDFW--SEVF-------
A7TDQ9_VANPO/62-283RCRD..............................................LKII--DILQFMHGTVW--TYLF