Sequence alignment for CL0212

PF04628

TPPC2_CHICK/9-136----------------------------------------------IVGHHDNPVFEMEFLPPG..KAESKD........
Q4X1U7_ASPFU/7-185----------------------------------------------ILSPTDVPLFNIAFGTSK..GGGDGIARFR....
Q6BW18_DEBHA/13-197----------------------------------------------LISRKDVPLYIQSFDIGP..MDSENPQ.......
Q7QCA5_ANOGA/9-136----------------------------------------------IVGHNDNPIFETEFVTVN..KEAKKE........
Q57YJ1_TRYB2/2-125----------------------------------------------VVGPDDSTLFECEKFSDN..DS............
Q5CFT6_CRYHO/9-137----------------------------------------------IVDRSNQPLFFRTLENES..LDS...........
Q4CQS2_TRYCC/4-127----------------------------------------------VIGPDDASLFECAKSVDG..ES............
TRS20_YEAST/7-171----------------------------------------------IIGKKDNPVYEIEFTNAENPQGFPQD........
Q7RCP8_PLAYO/11-149----------------------------------------------IIGKGDIPIYEADLSING..KKDIS.........
Q6FVV2_CANGA/7-168----------------------------------------------IIGDHDRPLYEAEFTQGP..QGFVQE........
Q6BRP5_DEBHA/8-164----------------------------------------------IIGTRDNPLYELEFSSFK..TAVSSSTSTNNIA.
Q5KAA6_CRYNJ/23-186----------------------------------------------VVSPRDSPLFELAFASAK..PPPPPAAAPPAFPS
TPPC2_DICDI/8-131----------------------------------------------IIGKNDNPLYEIEFPITV..QKKE..........
TPC2L_DICDI/9-139----------------------------------------------IVGKGNNPLFIQDFSSSI..TDE...........
A8X604_CAEBR/10-138----------------------------------------------IIGHSDQPIFEMDFPAGE..RKTKESE.......
TPPC2_DROME/8-135----------------------------------------------IVGQNDNPIYEKEFSTVN..KELRKE........
TRS20_SCHPO/7-134----------------------------------------------IIGTKDNPVYELEMGPIN..EKLDRS........
Q6CFC6_YARLI/9-134----------------------------------------------IISRENTPLFIGIYPGEG..ETT...........
Q5A920_CANAL/9-148----------------------------------------------IIGTKDNPLYELEFSSFK..SAN..ISTTDNVP.
Q651C7_ORYSJ/7-136----------------------------------------------VVGHQNNPLYLQSFTEAD................
Q4UE14_THEAN/25-171----------------------------------------------IVGKDDKPLLIEDLSTPG..RRSDP.........
Q6C760_YARLI/7-139----------------------------------------------IVGTEDNPIYTQEFGTYR..QGGDGNSRF.....
Q74ZF3_ASHGO/7-174----------------------------------------------IIGHKDNPIYEVEFISLQ..QSFPPD........
TPC2L_HUMAN/7-138----------------------------------------------VIAKENYPLYI....RST..PTE...........
Q6CQN4_KLULA/6-155----------------------------------------------IIGTSDNPIYEAEFTTAK..NTFQPE........
Q4PCM0_USTMA/13-185----------------------------------------------IVSPISGPIYVRQFSKVQ..SES...........
Q7F8Z0_ORYSJ/9-132----------------------------------------------IVSKNDIPIYEAEVGSAP..KKE..D........

PF04099

Q20100_CAEEL/5-215-----------------------------------------IQHLFIINRAGSLIYSWEARTET--PEVEKTYEWPIDVH
O77358_PLAF7/1-144-----------------------------------------MYSLYVNNQHGTLVYQKHFSEEI--..............
TRS23_SCHPO/1-132-----------------------------------------MHALIIINRAGSLIFQREFGSS.--..............
Q9VA95_DROME/3-137-----------------------------------------IFNLYIFDKFGTLLHYAEWNRTK--KSG...........
Q9LZ97_ARATH/4-134-----------------------------------------IYSLYIINKSGGLIFYKDCG...--..............
Q9VLI9_DROME/3-209-----------------------------------------IYGVYIVSKSGGLIFNLDNNVPR--IEHEKTFTYPLDLV
Q9AWN0_ORYSJ/33-178-----------------------------------------AQVLYVFNRGGVCLLYREWHRPL--RT............
TPPC1_HUMAN/3-137-----------------------------------------VHNLYLFDRNGVCLHYSEWHRKK--QAG...........
TPPC4_MOUSE/3-209-----------------------------------------IFSVYVVNKAGGLIYQWDSYSPR--AEAEKTFSYPLDLL
Q9SYB8_ARATH/23-168-----------------------------------------AHMMYVFNRNGVCLLYKEWNRPL--HT............
A7UW60_NEUCR/3-157-----------------------------------------VFSLVIINKAGGLIYNRTFHEGG--..............

PF01217

AP3S_SCHPO/1-139----------------------------------------MIYAVFIFNNKGKPRLTKFY.TPI----------------
AP1S1_MOUSE/1-142----------------------------------------MMRFMLLFSRQGKLRLQKWY.LAT----------------
AP2S_YEAST/2-147----------------------------------------AVQFILCFNKQGVVRLVRWFDVHS----------------
AP2S1_HUMAN/1-142----------------------------------------MIRFILIQNRAGKTRLAKWY.MQF----------------
AP3S_YEAST/1-160----------------------------------------MIHAVLIFNKKCQPRLVKFY.TPV----------------
COPZ1_BOVIN/12-153----------------------------------------TVKAILILDNDGDRLFAKYYDDTY----------------
AP1S1_YEAST/3-146----------------------------------------QLKYLLLVSRQGKIRLKKWY.TAM----------------

PF09201

C5E0Z1_ZYGRC/1-156----------------------------------------MLEQFVVFTSGGQVVYQFNCLGKK----------------
A7TFS7_VANPO/1-148----------------------------------------MFDQLVIFTPTGEVLYEYNPLNKK----------------
G8JRB0_ERECY/1-141----------------------------------------MIDQLAIFTVQGQLLCKYNALGKK----------------
G0VGX2_NAUCC/1-143----------------------------------------MFDQLTIFTPQGQVLFKYNCQGKK----------------
G8BTK8_TETPH/1-155----------------------------------------MFDQLAIFTPQGEVLYQYNPSGKK----------------
Q6CTR2_KLULA/1-140----------------------------------------MIDQFAVFTPAGNLLYGYNSLNKK----------------
G0W8F2_NAUDC/1-150----------------------------------------MFEQLAIFTLQGIILYQYNCQGKK----------------
I2GXE9_TETBL/1-153----------------------------------------MFEQLAILTPQGTVLYQYNPLGKK----------------
G8ZVC5_TORDC/1-153----------------------------------------MFEQFCIFTPQGDVIYQFNCAGKK----------------
SRPR_YEAST/1-155----------------------------------------MFDQLAVFTPQGQVLYQYNCLGKK----------------
C5DM67_LACTC/1-140----------------------------------------MIDQFVVFTLKGQVLYHFNPQGRK----------------
Q6FSE1_CANGA/1-148----------------------------------------MFEQLTIFTPQGEVLYYYNCYDRK----------------

PF12584

A8NHA2_COPC7/992-1155---------------------------------------------PVDVPVKDIVATASINILS----------------
A7F9J5_SCLS1/1351-1514---------------------------------------------PVDVPSVTVVHTADLRLLQ----------------
B2W2H3_PYRTR/1490-1643---------------------------------------------TVSIPQTHILHTASLILNS----------------
B6H3B0_PENCW/1240-1399---------------------------------------------PVDVPEVQVVHTADLQLQP----------------
C5FEM2_ARTOC/1257-1416---------------------------------------------PVDIPDVQVVHTAKLVLKD----------------
C4JLA5_UNCRE/1213-1358---------------------------------------------PVDIPEIQVVHRAELILHN----------------
Q4P224_USTMA/1235-1382---------------------------------------------PVDVPTVDYVNAVTLSLGR----------------
B8P4P6_POSPM/992-1139---------------------------------------------PVDVPRMHILAAAHLRVTP----------------
B0D3E6_LACBS/1015-1161---------------------------------------------PVDVPYMNIVAAACVRLIS----------------
C4R0Z1_PICPG/1026-1192---------------------------------------------DVPMPSIDILHVVDFEPIE----------------
A8PKV5_BRUMA/843-1047---------------------------------------------SLQIPAK..LLNPNLTHIQ----------------
B4HE09_DROSE/978-1138---------------------------------------------.HELPVVKVHFVIKYASLS----------------
F7CPS6_CALJA/149-377---------------------------------------------.EPPPSLHCRFSVGFSPAS----------------
H3CJ11_TETNG/1022-1246---------------------------------------------...PSCLQCVFSTDFSPLN----------------
Q4WSJ6_ASPFU/1252-1410---------------------------------------------PVDIPKIQVLHTAELRLKN----------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247INLRT.RDIMSCISITAEFAVTEGHVAEPIFAQIAIRSNAHKGSNPIILNNLVVEFKGPLGSIKLTHA.......ETDGG
R7YHS6_CONA1/667-1263VSLTS.KSTLSPLSTSFTFAHDEGHVGEPLRAQLVFQSRAQRSSAPVVLSAVKVGLTGSLEEIRISHKPSPSGPPSSPGK
C5G0L5_ARTOC/657-1267IVLKD.KDVASCISTSFTFISSRGNVGELLEGQLVLRSDSRRTSAPIYLSEVKITFEGCLPPIRILADDDA....EASEA
G2YB15_BOTF4/638-1224IVLHA.EEVQSFLTASYAFEKSEGKVGEHSLSQLAIRSSALASSTPVTISEIRIEFTGSMKPILLRHKANTES.SETVKS
M1WIS4_CLAP2/616-1226IQLSD.DVASPLISSSFVFRTKESKAGDYCKAQLALTSHAMPGSSPIRLSSVRVDFQTGLKPITVDHASSETGDEASTSR
C4JTF4_UNCRE/662-1266VVFKEDEEVVPCLSASFAFERSEGNVGEPLLAQLVITSTAHETASAIRLSEVIVAFEGSLRPIKLQASPVAA...TVSDN
H1V6N2_COLHI/632-1214VTIND.DLVSSFISASFIFKTEDGKAGETCQAQLAIKSDAFSDAKPVTLKGLKIHFEGSLKTITLDHETH..SASGTEKC
B8M738_TALSN/646-1234IVLKA.EDVLTCLSASMVFQKGEGNVGQALQLQMAITSHAHQHAAPLKLSQVKVIFEGGLRPITIQADDATG...KPNSS
M4G065_MAGP6/633-1227VDIVD.ESSLPLLSSSFVFRSEEGNAGRTSQGQLAITSNAQPSSAPIVLSGIQITFDGSIKTIHLKHDTAEAE..KRQCG
G4NCT1_MAGO7/630-1218VVISD.DSSLPLLTTSFIFRTEEGNAGRACLAQLSIKSNAAPMSAPLVLSSLQIVFDGSIKTVQLKHDAGQET..KTQNG
G3JHI1_CORMM/630-1211VDVSD.GSATGFISTSFVFRNKESRAGDFCQAQLSLASNAMPGSAPVTLSNVRVEFEGSLKPITLEHAPSDEKGAGC...
E3QU68_COLGM/632-1215VMIND.NVISSFISASFIFKTEDGKAGEACQAQLAIKSDAFPDAATVTLKGLRIDFEGSLKTITLDHEAG..STKGTEKG
Q2UPL2_ASPOR/663-1261VVLRA.EDIISSVTASFTFERPEGNVGEPLHGQLVITSCAQRSSSPIRFSEIKIAFEGCLRPIKLQSNHVAE...TDATT
G7XKR2_ASPKW/663-1260VVLRA.EDIVPSVTASFVFQSSEGNVGEPSKGQLIITSCAQPSSSPLTFSEVKVVFEGCLRPIRLQSDCNVD...ADTAT
N4VGT4_COLOR/632-1208VTIND.DTVSSFMSASFIFKGEDGKAGETSQAQLALKSEAFSDAAAVVFKGLRVDFEGSLKTITLDHSL...DVSAREKG
A6QX66_AJECN/503-1110VILKG.EDSVSCLAASFVFAKSEGNVGEPLQSQLVIRSCAHAGSSPIRLTEVKVAFEGNIRPIKLLASENES...SSSSS
S0E618_GIBF5/633-1211ISLSD.DKTGSFISASFVFRNKEGKAGETCTAQLALTSHTFLDAAPITFESLKVEFSGSLRPILLEQGASE.DEDSSLAS
T5AEY3_OPHSC/622-1204VSLSD.DSASSFVSASFVFRNKEGKAGEKGTAQVAIYSEALPCSSPVTFSSLRVDFTGSLKPVIIKHRDSETPGDSC.GS
C7YM27_NECH7/633-1211ISLSD.DKSGSFVSASFVFRNKESKAGETCTAQLALTSHTFLDAAPITLDSLKIEFSGNLKPLLLEHEEPESDEDSS.KS
E4ZMR8_LEPMJ/666-1245VNLNA.KDHMSPLIITFAFSESEGNVGEPLQSQMTITSNARQGSAPVTLSSLSYHFSGALSEVQLSHERDE....KTAVT
L8G4R2_PSED2/136-727VVLQG.RDIHSFLCATFVFEQAEGKVGEPCTSQLSVMSFASKGSSPVTMAEIKIKFEGSLKPVTIRHSS.EAQDVEVRPD
G9NXZ6_HYPAI/630-1207ISISD.DLASSFLSASFVFRAKEGRAGETCLAQLSLNSEALSGAAPVTLSSIRVEFEGHLKPITLVHDSALQMNSA..EG
T0LUP2_COLGC/632-1210VTIND.D.ISSFISASFIFKGEDGKAGETCQAQLAIKSDAFSDAAPVTLKGLRVDFEGSLKTITLDHAAE..PNAATVKG
G9MPU4_HYPVG/630-1207ITISD.DLASSFISASFAFRTKEGRAGETCLAQLSLKSEALQVAAPVTLSSIRVEFEGHLKPITLVHDSDLPTNSS..KE
K1XTU1_MARBU/632-1208VVLHS.NEIHSFLSATYTFEHAEGKVGELCPSQLVVTSVAIPTAASVTISDIKITFNGSMKPVVLSHRAIDDG..LDQSP
A1CQK2_ASPCL/664-1261VVLKA.EDVISCVTATFVFEKSEGNVGEPLKGQLILTSCAQRSSDPIRLSEVKIVFEGCLRPLKIQADQDVN...ADAKT
Q0CCQ2_ASPTN/665-1260IVLKA.EDIISCVTASFVIQNAEGNVGEPLSVQLVIRSCAQPSSAPIRFSAVKVVFEGCLRPIKLESSDDES...SDTTS
F2PXY2_TRIEC/646-1249IVLTD.KDVASCISMSFIFNSSSGNVGEPLRGQLVLQSDCSRKSSPIHLSEVKITFEGGLPSVRILADGNPA...DASES
B6QQY0_PENMQ/649-1238IVLKA.EDVVTCLSAAMVFQRGEGNVGQALQLQLAITSHAHQQATPLRLSEVKIVFEGGLRPITLHAKDIT....DDTNP
J3P062_GAGT3/633-1226VDIID.ESSLPLLSSSFVFRSEEGNAGRTARGQLSITSNAQPSSAPIVLSGIQITFDGSIKTIHLKHDTAQAK..KRQCG
U7Q1R6_SPOS1/669-1328VKLPEGTPPPSFLSAAFVFKNGEGKAGEAALAQLTIRSDALANSVPIVLEELHLQFNSSIKPIVLRHSA.DATATFFTKG
M2SXX2_COCSN/666-1245VNLNT.KEHISCLSVSFAFSEAEGNVGEPLQSQIAITSNARPGSAPITLSFLQYQFSGGLAEVRLTHQEGE....ELSDH
V5G1J1_BYSSN/642-1241VALRS.EDVVSCLTASLVFERPHGNVGEPLRLQLAITSRAQPESLPIRLSEVKVVFEGGLRPIKLLADESAP...GGSPG
J3K3J3_COCIM/661-1263IVFKE.EEVISFLSASFAFQKLEGNVGEPLQSQLVIGSCAHGSASPISLTEVKVTFEGSLRPIKLQASHEAA...IVACN
Q5BDK6_EMENI/657-1255IVIKA.EDVVSSVTATFIFQKAEGNVGEPLQCQLVLRSCAQKSSVPVRFAELRVAFEGCLRPIRLQSDQNID...ADTST
K9FSR4_PEND2/663-1258LVLRA.EDVITSLAASLVFERSDGNVGEPLQAQLSITSCAHKSSASIRLSEVKLVFEGCLRPVKIQSDQNQD...ADTTT
C5GAE4_AJEDR/665-1268VILKG.EDSVSCLAASFVFAKSEGNVGEPLQSQLVIRSCAQAGSSPIRLTEVKVVFEGSIRPIKLLPSEDAT...SSSST
S3D1H3_GLAL2/625-1196VVLHE.SEVHSFLSATFLFERLEGKVGEASRSQCVVTSSALPTSTPVTMTSLQIDFEGSMKPIIIRHKAMEETRSAPGNP
G2X5V0_VERDV/635-1221VSLSN.DNMTSFVSASFVFKTEEGKAGETCQAQLAVTSTAFPDSAPIVLKQLRVDFAGSLQTITLDHSIEEKTKGSMEKH
E4V6J7_ARTGP/54-658ILLTE.KDVASCISMSFTFNSSKGNVGEPLKGQLVLQSDCTRKSSPIHISEVKITFEGGLPPIRILADGNAA...AASGS
H6BX93_EXODN/653-1252VVIDM.DEAVSPLVPAFAFSTHNVFVGEPLECQLSIESRARQGLSPIQLTEARVVFEGSLKPICLVSGEVQHQ..ENDAS
E9E0X1_METAQ/607-1181IQLSD.ASSSHLISSSFVFRSKENKAGDQCLAQFTLTSNAMADSMPISFSSVKILFEGSLKPILLQHGSSGEE.......
C0SG01_PARBP/712-1314AVLRG.EDTVSCITASFSFEKSEGNVGEPLKSQLIIRSCAHAGSAPIRLTEVKIGFEGSLRPIKLLPGGDAT...SSSSF
S8BAM7_PENO1/662-1256VVLRA.EDVMTSLTASIVFEKPEGNVGEPLQAQLIISSCAQPTSAPIRLSEVKLVFEGCLRPLKLQSASELE...PDTTS
G0RNV0_HYPJQ/637-1222ITISD.DLASSFVAASFAFRSKEGRAGETCLAQLSLKSDAHQVATPVTLASIRIEFEGHLKPITIVHDSSAPSTNSS.GE

PF04628

TPPC2_CHICK/9-136.............................DHR------------------------------------------------
Q4X1U7_ASPFU/7-185..........................FPDTAQ------------------------------------------------
Q6BW18_DEBHA/13-197............................NANK------------------------------------------------
Q7QCA5_ANOGA/9-136.............................DHR------------------------------------------------
Q57YJ1_TRYB2/2-125...............................V------------------------------------------------
Q5CFT6_CRYHO/9-137................................------------------------------------------------
Q4CQS2_TRYCC/4-127...............................T------------------------------------------------
TRS20_YEAST/7-171..............................LK------------------------------------------------
Q7RCP8_PLAYO/11-149...............................E------------------------------------------------
Q6FVV2_CANGA/7-168..............................IK------------------------------------------------
Q6BRP5_DEBHA/8-164......................GRSNFPTSVK------------------------------------------------
Q5KAA6_CRYNJ/23-186WAAFAAAADPHDAPPAPAGPLIESRTAQQRDR------------------------------------------------
TPPC2_DICDI/8-131...............................T------------------------------------------------
TPC2L_DICDI/9-139...............................N------------------------------------------------
A8X604_CAEBR/10-138.............................GTR------------------------------------------------
TPPC2_DROME/8-135.............................DHR------------------------------------------------
TRS20_SCHPO/7-134.............................LNS------------------------------------------------
Q6CFC6_YARLI/9-134...............................T------------------------------------------------
Q5A920_CANAL/9-148......................GKSQFPQSTK------------------------------------------------
Q651C7_ORYSJ/7-136...............................D------------------------------------------------
Q4UE14_THEAN/25-171...............................P------------------------------------------------
Q6C760_YARLI/7-139...........................SPEMK------------------------------------------------
Q74ZF3_ASHGO/7-174..............................LK------------------------------------------------
TPC2L_HUMAN/7-138...............................N------------------------------------------------
Q6CQN4_KLULA/6-155..............................IK------------------------------------------------
Q4PCM0_USTMA/13-185...............................K------------------------------------------------
Q7F8Z0_ORYSJ/9-132..............................LA------------------------------------------------

PF04099

Q20100_CAEEL/5-215LEEVDQKAVVVFGEKDGIKLRYYVKSVNGETVSGTRLQLGAQQVNVLEYLQEEDHYPVTVKFAAP---------------
O77358_PLAF7/1-144.................................................................---------------
TRS23_SCHPO/1-132...............................................................PT---------------
Q9VA95_DROME/3-137.................................................................---------------
Q9LZ97_ARATH/4-134..............................................................TKG---------------
Q9VLI9_DROME/3-209LDYDSKKVSVSFNRKDGINVGHVL...VAVNGMPVNGVTLDDGRDVRTTLDAPENYPINLKFSRP---------------
Q9AWN0_ORYSJ/33-178.................................................................---------------
TPPC1_HUMAN/3-137.................................................................---------------
TPPC4_MOUSE/3-209LKLHDERVLVAFGQRDGIRVGHAV...LAINGMDVNGKYTADGKEVLEYLGNPANYPVSIRFGRP---------------
Q9SYB8_ARATH/23-168.................................................................---------------
A7UW60_NEUCR/3-157...............................................................LN---------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247NSPITELDLTEA...............EEQTSA..TVPSFKGDADLTLSAGEVRVFVFPVVFKEAGEVFVENASFEIETS
R7YHS6_CONA1/667-1263RFSMVEVDLQEN................IDSAISKIPSRLAGNADLTFYPGQTKVFVFAINFKEAGDVGAVDSTFIVEAE
C5G0L5_ARTOC/657-1267SHTLSSVVLGDA.........VSVPSDDQTPKA...CTEMRGNANLSLFAGQTSAVTLTLVPREAGHVRVASITLVVADD
G2YB15_BOTF4/638-1224GVLFKKTSLVDE..........STVEKGHDPDDPPTRHTLTNYEDLTLSPGQVKAFEFVNLLREAGDAKALKVTFSIASE
M1WIS4_CLAP2/616-1226KTQLAEIILEEA............FTKSDSGSD..VASQFSGACDLTLAAGQTRVLEMAIPLREPGEAGVSSVGMHYESE
C4JTF4_UNCRE/662-1266QTRISHTMLVDS........QSSDAASIQSPTL.GGTLSMTGTVDLAFPPGQTKAFNLTCIPREAGKVQVTSITLMIEDE
H1V6N2_COLHI/632-1214DVTLSNVPLAQA...........ARAAAEEGEE..GSSGLSGSANLSLKPGHTNIYEMAIPLREPGEAQASSVTLILEAE
B8M738_TALSN/646-1234SSQIFDIKLRDS.......AHSTESSTLLSPTG..HVSSMIGQADLTFRPSEARVFNMTAIPRESGESRIASITIAIEEE
M4G065_MAGP6/633-1227NAIVSGVSLQEQ.....SVEALRGDDPGKAKTAPAAVSVLVGSCDLTLPPGQTIVYEMDVPLREPGDAKALATTLSVSND
G4NCT1_MAGO7/630-1218NVKISTVTLREE..........TMQSSDPDTGASASISLLVGSCDLTLLPGHTMVYEMGVVLREPGEAKAASTTLSLSTE
G3JHI1_CORMM/630-1211PVSIRLVTLDEE.............FLDDSNDD..LPTKLNGSCDLTLQAGQRVVIEMAIPLREAGDVEPSTVTLNMNTK
E3QU68_COLGM/632-1215NVTLSRVPLTEK...........ARADAEEGDE..GTSGLGGSADLSVKPGHISVYEMAIPLREPGEAHASSVTLVLETD
Q2UPL2_ASPOR/663-1261PCTISSPSLREP.......STSSDTASLQSPTN..FLTPLIGTADLTIGPCQTKVFNVACIPREAGESRVASITLLIEEE
G7XKR2_ASPKW/663-1260PCTITSPMLRDP.......STAEDPAALQSPTS..GLTALTGLADLTFGPSQTKVYDITCIPREAGESRVASITLTVEEE
N4VGT4_COLOR/632-1208SISLSDVALTET...............PRESEE..GASVLGGSANLSLKPGHTNVYEMAIPLREPGEALAASVTLTVETD
A6QX66_AJECN/503-1110GCEIVPVSLQDS........VNLDASTVQSPTA..GLPQMVGATNLSFGPKQTRAFNLVSVPREPGEAQVASITLRIEQE
S0E618_GIBF5/633-1211KISILLLSLTED.............YAEGSEDE..LPTLLKGTSNLTLRPGQTRVFEMKIPLREPGTATASSVTLSHSNA
T5AEY3_OPHSC/622-1204SVCVDTLALDEE.............FSKGSEDE..LPSQLRGQSDLTLKPGQRRVLEVAIPLREAGDAEASSVTLSYQCE
C7YM27_NECH7/633-1211GVFISSISLQED.............FAGESEDD..LPSLLRGQSNLVLQPGQTRVFEMKIPLREPGTATASSVTLSHSND
E4ZMR8_LEPMJ/666-1245TSRMLACTLEET.................STSG..QKPQWAGVSDLTIYPGQTNVYTFPLIFREAGDVDADSCVFEVNTD
L8G4R2_PSED2/136-727NTSFTKVALREE....HGNSEDTAMSVGKERGL..RFSTLVGDESLIFLPGQTRVFELSCPLREPGKAKAISATFALAAP
G9NXZ6_HYPAI/630-1207PISLAAEEDADE................DKKDE..KEDRLTGRCDLTLRPGHRQVFEMNIPLREPGEASASTLILSYKAD
T0LUP2_COLGC/632-1210AVSLSNVTLKET.............ARAGEDEE..GASVLSGSANLTIVPGSTNVYEMAIPLREPGEARADSVTLLLETD
G9MPU4_HYPVG/630-1207PVSVTAVAETKD.................EEDE..KEGQLTGKCNITLRPGHRQVLEMNIPLREPGQASASRVILTYKTE
K1XTU1_MARBU/632-1208VVALQSVPLTEA....................TPDERSVLIGHASLVFGPGQTRIFEFSTVLREDGEAKAISATFSMATD
A1CQK2_ASPCL/664-1261PCIISSLTLREP........TSADSTSLNSPTI..GLTALVGLGDLTLGPSQTKVFNVTSIPREAGESRVASITLLIDEE
Q0CCQ2_ASPTN/665-1260PCTISSISLQEP.......RLSADVSSLQSPTS..HLETLTGVADLTIGPSQTKVYNLICTPREAGESRVASVTLLIEEE
F2PXY2_TRIEC/646-1249SHTHASISLADG...............QTGPSS..LLQEIKGNANLTLFPGQTRAFTLTLIPREASDVRVASITLIVADD
B6QQY0_PENMQ/649-1238LSHIYNVKLHDL.......ASSTESSTFLSPTA..HMASMIGQADLIFKPGETRVFNMTAIPREPGESRIASITLAIEEE
J3P062_GAGT3/633-1226KATVSDVSLQEQ.....SVEALRGDDPGKEKTTPAAVSVLLGSCDLTLPPGQTVVYEMDVPLREPGDAKALATTLSVAND
U7Q1R6_SPOS1/669-1328KTTHSTIHLEEEDEDDPGAGTKTINGGDDDDET..RVLGLHGSANLTLQPQSTLVFELAIPLRQPGDAHAVSADLVYRCP
M2SXX2_COCSN/666-1245ASRMYSCTLDEV.................QSAI..GKSQWTGTADLTLHADQTKVYSVPLIFRESGDVDVTACILGVSTE
V5G1J1_BYSSN/642-1241RILILPVTLRDS.......VTSTDSSALQSPTN..SLASMTGTTDLSVQSSQTKVFDLTSIPREAGEARIASITLMIEEE
J3K3J3_COCIM/661-1263QTEISNITLSDS........LLSDSASILSHPS..NLPSMTSTADLTLAPGQTRVFNLISIPREAGEVKVSSITLMFEDE
Q5BDK6_EMENI/657-1255TCLISSPSLRDP.......SATSDSSVHQSTTS..ALNALTGIADLTLGPAQTKVYNLACIPRESGESRVASIALLVSQE
K9FSR4_PEND2/663-1258PCCVATLPLREP.........SNSDTAIQSPTG..GLTALVGIADLTLGPSQTKVFNLTCIPREAGGARVASITMLIEEE
C5GAE4_AJEDR/665-1268SCEIISVPLQDS........AKVDASSVRSPTA..GLSLMAGFTNLSFNPKQTRAFNLVSVPREPGEARVASITLRIEEE
S3D1H3_GLAL2/625-1196RV.FSEISLAET....................VENTRSNQSGEADLCFAPGQSKVYEFQTPLRDDGEVKATSVTFSMNTE
G2X5V0_VERDV/635-1221NTSLAAIALVET.........TGPESEDVEETE..RGSVLNGRADLEIKPGCTSVYEMAIPLRESGEARAASVVLNFDTD
E4V6J7_ARTGP/54-658SRTHASISLGDG................QATAT..SSQEIKGHANLSLSPGQTRAYTLTLIPREASHVQVASITLIVADD
H6BX93_EXODN/653-1252RARFCDVALEDS.......SSTAVLASKRSSTE..TVPSLIGVGDLIIAPGHTIIYRFRVIPREAGEISIASIALKIQDE
E9E0X1_METAQ/607-1181SSFITKVALEEQ.............FSTDGPGD....LPLSGICDLTLKPGEKRVFEMAIPLRESGEAEASTVVATYEHK
C0SG01_PARBP/712-1314PSEILSVPLQDS........SNADASTVQFSTG..GSPLMVGFTNLSFSPGQIRAFNLVSVPREAGDARVASITLRIEEE
S8BAM7_PENO1/662-1256PCCIFSSSLRET..........TPAGEVQSPTA..GLATLVGDADLTIGPSQTKVYNLTCIPREAGEAQIASITMLIDEE
G0RNV0_HYPJQ/637-1222SPSVSAVSLTER...............LPESNE..KDAYLTGTCDLTLKPGHRRVLEMDIPLREPGQVSASRVILTYKAD

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247RFHLA.......CT..SEAPQENTSPFWWYLTTTGLKTKRLGRIMDD.PAIKVLPKPPKMEVRL...........PNLQK
R7YHS6_CONA1/667-1263RFVLT.......YT..SAVEGPETMPVWWYTARNLLKTKRLRAAAAA..STKILPKPPKMQIFL...........PNLQK
C5G0L5_ARTOC/657-1267KFGLT.......YT...NTNSSYPQPRRWTKSKGGAIARRIGKDRDP.SYCHILPKPPKVLISV...........PGLRD
G2YB15_BOTF4/638-1224LFDFD.......YV...HSFDRPSFPEMWY.GEHATKKKIVRARPSS...IHVLPKPPKLELRI...........LEFQE
M1WIS4_CLAP2/616-1226AFDLQ.......HT...RVFKETDPVTGWY.VRGDDKPHALRAHART...LRIHPRPPKLQMTL...........LDPST
C4JTF4_UNCRE/662-1266MFNLT.......SV...ISSQSFKDPVWWSPGIKGAISRRIGKDRDT.ITCDILPKPPKVRILT...........PTLHD
H1V6N2_COLHI/632-1214AFTLH.......YT...VAFHDLGAADFWF.SPSLSRRRIVRQSAHV...IQVQARPPKLEIKL...........AQPLD
B8M738_TALSN/646-1234KFNLL.......YV...ITNHEQGMSFWWRDGLRGPSKKRIGKGRDT.TACKILPKPPNIQIQL...........PDLKP
M4G065_MAGP6/633-1227AFSLD.......YE...VPYKDTSVAGIWH..GPGRPRKIPRANSHS...IRILPRPPNVEIKV...........TSAIE
G4NCT1_MAGO7/630-1218TFGLD.......CI...VRHRDSGVAGLWY.SQDGKPRKIHRVNSHT...VRILPRPPNVDIKV...........NNIMD
G3JHI1_CORMM/630-1211TFDLT.......SN...LPFRDTDAAVGWF.IPGSSKPRKVRADSRM...LTIQPRPPKLDIKI...........ARQLQ
E3QU68_COLGM/632-1215TFTLN.......YT...IAFRNLEAADFWF.SPSLSRRRIVRQSAHV...IQVQARPPKLEIKL...........AQPLE
Q2UPL2_ASPOR/663-1261KFDLT.......CA...MTDLTQRDCFWWKQTKNSVARRRVGKNRDT.GRCKIKPKPPNIRITT...........PNLME
G7XKR2_ASPKW/663-1260KFDLT.......NA...ITDLTPYESYWWQQTSKGPSRRRVGKGRDT.GRCKILPKPPKIRVEL...........LNLRE
N4VGT4_COLOR/632-1208TFTME.......YT...TVFRDLGAEDIWF.SPSLAKRRIVRGNAHV...IQVQPRPPKMEIKL...........AQPLD
A6QX66_AJECN/503-1110NFDLS.......CV...ISEQNRDESVWWRMGKQGPIARRTGKDRDT.SVSRILPKPPKVRIST...........PRSRN
S0E618_GIBF5/633-1211SFDLD.......AK...IGIRDTDPIVGWY.IQGSSKPRSSRPEAGT...IRIQPRPPKMEIKL...........LEPSA
T5AEY3_OPHSC/622-1204TYDLS.......YT...MRFRETDVTVGWY.SAGSGVPRKPRSNSRL...LRVQPRPPKMQISI...........PDKLP
C7YM27_NECH7/633-1211AFDLD.......YK...LKFRETDPVVGWY.IQGSSKPRNSRPEAGT...IQIQPRPPKMEIKL...........VKPLA
E4ZMR8_LEPMJ/666-1245HFNLT.......CS..DTDLHSSPNPAWWVTSNGAVKPRKYKGAGGL..SVHILPKPPKVEIRL...........PDVRT
L8G4R2_PSED2/136-727LFDLE.......CI...IEFDHITTRDMWW.SQKPARKRVVRADPHS...ITILPKPPKMEIKF...........QALKD
G9NXZ6_HYPAI/630-1207TFELD.......YK...LSLSELGKVSGWF.AQGSAKPRLSRPNGHI...LHIQPRPPKMKLRL...........IEPLE
T0LUP2_COLGC/632-1210AFRLD.......YT...VDFRDLGVADFWF.SPSLARRIIVRQSAHV...IQVQPRPPKMEIKL...........AKPLD
G9MPU4_HYPVG/630-1207TFELD.......YT...LSLSDLGKVTGWF.VRGAAKPRLSRPDGHI...LHIQPRPPKMKLRL...........VEPLG
K1XTU1_MARBU/632-1208HFDLE.......YV...NTFDQKIAPDVWW.GETSIKKRVVRLDATA...ITILPKPPKIQLRI...........VGMQE
A1CQK2_ASPCL/664-1261KFDLA.......CA...ITELARQEAYWWQETTHGAVRRRVGKGRDT.SRCKIMPKPPKIRIKT...........SGIKS
Q0CCQ2_ASPTN/665-1260KFDLA.......CA...VRDLGDRNSFWWQQSPNGMTRRRVGKGRDT.TQCRILPKPPKIRITT...........PNLKD
F2PXY2_TRIEC/646-1249KFDLT.......YTISSTSNDAYALPRWWAESKGSITSRRIGKGRDP.SSCQILPKPPKVLISV...........PGLRD
B6QQY0_PENMQ/649-1238KFNFL.......YV...MTNHERDMSFWWRHGPRGSYKKRIGKGRDT.AICKILPKPPNIQIQL...........PNLKP
J3P062_GAGT3/633-1226IFSLD.......YE...VPCKDTSVAGIWH..APVRPRKIPRANSHS...IRILPRPPNVEIKV...........KNAME
U7Q1R6_SPOS1/669-1328LYSLQMKLPLASYV...AGEGSRGRTPTWFLPRAGGRVSVPRADSQA...IKILPRPPKLDIQLLHAPVATAAATPIPTV
M2SXX2_COCSN/666-1245RFDLV.......SS..NTDIEIPIHPLWWIQSNNKIKPRSLKHGSGM..SVHILPKPPKMEISL...........PDVRD
V5G1J1_BYSSN/642-1241KFDLA.......YS...ITDLSQPESSWWQDTGKGPIRKRIGKDRDT.HACKILPKPPKIRLAI...........PNVKE
J3K3J3_COCIM/661-1263RFDIT.......YV...VTQQPSKESVWWTLGKKGAMSRRIGKDRDT.SACNILPKPPKVLITT...........PSLRN
Q5BDK6_EMENI/657-1255DFDLT.......YA...ITDLAQQEAFWWQQTTKGPARRRVGKGRDV.DRCKIQPKPPKIRLTI...........PNLKS
K9FSR4_PEND2/663-1258KFDLG.......YA...ITEPNQRESFWWQQTQKGVTRRRVGKNRDT.SRCKVLPKPPKIRLTT...........PNLKE
C5GAE4_AJEDR/665-1268NFDLA.......CI...ISEQNREESVWWRMGKQGPISRRTGKDRDT.SVAQILPKPPKVRITT...........PNLRN
S3D1H3_GLAL2/625-1196NFDLE.......YV...HAFEQTTLADIWW.GEKGMQKKIARPDTST...LRVLPKPPKMELRF...........RGLQG
G2X5V0_VERDV/635-1221AFTLD.......YT...IGFQAANVADVWF.GPSLSKRRIPRLSSHA...IHVRPKPPKMEIRR...........SAILQ
E4V6J7_ARTGP/54-658KFDLS.......YTTTSTSNDAYTLPRWWTESKGRVVARRIGKDRHP.SRCQILPKPPKVLISV...........PGLRD
H6BX93_EXODN/653-1252KFTLT.......VS...SSDSGHSTARWWEARNGIPIARPFGQESNAFNTIDVKPKPPKLQIEA...........PDLKP
E9E0X1_METAQ/607-1181SFDIQ.......YT...MSFRDTDQVTGWY.IKTSDRPRQLRPDARI...LHIKPRPPKLLVSL...........PESSG
C0SG01_PARBP/712-1314SFDLA.......YV...IGDQRWNGSVWWREGKQGPISRRIGMGRDI.SMARILPKPPKVRITT...........PKLRN
S8BAM7_PENO1/662-1256HFDLA.......YV...VTNHLTQKAYWWQETKKGPSRRRVGKDRDT.TRCKIMPKPPKIRISL...........PNLKA
G0RNV0_HYPJQ/637-1222AFELD.......YT...LSLSELGKVGAWY.VHGLAKPRLSRPDGHI...LQIQPRPPKMKLAL...........VEPMD

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247RYYATEPVVLELEVENGEDEETEAGLEFIL.........MDDQRKELEFSW.LSSPDAGATS..........DDKSANLP
R7YHS6_CONA1/667-1263AYYTDELVTLDIEIFNGEEEETEAVLEVRF.........FGRVESTLAFSWKIMEEAEQGNGSAEQAD...NANSEIDLP
C5G0L5_ARTOC/657-1267MYYSGERAGLNIRLDNNEDAAATIVVEVKL.........SGRSESLAAISW.LDGVDSDEQS.........EGMSASQTT
G2YB15_BOTF4/638-1224QYYTNELIYLNLEVKNGEETDSIVDLEARL.........LGENIPSNIVLRRLDKTDSPSDTESE......EDDHELS..
M1WIS4_CLAP2/616-1226QFYTDETIRIDVEMRNDEDEAALVKLGTQL.........KGEAVPSFTLQV..GEEEVAGTAA.EVDEEDIQARSAAVFT
C4JTF4_UNCRE/662-1266HYYTDEHAVLDIQIENEEDEAAEISIEARL.........LGQSEDSAQIHW.VDDPEACVQP..........RDSSPTSP
H1V6N2_COLHI/632-1214QFYANEPMDLVLDVVNAEDTEAIAKLEVHV.........FGEQIPPFRVCI.EDDEEHTAEAG.K......EETKLTGLS
B8M738_TALSN/646-1234HYYTSERVSLTVAIQNNEDDAAEVAMQIRV.........RGQPDSPLKISW.SDDADETT..............EFDGVS
M4G065_MAGP6/633-1227QYYTNEAIDLELEIINAEDASAELRLNVVI.........AGEESPDFRLAA.GDEESAVAEADTA......GEYKEMTIP
G4NCT1_MAGO7/630-1218QYYTNEAIELEFEIINAEDADAQLEVGVVI.........AGQEPPAFRVTSGGDIDVSATDINSA......DDSRQVTAP
G3JHI1_CORMM/630-1211QYYANEPIALNVVLENNEDEAATTKLDIHV.........LGKLIPKLHVGA..GGKDYATETRVE......EEAELTGIN
E3QU68_COLGM/632-1215QFYANEPMDLLLDVINAEDADAVAKLEVHV.........FGEQIPPFRVHI.ENGEEHTAEAG.K......EEAKLAGLS
Q2UPL2_ASPOR/663-1261TYYTDERIVLKVEIHNEEDEAAEVTAEARL.........FGRPESAAKVLW.LDEEGSPWIQ...........GSESSTP
G7XKR2_ASPKW/663-1260TYYTNEEIILRVGVDNEEEEAADVSVETRL.........FGRPESTAKIRW.LDEENSSEIH...........GSGESTP
N4VGT4_COLOR/632-1208QFYANEPMELVLDVVNAEDTEAIAKLDVHV.........FGEQIPPFRVQV.EDQDDHDAQPG.Q......EEAKLTGVP
A6QX66_AJECN/503-1110HYYTDEKVVLDVQIDNDEDEAAEVDVEIKL.........FGYTETSATFSW.INETASDSIA.........AEDASPSSL
S0E618_GIBF5/633-1211QYYANEAIELEVELINAEDESATAKLDIHL.........FGKEIPAIRVVT..EGNEGSAEST.T......EEAKILGLP
T5AEY3_OPHSC/622-1204QYYTNEVVELKVELRNDEDEPAGVKLDVIM.........SGDQHPGFRVLV..EGEERSAECG.Q......DECWVTGIP
C7YM27_NECH7/633-1211QYYANEAIDLHIELLNAEEESASVKLDIHV.........FGKEVPAIRIEA..DGHEGSSEAQ.E......EESKISGLV
E4ZMR8_LEPMJ/666-1245QYFTDEPVTLAIEILNQEEEDTEAVLEVRL.........LGRQQDALGFAW....LERPASSPMKEVPPQVDGFKDVDLP
L8G4R2_PSED2/136-727QYYTNEPIDLNVDIFNGEDEESLASLEVTISN.....DGVGTPQLPFKIIIPTAPESNVEYTP........DDETPPSAK
G9NXZ6_HYPAI/630-1207QYYANEPIALRIGLYNEEDDSANVKLDIRI.........IGKGIPRFQVQA..GEHKREVDAT.E......EESQVTDLT
T0LUP2_COLGC/632-1210QFYANEPMELLLDVFNAEDEEAVAKLEVHV.........FGEQIPAFRVQA.ADQDEHKAEAG.Q......EEAKLTGLP
G9MPU4_HYPVG/630-1207QFYANEPIPLKIGLHNEEDDSANVKLDIRI.........VGKIIPRFRVDA..GEHKREVDAA.E......EESQVTGLA
K1XTU1_MARBU/632-1208QYYTNEQIVLKVEVTNGEDVESIVNLEVRL.........VGDDVPTVTLKL..DDKENNEITELE......SGNQLAGTP
A1CQK2_ASPCL/664-1261TYYTNERVILQMDVHNEEDEAADVTAEIRL.........FGQSKLGGQILW.LEDEDETESH...........RSRDSSP
Q0CCQ2_ASPTN/665-1260NYYTNERIVLKLGIHNDEDEAADVLTETRL.........FGRPESAAKISW.LDEEDSAEPQ...........DSGTSTP
F2PXY2_TRIEC/646-1249AYYFGEKAGLNIRLDNNEDASASIVVELKL.........SGRSEYPAAISW.LDGADVEEHS..........KETEELSA
B6QQY0_PENMQ/649-1238HYYTNERVSLAVAIQNNEDDAAEVAMQIRI.........LGQPHSLLKVSW.SDDAEEAT..............EFGGVS
J3P062_GAGT3/633-1226QYYSNEAIELELEIVNAEDASAELRLNVII.........TGEEPPDFRLAA.GDEESAVAEPDTA......GESKEMMIP
U7Q1R6_SPOS1/669-1328QYYTNEAIDLALELVNAEDADASVKLDVIMEGGSDEAGASGSSTPGFTLLVAGDEIDTAEPQTTDIASPTPPTAMLRSVP
M2SXX2_COCSN/666-1245QYYTDEQVTLAIEIINQEDEDTEAVLEVRI.........LGRSKDSLRYTW....VDRPASSPMKEVPPALDGSTDVDLP
V5G1J1_BYSSN/642-1241AYYTNEHVCLDISIQNEEDEMADLSMDVRL.........FGHPESVAKLAW.ADEEVPTETS.........DEDAADGSP
J3K3J3_COCIM/661-1263HYYTDEHMVLDILVDNEEDEPAEISVEVRL.........LGQSEASAQIHW.ADEPEADAQS..........NKFAPTTP
Q5BDK6_EMENI/657-1255TYYTNERIVLNLVIDNGEDEAADVVAEARL.........FGSPDSAVNISW.LDQEGSVQAS..........TESRPNTP
K9FSR4_PEND2/663-1258TYYTNERVMLQIGIHNEEDEAADVSTEIRI.........FG.TESTAQIQW.LDTDSDLDLL...........ESRASTP
C5GAE4_AJEDR/665-1268HYYTDEKVVFDVHIDNDEDEAAEIDVEMKL.........FGHTGTSATFSW.INETAADSEA.........SEDAGSSTP
S3D1H3_GLAL2/625-1196QYYTSEGISLELEVLNAEDVDAITNLEVYL.........RGEDAPPIEIRA..SEALSAPEEQDE......VEKSLEGTP
G2X5V0_VERDV/635-1221QYYANEPIELPLDIFNAEDADATAKLELHV.........FGEHVPALRVQV.DGLEEQSVEAA.K......EESKFQGLT
E4V6J7_ARTGP/54-658VYYSGERAGLNIRLDNNEDAAASIVVELKL.........SGRSEYPAAISW.LDGADSGEQP..........EEAKEMSA
H6BX93_EXODN/653-1252TYYTNESFNIDFDILNGEDEEVVVSVEVRM.........IGSVEGAAQIRWHSSETNEAVDPS........SDTGSPTLP
E9E0X1_METAQ/607-1181LYYTNETVELGVELRNEEEEPAHVKLDVQL.........YGKSVPSLKLLV..GEHERNGETG.E......EATKALGVP
C0SG01_PARBP/712-1314HYYTDEKVVLDVQIDNEEDDVAEIDVEIKM.........FGVSGTSAKFSW.IKEADANSAI..........EDASASSP
S8BAM7_PENO1/662-1256TYYTNERVVLKLDLQNEEDESASVSVEIRL.........FGSPESSAKLQW.LDGSSGST.............ESGASSP
G0RNV0_HYPJQ/637-1222QYYANEPIPLRISLLNEEHDAANVKLDVRI.........VGKTIPRFRVEA..GEHKREVDAA.E......EESQVTGLT

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155-------------------------------------------------------------------------------T
A7F9J5_SCLS1/1351-1514-------------------------------------------------------------------------------T
B2W2H3_PYRTR/1490-1643-------------------------------------------------------------------------------P
B6H3B0_PENCW/1240-1399-------------------------------------------------------------------------------K
C5FEM2_ARTOC/1257-1416-------------------------------------------------------------------------------I
C4JLA5_UNCRE/1213-1358-------------------------------------------------------------------------------V
Q4P224_USTMA/1235-1382-------------------------------------------------------------------------------C
B8P4P6_POSPM/992-1139-------------------------------------------------------------------------------N
B0D3E6_LACBS/1015-1161-------------------------------------------------------------------------------T
C4R0Z1_PICPG/1026-1192-------------------------------------------------------------------------------Q
A8PKV5_BRUMA/843-1047-------------------------------------------------------------------------------P
B4HE09_DROSE/978-1138-------------------------------------------------------------------------------Q
F7CPS6_CALJA/149-377-------------------------------------------------------------------------------E
H3CJ11_TETNG/1022-1246-------------------------------------------------------------------------------Q
Q4WSJ6_ASPFU/1252-1410-------------------------------------------------------------------------------L

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247GH.............FIGKLESGAKRTHAVHFIAPIDSGELLFEAKVVYHTIGEPDVPISKTIVGELAIIDPFEATYDFT
R7YHS6_CONA1/667-1263GH.............QVGKISSAARCTQSITFRTPPDPAEYTLEIKVLYHLITDLETPISKTLTTDFFFADPWEAAYDFS
C5G0L5_ARTOC/657-1267GATTGITTQTIRR..KVAEIGPGEHTVLPAVIIEAPHPMQYDLEISAFYHLNSDPETPISKMISLDLPFIQPFEANYKFL
G2YB15_BOTF4/638-1224................LGTIASGSSITVEMVISSIDLPAVYDLSLKASYNLVTDLETPISQAMSAQLSILNPFEANYDFS
M1WIS4_CLAP2/616-1226................MGAIASGATAKFRLTISSTSTSSTLDLLLRATYHLESDAATTILQVLSVPLNIVGPFEANYDLV
C4JTF4_UNCRE/662-1266TDDSGSLGQVKRK..EIGALDSGGRKAISLNVTNTSVPLEYGLEISAFYHLLSDPETPIFKTVTLDLPFIRPFEANYELM
H1V6N2_COLHI/632-1214................LGTLATSQSTRVKIGLDPVQLTTSYDVTLRVFYHLVTDPATLIMQILPVQLTVVNPFEANYDLI
B8M738_TALSN/646-1234...VESTNHLKSR..SVGTLSPAAISEIPIILSNTADALEYEVEISVNYFLVSDPETPISKSISATLVFIRPFEANYDFL
M4G065_MAGP6/633-1227................LGTVAAAASVRATVHIDAVDFPASFDVAFVASYHLITDPTTPIIKTEDFKLTLVNPFEANYDLL
G4NCT1_MAGO7/630-1218................LGLVPSTGIVKGVIHIDPMDFSTTYELAISASYSLVTDPDTPVIQTMDFRLELVNPFEANYDLL
G3JHI1_CORMM/630-1211................LGKIESSASQEIVLGIEPIDGPMTYELQLRATYHLETDSATPIIQVSTVQLNLVNAFEANYDLV
E3QU68_COLGM/632-1215................LGTLATSQTTRINISLDPVQLTTSYDVTLRIFYHLTTDPATLIMQILPAQLTVVNPFEANYDLI
Q2UPL2_ASPOR/663-1261...VEGLSHFIKR..PLGTLETSSHRQLEIVLTDTRDASDYELEISSVYNLVSDTQTPIIATLRVKIPIIRPFEANYEFM
G7XKR2_ASPKW/663-1260...TEGNSHHLKR..PIGVMERSSHQELTIVVTDTNDALDYELEVSALYNLVSDVQTPIIASMRVGLSIIRPFEANYEFL
N4VGT4_COLOR/632-1208................LGTFGTAQSTRVKVKLDPVQLTTSYDVTLRVFYHLVSDPATLIMQILPVQVSVANPFEANYDLI
A6QX66_AJECN/503-1110DTPIEGGSSTLSKRRTVGTLACGASRTLSILFTNTTLPLDYEVEISAFYHLVSDVETKIFKTVSLDLSFIRPFEANYEFL
S0E618_GIBF5/633-1211................LGAIKSTASVKMVLHIDAAPGPTTFDLHLKTSYHLDSDVATPIMQLLTVQLNVVNAFEANYDLV
T5AEY3_OPHSC/622-1204................LGVIENGSLRSLVVRIDAVDVACLHDVQLRASYHLESDAATPMAQALPLQLSIVTPFEVNYDLV
C7YM27_NECH7/633-1211................LGTMEKASSSQLVLHMDPPTGPTTFDLHLRASYHLDSDAVTPIMQMLAVQVNVVNAFEANYDLV
E4ZMR8_LEPMJ/666-1245GH.............VVGKLSQGASTVEKIHFTAPPDPADFALEVKVLYHLLSDRDIPISKIMVADLVFNAPFEASYDLN
L8G4R2_PSED2/136-727................LGSISSSNTISAIVVLGPILIQSTYEITLQLKYNLASDLETPITRTAAIRFNIGSPFEANYDFS
G9NXZ6_HYPAI/630-1207................LGHIASSSSLEASIRLEPALAPTVYELQIRADYHLESDAATPIVQVLPIHLNIVNAFEANYDLM
T0LUP2_COLGC/632-1210................LGTLGTSQSTRVKVSLDPIQLTTSYDVTLRVFYHLVSDPATLVMQILPVQLHVVNPFEANYDLI
G9MPU4_HYPVG/630-1207................LGNIGSSSSLELSIHLDPAPAPTVYEIQIRADYHLESDAATPIVQVLPIHLNVVNAFEANYDLM
K1XTU1_MARBU/632-1208................IGRIASTAATIVDVVIPALDLPAVYDLSLKAAYNLVTDLETPVYQSMATQLEVINPFEANYDFS
A1CQK2_ASPCL/664-1261...IEGAHHFLRR..SIGIMERSSRRDLALVLTDTLEPSTYELEINCVYNLVSDIQTPIIATHRVTVSVVRPFEANYEFL
Q0CCQ2_ASPTN/665-1260...IEGVAHFLKR..PIGVMESSARRELEIVLTGTEDASDYELEISCVYNLVSDVHTPIIATARVSLSIIRPFEANYEFH
F2PXY2_TRIEC/646-1249SQTKEVATQTIRR..KIAELGADEHTILPAVVVEAPHPIQYDLEISVFYHLSSDPEAAISKAISLDLPFIQPFEANYNFL
B6QQY0_PENMQ/649-1238...VETTIHLKSR..SVGILSPAAISEIPVILSNTVDALEYEVDISVHYFLVSDPETPISKSISATLAFMRPFEANYDLV
J3P062_GAGT3/633-1226................LGAVAAADSTRVTVHISAVDFPASFDVTFVASYHLLTDPATPIIQTEDFKLTLVNPFEANYDLL
U7Q1R6_SPOS1/669-1328................LGHVKAGHSVAIAIRIPPTTPSMDLDLTLRAAYHLVSDTATPITQQLSVKLSLSNPFEANYDLL
M2SXX2_COCSN/666-1245GH.............VVGKLAQGARTTERIRFTAPADPADYALEVKVLYHVLSDRDIPISKIMVADIVFNAPFEASYDLN
V5G1J1_BYSSN/642-1241...MGRARHSLKR..SIGTMESASRQNLSLVLSDTTDAFDYELELSVLYHLVSDPETPISKTLTAELSFVRPFEANYEFL
J3K3J3_COCIM/661-1263TGSDPSLGQIKRR..SIGIVDATCRRTLPLMFTDTSMPQDYELEISAFYHLVSDPATPIFKTVTLDLSFIRPFEANYELM
Q5BDK6_EMENI/657-1255...AEEEPHSLKR..SVGVIESSSQREIPIVISGTESSFEYELEVSAAYNLFSDIQTPIIATTRLTLPIIRPFEANYEFL
K9FSR4_PEND2/663-1258...IEGPSHYLKR..AVGVLERFSNKTLTIVLDDTQETTDFTLEVSAVYHLVSDIQTPIMKNITVDLSFIRPFEANYEFL
C5GAE4_AJEDR/665-1268STPIEGDSSALSKQCTVGTLGRGASRTLSVLFTNTTQPLDYEVEISAFYHLVSDIETQIFKTVSLDLSFIRPFEANYEFL
S3D1H3_GLAL2/625-1196................LGRIASSASSVVHIIIPPIDLPYVYELAVKASYNLVSDLETPVSRSITMQLEVINPFEANYDFS
G2X5V0_VERDV/635-1221................LGSIDASQSKRAVLHLSPSDAPTSYEITARVGYHLVTDPATPILQVMTFQVTIVNPFEANYDIV
E4V6J7_ARTGP/54-658SQTTGAATQTIRR..KITGLGAGEHTILPALVIEVPQPIQYDLEISAFYHLTSDPETPISKAISLDLPFIQPFEANYDFL
H6BX93_EXODN/653-1252SR.............ELGAIPSSGKTTVSLIVTGTAVAVDYEIEITARYALISEPETILTKTTTVDVTVIRPFEANYEFT
E9E0X1_METAQ/607-1181................IGVISSGAAAELKLIIDPTTAPTTYDLHIQATYHLESDTATPIIQVLSLSLDLVGPFEANYDLL
C0SG01_PARBP/712-1314ITLVEGVSSTLSKRCRIGTLARGACHTVLALFTNTSEPLDYEIEISAYYHLISDVETQIFKTVSLDLSFIRPFEANYEFL
S8BAM7_PENO1/662-1256...TEGSSHFLRE..SIGVMERASRKELVVVLADTHDAANYVLEISAEYHLVSDIQTPIMKTVNAEISFVRPFEANYEFK
G0RNV0_HYPJQ/637-1222................LGRVASSSSMEVSIHLDPAPAPTVYDIEVQADYHLESDAATPIFQVLPVHLNVVNAFEANYDLM

PF04628

TPPC2_CHICK/9-136------------------------------------------------------------------------HL...NQ-
Q4X1U7_ASPFU/7-185------------------------------------------------------------------------YM...NQ-
Q6BW18_DEBHA/13-197------------------------------------------------------------------------YL..KYN-
Q7QCA5_ANOGA/9-136------------------------------------------------------------------------HL...NQ-
Q57YJ1_TRYB2/2-125------------------------------------------------------------------------NM..SHQ-
Q5CFT6_CRYHO/9-137------------------------------------------------------------------------.....LH-
Q4CQS2_TRYCC/4-127------------------------------------------------------------------------HL..SRQ-
TRS20_YEAST/7-171------------------------------------------------------------------------EL...NP-
Q7RCP8_PLAYO/11-149------------------------------------------------------------------------HL...SQ-
Q6FVV2_CANGA/7-168------------------------------------------------------------------------EL...NP-
Q6BRP5_DEBHA/8-164------------------------------------------------------------------------EI...LP-
Q5KAA6_CRYNJ/23-186------------------------------------------------------------------------AL...CQ-
TPPC2_DICDI/8-131------------------------------------------------------------------------YV...LQ-
TPC2L_DICDI/9-139------------------------------------------------------------------------KL..KLH-
A8X604_CAEBR/10-138------------------------------------------------------------------------HL...NH-
TPPC2_DROME/8-135------------------------------------------------------------------------HL...TQ-
TRS20_SCHPO/7-134------------------------------------------------------------------------HL...NQ-
Q6CFC6_YARLI/9-134------------------------------------------------------------------------QLEYDYS-
Q5A920_CANAL/9-148------------------------------------------------------------------------EL...LP-
Q651C7_ORYSJ/7-136------------------------------------------------------------------------AL..KLH-
Q4UE14_THEAN/25-171------------------------------------------------------------------------HL...SS-
Q6C760_YARLI/7-139------------------------------------------------------------------------EL...AP-
Q74ZF3_ASHGO/7-174------------------------------------------------------------------------EL...NP-
TPC2L_HUMAN/7-138------------------------------------------------------------------------EL..KFH-
Q6CQN4_KLULA/6-155------------------------------------------------------------------------EL...NP-
Q4PCM0_USTMA/13-185------------------------------------------------------------------------AADLRYH-
Q7F8Z0_ORYSJ/9-132------------------------------------------------------------------------YQ...HQ-

PF04099

Q20100_CAEEL/5-215------------------------------------------------------------------------TVSTNEK-
O77358_PLAF7/1-144------------------------------------------------------------------------KLNSNEE-
TRS23_SCHPO/1-132------------------------------------------------------------------------ALTPNEY-
Q9VA95_DROME/3-137------------------------------------------------------------------------ITREEEA-
Q9LZ97_ARATH/4-134------------------------------------------------------------------------RMDTNDS-
Q9VLI9_DROME/3-209------------------------------------------------------------------------KMTTNEK-
Q9AWN0_ORYSJ/33-178------------------------------------------------------------------------LDPTQDQ-
TPPC1_HUMAN/3-137------------------------------------------------------------------------IPKEEEY-
TPPC4_MOUSE/3-209------------------------------------------------------------------------RLTSNEK-
Q9SYB8_ARATH/23-168------------------------------------------------------------------------LNPQQDH-
A7UW60_NEUCR/3-157------------------------------------------------------------------------KISTNDY-

PF01217

AP3S_SCHPO/1-139------------------------------------------------------------------------DESIQ.Q-
AP1S1_MOUSE/1-142------------------------------------------------------------------------SDKER.K-
AP2S_YEAST/2-147------------------------------------------------------------------------SDPQRSQ-
AP2S1_HUMAN/1-142------------------------------------------------------------------------DDDEK.Q-
AP3S_YEAST/1-160------------------------------------------------------------------------DLPKQ.K-
COPZ1_BOVIN/12-153------------------------------------------------------------------------PSVKE.Q-
AP1S1_YEAST/3-146------------------------------------------------------------------------SAGEK.A-

PF09201

C5E0Z1_ZYGRC/1-156------------------------------------------------------------------------FAETQIN-
A7TFS7_VANPO/1-148------------------------------------------------------------------------AMLNQVN-
G8JRB0_ERECY/1-141------------------------------------------------------------------------FSEQQFN-
G0VGX2_NAUCC/1-143------------------------------------------------------------------------FAELQIN-
G8BTK8_TETPH/1-155------------------------------------------------------------------------FAETQVN-
Q6CTR2_KLULA/1-140------------------------------------------------------------------------FSETQIN-
G0W8F2_NAUDC/1-150------------------------------------------------------------------------FSEHQIN-
I2GXE9_TETBL/1-153------------------------------------------------------------------------FQEAQIN-
G8ZVC5_TORDC/1-153------------------------------------------------------------------------FLESQIN-
SRPR_YEAST/1-155------------------------------------------------------------------------FSEIQIN-
C5DM67_LACTC/1-140------------------------------------------------------------------------LAENHIN-
Q6FSE1_CANGA/1-148------------------------------------------------------------------------FAEAQVN-

PF12584

A8NHA2_COPC7/992-1155PFSAKQ.............................................................GPGA-PLSLYAG-
A7F9J5_SCLS1/1351-1514ASIA.................................................................SS-CAVAAAN-
B2W2H3_PYRTR/1490-1643RIAS..................................................................Y-TTIATVG-
B6H3B0_PENCW/1240-1399STTDP................................................................GP-STHAAVG-
C5FEM2_ARTOC/1257-1416SPG....................................................................-QTHVGVD-
C4JLA5_UNCRE/1213-1358SST....................................................................-QPHCGVG-
Q4P224_USTMA/1235-1382DSGS.................................................................SQ-SASVIVG-
B8P4P6_POSPM/992-1139PWVSPQ.............................................................AKNA-ALPLFAG-
B0D3E6_LACBS/1015-1161PFTNAS..............................................................SSE-KFSLYAG-
C4R0Z1_PICPG/1026-1192NVQ....................................................................-..DFRVE-
A8PKV5_BRUMA/843-1047GCKYRLVWILPSNKGKTDEVEHYELRFTYRVKSLDEHTNEEELIYDREYTLFDEFPPDYELCAQLLSSQPG-AILCRVD-
B4HE09_DROSE/978-1138PDVWRTYGCAFDLVD...........................................YTTLFKLQAQLEP-NELCRLR-
F7CPS6_CALJA/149-377EQLSISLKPYTYEFQVEN.....................................FFTLYNVKAEISPPSG-MEYCRTG-
H3CJ11_TETNG/1022-1246DVSVFKLFHHQFQLERV.......................................TTLYSVRADILPPAG-EQHCRCG-
Q4WSJ6_ASPFU/1252-1410ADQ....................................................................-PRHAAVG-

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247PQVHPDPWPSFFLVDDAQVPEGSTDAA...ATKA..FGLTARYLMNVRIGSYAEEDLIIQDAELSVHEVAG.GAVARVS.
R7YHS6_CONA1/667-1263PRVHPDLWPSFFHVDEKQSLEAPAEASIDTA.....VGIAQIWLATARLENFAEEDLVVEDLSLVLQAVNG.GAICAIS.
C5G0L5_ARTOC/657-1267PRLHPTPWPDFFHIDES......KDSK...EWDRQRTNMQQRWLVNSTLVSFAREALLIEDVALRVLSEVA.GKVCSIT.
G2YB15_BOTF4/638-1224PRIHPGSWPSFFTHDESLE..ISQDGQ...DNDREAFGLAQKWCLTTRFASFATEDVIVEDVDVEILGLQG.AIKCSTK.
M1WIS4_CLAP2/616-1226PRLHPDPWPSLFDCDGIPI.PSTADDE...ATAVRPKGLAQQWCLLCHYASFASEDLVVVGMETQVVSCTG.AVQCHVL.
C4JTF4_UNCRE/662-1266PRVHPGPWPDFFHVDEPKL....IDES...EPRA..HGLQQRWCLDCKLISFAHETLLIDKVSVAVTGIEG.GLVRHIG.
H1V6N2_COLHI/632-1214PRLHPDPWPSLFDHEGVQD...PSVDE....AALQPRGLAQKWCLVCHFASFATEDLEIVSMDAEVVACHN.HARCTTA.
B8M738_TALSN/646-1234PRINPNAWPNLFHLN........TDSD...GDKP..DGLQQRWCVSPKIVSFASEPLVIQKVNVGLLEIHG.GAICDIG.
M4G065_MAGP6/633-1227PRLHSDPWPSVFDHEGVQG...LYVDD...GSYVQPRGLFQTWCLVTRYASFASEDLVVMGVDVTIAPTL..GVQTRTS.
G4NCT1_MAGO7/630-1218PRLHSDPWPSIFDHEGVQA..LFVDDD...TYHVQPRGLCQTWCLVTRYASFASEDLKVAGVAVSISPGP..DVHTRIS.
G3JHI1_CORMM/630-1211PRLHPDPWPSLFDPEGLDD...IHEED...GKQRRPIGLIQRWCLLSHYASFAQEDVRVLDTEVEVTETVG.SARSVVR.
E3QU68_COLGM/632-1215PRLHSDPWPSLFDHEGVQD...PSVDE....AAVQPRGLAQRWCLVCHFASFATDDLELVGMDAEVVACQN.NARCTTV.
Q2UPL2_ASPOR/663-1261PRLHPQPWPDFFTVDDALL....GNDS...TPKL..GGLQQRWCLNSKVVSFALTPLVIEKISLVLVGVGG.GATCHVG.
G7XKR2_ASPKW/663-1260PRLHPQPWPDFFTVDDELL....PNGD...EVKP..GGLQQRWCLNSKVVSFAVEPLVVEKMSLVLLGLGG.AATCHIG.
N4VGT4_COLOR/632-1208PRLHPDPWPNLFDHEGVQD...PAAED...TAAALPRGLAQKWCLVCHFASFASEDLEIVSMDADVLACNS.NARCTTA.
A6QX66_AJECN/503-1110PRIHPAPWPDFFHYDDSPS....EDSE...EQEQKHNGLQQLWCLNSKIVSFALEPLIIEEVNVSLLGITA.GNICRIG.
S0E618_GIBF5/633-1211PRLHPGPWPSLFDSEGLGD...........TEEGVARGFTQKWCLLCHYASFAQEDLKVLGMDLTVVSCVG.GARCNVS.
T5AEY3_OPHSC/622-1204PRVHPEPWPSLFDEAGVED...PLEED...AASMPARGLAQQWCLVCHYASFAMEDLCVLEMDTVVSPAEG.RARCHMV.
C7YM27_NECH7/633-1211PRLHPEPWPSLFDSEGLGD...........TEEGVARGFAQKWCLLCHYASFAQEDLKVLGMDMKVTSCVG.GARCNVV.
E4ZMR8_LEPMJ/666-1245ARVHPEPWPSYFELRDAESNFNPESAD...A.....FGIAQKWGLRAKVASFADEQLTVSDLAVKVHGVHG.GATCDVT.
L8G4R2_PSED2/136-727PRLDSRSWPSFFDPKDGKT......SS...TGEVAALGLPQKWNLTARYCSFAGEALIVEDVSLAILSLNG.GVACSGI.
G9NXZ6_HYPAI/630-1207PRLHPDSWPSLFDYEDVQD...VSEGD.....AVPAKGLTQQWCLVCHYASFATEDLDVLGLDMQVASVTP.GGRCRVI.
T0LUP2_COLGC/632-1210PRLHPDPWPSLFDHEGVQD...PNITD...DAAIQPRGLAQKWCLVCHFASFASEDLEIISMDAEVLSCQN.NARCTTI.
G9MPU4_HYPVG/630-1207PRLHPDPWPSLFDYEDLQD...VSDGD.....VIQARGLAQQWCLVCHYASFATEDLDVVGLDMVVTAVTP.GGRCRVV.
K1XTU1_MARBU/632-1208PRIHPDPWPSLFTHEEVEA.....ATD...PQEVKAQGLAQKWCLTARYASFARDELIVNDVDVEVLGSNG.GIQCYTK.
A1CQK2_ASPCL/664-1261PRLHPEPWPDFFTMDEDSL....EDDA...VAKP..RGLHQRWCLNSKVVSFALEPLIIEKISVVLLNLGS.GAICNIG.
Q0CCQ2_ASPTN/665-1260PRLHPLPWPDFFSVDDDMF....EGQG...TPKP..AGLYQRWCLNSKLVSFALEPLVIEKVSLVLLGIGG.GSTCHIG.
F2PXY2_TRIEC/646-1249PQLHLSPWPDFFNIDESEV.................SNTQQRWLLNSTLMSFAREALVIEDVKLRVVAIEV.GKVCSITT
B6QQY0_PENMQ/649-1238PRIHPDAWPNLFQLD........TDSDGEKADKP..DGLQQRWCVSPKIVSFASEPLVIENVSVGLLEVNG.GAICEIG.
J3P062_GAGT3/633-1226PRLHPDPWPSVFDHEGVQG...LFVDD...SSYVQPRGLFQTWCLVTRYASFASEDLVVVSVDVSIAPTL..GVQTRAS.
U7Q1R6_SPOS1/669-1328PRMHPAAWPSLFDHEGIVATGTPEDAD...AVNRGFHGLTQAWALVTRYASFATEDLRVVDLDLVIQPEPRISVQHTRTD
M2SXX2_COCSN/666-1245ARVHPDPWPSYFELQEAESNMSPESSD...A.....FGIAQKWGLRAKVASFADEHLIVSDLAVEVHSIHG.GATCDVT.
V5G1J1_BYSSN/642-1241PRLHPQPWPNFFRVDEEPG....EESA...TSPP..NGLQQRWCLNSKLVSFAPEPLVVEKVALVLLGING.GANCEIS.
J3K3J3_COCIM/661-1263PRVHPDAWPDFFHLDEPGF....SDES...ESRA..HGLQQRWCLNCKIISFAHEALLIDEVEVTVNGIAG.GLVRQVG.
Q5BDK6_EMENI/657-1255PRLNPLPWPDFFTIDDDLT....ETQP...NTEP..RGLQQRWCLDTKVVSFAREPLVIENMSIAVLSLSG.GAISQVG.
K9FSR4_PEND2/663-1258PAIHPQPWPNFFAVGDTLP....ENSS...APSP..IGLFQRWYLNSKVVSFAVEPLVIDKMSLILLEANG.GAICEVH.
C5GAE4_AJEDR/665-1268PRIHPAPWPDFFHCDDSPS....EDSE...AKEQKLNGLQQLWCLNSKMVSFALEPLIIEEVNVTLLGITA.GNVCKIG.
S3D1H3_GLAL2/625-1196PRIHPDSWPSFFTHEDSTD....ADGS......EVARGLAQKWCLTARYASFATEDLLVEDIDVEVIGMNG.GIQSSTK.
G2X5V0_VERDV/635-1221PRLHPEPWPSLFDFEGTSE...TADRE...ELVTHPRGLAQRWSLVCHFASFATEDLQVVEMEAKVLSCLP.GARGHAA.
E4V6J7_ARTGP/54-658PRLHPAPWPDFFHIDESGV.................SSTQQRWLVSSTLMSFARETLLIEDVKLRSIAIEA.GKVCSITT
H6BX93_EXODN/653-1252PRLDADPWPNFFEAPPSD............SDSASALGLRHRYVMAASICSFAAEPIVIEAILLTATKVVG.GAVCSTS.
E9E0X1_METAQ/607-1181PRLRPEPWPSLFDYEGLHL...VTENE...AAAPPAKGFAQQWCLVCHYASFAMEDLTVLGVELQVVSCTG.GARCTVT.
C0SG01_PARBP/712-1314PRIHPAPWPDFFHYDDSPP....EDDD...AKEPKHDGLQQLWCLNSKMVSFALEPLVIEEVSVVLLSVTA.GNVCKIG.
S8BAM7_PENO1/662-1256PCVHPAPWPDFFSVDDSLI....CDDP...STVP..GGLVQRWCLNSKLVSFAQEALVIEDMSLRLLTLTG.GAVSTIE.
G0RNV0_HYPJQ/637-1222PRLHPDAWPSLFDYEDVQD...LTEGE.....VIPAKGLAQQWCLVCHYASFATEELDVVGLDLLVTGVTP.GGRCQVV.

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247.....KKPVEEPEVE.............IAPQAVQLRTFCVDVQKIALEDRRSSALATSISVTWRRKQPMSPHAEAS...
R7YHS6_CONA1/667-1263..................KESPANTDTVIPQQELREYNFSLEVRKLTLEDRRPVSLDLHLDIKWRRKTGG..........
C5G0L5_ARTOC/657-1267.SDESKQP.EDRS...............IGPEEPLSTDFIVDIERLAIDDRQSAALTFELDIKWRRGISEQDVSIADAPD
G2YB15_BOTF4/638-1224.........RLTAIP.EGG.......IKISPNELEEAQFDAFTQKYSLDDRGTATVDLSLVIKWRRNKDGS.........
M1WIS4_CLAP2/616-1226.........PRPEEG.TKGDDSSDNNITVSPKTMYEAQFHLVAQKLSLDDRQPVTLDLAFIIKWRRQRKTAAAAAAEPSP
C4JTF4_UNCRE/662-1266.PEIHTGNVEAAE...............LHPEQVRESQFILELQRLTLGDRQTTTLNLALEVKWRRQDAEAPSSSAVEL.
H1V6N2_COLHI/632-1214.........TRPEVP.EGG.......LRVPPKQMQEARFDLVAQKFSLDDRGPASLDVAFVLKWRRTKSSTSTA......
B8M738_TALSN/646-1234.PEKLTTP.EAKQ...............ILPEELRTSEFILNVQKISLDDRRSVALDLSLNIEWRRPSSADGDEEI....
M4G065_MAGP6/633-1227.........AKQTLP.KGG.......HTVKPKTIEEVQFDITAQKYSLDERDSVNLDVSLIINWRRAGDEKSS.......
G4NCT1_MAGO7/630-1218.........EANEFP.SEG.......LLVKPKTIEEVKFDITAQRYSLDERDPLSLDVTFMISWRRPSDSDD........
G3JHI1_CORMM/630-1211.........KMTEITEPDG.......LLVEPKTMHEAQFEIEAQKMQLEDRSPVSIDLAFKIKWRRADAAPES.......
E3QU68_COLGM/632-1215.........SGPEVP.EGG.......LRIPPRQMQEAQFDLVAQKFSLDDKGPASLDVAFVLRWRRVKSPSSAAA.....
Q2UPL2_ASPOR/663-1261.PEAIVSP.GGPE...............IYLEELRESSFAVDIHKTVLGDRRPTALNLALEIQWRRSATDESESAMSSN.
G7XKR2_ASPKW/663-1260.SEEIISP.EVAE...............IRPEELRESNFIMDLQKEILGDRRPTALNLALEIRWRRSATDDGALNDGS..
N4VGT4_COLOR/632-1208.........TRPNIP.EGG.......LRVSPKSMHEAQFDLVAQKFSLDDRGPASLDVAFVLKWRRTSSASA........
A6QX66_AJECN/503-1110.TETLKSP.EAPT...............IGPEGLRESEFTMEIQRLALNNRQPSTLNLALDIRWRRPDDDNNDQQSSSSS
S0E618_GIBF5/633-1211.........QGPDVS.QEG.......VIVAPKTMHEAQFDLIAQKLTMEDRHPVTLELAFVIRWQRQNRSDG........
T5AEY3_OPHSC/622-1204.........GRPQVP.EEG.......IVAAPRTMGEAQFHVVVQKLSLDDRHPVAIDTAFIIKWRRKKAGADG.......
C7YM27_NECH7/633-1211.........KGPSVS.PEG.......VVVAPKTMHEAQFDLVAQKLTMEDRHPVTLDLAFVIRWQRQSRDDE........
E4ZMR8_LEPMJ/666-1245.KEFEAGE..................QAMDPQILSEWAFSLDVRKNNLEERRSTALDTTLNITWQRTSIPNA........
L8G4R2_PSED2/136-727......HPLPNTSLG...........LPILPEALAESHFDVLTQKLSLDGRRSASLDLSLLIQWRRDVPES.........
G9NXZ6_HYPAI/630-1207.........SKPEFS.ADG.......MIVAPKTMYEARFDLVAEKVTLDDKHPVAIDLALVVRWRRRRSMDGETG.....
T0LUP2_COLGC/632-1210.........SRPELA.ADG.......LRISPKQMQEAQFNLVAQKYSLDDRGPASLDIAFVLKWRRTSSTSS........
G9MPU4_HYPVG/630-1207.........SQPELS.ADG.......MIVAPKTMYEARFGLVAQKVTLDDRHPVAIDLAFVVRWRRRRQVADGESN....
K1XTU1_MARBU/632-1208.........KLTSIP.STG.......LRVSPKSLDEAQFDTFTQKISLDDRGTATLDVSLAIKWRRSNRDSTSAS.....
A1CQK2_ASPCL/664-1261.PEMVVSA.DEPE...............IRPEELRESNFTLDLQKLVLGDRRPTALNLALEIQWRRSMEDTASPADHTS.
Q0CCQ2_ASPTN/665-1260.PEEVASP.DTPE...............IRPEELRESNFTLDMQKVVLGDRRPTAVNLALEIVWRRSSDESSENTH....
F2PXY2_TRIEC/646-1249ASDSSKEP.GNRY...............IRPEEPQSTDFIVVIERLVMEDRLQTGVSFELEIKWRRDEQQDVLEAEATS.
B6QQY0_PENMQ/649-1238.SERLTTP.EATQ...............ILPEELRASEFILDVQKTSLEDRRSVALDLSLNIKWRRPSSPDQDEH.....
J3P062_GAGT3/633-1226.........GKQMLP.DGG.......RTVKPKTIEEAQFDITAQKYSLDERDPVNLDVSFIINWRRADDQES........
U7Q1R6_SPOS1/669-1328AASHNGNDNGTPQTRDADGA......LTIKPQTMEESRFDLVVQKASLDDRDPVQLDVSFVITWQRLAPPGSPAGSAGSV
M2SXX2_COCSN/666-1245.KEFEISE..................TCMEPQVLSEWSFSLDIRKNNLEERRSTALDTTLNITWQRTSDPSA........
V5G1J1_BYSSN/642-1241.SESLLSP.ETPV...............ISLEELRESEFVLNIQKLSLEDRRSVSLNLALEIQWRRADSEDGPESTST..
J3K3J3_COCIM/661-1263.PGLRKDN.NAAE...............ILPEQVRECDFNIELQRLALDDRQTTTLNLSLDIRWRRQGAEAASSSTIEA.
Q5BDK6_EMENI/657-1255.HEVLVSP.ETRE...............IHPEDLRHSNFVLDIQKIILGDRRPTSLNLALEIQWRRSGEETDDSGRSD..
K9FSR4_PEND2/663-1258.SEELVSP.ETPH...............LAPEELRESNFCLDVQKLVLGDRRPTALTCALEVNWRRQSSGSAAYSDADN.
C5GAE4_AJEDR/665-1268.PETLKSP.ETPT...............IGPEELRESEFAIEIQRHALDDRQASTLNLSLDIRWRRPDDDDGGPQSS...
S3D1H3_GLAL2/625-1196.........RISPLS.EGG.......IKVTPRTLEEAQFDAFTQKLSLDDRGTATLDVTLLIKWRRDVKDS.........
G2X5V0_VERDV/635-1221.........GQPDLP.PAG.......LIIPPKSMQEVKFDLIVQKLSLDDRGPASLDVAFVLHWRRGTADPSS.......
E4V6J7_ARTGP/54-658SSEASKQP.GTRS...............IRLEDPLATDFMVDIERLAVDDRQQTGVTFELEVKWRRDGQQDASEAETAS.
H6BX93_EXODN/653-1252......TGIVRKEDDTQADKDAAAISSIILPDQTQIFDFELTIQKLKLGDRHTVGLDLALEIGWRRQGTE..........
E9E0X1_METAQ/607-1181.........RRTEVA.SDG.......ITISPQTIHEAQFDLVAQKFSLDDRHPVTLDLAFVIKWKRKTASVDS.......
C0SG01_PARBP/712-1314.KEMLKSP.ATPE...............FRPEELRESEFTVEIQRLALDDRSATTVNLALYIRWRRPDSDSDSNTTS...
S8BAM7_PENO1/662-1256.SEVLVSP.EAPQ...............INSEELRESNFFLNMQKISLGDRRPAALNVALDITWHRQSDETDGSSDSESN
G0RNV0_HYPJQ/637-1222.........NQPEFS.ADG.......MPVAPQKMYEARFDLVAQKATLDDRHPVAIDLAFAVRWRRRQRQRQQQPTGGES

PF04628

TPPC2_CHICK/9-136----------FIAHAALDLVDENMWL...........................---.......SNNMYLKT--VDKF...
Q4X1U7_ASPFU/7-185----------FIIHSSLDIVEEAQWM...........................---.......NGNMYLKH--IDTYP..
Q6BW18_DEBHA/13-197----------FLSHMALDIFASPSSTSLR........................---...EQQQDMEENGGA--ILLFI..
Q7QCA5_ANOGA/9-136----------FIAHAALDLIDEHKWK...........................---.......TNNTYLKS--IDKF...
Q57YJ1_TRYB2/2-125----------LTLYASMDLLDDALWK...........................---.......TGDFFLPS--IDKPL..
Q5CFT6_CRYHO/9-137----------FAVYSALDIIERKASGDA.........................---....MEGSLDPYLGY--LGPAISL
Q4CQS2_TRYCC/4-127----------LMLYASLDLLDDVLWK...........................---.......TGDFLLPA--IDRPL..
TRS20_YEAST/7-171----------FILHASLDIVEDLQWQINPTSQLNGNGGNG.....SNGGGGFL---RSRAVNNTDNCYLGK--VDHF...
Q7RCP8_PLAYO/11-149----------FIIHQSLDSVDELVWR...........................---.......NNNMFLKT--VDSF...
Q6FVV2_CANGA/7-168----------FILHASLDIVEDLQWQQNAGTGVAGGA...........GNSFL---RSRNNANTDNCYLGK--VDHF...
Q6BRP5_DEBHA/8-164----------FISNSSLDLIEDIQWS...........................---.......TNQFSLGK--IDSF...
Q5KAA6_CRYNJ/23-186----------MVAHMSLDSVEEVIEG...........................---.......TGALYLKG--VDRH...
TPPC2_DICDI/8-131----------YIAHGSLDIVEEHVWK...........................---.......SNNMYLKI--IDKF...
TPC2L_DICDI/9-139----------YIVHCSLDIIEDKPGSN..........................---....KKLPSDMYLGL--LYPT...
A8X604_CAEBR/10-138----------YIGHAALDIVDEHAFT...........................---.......TTQMYLKM--VDKF...
TPPC2_DROME/8-135----------FIAHAALDLVDEHKWK...........................---.......TANMQLKS--IDRF...
TRS20_SCHPO/7-134----------FIVHSSLDIVDQLQWT...........................---.......SNAFYMKT--IDQF...
Q6CFC6_YARLI/9-134----------SLAYMALDYLGQ...............................---.......QQNENAGT--VSLLY..
Q5A920_CANAL/9-148----------FIANSSLDLIDDQAFT...........................---.......TNVLNLGK--IDQF...
Q651C7_ORYSJ/7-136----------HVVHCSLDVIDERVNNPKR........................---...NAPALNETFLGL--LYPT...
Q4UE14_THEAN/25-171----------FVAHQSLDVIEDLVWN...........................---.......NPNLFLKQ--VDAF...
Q6C760_YARLI/7-139----------FILHAAIDMVEQTASR...........................---.......TNQLYLRT--VDNF...
Q74ZF3_ASHGO/7-174----------FILHASLDIIEDLQWQSTHSASLASSVGNSGSSGGGSFLRSRH---THGGAGAPGSCYLSK--VDNF...
TPC2L_HUMAN/7-138----------YMVHTSLDVVDEKISAMGK........................---...ALVDQRELYLGL--LYPT...
Q6CQN4_KLULA/6-155----------YIVHSTLDIMEYLQWQRQPQLDINTS.............SGGF---LRSRHSTQENSYLGK--VDSF...
Q4PCM0_USTMA/13-185----------YFAHAALDVMDERSGVSS.........................---....SRANSEQYLGL--LYTI...
Q7F8Z0_ORYSJ/9-132----------FILHAALDVVQDLAWS...........................---.......TNAMFLKS--VDRF...

PF04099

Q20100_CAEEL/5-215----------IILSSMFHSLFTIAVQLSP............CQKS........---...----SGVEVLET---------
O77358_PLAF7/1-144----------IRLASMLHGISTISEKINVYSLYEKKT..NIFQSLE.......---..K----KGIETIEG---------
TRS23_SCHPO/1-132----------LVLAGTIHGVHAISTQISP............LPGS........---...----SGIQLLEA---------
Q9VA95_DROME/3-137----------KLTYGMLFSIKSFVSKISPHDPKEG..................---...----..FLYYKT---------
Q9LZ97_ARATH/4-134----------LRVASLWHSMHAISQQLSP............VNGC........---...----SGIELLEA---------
Q9VLI9_DROME/3-209----------IFLASMFYPLFAIASQLSP............EPKS........---...----SGIEILEA---------
Q9AWN0_ORYSJ/33-178----------KLMFGLLFSLRSFTAKIDPTTAEKGNLGVPLLPGQ........---..G----CSFYSFKT---------
TPPC1_HUMAN/3-137----------KLMYGMLFSIRSFVSKMSPLDMKDG..................---...----..FLAFQT---------
TPPC4_MOUSE/3-209----------LMLASMFHSLFAIGSQLSP............EQGS........---...----SGIEMLET---------
Q9SYB8_ARATH/23-168----------KLMFGLLFSLKSLTAKMDPVNADKGNLGVPQLPGQ........---..G----CSFHSFRT---------
A7UW60_NEUCR/3-157----------LVLAGTFHGVHAITARLNPVKSAPERPLSNSIPGVPGGILTRP---EPP----SGLEVLES---------

PF01217

AP3S_SCHPO/1-139----------KLIGDIYAAVSTR...........PPTACNFLE--------------------SNLIAGKN...RIIYRQ
AP1S1_MOUSE/1-142----------KMVRELMQVVLARKPKM................--------------------CSFLEWRD..LKVVYKR
AP2S_YEAST/2-147----------DAIAQIYRLISSRDHKHQ...............--------------------SNFVEFSDS.TKLIYRR
AP2S1_HUMAN/1-142----------KLIEEVHAVVTVRDAKH................--------------------TNFVEFRN..FKIIYRR
AP3S_YEAST/1-160----------LLLEQVYELISQRNSDFQSSFLVTPPSLLLSNE--------------------NNNDEVNNEDIQIIYKN
COPZ1_BOVIN/12-153----------KAFEKNIFNKTHR.TD.................--------------------SEIALLEG..LTVVYKS
AP1S1_YEAST/3-146----------KIVKDLTPTILARKPKM................--------------------CNIIEYND..HKVVYKR

PF09201

C5E0Z1_ZYGRC/1-156----------RFISHLLSSPTIHNEDSS......-----------------------------RKYRIVEIAGNSNTSGG
A7TFS7_VANPO/1-148----------AFISHLVNMPVSKKDDIN......-----------------------------SKLTIINVTQEKST...
G8JRB0_ERECY/1-141----------KFIHTLIAQSIATSN.........-----------------------------SKFPTLSV.........
G0VGX2_NAUCC/1-143----------TFISKIITSPVTQRG.........-----------------------------SKFNILNITNDSLSKSN
G8BTK8_TETPH/1-155----------AFINHLMNSPISKKNDVH......-----------------------------SKFSLVNISPTVGDSSN
Q6CTR2_KLULA/1-140----------RFVSEFISQPVKDVT.........-----------------------------SKFPIIST.........
G0W8F2_NAUDC/1-150----------AFISKLITAPATRDTTTA.....G-----------------------------GKFTILNVTNDSTLSTT
I2GXE9_TETBL/1-153----------AFINQLIVSPATKKDDIT......-----------------------------KKFSVFVVNSSVSSKKS
G8ZVC5_TORDC/1-153----------RFLSQYITSPAPNEETY.......-----------------------------KKYNLLSVSGGLSGPGV
SRPR_YEAST/1-155----------SFISQLITSPVTRKESVANANTDG-----------------------------FDFNLLTINSEHKNS..
C5DM67_LACTC/1-140----------KVISHLITSPSKKEES........-----------------------------GKYLLFKL.........
Q6FSE1_CANGA/1-148----------AVISHLLTSPISRDHGS.......-----------------------------SKYKLLSIPSVSKNA..

PF12584

A8NHA2_COPC7/992-1155----------QPINAELVIRT.TLRWGSDDE..............................SARRHVLN--YHI.EDM--
A7F9J5_SCLS1/1351-1514----------EPIPASLHLKS.TRNWDTAYQDDVA........................SP.EEDLEFV--YEV.TGP--
B2W2H3_PYRTR/1490-1643----------QPLPATLRISH.TRRWATPSLLVSAAS....................IDTP.TDPIDFY--YTI.DAN--
B6H3B0_PENCW/1240-1399----------QMIVAELCLRH.TRRWCSPATREN..........................A.DQPLECS--YEI.HAN--
C5FEM2_ARTOC/1257-1416----------DMIPTELIIRH.TRGWCKVSEREA............................QPSLEFM--YEV.IAN--
C4JLA5_UNCRE/1213-1358----------EALSAELVLHH.TRQWCPKATREA............................QPSLEFM--YEI.ITN--
Q4P224_USTMA/1235-1382----------QPIELTVSIET.STLWSCS................................SHEGEIMV--YDI.VPD--
B8P4P6_POSPM/992-1139----------QPISAVVSVTT.SFHWAPLEDE.............................KPQGCLLR--YDI.EDM--
B0D3E6_LACBS/1015-1161----------QPISANLTIHT.SFHWGSTAQD.............................TGRRYNLR--FNI.EEM--
C4R0Z1_PICPG/1026-1192----------EPIQFALKLKT.DTRWSDMDFGKQESCSELSNDDKETVDKTTGEEKKVELNRNINKKYC--FSLEVQD--
A8PKV5_BRUMA/843-1047----------DACDMIVSLRS.L......................................TNRVETVV--VGI.DAD--
B4HE09_DROSE/978-1138----------TVCNMNLKITK.V.....H................................ENPYTDLM--YEV.LND--
F7CPS6_CALJA/149-377----------SLCSLEVLITRLSDLLEVD.KDEALT......................ESDEHVTTKLM--YEV.VDN--
H3CJ11_TETNG/1022-1246----------LLCKLEVFITRLSEPAEGEMAEESRS......................DLDGLKTTKLM--YQV.ADS--
Q4WSJ6_ASPFU/1252-1410----------QMIAAELVLRH.TRRWSSPETREN...........................AGGTLEFS--YEI.HAN--

PF12742

TPC11_MOUSE/1036-1095-------------------------------------------------------------LQNKTDLVQDVEISVEP..
A2FUL4_TRIVA/291-348-------------------------------------------------------------ARKDSELL....IEVRENS
A2FF60_TRIVA/461-517-------------------------------------------------------------TEKACGII...HIIVDK..
A2EKE8_TRIVA/495-550-------------------------------------------------------------AKTPLDLF....MLVGE..
A2EQW1_TRIVA/476-534-------------------------------------------------------------LPNESELLN.FTLCVEK..
H3CLI1_TETNG/1011-1064-------------------------------------------------------------LVQEVE......MAVEP..

PF07919

K2S4Z6_MACPH/666-1247..........SNVRSVIANPRLIAANSEPRVLASARPS.......SAVPSLIH...LDYTLENPTMHFL-TFDVTMEA--
R7YHS6_CONA1/667-1263..........ASITSSKPCPRFVVPSSEPRVLCTATQSPPTATATSQTPPLIT...LSYTLENPTMHFL-AFELTMEA--
C5G0L5_ARTOC/657-1267PLPPNVSLPPETATTSLAIPRFVIPMSEPRALASLGAT.......TGLPGLIQ...INYTLENPSMHFL-TFSLTMEA--
G2YB15_BOTF4/638-1224..........TINTCIVPVPRLLVSSSEPRVLAAVTYS.......STIPSMIH...FDVTIENPSHHFL-SFAITMDP--
M1WIS4_CLAP2/616-1226ED........EVNTTLMPVGQYLVLGSEPRVLATATMDPLSA...TASSRLLH...LDLTIENPSSHFL-TFGLTMDP--
C4JTF4_UNCRE/662-1266..........FIPTTTLSVPRFVIPMGEPRVLATVTRA.......SALPNFIH...LDYTLENPSIHFL-TFTITMEA--
H1V6N2_COLHI/632-1214..........AVNTTRMLVPRYIVLGTEPRVLASYSLA.......NSQTGLIN...LDVTIENPSSHFL-TFGLGMDP--
B8M738_TALSN/646-1234..........ITTATSLAMPRFMIPMGEPRVLASASAS.......KELPGLIH...LDYTLENPSMHTL-TFSLTMDA--
M4G065_MAGP6/633-1227..........RVNKTTLPVPRLDIFGPEPRVLASVSYARAGVE..RAKLGLVH...LHITIENPSSHFL-TFGTNMEP--
G4NCT1_MAGO7/630-1218..........HVNITKLPVPRLGIFGAEPRVLATVAYPKM.....ESMGDMVQ...LDIMIENASNHFL-TFGLNMEP--
G3JHI1_CORMM/630-1211..........PANTTTLPVGRYLVLGSEPRVLATTFHGE......PDETSTIQ...LDISIENPSNHLL-TFGLTMDP--
E3QU68_COLGM/632-1215..........AVNTTRMLVPRYIVLGAEPRVLASYSLA.......SPLTGLIN...LNITIENPSSHFL-TFGLSMDP--
Q2UPL2_ASPOR/663-1261..........GTTISTLAIPRFVVPGGEPRVLASAMTS.......QIRSGLIH...LDYTIENPSMHFL-TFNLTMEA--
G7XKR2_ASPKW/663-1260..........TTTTTTLDIPRFVMPAGEPRVVASAKAS.......DTLSGLIH...LDYTLENPSMHFL-TFNLSMEA--
N4VGT4_COLOR/632-1208..........PINTTTMLVPRYIILGTEPRVLASYSLA.......NPATGLVH...LDVTIENASSHFL-TFGLTMDP--
A6QX66_AJECN/503-1110..........QSTISTLPIPRFLVPLVEPRVLAHTTPS.......TTLPGFLH...LDYTLENPSMHFL-TFNITMEA--
S0E618_GIBF5/633-1211..........AVNTTTMPVGKYLVLGTEPRVLASVYRATKAE...DGMPGLMQ...LDMTVENPSNHFL-TFGLSMEP--
T5AEY3_OPHSC/622-1204..........PVNTTRLPVGQYLVLGVEPRVLGSVVCETR.....DTWPSLMY...LDITIENPSQHFL-TFGLTMEP--
C7YM27_NECH7/633-1211..........VVNTTTMPVGKYLVLGTEPRVLASAYHNHESE...DGVPGLMQ...LDMTIENPSNHFL-TFGLSMEP--
E4ZMR8_LEPMJ/666-1245..........PVVTSCLPIPRIQIPSSEPRVLASVQYS.......TSVASLVH...LDYTLENPTMHFL-TFEVNMEA--
L8G4R2_PSED2/136-727..........PSNTSTLPIPRLLVASSEPRVLTKLSYSEN.....TTQPMVLH...MEYMIENPSMHFL-TFSVVMEP--
G9NXZ6_HYPAI/630-1207..........PVNVTTMIVGQYMVLGTEPRVLASVLHSS......QEKTGLVR...LDITIENPSSHFL-TFGLAMEP--
T0LUP2_COLGC/632-1210..........TVNTTTMLVPRYIVLGTEPRVLASYTLA.......NPATGLVN...LNVTIENASSHFL-TFGLSMEP--
G9MPU4_HYPVG/630-1207..........AINATTMTVGQYMVLGTEPRVLASVLHSS......QEQSGLVR...LDITIENPSSHFL-TFGLAMEP--
K1XTU1_MARBU/632-1208..........PINTTILAVPRLLVSSSEPRVLAAVSYS.......NKIASMIH...FDVTIENPSNHFL-TFGLTMEP--
A1CQK2_ASPCL/664-1261..........ATTTTTLPIPRFIVPTGEPRILASAVAS.......QTLNGVIH...LDYTLENPSTHFL-TFNLAMEA--
Q0CCQ2_ASPTN/665-1260..........TSTTSTLAVPRFVVPSGEPRVLASAVGS.......NALPGLVH...VDYTLENPSTHFL-TFNLTMEA--
F2PXY2_TRIEC/646-1249...PEISLPTESVVTSLAVPRFSIPMSEPRVLASLGPETSHGN..DGVPGLIQ...LNYTLENPSMHFL-TFNLIMET--
B6QQY0_PENMQ/649-1238..........TSTVTSLAMPRFTIPTGEPRVLASASPS.......KEHPGLIH...MDYTLENPSMHTL-TFSLTMDA--
J3P062_GAGT3/633-1226..........RANKTTLPVPRLDIFGPEPRVLASVSYARAGGD..RAQLGLAH...LHITIENPSSHFL-TFGTNMEP--
U7Q1R6_SPOS1/669-1328APL.......PTNTTTLPVPQLSLFGTEPRVLASVAYSRP.....SAPVPAIQ...LTLAIENASNHFL-TFGVSMEP--
M2SXX2_COCSN/666-1245..........LPVTSSLPIPRIQIPSSEPRVLARSHFS.......PSIPSLIH...LDYVLENPTMHFL-TFELAMEA--
V5G1J1_BYSSN/642-1241..........LSATTPLAIPRFVVPMGEPRILASAISS.......ETIPEFIH...LDYTLENPSLHFL-TFSLTMEV--
J3K3J3_COCIM/661-1263..........FIPTTTLPIPRFVIPMGEPRVLATVMPSS......SAIPGFIH...LNYTLENPSMHLL-TFNITMEA--
Q5BDK6_EMENI/657-1255..........RLTTTKLAIPRFVIPAGEPRVLASAISS.......RKFPGLIH...VEYTLENPSLHFL-TFSLTMEA--
K9FSR4_PEND2/663-1258..........SITTTVLDIPRFVVPMGEPRVLASATSS.......SNMPGLIH...MDYVLENSSTHFL-TFNLVMEA--
C5GAE4_AJEDR/665-1268...........STTSTLPIPRFLLPLGEPRVLASATPS.......PTFPGFLH...LDYTLENPSMHFL-TFNLTMEA--
S3D1H3_GLAL2/625-1196..........PLNISKLAVPRLLVSSSEPRVLAAVSYS.......ATISSMIH...FDVTIENPSNHFL-TFGLTMEP--
G2X5V0_VERDV/635-1221..........PVNTTTMSVPRSIVLGTEPRVLASVSYV.......NAATGLMH...LDVTIENASSHFL-TFGLSLEP--
E4V6J7_ARTGP/54-658...PDITLPLESATTLLAIPRFTIPMSEPRALASLGSKSSSNDSSSSLPGLVQ...VNYTLENPSMHFL-TFNLTMEA--
H6BX93_EXODN/653-1252..........IVNTTVLEVSKLLAPMAEPRVLLTTTDM.......AVDLSEMHTRQLKFTIENPSMHFL-TFNISMEA--
E9E0X1_METAQ/607-1181..........QTSATTMPVGQYLVLGTEPRVLASALYSNP.....TASTNLLH...LDITIENPSNHFL-TFGLSMEP--
C0SG01_PARBP/712-1314...........STTSTLAISRFLVPLGEPRVLASATPS.......PQLPGFLH...LDYTLENPSLHFL-TFNLTMEA--
S8BAM7_PENO1/662-1256..........FSTTTILEVPRFVAAMGEPRVLASASAS.......TSLPGLLH...LDYTLENPSTHFL-TFNLIMEA--
G0RNV0_HYPJQ/637-1222G.........TVNVTTMTVGQYMVLGTEPRVLASVLHSS......PEQAGLVR...LDITIENPSSHFL-TFGLAMEP--

PF04628

TPPC2_CHICK/9-136.----NEWFVSAFAF-VLHMRFIMLHD...........................................VRQEDG----
Q4X1U7_ASPFU/7-185P----ASAYISAFLT-PSGTRFLLLHQPPQLPSTGTAGSGSSLLGSSFSVGGGSSSRASSSSIAANP.TSPQTEEA----
Q6BW18_DEBHA/13-197Q----DDITVYGYET-NTGLKIIVGLGMSQAVPEDKRDDNKSSPT.....PESKDSAQESTKESAKTPSSTKKPMK----
Q7QCA5_ANOGA/9-136.----NQWFVSGFVT-ASHLRFVMVHD...........................................NRNDEG----
Q57YJ1_TRYB2/2-125D----GKYSVSAYVG-FAPIKLLLMKE...........................................HESDKE----
Q5CFT6_CRYHO/9-137S----YEYEIYGFLS-FSHVKIIVVLQ.........................................DHPENEIE----
Q4CQS2_TRYCC/4-127E----GKYYVSAYVG-FAPIKLLLMQE...........................................QEPNKN----
TRS20_YEAST/7-171.----YGLAITAYIS-YSGMKFVMIHGNS....................................ANSSVVIDDNN----
Q7RCP8_PLAYO/11-149.----NNYSVSAYCT-PGHIKLLLLYKNKNELN.............................NSINANMHVPSDDN----
Q6FVV2_CANGA/7-168.----YGLVVTAYLT-YGGKKFVMLHGSSVPG...............................GNKTTTTTIDDSM----
Q6BRP5_DEBHA/8-164.----YGLLINAFIT-QGNIKFLLCYDLNGGNP............................GSGGSNLQSKNEDNS----
Q5KAA6_CRYNJ/23-186.----NEWTVSAFIP-TG.VKFILLHD...........................................VKNDDG----
TPPC2_DICDI/8-131.----NKVQISSFVT-AGHIKFLLLHE...........................................KKDEDA----
TPC2L_DICDI/9-139.----EDYKVYGYLT-NTKIKFIIVVL........................................DTSDIKDSD----
A8X604_CAEBR/10-138.----NEWYVSAFVT-ASRIRFIILHT...........................................HRADEG----
TPPC2_DROME/8-135.----NQWFVSAFIT-ASQIRFIIVHD...........................................NKNDEG----
TRS20_SCHPO/7-134.----HEMYISAYVT-PSNMRFMLLHQ...........................................NQSADN----
Q6CFC6_YARLI/9-134V----HKLAVYGMLT-NTANKIVIGCE..........................................AQEGSES----
Q5A920_CANAL/9-148.----YGLSINAYVL-QSQVKFILCYN...........................................SKEEST----
Q651C7_ORYSJ/7-136.----ENYKVYGYLT-NTKVKFIMVTT.........................................DLDVKDAD----
Q4UE14_THEAN/25-171.----DFLSVSAYVT-CSHANFLLVTRSHNPGSNDFV.....................IYSSNTSPVDPQPPSSDN----
Q6C760_YARLI/7-139.----YSHLVSAFVT-AGDIKIMLLHE...........................................TRNEES----
Q74ZF3_ASHGO/7-174.----YGLSITGYIT-YGNMKFVMIHGTQ....................................NGAPVSVDDGM----
TPC2L_HUMAN/7-138.----EDYKVYGYVT-NSKVKFVMVVDS.......................................SNTALRDNE----
Q6CQN4_KLULA/6-155.----YGLAVSGFLT-YGNIKFIMVHG.........................................NGTVDDTV----
Q4PCM0_USTMA/13-185.----EDLAIYGFQT-CTQLRFLIMLSL.......................................TDHAVRDID----
Q7F8Z0_ORYSJ/9-132.----NDLVVSVYVT-AGHARFMLLHD...........................................SRSEDG----

PF04099

Q20100_CAEEL/5-215-----TQFKLFCLQS-RTGVKFVVITS-------------------------------------------AASNIA----
O77358_PLAF7/1-144-----DGFKIQCYDT-LTGIKIFIVHK-------------------------------------------DDLNIE----
TRS23_SCHPO/1-132-----GTFNMHILQT-HTGMKFVLFTE-------------------------------------------KKT.TN----
Q9VA95_DROME/3-137-----NRYALHYLET-PSGLKFVLNTD-------------------------------------------TTAINV----
Q9LZ97_ARATH/4-134-----DTFDLHCFQS-LPGTKFFVVCE-------------------------------------------PGT.PH----
Q9VLI9_DROME/3-209-----DTFTLHCFQT-LTGIKFIIISE-------------------------------------------TGL.NG----
Q9AWN0_ORYSJ/33-178-----NTYKLNFLES-PSGIKLILITH-------------------------------------------PRTGDQ----
TPPC1_HUMAN/3-137-----SRYKLHYYET-PTGIKVVMNTD-------------------------------------------LGVGPI----
TPPC4_MOUSE/3-209-----DTFKLHCFQT-LTGIKFVVLAD-------------------------------------------PRQ.AG----
Q9SYB8_ARATH/23-168-----NTYKLSFMET-PSGIKIILVTH-------------------------------------------PKTGDL----
A7UW60_NEUCR/3-157-----ENFRLQCFNT-LTGVKFLLFTD-------------------------------------------TTQ.TN----

PF01217

AP3S_SCHPO/1-139Y----ATLYFVFVVD.EGESELGILDL------------------------------------------IQVFVEA----
AP1S1_MOUSE/1-142Y----ASLYFCCAIE.GQDNELITLEL------------------------------------------IHRYVEL----
AP2S_YEAST/2-147Y----AGLYFVMGVD.LLDDEPIYLCH------------------------------------------IHLFVEV----
AP2S1_HUMAN/1-142Y----AGLYFCICVD.VNDNNLAYLEA------------------------------------------IHNFVEV----
AP3S_YEAST/1-160Y----ATLYFTFIVD.DQESELAILDL------------------------------------------IQTFVES----
COPZ1_BOVIN/12-153S----IDLYFYVIGS.SYENELMLMTV------------------------------------------LNCLFDS----
AP1S1_YEAST/3-146Y----ASLYFIVGMTPDVDNELLTLEI------------------------------------------IHRFVET----

PF09201

C5E0Z1_ZYGRC/1-156NKAQSRGFCSMYHVSRRPELYYVVTYA---------------------------------------.EQSLQLNQE----
A7TFS7_VANPO/1-148.....RSFSAMFHISKQPELYFVITYA---------------------------------------.EQSLELNNE----
G8JRB0_ERECY/1-141.....DSHTFMFHETKQPFLYYVVSYS---------------------------------------SSESLELNQE----
G0VGX2_NAUCC/1-143V....RPFCSMFHVTKQPELYFVITYA---------------------------------------.EQTIDLDKE----
G8BTK8_TETPH/1-155SSK..LNFSSMFYISKQPELYYLVTFP---------------------------------------.EQKLDLKNE----
Q6CTR2_KLULA/1-140.....SDTSYMYHETKQPHLFLVVSFA---------------------------------------SSESIQLTAE----
G0W8F2_NAUDC/1-150NAY.SRSFCSMFYKTKQPEIYFVITYA---------------------------------------.EQTIELDKE----
I2GXE9_TETBL/1-153V....KNFCAMFHVNKQPEIYFVVTYA---------------------------------------.ELSLELNRD----
G8ZVC5_TORDC/1-153QGP..RGFSAMFHISKQPELYYVVTYA---------------------------------------.EQSLQLNEE----
SRPR_YEAST/1-155.....PSFNALFYLNKQPELYFVVTFA---------------------------------------.EQTLELNQE----
C5DM67_LACTC/1-140.....DNFAAACFIGKQPPLVYLVTYA---------------------------------------.AQDLELNQE----
Q6FSE1_CANGA/1-148.....KPFTVLSHVSKQPELYFIITYP---------------------------------------.EPSMELNNE----

PF12584

A8NHA2_COPC7/992-1155T----REWLIGGIKQGDFIAEVLLYSR--------------------------------LGKNTMLTTLQNNGKFT....
A7F9J5_SCLS1/1351-1514S----DTWLIGGKRKGHFKVPR.....--------------------------------.......RIDGKNNKLT....
B2W2H3_PYRTR/1490-1643P----DVWLVAGPRRAQFSA.......--------------------------------..........KEDEVME....
B6H3B0_PENCW/1240-1399P----DQWQIGGRRRGNFLA.......--------------------------------..........RDGASTR....
C5FEM2_ARTOC/1257-1416P----ELWVIGGRRRGNFSC.......--------------------------------..........AEGEERR....
C4JLA5_UNCRE/1213-1358P----DTWLVGGRRRGNFSA.......--------------------------------..........EEGEQRR....
Q4P224_USTMA/1235-1382F----ETWLVDGCKRGSFKV.......--------------------------------..........KPNSAPLACDV
B8P4P6_POSPM/992-1139T----GDWLVSGCKRSDFQA.......--------------------------------..........EDGSTFT....
B0D3E6_LACBS/1015-1161V----REWLVSGPKRGDFIA.......--------------------------------..........MDGGIHV....
C4R0Z1_PICPG/1026-1192S----DTWLISGITTFTYEVD......--------------------------------.........FSRGKNITTF..
A8PKV5_BRUMA/843-1047P----CFWTISQKHK.LVHV.......--------------------------------..........KESGLGQ....
B4HE09_DROSE/978-1138Q----NLWAVCGRSAGVVSM.......--------------------------------..........KDVDSHS....
F7CPS6_CALJA/149-377S----SNWAVCGKSCGVISMP......--------------------------------.........VAAQATHR....
H3CJ11_TETNG/1022-1246N----SNWAVCGKSSGLVSMP......--------------------------------.........VATGSSQK....
Q4WSJ6_ASPFU/1252-1410P----ELWLIGGRRRGNFVA.......--------------------------------..........SENETQT....

PF12742

TPC11_MOUSE/1036-1095S----DAFMFSGLKQIRLRI-------------------------------------------------LPGTKQE----
A2FUL4_TRIVA/291-348N----ENFIVCGMTKSNFHM-------------------------------------------------DAGEIRK----
A2FF60_TRIVA/461-517S----SQFAEIGPSEVNTVV-------------------------------------------------WSSKVTQ----
A2EKE8_TRIVA/495-550S----KNFFIKGPNLLPISL-------------------------------------------------LPGEEEI----
A2EQW1_TRIVA/476-534T----PNFFLEGPGKLNFHM-------------------------------------------------WRNQKKE----
H3CLI1_TETNG/1011-1064S----DAFMFSGLKQVRLRI-------------------------------------------------VRGSEQR----

PF07919

K2S4Z6_MACPH/666-1247S----EEFAFAGPKLTALHL-------------------------------------------------LPHSRQT----
R7YHS6_CONA1/667-1263S----EEFAFSGPKAGAVQL-------------------------------------------------LPMSRQD----
C5G0L5_ARTOC/657-1267S----DQFAFSGPKSLAVQL-------------------------------------------------VPLSRHT----
G2YB15_BOTF4/638-1224S----EQFAFSGVKQSTLQL-------------------------------------------------VPLSRRT----
M1WIS4_CLAP2/616-1226S----DSFGFSGPKHTTVHL-------------------------------------------------LPVSRRS----
C4JTF4_UNCRE/662-1266S----DQFAFSGPKSLAVQL-------------------------------------------------VPLSRHT----
H1V6N2_COLHI/632-1214S----DEFAFSGSKQTTVHV-------------------------------------------------LPVSRRS----
B8M738_TALSN/646-1234S----EHFAFSGAKTRALQL-------------------------------------------------VPLSRHT----
M4G065_MAGP6/633-1227N----DDFAFSGSKMGTVHL-------------------------------------------------LPCSRRV----
G4NCT1_MAGO7/630-1218S----EQFAFSGPKLVTTHL-------------------------------------------------LPVSRRK----
G3JHI1_CORMM/630-1211S----DEFAFSGAKQTTLHM-------------------------------------------------LPMSRRT----
E3QU68_COLGM/632-1215S----DEFAFSGSKQTTMHV-------------------------------------------------LPVSRRT----
Q2UPL2_ASPOR/663-1261S----ENFAFSGPKTLVVQL-------------------------------------------------VPLSRHT----
G7XKR2_ASPKW/663-1260S----ENFAFSGPKTMVVQL-------------------------------------------------VPLSRHT----
N4VGT4_COLOR/632-1208S----DEFAFSGAKQTTVHV-------------------------------------------------LPVSRRT----
A6QX66_AJECN/503-1110S----DQFAFHGPKATTLQL-------------------------------------------------VPLSRHT----
S0E618_GIBF5/633-1211S----EDFAFSGSKQTTLSL-------------------------------------------------LPQSRRT----
T5AEY3_OPHSC/622-1204S----DTFAFSGAKQTTMHL-------------------------------------------------LPMSRRA----
C7YM27_NECH7/633-1211S----DEFAFSGAKQTTLNL-------------------------------------------------LPQSRRT----
E4ZMR8_LEPMJ/666-1245S----EEFGFSGPKLRTLHL-------------------------------------------------LPMSRQT----
L8G4R2_PSED2/136-727N----DKFAFSGAKQSTIQL-------------------------------------------------LPLSRRG----
G9NXZ6_HYPAI/630-1207S----DAFAFSGSKQTTMHL-------------------------------------------------LPMSRRT----
T0LUP2_COLGC/632-1210S----DEFAFSGAKQTTMHV-------------------------------------------------LPVSRRS----
G9MPU4_HYPVG/630-1207S----DAFAFSGSKQTTVHL-------------------------------------------------LPMSRRT----
K1XTU1_MARBU/632-1208S----EKFAFSGTKQSTLQL-------------------------------------------------VPLSRRT----
A1CQK2_ASPCL/664-1261S----ENFAFSGPKTMVVQL-------------------------------------------------VPLSRHT----
Q0CCQ2_ASPTN/665-1260S----EHFAFSGPKTMVVQL-------------------------------------------------VPLSRHT----
F2PXY2_TRIEC/646-1249S----DQFAFSGPKSMTLRL-------------------------------------------------VPLSRHT----
B6QQY0_PENMQ/649-1238S----EHFAFSGSKTRALQL-------------------------------------------------VPLSRHK----
J3P062_GAGT3/633-1226S----DDFAFSGSKTATLHL-------------------------------------------------LPCSRRV----
U7Q1R6_SPOS1/669-1328S----ADFAFSGAKLTTIHV-------------------------------------------------LPMSRRA----
M2SXX2_COCSN/666-1245S----ETFGFSGPKLRTLHL-------------------------------------------------LPMSRQT----
V5G1J1_BYSSN/642-1241S----DQFAFSGPKSTTVQL-------------------------------------------------VPLSRHT----
J3K3J3_COCIM/661-1263S----DQFAFSGPKSIAVQL-------------------------------------------------VPLSRHT----
Q5BDK6_EMENI/657-1255S----EYFAFSGPKTMVVQL-------------------------------------------------APVSRQT----
K9FSR4_PEND2/663-1258S----EHFAFSGPKTTVVQL-------------------------------------------------VPLSRHT----
C5GAE4_AJEDR/665-1268S----DQFAFHGPKSTTVQL-------------------------------------------------VPLSRHT----
S3D1H3_GLAL2/625-1196N----EKFAFSGMKQSTLQL-------------------------------------------------VPLSRRT----
G2X5V0_VERDV/635-1221S----EEFAFSGAKQTTLHV-------------------------------------------------LPVSRRA----
E4V6J7_ARTGP/54-658S----DQFAFSGPKSLTVQL-------------------------------------------------VPLSRHT----
H6BX93_EXODN/653-1252S----EDFAFSGPKICAPSL-------------------------------------------------VPISRHT----
E9E0X1_METAQ/607-1181S----DTFGFSGAKQTTINL-------------------------------------------------LPMSRRT----
C0SG01_PARBP/712-1314S----DQFAFHGPKSMALQL-------------------------------------------------VPLSRHT----
S8BAM7_PENO1/662-1256S----EQFAFSGPKTTVVQL-------------------------------------------------VPLSRHT----
G0RNV0_HYPJQ/637-1222S----DAFAFSGPKQTTMHL-------------------------------------------------LPMSRRT----

PF04628

TPPC2_CHICK/9-136--IKNFFN-DVYDLYI---KFAM------------------------------------------------------NPF
Q4X1U7_ASPFU/7-185--VRQFMN-EVYENYV---KTAM------------------------------------------------------NPF
Q6BW18_DEBHA/13-197--LKDLFS-QLHKSYI---HIIC------------------------------------------------------NPF
Q7QCA5_ANOGA/9-136--IKNFFN-EMYETYI---KYLM------------------------------------------------------NPF
Q57YJ1_TRYB2/2-125--TRLFLS-EAYGLCV---RYLM------------------------------------------------------NPF
Q5CFT6_CRYHO/9-137--LRNFFH-NVYKAYV---DSIC------------------------------------------------------NPF
Q4CQS2_TRYCC/4-127--TRQFMN-EVYGLCV---RYLL------------------------------------------------------NPF
TRS20_YEAST/7-171--MRSFYQ-EVHELYV---KTLM------------------------------------------------------NPF
Q7RCP8_PLAYO/11-149--IKSFFE-LVHENYI---KVLL------------------------------------------------------NPL
Q6FVV2_CANGA/7-168--VRSFYQ-EVHELYI---KTIM------------------------------------------------------NPF
Q6BRP5_DEBHA/8-164--IKQFFT-EVNELYV---KCLL------------------------------------------------------NPF
Q5KAA6_CRYNJ/23-186--IRLFFI-DLWEAYV---KILL------------------------------------------------------NPF
TPPC2_DICDI/8-131--IKNFFV-EVHDLYL---KILL------------------------------------------------------NPF
TPC2L_DICDI/9-139--LKLFFK-RLQTLFI---NTTS------------------------------------------------------NPF
A8X604_CAEBR/10-138--IKQFFQ-EMYETYI---KHAM------------------------------------------------------NPF
TPPC2_DROME/8-135--IKNFFN-EMYDTYI---KNSM------------------------------------------------------NAF
TRS20_SCHPO/7-134--IKLFFQ-ELHELYI---KTLM------------------------------------------------------SPF
Q6CFC6_YARLI/9-134--IEQFAK-QVLKVLV---AYKS------------------------------------------------------NPF
Q5A920_CANAL/9-148--IKQFFQ-EVNELYT---KCLM------------------------------------------------------NPF
Q651C7_ORYSJ/7-136--ARNFFR-KFHAAYV---DAVS------------------------------------------------------NPF
Q4UE14_THEAN/25-171--IRYFFR-EVHELYS---KQLM------------------------------------------------------NPL
Q6C760_YARLI/7-139--IRQFFQ-EVHDLYV---KTLL------------------------------------------------------SPF
Q74ZF3_ASHGO/7-174--LKSFYQ-EVHELYI---KTLM------------------------------------------------------NPF
TPC2L_HUMAN/7-138--IRSMFR-KLHNSYT---DVMC------------------------------------------------------NPF
Q6CQN4_KLULA/6-155--TRSFYY-EVYELYL---KTLM------------------------------------------------------NPF
Q4PCM0_USTMA/13-185--MLTLFR-AIYTSYL---KYSA------------------------------------------------------NPF
Q7F8Z0_ORYSJ/9-132--IKSFFQ-EVHELYI---KIFL------------------------------------------------------NPL

PF04099

Q20100_CAEEL/5-215--ADSLLS-KMYELYT---DFAL-----------------------------------------------------KNPF
O77358_PLAF7/1-144--MNTYLK-RVYELYS---DIIL-----------------------------------------------------KNPF
TRS23_SCHPO/1-132--ARLQLQ-KFYELYS---DYVL-----------------------------------------------------KNPF
Q9VA95_DROME/3-137--KELLQQ-LYAKVWV---EFVV-----------------------------------------------------RDPL
Q9LZ97_ARATH/4-134--MESLLR-YIYELYT---DYVL-----------------------------------------------------KNPF
Q9VLI9_DROME/3-209--IDLLLR-KVYELYS---DYVL-----------------------------------------------------KNPF
Q9AWN0_ORYSJ/33-178--RDTLKH-IYN.LYV---EYVV-----------------------------------------------------KNPL
TPPC1_HUMAN/3-137--RDVLHH-IYSALYV---ELVV-----------------------------------------------------KNPL
TPPC4_MOUSE/3-209--IDSLLR-KIYEIYS---DFAL-----------------------------------------------------KNPF
Q9SYB8_ARATH/23-168--RESLKY-IYS.LYV---EYVV-----------------------------------------------------KNPI
A7UW60_NEUCR/3-157--VDVIIR-RIYDLYS---DYVM-----------------------------------------------------KNPF

PF01217

AP3S_SCHPO/1-139--LDRCFN.NVCELDL---VFKF-----------------------------------------------------QEIH
AP1S1_MOUSE/1-142--LDKYFG.SVCELDI---IFNF-----------------------------------------------------EKAY
AP2S_YEAST/2-147--LDAFFG.NVCELDI---VFNF-----------------------------------------------------YKVY
AP2S1_HUMAN/1-142--LNEYFH.NVCELDL---VFNF-----------------------------------------------------YKVY
AP3S_YEAST/1-160--LDRCFT.EVNELDL---IFNW-----------------------------------------------------QTLE
COPZ1_BOVIN/12-153--LSQMLRKNVEKRAL---LENM-----------------------------------------------------EGLF
AP1S1_YEAST/3-146--MDTYFG.NVCELDI---IFNF-----------------------------------------------------SKVY

PF09201

C5E0Z1_ZYGRC/1-156--AEETLQ-VGINLWE---SLGL-----------------------------------------------------SEGV
A7TFS7_VANPO/1-148--AESTLN-LVLALWD---SLDL-----------------------------------------------------NQSI
G8JRB0_ERECY/1-141--AEQVLN-IAIKLWD---SLGL-----------------------------------------------------NDAI
G0VGX2_NAUCC/1-143--AEKTLD-LALKLWD---SLDL-----------------------------------------------------NEEI
G8BTK8_TETPH/1-155--AEETLN-LALSLWD---SLGL-----------------------------------------------------NDSI
Q6CTR2_KLULA/1-140--AESVVV-LATKLWE---SLGL-----------------------------------------------------NEVI
G0W8F2_NAUDC/1-150--AEKTLD-LATKLWN---SLEI-----------------------------------------------------NKSI
I2GXE9_TETBL/1-153--SEELLK-LAIDLWD---SLEL-----------------------------------------------------STSV
G8ZVC5_TORDC/1-153--AAEILR-LSISLWN---SLNV-----------------------------------------------------NEEI
SRPR_YEAST/1-155--TQQTLA-LVLKLWN---SLHL-----------------------------------------------------SESI
C5DM67_LACTC/1-140--AEQVLD-LGFGLWD---SLKL-----------------------------------------------------NNSV
Q6FSE1_CANGA/1-148--AQEVLD-VAIALWD---SLPI-----------------------------------------------------NDII

PF12584

A8NHA2_COPC7/992-1155..LPLTLMALHHGEFGLP-KVHVQPRV.................................................NWRD
A7F9J5_SCLS1/1351-1514..YPIVLIPLREGFLQYP-TVEIKALPSTRGV......................................RPGSSGGGEE
B2W2H3_PYRTR/1490-1643..WDIVLIPLRAGNALMP-NVEVRAKVK..............................................PKDESA
B6H3B0_PENCW/1240-1399..FTVLLLPQKPGHLLLP-GVEIRTFLPPAPQP....................................PTSPPAADAAG
C5FEM2_ARTOC/1257-1416..FQLLLLPQRAGHLLLP-TVDVKSFATGPGHQQPL...............................SPTGGEHLQLDTS
C4JLA5_UNCRE/1213-1358..FSLMLIPQVPGHLLLP-SVEVKSFVSQ.............................................EHPPEA
Q4P224_USTMA/1235-1382FSVTLTIVALRTGRLPLP-TVQVRPLS................................................TVEAA
B8P4P6_POSPM/992-1139..MPVTLIALHHGELSLP-KIAINALP.................................................TQGG
B0D3E6_LACBS/1015-1161..IPITLIALHHGEFSLP-KVTVTALP.................................................MAGD
C4R0Z1_PICPG/1026-1192DEMRFVLIPLKTGQLLLP-KVEIKHGD.....................................................
A8PKV5_BRUMA/843-1047..ISFTVFPKMIGFLPYP-IISVYSCRHKRS.........................................DSDISQLS
B4HE09_DROSE/978-1138..ISLDVMPLSTGFLPMP-SIRLSKYTAG.............................................GKSKTD
F7CPS6_CALJA/149-377..VHMEVMPLFAGYLPLP-DVRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDEQPDSSSLKSRGSVHSVCSSEHKGL
H3CJ11_TETNG/1022-1246..VQIEVMPLFAGHLPYP-RINVLRYLPHTAGVFNQPDPDSCMENDSLSLL.DDQTDTASIRSRGSVHSVGSSEHQQRGI
Q4WSJ6_ASPFU/1252-1410..FAVMLLPQKAGHLLLP-GLEIKSYVPAAPPSTA.................................TTSQPGNLAVGG

PF12742

TPC11_MOUSE/1036-1095--MLYNFYPLMAGYQQLP-SLNI---------------------------------------------------------
A2FUL4_TRIVA/291-348--LIFNFTPLKIGLHKLP-EIRV---------------------------------------------------------
A2FF60_TRIVA/461-517--IPITFIPMVAGSYILP-KITI---------------------------------------------------------
A2EKE8_TRIVA/495-550--IEFSFYAINHGLLYFP-KIFI---------------------------------------------------------
A2EQW1_TRIVA/476-534--IPIKYIPLTTGFLYLP-KINI---------------------------------------------------------
H3CLI1_TETNG/1011-1064--MLYNYYPLMAGYQTLP-QLNI---------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247--VRYNVLPLVKGAWIYP.QLKV-----------------------------------------------------QDRY
R7YHS6_CONA1/667-1263--VKFRILPLVRGAWISP.QLRV-----------------------------------------------------VDRY
C5G0L5_ARTOC/657-1267--VQYSLLATRRGVWIQP.QLIV-----------------------------------------------------VDSY
G2YB15_BOTF4/638-1224--VKFRLLPTVRGEWIGPIRCVI-----------------------------------------------------RDRY
M1WIS4_CLAP2/616-1226--IRYRLLPFVSGDYVRP.GIVV-----------------------------------------------------RDKY
C4JTF4_UNCRE/662-1266--VRYNLLAAGNQKWIQP.QLMV-----------------------------------------------------VDSY
H1V6N2_COLHI/632-1214--VTYRLLPFTRGDYIRP.TLVV-----------------------------------------------------RDKY
B8M738_TALSN/646-1234--VRYNIFAFRSGMWIQP.HLVV-----------------------------------------------------VDTY
M4G065_MAGP6/633-1227--VTYSILPLVRGAWVRP.SLTV-----------------------------------------------------RDKY
G4NCT1_MAGO7/630-1218--VTWRLVPLVRGVWVRP.NLTV-----------------------------------------------------RDKY
G3JHI1_CORMM/630-1211--ATYRLLPYQRGCYIRP.GLVV-----------------------------------------------------RDKY
E3QU68_COLGM/632-1215--ITYRLLPLVRGDYIRP.TLVV-----------------------------------------------------RDKY
Q2UPL2_ASPOR/663-1261--VRYNLLASKRGLWIQP.QLVV-----------------------------------------------------VDTY
G7XKR2_ASPKW/663-1260--VRYNLLASKRGLWIQP.QLLV-----------------------------------------------------VDTY
N4VGT4_COLOR/632-1208--VTYRLLPMVRGDYIRP.SLVV-----------------------------------------------------RDKY
A6QX66_AJECN/503-1110--VRYNLLANVRGKWIQP.QLAV-----------------------------------------------------VDSY
S0E618_GIBF5/633-1211--TTYRLLPHVNGVWIRP.KLTV-----------------------------------------------------RDKY
T5AEY3_OPHSC/622-1204--TRYRLLPLVRGAYLRP.GLVV-----------------------------------------------------RDKY
C7YM27_NECH7/633-1211--TTYRLLPQVSGDYIRP.RLTV-----------------------------------------------------RDKY
E4ZMR8_LEPMJ/666-1245--VCYSLLPLVTATWITP.HLKV-----------------------------------------------------MDRY
L8G4R2_PSED2/136-727--MSFNLLPNVRGEWVRP.QLVV-----------------------------------------------------TDRY
G9NXZ6_HYPAI/630-1207--QTYRLMPLVRGVYVRP.GLVV-----------------------------------------------------RDKY
T0LUP2_COLGC/632-1210--ATYRLLPLVRGAFIRP.SLVV-----------------------------------------------------RDKY
G9MPU4_HYPVG/630-1207--KTYRLLPLTRGVYIRP.GLVV-----------------------------------------------------RDKY
K1XTU1_MARBU/632-1208--VGFRLLPTVRGEWVGPIQCVI-----------------------------------------------------RDRY
A1CQK2_ASPCL/664-1261--VRYNLLASKRGLWIQP.QLIV-----------------------------------------------------VDTY
Q0CCQ2_ASPTN/665-1260--VRYNLLASKRGQWIQP.QLLV-----------------------------------------------------VDTY
F2PXY2_TRIEC/646-1249--LQYSLLATRRGVWIQP.QLVI-----------------------------------------------------VDTY
B6QQY0_PENMQ/649-1238--VRYNIFAFKSGMWIQP.HLVV-----------------------------------------------------VDTY
J3P062_GAGT3/633-1226--VTYSILPLVRGAWVRP.SLTV-----------------------------------------------------RDKY
U7Q1R6_SPOS1/669-1328--TSYRLVPLVRGAWIRP.ALVV-----------------------------------------------------RDKY
M2SXX2_COCSN/666-1245--VRYNLLSSVEGDWITP.NLKV-----------------------------------------------------TDRY
V5G1J1_BYSSN/642-1241--IRYNLLASKRGEWIQP.QLVV-----------------------------------------------------VDTY
J3K3J3_COCIM/661-1263--IQYNLLATGKDKWIQP.QLVV-----------------------------------------------------VDSY
Q5BDK6_EMENI/657-1255--VRYNLLASKRGLWIQP.QLLV-----------------------------------------------------VDTY
K9FSR4_PEND2/663-1258--VNFNLFAAKRGLWIQP.QLVV-----------------------------------------------------IDTY
C5GAE4_AJEDR/665-1268--VRYNLLANVTGTWIQP.QLVV-----------------------------------------------------VDSY
S3D1H3_GLAL2/625-1196--VRFRLLPAIRGDWIGPINCVI-----------------------------------------------------KDRY
G2X5V0_VERDV/635-1221--VTYRLLPLVRGTYVRP.NLVV-----------------------------------------------------RDKY
E4V6J7_ARTGP/54-658--VQYSLLATRRGIWIQP.QLVV-----------------------------------------------------VDSY
H6BX93_EXODN/653-1252--ITYQIFPYKRDQWVAV.QLKV-----------------------------------------------------VDAY
E9E0X1_METAQ/607-1181--ARYRLLPFVQGDYIRP.GLVV-----------------------------------------------------RDKY
C0SG01_PARBP/712-1314--VRYNLLANVRGAWIQP.QLSV-----------------------------------------------------VDSY
S8BAM7_PENO1/662-1256--VRYTILPAKRGLWIQP.QLVV-----------------------------------------------------VDTY
G0RNV0_HYPJQ/637-1222--KTYRLLPLVRGVFIRP.GLVV-----------------------------------------------------RDKY

PF04628

TPPC2_CHICK/9-136Y..........................ELNS............PIR.-SSAFERKVQF-LGKK--------
Q4X1U7_ASPFU/7-185Y..........................RQGM............EIR.-SPVFRARVVA-AGKK--------
Q6BW18_DEBHA/13-197TNLS....................GSLADNE............TILQ-SAKFDKSISK-IVDS--------
Q7QCA5_ANOGA/9-136Y..........................MPNT............PIK.-SLAFEKKAQL-YGKK--------
Q57YJ1_TRYB2/2-125S..........................SLKT............PVR.-A.VLAENLRR-LYQR--------
Q5CFT6_CRYHO/9-137L..............................L..........RTIE.-TPKLIGKIDR-LISN--------
Q4CQS2_TRYCC/4-127S..........................FPNT............PVR.-S.TLGEKVRR-LYER--------
TRS20_YEAST/7-171Y..........................KITD............PIR.-SPAFDSRVRT-LARK--------
Q7RCP8_PLAYO/11-149Y..........................EPNG............IIT.-SSLFDQNVHL-AAKN--------
Q6FVV2_CANGA/7-168Y..........................QEGD............ELR.-SPLFDTRVKA-LAKK--------
Q6BRP5_DEBHA/8-164Y..........................SVND............AIT.-SPDFDMRLKM-LARK--------
Q5KAA6_CRYNJ/23-186F..........................TTNT............PIK.-SPAFEARVKS-IAKR--------
TPPC2_DICDI/8-131Y..........................EYNK............PIT.-STAFDAKVRK-IGTK--------
TPC2L_DICDI/9-139Y..........................KPNS............KVE.-SKKFLQEVTN-LVPS--------
A8X604_CAEBR/10-138Y..........................EIDD............VIE.-SIAFEQKAAL-YGRK--------
TPPC2_DROME/8-135Y..........................RINT............PIK.-SPMFEKKSEI-FGRK--------
TRS20_SCHPO/7-134Y..........................QPNQ............PIR.-SQAFDLKVRS-IARR--------
Q6CFC6_YARLI/9-134Y..........................DETE............TSID-SQGFRKEMAK-VVDK--------
Q5A920_CANAL/9-148Y..........................NVDD............AIV.-SPDFDLKIKQ-LARK--------
Q651C7_ORYSJ/7-136H..........................VPGK............KIA.-SRSFGARVST-IVKS--------
Q4UE14_THEAN/25-171Y..........................VFNT............SLD.-SSNFKSKVHQ-AAKK--------
Q6C760_YARLI/7-139Y..........................FVNQ............PIT.-SPVFDQRIKS-LAKK--------
Q74ZF3_ASHGO/7-174Y..........................KVDE............PIT.-SPTFDWKVKQ-LAKK--------
TPC2L_HUMAN/7-138Y..........................NPGD............RIQS-SRAFDNMVTS-MMIQ--------
Q6CQN4_KLULA/6-155Y..........................KVND............PIS.-NSAFDSKVRV-LSKR--------
Q4PCM0_USTMA/13-185HSLPPAAFAPEKDQQKEDSQARALRLQEESQSRQQSNLAVNCRQIK.-SAAFDARINR-IVFG--------
Q7F8Z0_ORYSJ/9-132Y..........................LPGS............RIT.-SSHFDTKVRA-LAR.--------

PF04099

Q20100_CAEEL/5-215Y--------------------------SIDM------------PIR--AQKFDEAIKT-LLERA-------
O77358_PLAF7/1-144Y--------------------------DIDM------------PIR--SAVFNEQIEK-LFSNI-------
TRS23_SCHPO/1-132Y--------------------------TLEM------------PIK--CQLFDEQLKR-YIDSH-------
Q9VA95_DROME/3-137W--------------------------TPGT------------VVT--SELFQSKLDE-FVRQS-------
Q9LZ97_ARATH/4-134Y--------------------------EIEM------------PIR--CELFDINLTQ-AVQSD-------
Q9VLI9_DROME/3-209Y--------------------------SLEM------------PIR--CELFDNKLQE-LLAQV-------
Q9AWN0_ORYSJ/33-178Y--------------------------APGT------------PIK--CELFNKHLDQ-YVKTL-------
TPPC1_HUMAN/3-137C--------------------------PLGQ------------TVQ--SELFRSRLDS-YVRSL-------
TPPC4_MOUSE/3-209Y--------------------------SLEM------------PIR--CELFDQNLKL-ALEVA-------
Q9SYB8_ARATH/23-168Y--------------------------SPGS------------PIK--SELFNTALDQ-YVRSI-------
A7UW60_NEUCR/3-157Y--------------------------QLEM------------PIR--CDMFDRKLLS-YIRE.-------

PF01217

AP3S_SCHPO/1-139A--------------------------ILAE------------VVSG.GLVLETNLNE-IV.....L..AA
AP1S1_MOUSE/1-142F--------------------------ILDE------------FLMG.GDVQDTSKKS-VLKAIEQADLLQ
AP2S_YEAST/2-147M--------------------------IMDE------------MFIG.GEIQEISKDM-LLERLSILDRLD
AP2S1_HUMAN/1-142T--------------------------VVDE------------MFLA.GEIRETSQTK-VLKQLLMLQSLE
AP3S_YEAST/1-160S--------------------------VLEE------------IVQG.GMVIETNVNR-IVASVDELNKAA
COPZ1_BOVIN/12-153L--------------------------AVDE------------IVDG.GVILESDPQQ-VVHRVALRGEDV
AP1S1_YEAST/3-146D--------------------------ILNE------------MIMCDGSIAESSRKE-VLHHVTVMDTME

PF09201

C5E0Z1_ZYGRC/1-156L-----------------DNI.NGKGSRNER------------NCIDVLTDLEEELEK-FDQYL-------
A7TFS7_VANPO/1-148L-----------------ENM.KGKSGKNEH------------NYCEVLQDLNETIKT-FDKYF-------
G8JRB0_ERECY/1-141R-----------------KNQDHAKSKKNRH------------NYTWLLEGAEDKLLQ-FEQFF-------
G0VGX2_NAUCC/1-143Q-----------------SNL.......KNK------------QHVDILYGMNEDLSK-FDKYL-------
G8BTK8_TETPH/1-155L-----------------QNLKNRTETKNWH------------NYIDLLYGTENDFKK-FKEYF-------
Q6CTR2_KLULA/1-140L-----------------DNI.SGKGKKNVH------------NFRFITEGASDQISK-FGSYF-------
G0W8F2_NAUDC/1-150Q-----------------ENL.......NSR------------DHIDILDGVNDGISK-FDQYF-------
I2GXE9_TETBL/1-153S-----------------ENLNQYKTNANEH------------SQVFILNDMEEDLSK-YDKYL-------
G8ZVC5_TORDC/1-153V-----------------RNL.SGRGSKNEH------------NFTDVVDGLDKDIET-FDKYL-------
SRPR_YEAST/1-155L-----------------KNR.QGQNEKNKH------------NYVDILQGIEDDLKK-FEQYF-------
C5DM67_LACTC/1-140L-----------------QNL.SGKGVKNRH------------NYTWILEGCDSNLNK-FDEYF-------
Q6FSE1_CANGA/1-148I-----------------KAA.KGTGKKNAF------------NCIDISGEISEDIEK-FDNYL-------

PF12584

A8NHA2_COPC7/992-1155I--------------------------TVAS------------QAPP-NVETYQEHGA-VKVLVL------
A7F9J5_SCLS1/1351-1514S--------------------------VKNK------------SRPV-TCETDSKNTG-ETIRII------
B2W2H3_PYRTR/1490-1643K--------------------------KGDE------------AEPL-NCETDYWSYG-DVVVVV------
B6H3B0_PENCW/1240-1399S--------------------------MAPA------------RRSI-PCEVDYRNHG-ETVLVL------
C5FEM2_ARTOC/1257-1416F--------------------------APRQ------------RRAI-SSELDYRSHG-ETILVS------
C4JLA5_UNCRE/1213-1358Q--------------------------HALQ------------RRPI-SSEVEYCNHG-ETVLVT------
Q4P224_USTMA/1235-1382T--------------------------NPKT------------GQLP-TCETYISNAA-QRVNVV------
B8P4P6_POSPM/992-1139P--------------------------RMGS------------SSVP-SCETYQMHGA-EKVLVL------
B0D3E6_LACBS/1015-1161V--------------------------TMGS------------MAVP-SIETYQVHGA-EKVLVL------
C4R0Z1_PICPG/1026-1192.--------------------------...P------------GESL-RYEVDYKNGS-ESILVV------
A8PKV5_BRUMA/843-1047T--------------------------ESTY------------DFGP-QLSSFVRTNG-KQVHVL------
B4HE09_DROSE/978-1138G--------------------------HSKV------------HPFP-PGQVYNSTKS-MQIHVI------
F7CPS6_CALJA/149-377P--------------------------MPRL------------QALP-AGQVFNSSSG-TQVLVI------
H3CJ11_TETNG/1022-1246A--------------------------MPRL------------DSFG-PGEVFNHSHM-QQVLVL------
Q4WSJ6_ASPFU/1252-1410A--------------------------PSLQ------------RRQI-PSEVDYRNHG-ETVLVL------

PF12742

TPC11_MOUSE/1036-1095-----------------------------------------------------------------------
A2FUL4_TRIVA/291-348-----------------------------------------------------------------------
A2FF60_TRIVA/461-517-----------------------------------------------------------------------
A2EKE8_TRIVA/495-550-----------------------------------------------------------------------
A2EQW1_TRIVA/476-534-----------------------------------------------------------------------
H3CLI1_TETNG/1011-1064-----------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247F--------------------------NKIL------------KPAP.TEGMRQDKKG.VAVWAD------
R7YHS6_CONA1/667-1263F--------------------------GKVL------------KVLP.TEGLRADKGA.VGVWVD------
C5G0L5_ARTOC/657-1267Y--------------------------NKTL------------HVLP.TDGMRTDEKG.LLVWVD------
G2YB15_BOTF4/638-1224F--------------------------QKVL------------KIAP.TEGMKSDKEG.LLIWVP------
M1WIS4_CLAP2/616-1226F--------------------------QKVL------------RIIP.TEAMKIDKDG.LLVWVP------
C4JTF4_UNCRE/662-1266Y--------------------------NKTL------------RVLP.TEGMRADKKG.ILVYTA------
H1V6N2_COLHI/632-1214F--------------------------QKVL------------RIIP.TEGMKIDKDG.LLVWIP------
B8M738_TALSN/646-1234F--------------------------NKTL------------RVLP.TEGMRADKKG.ILVWVD------
M4G065_MAGP6/633-1227F--------------------------QKVL------------RVIP.TEGMKLDKEG.FLVWIP------
G4NCT1_MAGO7/630-1218F--------------------------QKLL------------RVIP.TAGMKLDKEG.FLIWIP------
G3JHI1_CORMM/630-1211F--------------------------QKVL------------RIIP.TEGMKIDKDG.LLVWVP------
E3QU68_COLGM/632-1215F--------------------------QKVL------------RIIP.TEGMKIDKEG.LQVWIP------
Q2UPL2_ASPOR/663-1261F--------------------------NKTL------------RVLP.TEDMRSDKKG.PLIWVD------
G7XKR2_ASPKW/663-1260F--------------------------NKTL------------RVLP.TEDMRSDKKG.ILVWVD------
N4VGT4_COLOR/632-1208F--------------------------QKVL------------RIIP.TEGMKIDKEG.LLVWIP------
A6QX66_AJECN/503-1110F--------------------------NKTL------------RVLP.TEGMMGDKKG.ILVWVD------
S0E618_GIBF5/633-1211F--------------------------QKVL------------RIIP.TEGMKIDEEG.LLVWVP------
T5AEY3_OPHSC/622-1204F--------------------------QKTL------------RVIP.TEGMKIDKDG.LLVWVP------
C7YM27_NECH7/633-1211F--------------------------QKVL------------RIIP.TEGMKIDKDG.LLVWIP------
E4ZMR8_LEPMJ/666-1245F--------------------------NKTL------------KVQA.TEGLRMEKKG.VGVWIP------
L8G4R2_PSED2/136-727F--------------------------QKVL------------KVAP.GDGMKSDKEG.ILIWIP------
G9NXZ6_HYPAI/630-1207F--------------------------QKVL------------RVIP.TEGMKIDKDG.LLVWIP------
T0LUP2_COLGC/632-1210F--------------------------QKVL------------RIIP.TEGMKIDKDG.LLIWIP------
G9MPU4_HYPVG/630-1207F--------------------------QKVL------------RVIP.TEGMKIDKDG.LLVWIP------
K1XTU1_MARBU/632-1208F--------------------------QKVL------------RIAP.TEGMKSEKEG.LLVWVP------
A1CQK2_ASPCL/664-1261F--------------------------NKTL------------RVQP.TEEMRSDKKG.ILVWVD------
Q0CCQ2_ASPTN/665-1260F--------------------------NKSL------------RVLP.TEDMRSDKKG.IWVWVD------
F2PXY2_TRIEC/646-1249F--------------------------NKTL------------RILP.TESIKSDAKG.ILIWVD------
B6QQY0_PENMQ/649-1238F--------------------------NKTL------------RVLP.TEGMRADKKG.ILVWVD------
J3P062_GAGT3/633-1226F--------------------------QKVL------------RVIP.TEGMKLDKEG.FLIWIP------
U7Q1R6_SPOS1/669-1328F--------------------------QKVL------------RILP.TEGMKMDKDG.ILIWVP------
M2SXX2_COCSN/666-1245F--------------------------NKTL------------KVQG.TEGMRGDKKG.VGIWVP------
V5G1J1_BYSSN/642-1241F--------------------------NKTL------------RILP.TEGMRSDKRG.ILIWVD------
J3K3J3_COCIM/661-1263Y--------------------------NKTL------------RVLP.TEGMKADKKG.ILIHIA------
Q5BDK6_EMENI/657-1255F--------------------------NKSL------------RVLP.TEDMRSDKKG.ILIWVD------
K9FSR4_PEND2/663-1258F--------------------------NKTL------------RVLP.TGDVKSDKKG.ILVWVD------
C5GAE4_AJEDR/665-1268F--------------------------NKTL------------RVLP.TEGMRGDKKG.ILVWVD------
S3D1H3_GLAL2/625-1196F--------------------------QKTL------------KIAP.TEGMKMDKEG.ILIWVP------
G2X5V0_VERDV/635-1221F--------------------------QKVL------------RIIP.TEGMKIDKEG.LLLWVP------
E4V6J7_ARTGP/54-658Y--------------------------NKTL------------HVLP.TEGMRSDAKG.ILIWAD------
H6BX93_EXODN/653-1252F--------------------------GQTL------------KVLPGGEGVKVDKKGNLLVKV.------
E9E0X1_METAQ/607-1181F--------------------------QKVL------------RIIP.TEGMKIDKDG.LLVWVP------
C0SG01_PARBP/712-1314F--------------------------NKSL------------RVLP.TEGMRADKKG.IFVWVD------
S8BAM7_PENO1/662-1256F--------------------------NKTL------------RVLP.TGEMRSDKKG.ILVWID------
G0RNV0_HYPJQ/637-1222F--------------------------QKVL------------RVIP.TEGMKIDKDG.LLVWVP------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window