Sequence alignment for CL0212

PF04628

TPPC2_CHICK/9-136----------------------------------------------------------------------------IVGH
Q4X1U7_ASPFU/7-185----------------------------------------------------------------------------ILSP
Q6BW18_DEBHA/13-197----------------------------------------------------------------------------LISR
Q7QCA5_ANOGA/9-136----------------------------------------------------------------------------IVGH
Q55XF0_CRYNB/19-171----------------------------------------------------------------------------ILSP
Q57YJ1_TRYB2/2-125----------------------------------------------------------------------------VVGP
Q5CFT6_CRYHO/9-137----------------------------------------------------------------------------IVDR
Q4CQS2_TRYCC/4-127----------------------------------------------------------------------------VIGP
Q5B584_EMENI/11-172----------------------------------------------------------------------------VIGK
TRS20_YEAST/7-171----------------------------------------------------------------------------IIGK
Q7RCP8_PLAYO/11-149----------------------------------------------------------------------------IIGK
Q6FVV2_CANGA/7-168----------------------------------------------------------------------------IIGD
Q6BRP5_DEBHA/8-164----------------------------------------------------------------------------IIGT
Q5KAA6_CRYNJ/23-186----------------------------------------------------------------------------VVSP
TPPC2_DICDI/8-131----------------------------------------------------------------------------IIGK
TPC2L_DICDI/9-139----------------------------------------------------------------------------IVGK
A8X604_CAEBR/10-138----------------------------------------------------------------------------IIGH
TPPC2_DROME/8-135----------------------------------------------------------------------------IVGQ
TRS20_SCHPO/7-134----------------------------------------------------------------------------IIGT
Q6CFC6_YARLI/9-134----------------------------------------------------------------------------IISR
Q5A920_CANAL/9-148----------------------------------------------------------------------------IIGT
Q651C7_ORYSJ/7-136----------------------------------------------------------------------------VVGH
Q4UE14_THEAN/25-171----------------------------------------------------------------------------IVGK
Q5DDE1_SCHJA/12-164----------------------------------------------------------------------------VISD
Q6C760_YARLI/7-139----------------------------------------------------------------------------IVGT
Q8IE05_PLAF7/20-159----------------------------------------------------------------------------IIGK
Q74ZF3_ASHGO/7-174----------------------------------------------------------------------------IIGH
TPC2L_HUMAN/7-138----------------------------------------------------------------------------VIAK
Q6E4A0_CYNDA/9-133----------------------------------------------------------------------------IVSK
Q5DCH5_SCHJA/9-138----------------------------------------------------------------------------ICGP
Q6CQN4_KLULA/6-155----------------------------------------------------------------------------IIGT
Q4PCM0_USTMA/13-185----------------------------------------------------------------------------IVSP

PF04099

Q20100_CAEEL/5-215-----------------------------------------------------------------------IQHLFIINR
Q9P3N1_NEUCS/3-158-----------------------------------------------------------------------VFSLVIINK
O77358_PLAF7/1-144-----------------------------------------------------------------------MYSLYVNNQ
TRS23_SCHPO/1-132-----------------------------------------------------------------------MHALIIINR
Q9VA95_DROME/3-137-----------------------------------------------------------------------IFNLYIFDK
Q9LZ97_ARATH/4-134-----------------------------------------------------------------------IYSLYIINK
Q9VLI9_DROME/3-209-----------------------------------------------------------------------IYGVYIVSK
Q9AWN0_ORYSJ/33-178-----------------------------------------------------------------------AQVLYVFNR
TPPC1_HUMAN/3-137-----------------------------------------------------------------------VHNLYLFDR
TPPC4_MOUSE/3-209-----------------------------------------------------------------------IFSVYVVNK
Q9SYB8_ARATH/23-168-----------------------------------------------------------------------AHMMYVFNR

PF01217

AP3S_SCHPO/1-139----------------------------------------------------------------------MIYAVFIFNN
AP1S1_MOUSE/1-142----------------------------------------------------------------------MMRFMLLFSR
AP2S_YEAST/2-147----------------------------------------------------------------------AVQFILCFNK
AP2S1_HUMAN/1-142----------------------------------------------------------------------MIRFILIQNR
AP3S_YEAST/1-160----------------------------------------------------------------------MIHAVLIFNK
COPZ1_BOVIN/12-153----------------------------------------------------------------------TVKAILILDN
AP1S1_YEAST/3-146----------------------------------------------------------------------QLKYLLLVSR

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240-----------IVLKD.KDVASC..-............................ISTSFTFISS.RGNVGELLEGQLVLR
Q17IT4_AEDAE/569-1266-----------IKLDL.DRLNDL..-............................LECKITFDQR.QIKNDEKLCLQLYVR
B4N3P6_DROWI/571-1279-----------IQIDL.DKVQDV..-............................LQLFATFEQV.QLNNNDLVQIKIIVR
A2X8W8_ORYSI/587-1138-----------THLDI.DQISPL..-.........................RIVFLASVAFHDQ.SVKPDSPMLVSVSLQ
B6H784_PENCW/663-1219-----------LILRA.EDVITS..-............................LTASLVFEKS.DGNVGEPLHAQLAIT
B8C9G3_THAPS/960-1719-----------SEGEI.RQSQTNAW-SADHSDAATSFSREIVWTDDDSGVAKPPFEFAVTFLESTHATSSDSVLVCVSVK
B0WFL7_CULQU/525-1276-----------IKLDL.DRLNDL..-............................LECKVTFEQR.QIKNDEKLHLQLYIR
A4S1A2_OSTLU/578-1070-----------PTITCEDNLSHT..-............................FILKAGFSTS.DCVPGEPVKFHVALR
A5DBY9_PICGU/617-1163-----------DKLSLTINSLSV..-.................................NYQKIDGQGKGNMKKVVVTHA
B4IX46_DROGR/568-1290-----------IQIDL.DKVSDV..-............................LELYATFQQI.QLNNNDVLQLQLIVR
B3DLV7_XENTR/577-1097-----------FTIEV.QEFVPF..-............................VQCKAKFLSP.TFHVDSPVELHVYLR
Q54KR2_DICDI/821-1497-----------LDINM.DHVHPL..-............................LDCRVQFPSS.FTFTNSTTEFYVVIG
A4HUB1_LEIIN/384-917-----------VVLEYPKGRLQS..-...........................PFTAVAYFDEESAKVVGDSARVVVTLY
A1CQK2_ASPCL/664-1234-----------VVLKA.EDVISC..-............................VTATFVFEKS.EGNVGEPLKGQLILT
Q57YW4_TRYB2/511-1059-----------F.LSY.PHKGYYA.-...........................PFNIFCGF.SE.VHGDDSMHELVMVFR
TPC11_DANRE/577-1097-----------FTIDV.QDYVPF..-............................VQCKAKFLSP.SFHIDEPVQLHVYVR
B0D8K9_LACBS/629-1224-----------ALVVDLSEAQPI..-............................FDSSVIFWTP.EINVRESSAFQISLA
Q0CCQ2_ASPTN/665-1233-----------IVLKA.EDIISC..-............................VTASFVIQNA.EGNVGEPLSVQLVIR
A8N717_COPC7/639-1200-----------VLVYDFEDTLPI..-............................FETSVAFWDT.EVHVSQPAAFQLSLS
A5B032_VITVI/377-937-----------LHLEI.DLVSPL..-.........................RVVFLASVAFHEQ.IVKPGAPTLIMLSLL
B3M5T6_DROAN/568-1287-----------IQIDL.DKVVDV..-............................VEMCATFDRV.QLNNDDVLQLQIIVR
B3S6B6_TRIAD/573-1077-----------FDIDI.SQLASF..-............................VECKVSFGTS.SFTADVPIIINVYLR
B7P2U2_IXOSC/583-1086-----------QNLDM.DHII....-..............................QSVYNTDVPAKVLSCPFTHFLASR
Q4D1A2_TRYCC/511-1062-----------FSLSY.PRRGHFA.-...........................PFTILCRFQDE.HHVCATKTEIHVSLF
P90984_CAEEL/775-1075-----------LQLDFKRKEQKH..-...........................AEAAAVLFVEQ......DGTELKSEFS
A9V4M9_MONBE/1582-1761-----------LELRG.........-..............................................AEVQPGIK
B2VQZ9_PYRTR/662-1229-----------VSLNV.KDHLSC..-............................LHTSFAFSEA.EGNVGEPLQCQIAIT
A2QPY0_ASPNC/663-1233-----------VVLRA.EDIVPS..-............................VTASFVFQSS.EGNVGEPSKGQLIIA
C4JTF4_UNCRE/662-1239-----------VVFKEDEEVVPC..-............................LSASFAFERS.EGNVGEPLLAQLVIT
Q2GSS2_CHAGB/391-959-----------VSIRD.GQLVSF..-............................ISASFVFQNE.EGKAGQSVRGQLSIK
Q7Q5C6_ANOGA/565-1322-----------IKLDL.DRLNEL..-............................VECRLTFEKR.QIKNDEKLQLLLYIR
C0SG01_PARBP/712-1287-----------AVLRG.EDTVSC..-............................ITASFSFEKS.EGNVGEPLKSQLIIR
Q8L614_ARATH/276-832-----------LHLEI.DLVSPL..-.........................RPVLLASVAFHDQ.MIKPHALCSFTLSLL
TPC11_BOVIN/577-1097-----------FTIGV.QDFVPF..-............................VQCKAKFHAP.SFHVDVPVQFDVYLK
Q4N165_THEPA/627-1297-----------PEILL.KLSNLSV.-....................PKYNPKNQLNSGSAYMAVYKLVLIKSLITFISIS
Q6CF42_YARLI/694-1263-----------VSYVP.........-............................FKANFCFEQS.EFHLKVPGRCQLTFT
Q7S6A3_NEUCR/636-1264-----------INIAD.GQIIPP..-............................VSATFVFRDE.EGKAGQTTRAQLCLH
Q5AH80_CANAL/196-781-----------TKIVININQIDI..-...........................HFSRIDEKKKS..KENSHPGIKNISIT
Q2UPL2_ASPOR/663-1234-----------VVLRA.EDIISS..-............................VTASFTFERP.EGNVGEPLHGQLVIT
B9WKD3_CANDC/668-1247-----------TKIIININQIDI..-...........................HFSRIDEKKKNIKKKNSRPGIKNISIT
B6QQY0_PENMQ/649-1211-----------IVLKA.EDVVTC..-............................LSAAMVFQRG.EGNVGQALQLQLAIT
A6QX66_AJECN/503-1083-----------VILKG.EDSVSC..-............................LAASFVFAKS.EGNVGEPLQSQLVIR
Q0UML5_PHANO/649-1218-----------VQLDA.KDSISC..-.............CKYVSKKRNGFANQVVSTSFAFSGI.EGNVGEPLRSQIVIR
A6S8E4_BOTFB/493-1052-----------IVLHA.EEVQSF..-............................LTASYAFEKS.EGKVGEHSLSQLAIR
B9I0K4_POPTR/546-1104-----------LHLEI.DLVSPL..-.........................RLVLLASVAFHEP.VIKPGASTSITVSLL
B9T2L8_RICCO/584-1142-----------LHLEI.DLVSPL..-.........................RMVLLASVAFHEQ.IIKPGVPTLLTLSLL
A1D3G8_NEOFI/665-1235-----------VALKA.EDVISS..-............................LTATFVFEKS.EGNVGEPLMGQLTIT
A2EKE8_TRIVA/370-552-----------VWAKF.........-.......................................KYLLPWKCSIESVLI
Q4SVC2_TETNG/484-996-----------LTIEV.QDYIPF..-............................IQCKAKFLAP.SFHVDQAVTLLVYLR
A3LPF0_PICST/628-1173-----------YSALINIKSIIV..-.................................KFERSDSKKTKRNKKVKLIHD
Q5BDK6_EMENI/657-1228-----------IVIKA.EDVVSS..-............................VTATFIFQKA.EGNVGEPLQCQLVLR

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138ME...PGVS..IESGSAIRVAVLPVGGPISPARLRDYAALVARH.ARVDLASLRPYYSEHQKSPFAHQPWGGGCLRLKFV
TR120_SCHPO/1-1173MEF..DFFS..FVAPSRVQSLVLPF.GRVRRKSFSSYLQLLRRV.SHIQLSDVPVATATRKSSSFNPLAFPLGRLVYNFL
A3GI78_PICST/1-1320M...STVYG..YTTPANVKTLLVPI.NKCTSTQFNRHLQVLPPDMHEVRLLDL...SPNTDLQYFNPQTFPNGRIFLDLH
B9HAT3_POPTR/1-113ME...PDVS..IETFSMIRIAILPI.GKIPHQTLRDYYSMFLHQ.HTIPLSSISSFYTEEQKSPFTNQPWDTGSLRFKFI
Q5ACN8_CANAL/1-1244M...WDKYN..FITPAKVRVLLVPI.NDCTPSNFQRYLHLIQTNVGEVRLLDI...RENNKLHYFNSVTSPQGRIFPEFI
TPPC9_HUMAN/1-1108MSV..PDYMQCAEDHQTLLVVVQPV.GIVSEENFFRIYKRICSV.SQISVRDSQRVLYIRYRHHYP..............
Q6FUK5_CANGA/1-1224MDFLSSNLS..FVNPCKVRTLVVPI.GKWKKRDFLNQFETLRAN.NEVRLLDI...TP.IDCPLFTPQAFPNGRVFYDFT
TR120_YEAST/1-1255MNILKHFPS..YVGPSKIRTLVIPI.GHWTRKEFNNAVQKLSEF.NEIHLSDV...TP.IDSPIFTPQGFPHGKLFFDFL
A9TGF2_PHYPA/1-1085ME...PEVS..VEGGSMIRVAVVAI.GEMPPSQFRDYVEMLVQH.AQIPLSTVSTYYTEHQKSPFSQQLWETGSLLLKFM

PF04628

TPPC2_CHICK/9-136.....HDNPVFEMEFLPPG..KAESKDD.....................................HR-------------
Q4X1U7_ASPFU/7-185.....TDVPLFNIAFGTSK..GGGDGIARFR..............................FPDTAQ-------------
Q6BW18_DEBHA/13-197.....KDVPLYIQSFDIGP..MDSENPQN...................................ANK-------------
Q7QCA5_ANOGA/9-136.....NDNPIFETEFVTVN..KEAKKED.....................................HR-------------
Q55XF0_CRYNB/19-171.....SNTPLYVRSFTSEQ..DEL...........................................-------------
Q57YJ1_TRYB2/2-125.....DDSTLFECEKFSDN..DS...........................................V-------------
Q5CFT6_CRYHO/9-137.....SNQPLFFRTLENES..LDS...........................................-------------
Q4CQS2_TRYCC/4-127.....DDASLFECAKSVDG..ES...........................................T-------------
Q5B584_EMENI/11-172ASDRLKDNPLHISLFPPYL..GSA...........................................-------------
TRS20_YEAST/7-171.....KDNPVYEIEFTNAENPQGFPQD......................................LK-------------
Q7RCP8_PLAYO/11-149.....GDIPIYEADLSING..KKDIS........................................E-------------
Q6FVV2_CANGA/7-168.....HDRPLYEAEFTQGP..QGFVQE......................................IK-------------
Q6BRP5_DEBHA/8-164.....RDNPLYELEFSSFK..TAVSSSTSTNNIAG.......................RSNFPTSVK-------------
Q5KAA6_CRYNJ/23-186.....RDSPLFELAFASAK..PPPPPAAAPPAFPSWAAFAAAADPHDAPPAPAGPLIESRTAQQRDR-------------
TPPC2_DICDI/8-131.....NDNPLYEIEFPITV..QKKE.........................................T-------------
TPC2L_DICDI/9-139.....GNNPLFIQDFSSSI..TDE..........................................N-------------
A8X604_CAEBR/10-138.....SDQPIFEMDFPAGE..RKTKESE....................................GTR-------------
TPPC2_DROME/8-135.....NDNPIYEKEFSTVN..KELRKED.....................................HR-------------
TRS20_SCHPO/7-134.....KDNPVYELEMGPIN..EKLDRSL.....................................NS-------------
Q6CFC6_YARLI/9-134.....ENTPLFIGIYPGEG..ETT..........................................T-------------
Q5A920_CANAL/9-148.....KDNPLYELEFSSFK..SAN..ISTTDNVPG.......................KSQFPQSTK-------------
Q651C7_ORYSJ/7-136.....QNNPLYLQSFTEAD...............................................D-------------
Q4UE14_THEAN/25-171.....DDKPLLIEDLSTPG..RRSDP........................................P-------------
Q5DDE1_SCHJA/12-164.....TNQLLYI....RTA..ECP..........................................D-------------
Q6C760_YARLI/7-139.....EDNPIYTQEFGTYR..QGGDGNSRF................................SPEMK-------------
Q8IE05_PLAF7/20-159.....GDIPLYEADLSINS..KRDIS........................................E-------------
Q74ZF3_ASHGO/7-174.....KDNPIYEVEFISLQ..QSFPPD......................................LK-------------
TPC2L_HUMAN/7-138.....ENYPLYI....RST..PTE..........................................N-------------
Q6E4A0_CYNDA/9-133.....NDIPIYGAEVGSAP..KKEEL........................................A-------------
Q5DCH5_SCHJA/9-138.....HDEALFDLDYNSPG..KTTGGKVD...................................ECL-------------
Q6CQN4_KLULA/6-155.....SDNPIYEAEFTTAK..NTFQPE......................................IK-------------
Q4PCM0_USTMA/13-185.....ISGPIYVRQFSKVQ..SES..........................................K-------------

PF04099

Q20100_CAEEL/5-215-----AGSLIYSWEARTET--PEVEKTYEWPIDVHLEEVDQKAVVVFGEKDGIKLRYYVKSVNGETVSGTRLQLGAQQVN
Q9P3N1_NEUCS/3-158-----AGGLIYNRTFHEGG--...........................................................
O77358_PLAF7/1-144-----HGTLVYQKHFSEEI--...........................................................
TRS23_SCHPO/1-132-----AGSLIFQREFGSS.--...........................................................
Q9VA95_DROME/3-137-----FGTLLHYAEWNRTK--KSG........................................................
Q9LZ97_ARATH/4-134-----SGGLIFYKDCG...--...........................T...............................
Q9VLI9_DROME/3-209-----SGGLIFNLDNNVPR--IEHEKTFTYPLDLVLDYDSKKVSVSFNRKDGINVGHVLVAVNGMPVNGVTLDDGRD...
Q9AWN0_ORYSJ/33-178-----GGVCLLYREWHRPL--RT.........................................................
TPPC1_HUMAN/3-137-----NGVCLHYSEWHRKK--QAG........................................................
TPPC4_MOUSE/3-209-----AGGLIYQWDSYSPR--AEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGKYTADGKE...
Q9SYB8_ARATH/23-168-----NGVCLLYKEWNRPL--HT.........................................................

PF01217

AP3S_SCHPO/1-139-----KGKPRLTKFY.TPI-------------------------------------------------------------
AP1S1_MOUSE/1-142-----QGKLRLQKWY.LAT-------------------------------------------------------------
AP2S_YEAST/2-147-----QGVVRLVRWFDVHS-------------------------------------------------------------
AP2S1_HUMAN/1-142-----AGKTRLAKWY.MQF-------------------------------------------------------------
AP3S_YEAST/1-160-----KCQPRLVKFY.TPV-------------------------------------------------------------
COPZ1_BOVIN/12-153-----DGDRLFAKYYDDTY-------------------------------------------------------------
AP1S1_YEAST/3-146-----QGKIRLKKWY.TAM-------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240SDSRRTSAPIYLSEVKITF--EGCLPPIRILADD.....DAEASEASHTLSSVVLGDAVSVPSDDQTPKACTE......M
Q17IT4_AEDAE/569-1266SIV...EVPLKLKNFSVLL--TDLKSSAVRVPAI............................QYCEYA..PNEDIPEGAL
B4N3P6_DROWI/571-1279VLT...DVPLRIRSFHVLL--SDVAQPQN.SFKL..............EALKYVCFSNLLELR...QAKDSTTI...DLR
A2X8W8_ORYSI/587-1138SHL...PCPVMIDKLEVQF--NQSDCNFVIVSAQ.................................EDCSASNSHVHDG
B6H784_PENCW/663-1219SCAHKFSAPIRLSEVKLVF--EGCLRPVKVQSDQ.....NQDADTTTSCCIATLPLREP.SNAD.TAVQSPAG..GLTAL
B8C9G3_THAPS/960-1719SCL...NFPVFVDSVQLNT--TAGCFPISNLEHCADKSLMQSWLKSQNESKNDGFQSSTDKGIQFQSKDLSFFFSEIKVP
B0WFL7_CULQU/525-1276SIV...EVPLKLKNFSILL--SDLKSNSVRVPAT............................QYGDFEDPQN......AL
A4S1A2_OSTLU/578-1070SNF...AGDLDVTHIDVDF--TEL...................................................DAYEL
A5DBY9_PICGU/617-1163P.....SSNPDLCPMIPDL--KDEDETLEGSVNL..............................................
B4IX46_DROGR/568-1290VIT...DVPLRIRSFHVLL--ADASNPQNTSYKL..............EALKYLCFSDLLHLRAAQQQQQQAQLL..EPK
B3DLV7_XENTR/577-1097TDC...PHPIRFSKLCIGF--SNQEYNQFCVVEE....................................QYHASEILEQ
Q54KR2_DICDI/821-1497SHF...PNPIRFSALKVIF--SEKSYNKSIHDKQ...............................PIQSPINQSTIKRDD
A4HUB1_LEIIN/384-917STS...AACINVDVRMLAL--SSGTVAGATETQV............................................PF
A1CQK2_ASPCL/664-1234SCAQRSSDPIRLSEVKIVF--EGCLRPLKIQADQ.....DVNADAKTPCIISSLTLREP.TSADSTSLNSPTI..GLTAL
Q57YW4_TRYB2/511-1059THS...IDNVNVDSLCVNL--SRMRDNKLDSWAK............................................QT
TPC11_DANRE/577-1097ADC...PHPVRFSKLCVSL--SNQEYNQYCLLED....................................AYKGKDILEP
B0D8K9_LACBS/629-1224APTCRTIKSIPFSSLAVFI--QDRVSPLIIRHSP....................SDADPPLLGVVNLGHISPSDDDDLEG
Q0CCQ2_ASPTN/665-1233SCAQPSSAPIRFSAVKVVF--EGCLRPIKLESSD.....DESSDTTSPCTISSISLQEPRLSADVSSLQSPTS..HLETL
A8N717_COPC7/639-1200APPRVVVSSLPITSMEVHF--LGLNEPLVVRHDD......................SEEVVTRPTRVDLGNIKVGDETPS
A5B032_VITVI/377-937SHL...PLTFEIDQLEVQF--NQSHCNFTIINAQ..............................RPPSAAISSSQQGCRV
B3M5T6_DROAN/568-1287VLT...DVPLRVRSFHVIL--ADAANPQN.SYKL..............EALKFFCFPSLTQLRCQQQEREKTGKLPKEPK
B3S6B6_TRIAD/573-1077SSS...PLPIRFHRLSLKF--NIEEYNNVCSIIN...........................................KDT
B7P2U2_IXOSC/583-1086SNC...PLPIKANKLSVHF--NNQHYSSFCVVED..........................................ESAA
Q4D1A2_TRYCC/511-1062TAS...IEMIIVDSLYVVV--SWLSSDGVEDLST............................................YL
P90984_CAEEL/775-1075KSVCEQLGAGEMAKIPVMF--SAQ........................................................
A9V4M9_MONBE/1582-1761SDG................--...........................................................
B2VQZ9_PYRTR/662-1229SNARQGSAPVTLSSLQYQF--NGGLAEVRLTHGE...................QDAAHSASIMYSCTLEETHSTTCKPRW
A2QPY0_ASPNC/663-1233SCAQPSSNPLTFSEVKVVF--EGCLRPIRLQSDR.....NVDADTTTPCTILSPLLRDPSTAEDPSALQSPTS..GLTAL
C4JTF4_UNCRE/662-1239STAHETASAIRLSEVIVAF--EGSLRPIKLQASP.....VAATVSDNQTRISHTMLVDS.QSSDAASIQSPTL.GGTLSM
Q2GSS2_CHAGB/391-959SNAHVGSAPVVLSTVYLSF--DGSLDGIILRHHE.....TATQSQGKAVITTVPLTKQTDNDDPQPTV..PAEVGSGVTL
Q7Q5C6_ANOGA/565-1322SLT...EVPLKLKNFSILL--TDLKSSSVRINAS............................QYAEYAGPPTTDSSTGSA
C0SG01_PARBP/712-1287SCAHAGSAPIRLTEVKIGF--EGSLRPIKLLPGG.....DATSSSSFPSEILSVPLQDS.SNADASTVQFSTG..GSPLM
Q8L614_ARATH/276-832SHL...PLPVEIDHLEVQF--NQSTCNFVIRNSQ.............................RPLWASASNTVKSGSQV
TPC11_BOVIN/577-1097ADC...PHPIRFSKLCISF--NNQEYNQFCVIEE....................................ASKASDVLEN
Q4N165_THEPA/627-1297TEE...HDLIDYLNDTINL--FSAHDENELEIDM..............................................
Q6CF42_YARLI/694-1263SQLHRVVSQVTLSTLWLQL--SGTLHPVCIEHDE......................TSLADGAIANLATPSVETRNGSKV
Q7S6A3_NEUCR/636-1264SNAHAESTPIPFRRIEVKF--NGSINTLVLRHQVQEEEGNKRQKHGNIVLCPVPLEDITPSDREPTTEDSAEDDDRGTEL
Q5AH80_CANAL/196-781NDTNKDP.NTSNGLIKLAG--QELDLTFVDSANL..............................................
Q2UPL2_ASPOR/663-1234SCAQRSSSPIRFSEIKIAF--EGCLRPIKLQSNH.....VAETDATTPCTISSPSLREPSTSSDTASLQSPTN..FLTPL
B9WKD3_CANDC/668-1247NDTNKKHCHNDNGIIKLKG--QELDLTFVDSTNM..............................................
B6QQY0_PENMQ/649-1211SHAHQQATPLRLSEVKIVF--EGGLRPITLHAKD......ITDDTNPLSHIYNVKLHDLASSTESSTFLSPTA..HMASM
A6QX66_AJECN/503-1083SCAHAGSSPIRLTEVKVAF--EGNIRPIKLLASE.....NESSSSSSGCEIVPVSLQDS.VNLDASTVQSPTA..GLPQM
Q0UML5_PHANO/649-1218SLARSGSAPVTLSSLVYQF--EGGLNEVHLSHDT.................GKDDPGTDASRSDEVVLEESVVQGQKPSW
A6S8E4_BOTFB/493-1052SSALASSTPVTISEIRIEF--TGSMKPILLRHKA..NTESSETVKSGVLFKKTSLVDESTVEKGHDPDDPPT....RHTL
B9I0K4_POPTR/546-1104SQL...PLPVDIDKLEVQF--NQSECNFVITNSE...............................SPSAAVSSGQQGWRI
B9T2L8_RICCO/584-1142SQL...PVTIDIDQVEVQF--NQSDCNFIILNSQ..............................KPPSAAMSIGLQGRRT
A1D3G8_NEOFI/665-1235SLGQRSSDPIRLSEVKVVF--EGCLRPLKLQSDQ.....NVTADVTSPCTISSLTLREP.TSADSTTLLSPSN..GLTAL
A2EKE8_TRIVA/370-552HPIKEQGESFQIGEFNSTF--P..........................................................
Q4SVC2_TETNG/484-996ADC...PHRISFNKLSVFL--SNQEYNQWCVASS..............................................
A3LPF0_PICST/628-1173GQ....NNSSMISKIELKE--GDESDTLIGTGNL..............................................
Q5BDK6_EMENI/657-1228SCAQKSSVPVRFAELRVAF--EGCLRPIRLQSDQ.....NIDADTSTTCLISSPSLRDPSATSDSSVHQSTTS..ALNAL

PF12584

A8NHA2_COPC7/992-1155--------PVDVPVKDIVA--TA---------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------PVDVPSVTVVH--TA---------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------TVSIPQTHILH--TA---------------------------------------------------------
B6H3B0_PENCW/1240-1399--------PVDVPEVQVVH--TA---------------------------------------------------------
B0XR26_ASPFC/1252-1410--------PVDIPEIQVLH--TA---------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------PVDIPEVQIVH--TA---------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------PVDIPDVQVVH--TA---------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------PVDIPEIQVVH--RA---------------------------------------------------------
Q6CDM8_YARLI/995-1119--------SVPVPQVQIVL--SS---------------------------------------------------------
Q4P224_USTMA/1235-1382--------PVDVPTVDYVN--AV---------------------------------------------------------
A8PWK6_MALGO/1105-1237--------PLDVPFVDAVN--SV---------------------------------------------------------
B8P4P6_POSPM/992-1139--------PVDVPRMHILA--AA---------------------------------------------------------
B0D3E6_LACBS/1015-1161--------PVDVPYMNIVA--AA---------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------SVPIPVLNILQ--II---------------------------------------------------------
A5DA23_PICGU/1047-1195--------AVPAPSLDVLH--SA---------------------------------------------------------
C4YB04_CLAL4/693-833--------SVAVPFLSMLH--QV---------------------------------------------------------
B9WGM9_CANDC/1083-1255--------SVPVPVLKYLQ--IV---------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------DVPMPSIDILH--VV---------------------------------------------------------
A7TMG8_VANPO/967-1085--------PVTLPEFEEFF--YV---------------------------------------------------------
B9SID3_RICCO/54-178--------ILQRPVLDPCL--AV---------------------------------------------------------
A5AE80_VITVI/867-991--------VLQRPVMDPCL--AV---------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------VLQRPVLDPCL--TV---------------------------------------------------------
B7FNC5_MEDTR/160-284--------VLQRPVLDPCL--AV---------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------KMKRPVLDPCV--AV---------------------------------------------------------
A5BYI0_VITVI/102-216--------VLQRPVMDPCL--AV---------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------HLIMPVLEQLV--AV---------------------------------------------------------
B3P0R7_DROER/977-1138--------EHELPVVKVHF--VI---------------------------------------------------------
B0WLN5_CULQU/969-1132--------ESELPVIHVDY--RM---------------------------------------------------------
B4DI17_HUMAN/276-505--------EEPPPSLHCRF--SV---------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------DNLPSCLQCVF--ST---------------------------------------------------------
A8PKV5_BRUMA/526-730--------SLQIPAK..LL--NP---------------------------------------------------------
A8Y1L1_CAEBR/135-260--------ELTVPDVQFEI--CT---------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138LGG...CVPSPWEDFQSSR--KVLAVVGICHLPSSPDLGRGAADVVDAARSDPAARA.SRCFAFC..PTDAQL...VQ..
TR120_SCHPO/1-1173TSL..DDQQALLEEFEYFR--RVFVLIGIVDGSEEQEVEQLCSTLDVWRRRIPHALV.AKCIVFN.CPEDK........E
A3GI78_PICST/1-1320LAA.PEANSIFLHDFEPFR--KTFVVIGVASYTADINVEY...HLENLAKHYPGAIV.HNIIVFD.TPTSEINGL..NRA
B9HAT3_POPTR/1-113LGG...SPPSPWEDFQSNP--...........................................................
Q5ACN8_CANAL/1-1244TSS.IDNELIFLHDFDPFR--KTFIVLGVGPYGQDPSTA.....LVELKKKYNTAIV.HNVILFD.TPEDKLN.......
TPPC9_HUMAN/1-1108......PENNEWGDFQTHR--KVVGLITITDCFSAKDWPQTFEKFHVQKEIYGSTLYDSRLFVFG..LQGEIV......E
Q6FUK5_CANGA/1-1224ISQHADALDLFLYDFEPFR--KIFVIIGLVNDKSDPVDN.....MNILKERYPTVIS.HNLLYTDKSLINSDV......E
TR120_YEAST/1-1255TIDHDDALELFLYDFEPFR--KTFVIIGLVNDYSDPLTN.....LNFMKEKYPTLIS.PNLVYASSTPTKELE......Q
A9TGF2_PHYPA/1-1085VGG...ASKSPWEDFQAHR--KILGVIGLCHLPLTPDISTAYDQFLTICKAYPSAQV.TRCFAFH..PTDVQI..DSDDE

PF04628

TPPC2_CHICK/9-136--------------------HL...NQ-----------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------YM...NQ-----------------------------------------------------
Q6BW18_DEBHA/13-197--------------------YL..KYN-----------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------HL...NQ-----------------------------------------------------
Q55XF0_CRYNB/19-171--------------------....RHY-----------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------NM..SHQ-----------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------.....LH-----------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------HL..SRQ-----------------------------------------------------
Q5B584_EMENI/11-172--------------------..I.DFS-----------------------------------------------------
TRS20_YEAST/7-171--------------------EL...NP-----------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------HL...SQ-----------------------------------------------------
Q6FVV2_CANGA/7-168--------------------EL...NP-----------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------EI...LP-----------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------AL...CQ-----------------------------------------------------
TPPC2_DICDI/8-131--------------------YV...LQ-----------------------------------------------------
TPC2L_DICDI/9-139--------------------KL..KLH-----------------------------------------------------
A8X604_CAEBR/10-138--------------------HL...NH-----------------------------------------------------
TPPC2_DROME/8-135--------------------HL...TQ-----------------------------------------------------
TRS20_SCHPO/7-134--------------------HL...NQ-----------------------------------------------------
Q6CFC6_YARLI/9-134--------------------QLEYDYS-----------------------------------------------------
Q5A920_CANAL/9-148--------------------EL...LP-----------------------------------------------------
Q651C7_ORYSJ/7-136--------------------AL..KLH-----------------------------------------------------
Q4UE14_THEAN/25-171--------------------HL...SS-----------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------PL..FYH-----------------------------------------------------
Q6C760_YARLI/7-139--------------------EL...AP-----------------------------------------------------
Q8IE05_PLAF7/20-159--------------------HL...TQ-----------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------EL...NP-----------------------------------------------------
TPC2L_HUMAN/7-138--------------------EL..KFH-----------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------YQ...HQ-----------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------HL...NQ-----------------------------------------------------
Q6CQN4_KLULA/6-155--------------------EL...NP-----------------------------------------------------
Q4PCM0_USTMA/13-185--------------------AADLRYH-----------------------------------------------------

PF04099

Q20100_CAEEL/5-215VLEYLQEEDHYPVTVKFAAPTVSTNEK-----------------------------------------------------
Q9P3N1_NEUCS/3-158..................LNKISTNDY-----------------------------------------------------
O77358_PLAF7/1-144....................KLNSNEE-----------------------------------------------------
TRS23_SCHPO/1-132..................PTALTPNEY-----------------------------------------------------
Q9VA95_DROME/3-137....................ITREEEA-----------------------------------------------------
Q9LZ97_ARATH/4-134..................KGRMDTNDS-----------------------------------------------------
Q9VLI9_DROME/3-209VRTTLDAPENYPINLKFSRPKMTTNEK-----------------------------------------------------
Q9AWN0_ORYSJ/33-178....................LDPTQDQ-----------------------------------------------------
TPPC1_HUMAN/3-137....................IPKEEEY-----------------------------------------------------
TPPC4_MOUSE/3-209VLEYLGNPANYPVSIRFGRPRLTSNEK-----------------------------------------------------
Q9SYB8_ARATH/23-168....................LNPQQDH-----------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------DESIQ.Q-----------------------------------------------------
AP1S1_MOUSE/1-142--------------------SDKER.K-----------------------------------------------------
AP2S_YEAST/2-147--------------------SDPQRSQ-----------------------------------------------------
AP2S1_HUMAN/1-142--------------------DDDEK.Q-----------------------------------------------------
AP3S_YEAST/1-160--------------------DLPKQ.K-----------------------------------------------------
COPZ1_BOVIN/12-153--------------------PSVKE.Q-----------------------------------------------------
AP1S1_YEAST/3-146--------------------SAGEK.A-----------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240RGNANLSLFAGQTSAVTLTLVPRE.....AGHVRVA--------------------------------------------
Q17IT4_AEDAE/569-1266KPIEEFILEPHKC..YRIVFVGERYQFMENVDVHIF--------------------------------------------
B4N3P6_DROWI/571-1279PFDKNMRLEPNCY..YQLYCTTEAHQFLENTQLRIM--------------------------------------------
A2X8W8_ORYSI/587-1138AVQTPLTLFTDKWMRLTHEVKPGQ.....SGKLECL--------------------------------------------
B6H784_PENCW/663-1219............TKVFDLTCVPRE.....AGEARVA--------------------------------------------
B8C9G3_THAPS/960-1719SDLAEIAL..GKAAVDLSKFFPKNAKLCNMGLVYAA--------------------------------------------
B0WFL7_CULQU/525-1276KPIEEFILEPQKC..YRIVFVGERYQFMENVDVHIF--------------------------------------------
A4S1A2_OSTLU/578-1070SDATPRTLRSNEWLKIDFEVIPKCGYVCEANSLTIT--------------------------------------------
A5DBY9_PICGU/617-1163.........TMNSDTKSSKVVQVFQPCQRAGTYIVS--------------------------------------------
B4IX46_DROGR/568-1290AYEKNMRLEPGCY..YQLMCSTEAHQFNENTQLRIV--------------------------------------------
B3DLV7_XENTR/577-1097STQGTMCLVPGKTRKFTFKFVAKTEDV..GKKIEIS--------------------------------------------
Q54KR2_DICDI/821-1497HSRQDLIFLPDESRLFTFKLEVAKE....KMELECL--------------------------------------------
A4HUB1_LEIIN/384-917SPARCVKLSASCPQELAVDVPLSH.....SGEYVCT--------------------------------------------
A1CQK2_ASPCL/664-1234VGLGDLTLGPSQTKVFNVTSIPRE.....AGESRVA--------------------------------------------
Q57YW4_TRYB2/511-1059SVDRSVELCSCNSSSVSALFDLRE.....PGVYYCS--------------------------------------------
TPC11_DANRE/577-1097SSQENMCLVPGKTRKYCFNFVAKTEDV..GKKIEIT--------------------------------------------
B0D8K9_LACBS/629-1224SRTADLRWTPGSTIVFRGTMSSDV.....PSVLKVT--------------------------------------------
Q0CCQ2_ASPTN/665-1233TGVADLTIGPSQTKVYNLICTPRE.....AGESRVA--------------------------------------------
A8N717_COPC7/639-1200EVSGHLRWGPGSTVVFTGTVSAER.....PSRLTVE--------------------------------------------
A5B032_VITVI/377-937ESTPVLALVMNKWLRLRYEIKSEQ.....SGKLECI--------------------------------------------
B3M5T6_DROAN/568-1287AIEKNMRLEPGSY..YQLLCSTEAQQFHENTQLRIV--------------------------------------------
B3S6B6_TRIAD/573-1077DNEESLLLIPNQLKCVTFKFVARSEDV..GESLEVS--------------------------------------------
B7P2U2_IXOSC/583-1086MSGTSLHLVPRRTQSFFFAFLPRTCDA..NTDIQVS--------------------------------------------
Q4D1A2_TRYCC/511-1062VSDKGLKLSLNTPSSASLTLALDK.....PGTYHCK--------------------------------------------
P90984_CAEEL/775-1075.......LVGDYVLQLELSYKISE.....DGILVTK--------------------------------------------
A9V4M9_MONBE/1582-1761....................................--------------------------------------------
B2VQZ9_PYRTR/662-1229EGVSDLTLHAGQTKVYNFPIVFRE.....SGDVDVG--------------------------------------------
A2QPY0_ASPNC/663-1233IGLADLTFGPTQTKVYDITCIPRE.....AGESRVA--------------------------------------------
C4JTF4_UNCRE/662-1239TGTVDLAFPPGQTKAFNLTCIPRE.....AGKVQVT--------------------------------------------
Q2GSS2_CHAGB/391-959VGSANLTLRPGQTLVLNLEIPLRE.....PGETRVD--------------------------------------------
Q7Q5C6_ANOGA/565-1322KPFEEFILEPEKC..YRVLFVGERYLFAESVDVHIF--------------------------------------------
C0SG01_PARBP/712-1287VGFTNLSFSPGQIRAFNLVSVPRE.....AGDARVA--------------------------------------------
Q8L614_ARATH/276-832ENAPLLVLVPNNWLRLTYAIKSEQ.....SGKLECL--------------------------------------------
TPC11_BOVIN/577-1097LTQGKMCLVPGKTRKFLFKFVAKTEDV..GKKIEIT--------------------------------------------
Q4N165_THEPA/627-1297.MESYVLLSKNVISQYAYKFESERIEVLISFE...T--------------------------------------------
Q6CF42_YARLI/694-1263IVYKANLTFTGATKRFQMTISPET.....LGEAYCT--------------------------------------------
Q7S6A3_NEUCR/636-1264QGTTDLTLSPGHTLVLVMDIPLRE.....QGEVNAL--------------------------------------------
Q5AH80_CANAL/196-781.......SFPREDKDRSHILLQHVQSVTNSGHFQID--------------------------------------------
Q2UPL2_ASPOR/663-1234IGTADLTIGPCQTKVFNVACIPRE.....AGESRVA--------------------------------------------
B9WKD3_CANDC/668-1247.......SFSGDNK....LFLQHIQSVTNSGHYQID--------------------------------------------
B6QQY0_PENMQ/649-1211IGQADLIFKPGETRVFNMTAIPRE.....PGESRIA--------------------------------------------
A6QX66_AJECN/503-1083VGATNLSFGPKQTRAFNLVSVPRE.....PGEAQVA--------------------------------------------
Q0UML5_PHANO/649-1218TGTTDLTIHPGQTKVYNFQLVFRE.....AGDVDIS--------------------------------------------
A6S8E4_BOTFB/493-1052TNYEDLTLSPGQVKAFEFVNLLRE.....AGDAKAL--------------------------------------------
B9I0K4_POPTR/546-1104ESAPSLALVTNKWLRLTYDVKPEQ.....SGKLECI--------------------------------------------
B9T2L8_RICCO/584-1142ETAPSLALVTNKWLRLTYAITSEQ.....SGKLECI--------------------------------------------
A1D3G8_NEOFI/665-1235VGMGDLTIGPAQTKVFNLTSVPRE.....AGDSRVA--------------------------------------------
A2EKE8_TRIVA/370-552....................................--------------------------------------------
Q4SVC2_TETNG/484-996.GEESMHLLPGKSKCFSFSFVAKTEDV..GKKLEVT--------------------------------------------
A3LPF0_PICST/628-1173..........FPNEENGLKIIQFSQTASISGSYHIS--------------------------------------------
Q5BDK6_EMENI/657-1228TGIADLTLGPAQTKVYNLACIPRE.....SGESRVA--------------------------------------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138KKRDNIIMFP.PSDQQSLELHMLTMIQDLSASLLMEFEKW.....VLRAESTGTI.........................
TR120_SCHPO/1-1173NIFNAPNIIIGPRSDFSINSVMRSILCDITAELLEGFSSL.....EFSIHARSVILSPITDMPHLAPLQR..........
A3GI78_PICST/1-1320SDHSAKSVFYHDASSDHNLTALETIICGITQNFLVALDTYAASYTNITLRSPVSITDSYILTKTI...............
B9HAT3_POPTR/1-113.................................................ESSGTI.........................
Q5ACN8_CANAL/1-1244..EQVPEVFFHNGTTSH.LTALETIFCDISGNFLEKLDAYASAYANITLRSPVSITDSHVLTKTI...............
TPPC9_HUMAN/1-1108QPRTDVAFYPNYEDCQTVEKRIE....DFIESLFIVLESK..RLDRATDKSGDKI.........................
Q6FUK5_CANGA/1-1224NQD.ISNIFHYNSDK...LENYETILCDITRNFLVALNHYYSSYKHVTLRSPGAIGGNAVRKTSLL.............M
TR120_YEAST/1-1255TIDTMENVFASSPDM...QKNIETIMCDIARNFLTALNSYYSSYKHVTLRSPGAIGGNAVLKTTLIRQNSYTSSSSSTPM
A9TGF2_PHYPA/1-1085KKKEFLVMFP.TMDRQKLKSHMQILMQDFAASLLMAFESW.....VLHLKPVR...........................

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240-------------------------------------SITLVVA.......................DDKFGLTYTNTNS
Q17IT4_AEDAE/569-1266-------------------------------------RLEMQMG.......................SDRTYAVLSMREK
B4N3P6_DROWI/571-1279-------------------------------------RLEALMG.......................TDQCGALLTSNAN
A2X8W8_ORYSI/587-1138-------------------------------------AVKATIS..........................KRLVVCCQAE
B6H784_PENCW/663-1219-------------------------------------SITMLIE.......................EEQFDLGYAVTEP
B8C9G3_THAPS/960-1719-------------------------------------GNVCEIR.......................VDEDHKQISLNGK
B0WFL7_CULQU/525-1276-------------------------------------RLELQMG.......................SDRTYAVLSAREK
A4S1A2_OSTLU/578-1070-------------------------------------TVS.............................GYELVLPFTTQ
A5DBY9_PICGU/617-1163-------------------------------------SVDVQLVISDVNGSVK..........IIQDKSIIIDALQSRPE
B4IX46_DROGR/568-1290-------------------------------------RMEALMG.......................TDQVGALLTCSAN
B3DLV7_XENTR/577-1097-------------------------------------SVDLILG......................GDAGRCVILNWRGG
Q54KR2_DICDI/821-1497-------------------------------------SVILELGNIGSPTKTINFVWNVQEWAIKSDETEIEKKIKDPSS
A4HUB1_LEIIN/384-917-------------------------------------SLTADVH.......................VGGICATTRWRFA
A1CQK2_ASPCL/664-1234-------------------------------------SITLLID.......................EEKFDLACAITEL
Q57YW4_TRYB2/511-1059-------------------------------------RVQGRVK.......................CGDICLNVEWSFD
TPC11_DANRE/577-1097-------------------------------------SVGLMLG......................RETGRYVYLNWRGG
B0D8K9_LACBS/629-1224-------------------------------------KLTLTIE.....................LNTWKVEIPVPPCSS
Q0CCQ2_ASPTN/665-1233-------------------------------------SVTLLIE.......................EEKFDLACAVRDL
A8N717_COPC7/639-1200-------------------------------------KVLLNLE.....................QNKWKIQMPLSLNMS
A5B032_VITVI/377-937-------------------------------------SVIARIG..........................PHVSICCRAE
B3M5T6_DROAN/568-1287-------------------------------------RLEAHMG.......................TEHVAALLTSSSN
B3S6B6_TRIAD/573-1077-------------------------------------TASLQLG......................DEKSYNIVMTWNTS
B7P2U2_IXOSC/583-1086-------------------------------------SVHLCLG......................SRDPPGLTLVWSFD
Q4D1A2_TRYCC/511-1062-------------------------------------SVRGRVN.......................CAGIQLNVEWKLE
P90984_CAEEL/775-1075-------------------------------------STMLEVG....................................
A9V4M9_MONBE/1582-1761-------------------------------------...........................................
B2VQZ9_PYRTR/662-1229-------------------------------------TCVFEVS.......................TGKFSLICSDTDP
A2QPY0_ASPNC/663-1233-------------------------------------SITLTVE.......................EEKFDLTNAITDL
C4JTF4_UNCRE/662-1239-------------------------------------SITLMIE.......................DEMFNLTSVISSQ
Q2GSS2_CHAGB/391-959-------------------------------------SLTVNVA.......................SETFDLRQSLTLE
Q7Q5C6_ANOGA/565-1322-------------------------------------RLELQMG.......................SESTYAVLSVREK
C0SG01_PARBP/712-1287-------------------------------------SITLRIE.......................EESFDLAYVIGDQ
Q8L614_ARATH/276-832-------------------------------------SVLAKLG..........................PLFTICSRAE
TPC11_BOVIN/577-1097-------------------------------------SVDLVLG......................SEAGRCVVLNWQGG
Q4N165_THEPA/627-1297-------------------------------------DVDLDLQFYEGFLDTSEGILRFYHDKSEYLPEAFVVYCNNVGN
Q6CF42_YARLI/694-1263-------------------------------------GCIVSFA.........................GFRIEVPLQIE
Q7S6A3_NEUCR/636-1264-------------------------------------SLTASLE.......................TESFDLHQSLKLR
Q5AH80_CANAL/196-781-------------------------------------SIKLQIT...IQLQRK...EKCINLNKIELHQDFSNI......
Q2UPL2_ASPOR/663-1234-------------------------------------SITLLIE.......................EEKFDLTCAMTDL
B9WKD3_CANDC/668-1247-------------------------------------VVKLQIT...IQLQNKNNHQKQINLNKIELHQNFFTSGGTGIG
B6QQY0_PENMQ/649-1211-------------------------------------SITLAIE.......................EEKFNFLYVMTNH
A6QX66_AJECN/503-1083-------------------------------------SITLRIE.......................QENFDLSCVISEQ
Q0UML5_PHANO/649-1218-------------------------------------NCIFRIA.......................TDKFELTCSNVGL
A6S8E4_BOTFB/493-1052-------------------------------------KVTFSIA.......................SELFDFDYVHSFD
B9I0K4_POPTR/546-1104-------------------------------------YVIAKMR..........................PHFTICCGAE
B9T2L8_RICCO/584-1142-------------------------------------YVVAKMG..........................PHFTICCRAE
A1D3G8_NEOFI/665-1235-------------------------------------SITLLIE.......................DERFDLACAITDL
A2EKE8_TRIVA/370-552-------------------------------------...........................................
Q4SVC2_TETNG/484-996-------------------------------------GIEVMLG......................GDCARCVFLTWRGA
A3LPF0_PICST/628-1173-------------------------------------SIRIESEVEFRNGDKH..............VIVNNSELHEFDE
Q5BDK6_EMENI/657-1228-------------------------------------SIALLVS.......................QEDFDLTYAITDL

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138.....................................LKTPLDSQSSLGS...EEVIKAKKRRLGRAQKIIGDYCLLAGS
TR120_SCHPO/1-1173...................KNSNASIHSLGSSSRPTLTRTPSITSRSVNSVTE....RSKSLSKGRIENQFGQLYLLAGR
A3GI78_PICST/1-1320...................NQAQKRLSSGSTSFKVSFSGPNPPSSNPIDS...KS..KSQQRHNGRQLKLMANFYLLAGK
B9HAT3_POPTR/1-113.....................................LKTPLDSQASLSS...EEV........................
Q5ACN8_CANAL/1-1244...................NQAQKRLSSGSTSFKVTFNNSTTTSTTTPGSTLEKS..KTHLKHLGRQRKLMGSFYLLAGK
TPPC9_HUMAN/1-1108...................................PLLCVPFEKKDFVGLDTDSR..HYKKRCQGRMRKHVGDLCLQAGM
Q6FUK5_CANGA/1-1224SALPGNQSRGSGSLYNSNSTNTNKRLS....SFEMTTNNIKRSASLKLSTSLASTDNKIQTRAQGRQYKILGNFQLLAGR
TR120_YEAST/1-1255SAV...QSSVSSSSKAGSVTTASKRLS....SFEMTTNSLKRSASLKLATTLSTSENRSQQKSLGRQMKILGNFQLLAGR
A9TGF2_PHYPA/1-1085.....................................LVTPLDSQVSLTS...DEV..NKKRKLGRVQKTMGDYCLLAGS

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240..SYPQPRRWTKSKGGAI..ARRIGKDR...................DPSYCHILPK.......................
Q17IT4_AEDAE/569-1266LNIQKGFKNYNPHQDCME..QIAV........................ISSCYIIPT...............YRGQFQDI
B4N3P6_DROWI/571-1279YIRPAFRYHTRSRDLDDN...........................VTINSICYIAPT.......................
A2X8W8_ORYSI/587-1138SPVSMGEFSLWKFEDQVE..ALPMKDNVLAFS...............GQKLIQVEEP.......................
B6H784_PENCW/663-1219..EQRESFWWEQTQKGVT..RRRVGKDR...................DTGRCKVMPK.......................
B8C9G3_THAPS/960-1719PIPITELPESSVAFIGGV..PLVCHGLTLVLKPAREL.SRGSSVLNLQIDSQHLISPLGRSGPQQLLMEECNYMAHSWSR
B0WFL7_CULQU/525-1276LNVQRVFKLLNPHQDCME..RIRTG......................GATSCYIIPT.......................
A4S1A2_OSTLU/578-1070TSDCSVMNADYESLPASVL.KMKI.......................KTHILDVSDA.......................
A5DBY9_PICGU/617-1163IWHHDWVYVTDKDSKVAK..RIPIRLHHD..................PPYMARVTSL.......................
B4IX46_DROGR/568-1290YVRQSFRYHTRTRDLDDN...........................LTINPICYIAPT.......................
B3DLV7_XENTR/577-1097GGDAASSQEAVQASRSFK..RRPKLPENEVHWDSVA...........IQASTMIVSR.......................
Q54KR2_DICDI/821-1497LLISTTTTPPIQNKLKDK..NIKTTQQQQQQQPPKTLEKLNPYKKFLERSSIRILDH.......................
A4HUB1_LEIIN/384-917VGPSSVAGRSAAGTRAVL..SAKI.......................YRQVLQVLNP.......................
A1CQK2_ASPCL/664-1234..ARQEAYWWQETTHGAV..RRRVGKGR...................DTSRCKIMPK.......................
Q57YW4_TRYB2/511-1059DTSVENYFLQHGQFKKWG..VSCSQ......................CTPWVCVAEP.......................
TPC11_DANRE/577-1097WGDAASSHESLQASRSFK..RRTRLPEQHVDWDAVS...........VQSSTMIISR.......................
B0D8K9_LACBS/629-1224RVQGGHAPRWLSSLDPPK..FIPIERENYDFTAYVILFTSLSFF...EQQSSSIKHV.......................
Q0CCQ2_ASPTN/665-1233..GDRNSFWWQQSPNGMT..RRRVGKGR...................DTTQCRILPK.......................
A8N717_COPC7/639-1200RTSSRIQPRWLRSLDPPR..FIPVNRQ....................EFSFAIVKHR.......................
A5B032_VITVI/377-937SPASMDDLPLWRFEDHVD..TYPTKDPALSFS...............GQKAIQVEEP.......................
B3M5T6_DROAN/568-1287YARHPFRHHTRSRDLDDN...........................VTINPLCYIAPT.......................
B3S6B6_TRIAD/573-1077SSALTTPTPTLLSNVTNH..PEVLSFDQIQ.................AKPATKLTSR.......................
B7P2U2_IXOSC/583-1086WLHAGSVRGGLAWEPLPN..KQFVSGEEVAFHQLP............QLASTRIHPR.......................
Q4D1A2_TRYCC/511-1062KSLGGNPFLRGTEMLGSI..SGLLY......................HKPWISIVRP.......................
P90984_CAEEL/775-1075................................................................................
A9V4M9_MONBE/1582-1761................................................................................
B2VQZ9_PYRTR/662-1229.DITARPLWWIKSDTKIK..SRALKQG....................SGTSVHILPK.......................
A2QPY0_ASPNC/663-1233..TPYESYWWQQTSKGPS..RRRVGKGR...................DTGRCKILPK.......................
C4JTF4_UNCRE/662-1239..SFKDPVWWSPGIKGAI..SRRIGKDR...................DTITCDILPK.......................
Q2GSS2_CHAGB/391-959.ERGNRNLWYLSPSA.....TKYIAHP....................QPLVIRVLPR.......................
Q7Q5C6_ANOGA/565-1322LNASKPFKSYNPHKDCME..SIGI........................ISSCYIIPT.......................
C0SG01_PARBP/712-1287..RWNGSVWWREGKQGPI..SRRIGMGR...................DISMARILPK.......................
Q8L614_ARATH/276-832SPAAMEDLPVWKHENRVE..SLPTKDPVLAVF...............GQKATQVDEP.......................
TPC11_BOVIN/577-1097GGDAASAQEALQASRSFK..RRPRLPDSEVHWDGIV...........IQASTMIISR.......................
Q4N165_THEPA/627-1297ERREMVQLPNNTRIILII..SLPFYTLKRL.................RINGVVLKSL.......................
Q6CF42_YARLI/694-1263RSARAVEWFFKKDGVVRS..RALVSTE....................SHHMVRTLPR.......................
Q7S6A3_NEUCR/636-1264DMPNTTHTWYPTPST.....RKRITRPV...................SPLSLRILPR.......................
Q5AH80_CANAL/196-781......TNIGCYQISSTK..QCKIRLDY...................PNNEIKIYPV.......................
Q2UPL2_ASPOR/663-1234..TQRDCFWWKQTKNSVA..RRRVGKNR...................DTGRCKIKPK.......................
B9WKD3_CANDC/668-1247GGTGIGGGIGYYQISSTK..QRKIRLNY...................PNNEIKIYPV.......................
B6QQY0_PENMQ/649-1211..ERDMSFWWRHGPRGSY..KKRIGKGR...................DTAICKILPK.......................
A6QX66_AJECN/503-1083..NRDESVWWRMGKQGPI..ARRTGKDR...................DTSVSRILPK.......................
Q0UML5_PHANO/649-1218SSEQPAPAWWTQTNSGVK..PRKLKGG....................STTAIKILPK.......................
A6S8E4_BOTFB/493-1052.RPSFPEMWYGEHAT.....KKKIVRA....................RPSSIHVLPK.......................
B9I0K4_POPTR/546-1104SPASMEDLPLWKFEDCAE..TFPTKDPALAFS...............GQKAAQVEEP.......................
B9T2L8_RICCO/584-1142NPASMDDLPLWKFEDRVE..TFPIKDPALAFS...............GQKVAQVEEP.......................
A1D3G8_NEOFI/665-1235..TQRDSFWWQQTTNGVA..RKRVGKDR...................DTCRCKIMPK.......................
A2EKE8_TRIVA/370-552................................................................................
Q4SVC2_TETNG/484-996GGDVASAHEALQASRSSRGWDRGNEARKEEDWDSLT...........MQPSTMIMSR.......................
A3LPF0_PICST/628-1173YSSSHHAELYNEANGIIN..KKQVRLNGR..................SGNTIRFLPL.......................
Q5BDK6_EMENI/657-1228..AQQEAFWWQQTTKGPA..RRRVGKGR...................DVDRCKIQPK.......................

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138PADANAHYATAIELARLTGDVFWHAGALEGSVCALVVDRMAESDP...................................
TR120_SCHPO/1-1173VPNALKHFSTAIALSKATGDFLWQGLSLELFTVCLVIMAHLHVDVQIPPNILSMFPSYN.....................
A3GI78_PICST/1-1320YVDSVQHFIDAAITLKKCDDYLWLGSALEGISNSVVLLHYIGSNHQLSSSLISSILSVSKMKLSSL..............
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244YHDAFQNFIESLTSLKKSDDFLWLASALEGVAVSIVLMQFIGTAYQLPNQTMNPVLQVSKIR..................
TPPC9_HUMAN/1-1108LQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPG......................................
Q6FUK5_CANGA/1-1224VSDALNSFNEAVILLYRVRDLLWLGSALDGVAICAVILSYLQMPFKIP.HIVALICPMESPN..................
TR120_YEAST/1-1255YVDALNSFVDAITTLYKVRDYLWLGSALDGISICFLLLSYLGLSYQIP.QIVSLICPVEKLNFESSSTGISPVDSNSKAT
A9TGF2_PHYPA/1-1085PLDANSHYYTAIELARLTGDSLWQAGAIEGYVCALVLDRAGHKDY...................................

PF04628

TPPC2_CHICK/9-136-------------------------------------------------------------------------------F
Q4X1U7_ASPFU/7-185-------------------------------------------------------------------------------F
Q6BW18_DEBHA/13-197-------------------------------------------------------------------------------F
Q7QCA5_ANOGA/9-136-------------------------------------------------------------------------------F
Q55XF0_CRYNB/19-171-------------------------------------------------------------------------------H
Q57YJ1_TRYB2/2-125-------------------------------------------------------------------------------L
Q5CFT6_CRYHO/9-137-------------------------------------------------------------------------------F
Q4CQS2_TRYCC/4-127-------------------------------------------------------------------------------L
Q5B584_EMENI/11-172-------------------------------------------------------------------------------F
TRS20_YEAST/7-171-------------------------------------------------------------------------------F
Q7RCP8_PLAYO/11-149-------------------------------------------------------------------------------F
Q6FVV2_CANGA/7-168-------------------------------------------------------------------------------F
Q6BRP5_DEBHA/8-164-------------------------------------------------------------------------------F
Q5KAA6_CRYNJ/23-186-------------------------------------------------------------------------------M
TPPC2_DICDI/8-131-------------------------------------------------------------------------------Y
TPC2L_DICDI/9-139-------------------------------------------------------------------------------Y
A8X604_CAEBR/10-138-------------------------------------------------------------------------------Y
TPPC2_DROME/8-135-------------------------------------------------------------------------------F
TRS20_SCHPO/7-134-------------------------------------------------------------------------------F
Q6CFC6_YARLI/9-134-------------------------------------------------------------------------------S
Q5A920_CANAL/9-148-------------------------------------------------------------------------------F
Q651C7_ORYSJ/7-136-------------------------------------------------------------------------------H
Q4UE14_THEAN/25-171-------------------------------------------------------------------------------F
Q5DDE1_SCHJA/12-164-------------------------------------------------------------------------------F
Q6C760_YARLI/7-139-------------------------------------------------------------------------------F
Q8IE05_PLAF7/20-159-------------------------------------------------------------------------------F
Q74ZF3_ASHGO/7-174-------------------------------------------------------------------------------F
TPC2L_HUMAN/7-138-------------------------------------------------------------------------------Y
Q6E4A0_CYNDA/9-133-------------------------------------------------------------------------------F
Q5DCH5_SCHJA/9-138-------------------------------------------------------------------------------F
Q6CQN4_KLULA/6-155-------------------------------------------------------------------------------Y
Q4PCM0_USTMA/13-185-------------------------------------------------------------------------------Y

PF04099

Q20100_CAEEL/5-215-------------------------------------------------------------------------------I
Q9P3N1_NEUCS/3-158-------------------------------------------------------------------------------L
O77358_PLAF7/1-144-------------------------------------------------------------------------------I
TRS23_SCHPO/1-132-------------------------------------------------------------------------------L
Q9VA95_DROME/3-137-------------------------------------------------------------------------------K
Q9LZ97_ARATH/4-134-------------------------------------------------------------------------------L
Q9VLI9_DROME/3-209-------------------------------------------------------------------------------I
Q9AWN0_ORYSJ/33-178-------------------------------------------------------------------------------K
TPPC1_HUMAN/3-137-------------------------------------------------------------------------------K
TPPC4_MOUSE/3-209-------------------------------------------------------------------------------L
Q9SYB8_ARATH/23-168-------------------------------------------------------------------------------K

PF01217

AP3S_SCHPO/1-139-------------------------------------------------------------------------------K
AP1S1_MOUSE/1-142-------------------------------------------------------------------------------K
AP2S_YEAST/2-147-------------------------------------------------------------------------------D
AP2S1_HUMAN/1-142-------------------------------------------------------------------------------K
AP3S_YEAST/1-160-------------------------------------------------------------------------------L
COPZ1_BOVIN/12-153-------------------------------------------------------------------------------K
AP1S1_YEAST/3-146-------------------------------------------------------------------------------K

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240....PPKVLISV...............PGL----------------------------RDMYYSGERAGLN........I
Q17IT4_AEDAE/569-1266FFFFRFHLGSQT...............KQN----------------------------SQPMLTNEFYRIT........T
B4N3P6_DROWI/571-1279.....FHLNTQTNLGHGHGPNTCED..VST----------------------------TTKMLVNEYYPVV........T
A2X8W8_ORYSI/587-1138....DAQVDLVL................DC----------------------------PGPALVGELFTVP........V
B6H784_PENCW/663-1219....PPKIRLTT...............PNL----------------------------KRTYYTNERVMLQ........I
B8C9G3_THAPS/960-1719PSHHPWQLGPRS...............LRV----------------------------ISPRPQMELINLT........S
B0WFL7_CULQU/525-1276.....FALSAQT...............KQS----------------------------AQPMLTNEFYRVT........T
A4S1A2_OSTLU/578-1070....PPRASISM...............RTP----------------------------DGPALVGEMSRVI........I
A5DBY9_PICGU/617-1163....KPKVTVSTQ..............PTN----------------------------IKGIVLGEKVTIP........F
B4IX46_DROGR/568-1290.....FHLNTQTNLGHVTMMNGD....PTT----------------------------ATTMLVNEYYPVV........T
B3DLV7_XENTR/577-1097....VPKISVQL................HH----------------------------EPPALNNEMYCLK........I
Q54KR2_DICDI/821-1497....ESLIQIKC................NH----------------------------SSPAIVNEFYEIE........L
A4HUB1_LEIIN/384-917....PTTFRVEC................PS----------------------------LLEAVEGECAECD........I
A1CQK2_ASPCL/664-1234....PPKIRIKT...............SGI----------------------------KSTYYTNERVILQ........M
Q57YW4_TRYB2/511-1059....ICHIEVHA................PD----------------------------YIVGVEGEVVEVD........V
TPC11_DANRE/577-1097....VPKISVQL................TH----------------------------EPPALTNEMFCMT........V
B0D8K9_LACBS/629-1224....PHRLDVSL................VH----------------------------HAPAFLDESYPIV........V
Q0CCQ2_ASPTN/665-1233....PPKIRITT...............PNL----------------------------KDNYYTNERIVLK........L
A8N717_COPC7/639-1200....PHLVDVSI................SH----------------------------HTPSYLDEDYEIH........I
A5B032_VITVI/377-937....DPQVDLNL................GA----------------------------CGPALVGEKFIVP........V
B3M5T6_DROAN/568-1287.....FHLVTQTNLGHGNGSGSLEGDLPVV----------------------------STRMLVNEYYPVV........T
B3S6B6_TRIAD/573-1077....KPLIDLKL................QH----------------------------EPPALVNEYYSVK........L
B7P2U2_IXOSC/583-1086....RPHLSVTL................DH----------------------------KPPVLLHEFYPLS........V
Q4D1A2_TRYCC/511-1062....VCGVDIEV................PR----------------------------NIAGIEGEEVNVD........I
P90984_CAEEL/775-1075..............................----------------------------...VTAKEPFTVT........S
A9V4M9_MONBE/1582-1761..............................----------------------------.....................L
B2VQZ9_PYRTR/662-1229....PPKMEISL...............PEV----------------------------RNQYYTDEPVTLA........I
A2QPY0_ASPNC/663-1233....PPKIRVEL...............LNL----------------------------RETYYTNEEIVLR........L
C4JTF4_UNCRE/662-1239....PPKVRILT...............PTL----------------------------HDHYYTDEHAVLD........I
Q2GSS2_CHAGB/391-959....PPKMEVRC...............PVW----------------------------KEQYYTDEPIDLE........F
Q7Q5C6_ANOGA/565-1322.....FHLGSQT...............KPT----------------------------NQPMLTNEFHQVT........T
C0SG01_PARBP/712-1287....PPKVRITT...............PKL----------------------------RNHYYTDEKVVLD........V
Q8L614_ARATH/276-832....EPQVDVSL................GA----------------------------SGPALVGEDFAMP........I
TPC11_BOVIN/577-1097....VPNISVHL................RH----------------------------DPPALTNEMYCLV........V
Q4N165_THEPA/627-1297....YLKLLVNA...............VIL----------------------------TNKYFTNEFTSVSVFRDLDRKV
Q6CF42_YARLI/694-1263....PAQLKTEL................QL----------------------------PTALLFGETVSGA........L
Q7S6A3_NEUCR/636-1264....PPKMEIKS................EI----------------------------KEQYYTNEAITLD........F
Q5AH80_CANAL/196-781....KPDINIKP...............KLP----------------------------IHCFIPGEKLSIP........L
Q2UPL2_ASPOR/663-1234....PPNIRITT...............PNL----------------------------METYYTDERIVLK........V
B9WKD3_CANDC/668-1247....KPNINIKP...............IIP----------------------------INCYIPGEKLAIP........L
B6QQY0_PENMQ/649-1211....PPNIQIQL...............PNL----------------------------KPHYYTNERVSLA........V
A6QX66_AJECN/503-1083....PPKVRIST...............PRS----------------------------RNHYYTDEKVVLD........V
Q0UML5_PHANO/649-1218....PPKMEIRL...............PDV----------------------------RNQYYTDEPVTVA........I
A6S8E4_BOTFB/493-1052....PPKLELRI...............LEF----------------------------QEQYYTNELIYLN........L
B9I0K4_POPTR/546-1104....EPQVDLIL................GA----------------------------TGPALVGECFKIP........V
B9T2L8_RICCO/584-1142....DPQVDLIL................GA----------------------------TGPALVGECFVIP........V
A1D3G8_NEOFI/665-1235....PPKIRIST...............PNI----------------------------RATYYTNERVVLK........L
A2EKE8_TRIVA/370-552..............................----------------------------.....................I
Q4SVC2_TETNG/484-996....VPKISVRL................SH----------------------------EPPALISEMYRIS........I
A3LPF0_PICST/628-1173....RPSVSVTMT..............DED----------------------------INCLILGEKISIP........F
Q5BDK6_EMENI/657-1228....PPKIRLTI...............PNL----------------------------KSTYYTNERIVLN........L

PF12584

A8NHA2_COPC7/992-1155-------------------------------------------------------------------------------S
A7F9J5_SCLS1/1351-1514-------------------------------------------------------------------------------D
B2W2H3_PYRTR/1490-1643-------------------------------------------------------------------------------S
B6H3B0_PENCW/1240-1399-------------------------------------------------------------------------------D
B0XR26_ASPFC/1252-1410-------------------------------------------------------------------------------E
C5JCH6_AJEDS/1251-1399-------------------------------------------------------------------------------N
C5FEM2_ARTOC/1257-1416-------------------------------------------------------------------------------K
C4JLA5_UNCRE/1213-1358-------------------------------------------------------------------------------E
Q6CDM8_YARLI/995-1119-------------------------------------------------------------------------------K
Q4P224_USTMA/1235-1382-------------------------------------------------------------------------------T
A8PWK6_MALGO/1105-1237-------------------------------------------------------------------------------S
B8P4P6_POSPM/992-1139-------------------------------------------------------------------------------H
B0D3E6_LACBS/1015-1161-------------------------------------------------------------------------------C
Q6BQQ9_DEBHA/1053-1205-------------------------------------------------------------------------------E
A5DA23_PICGU/1047-1195-------------------------------------------------------------------------------T
C4YB04_CLAL4/693-833-------------------------------------------------------------------------------E
B9WGM9_CANDC/1083-1255-------------------------------------------------------------------------------E
C4R0Z1_PICPG/1026-1192-------------------------------------------------------------------------------D
A7TMG8_VANPO/967-1085-------------------------------------------------------------------------------E
B9SID3_RICCO/54-178-------------------------------------------------------------------------------G
A5AE80_VITVI/867-991-------------------------------------------------------------------------------G
Q9LSR1_ARATH/1141-1266-------------------------------------------------------------------------------G
B7FNC5_MEDTR/160-284-------------------------------------------------------------------------------G
Q2QNU0_ORYSJ/1110-1232-------------------------------------------------------------------------------G
A5BYI0_VITVI/102-216-------------------------------------------------------------------------------G
A9RFK8_PHYPA/1148-1278-------------------------------------------------------------------------------G
B3P0R7_DROER/977-1138-------------------------------------------------------------------------------K
B0WLN5_CULQU/969-1132-------------------------------------------------------------------------------K
B4DI17_HUMAN/276-505-------------------------------------------------------------------------------G
Q4SZ20_TETNG/1076-1303-------------------------------------------------------------------------------D
A8PKV5_BRUMA/526-730-------------------------------------------------------------------------------N
A8Y1L1_CAEBR/135-260-------------------------------------------------------------------------------Q

PF08626

Q01I83_ORYSA/1-1138..........................................................VLEDEVKFRYYTIIQLYRRATL
TR120_SCHPO/1-1173.DRLNAFGPLKFD.............................................ALLNFITEMRNVVDQLYQKSTL
A3GI78_PICST/1-1320.STTDLLSPKRTSVDQSSNGRTIAPSPRSS.VSGSS.FSF....SSGADINAI.....PLPELIKIFSARVLFYYDQSTN
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244.GSIDTATVRKTSIDSN......VSSPRNS.INGSNGFGFNALTSAIPDFNNL.....PVQELLKIITSRVVYYFSMSTN
TPPC9_HUMAN/1-1108.GTGGKSGARRFQGSTLPAEAANRHRPGAQEVLIDPGALTTNGINPDTSTEIGRAKNCLSPEDIIDKYKEAISYYSKYK.
Q6FUK5_CANGA/1-1224.NSIEALSPRNSLT.NS......VQSPRNS.LTLAT.......SEANIDVDMS.....NLPVLVKAILDKALHYYDESLS
TR120_YEAST/1-1255ASTTASSTPRNSISIAA......MQSPRNSIMSLSA.......PALNIDVENI.....NLPLLIKCISDKVLYYYDLSLM
A9TGF2_PHYPA/1-1085..........................................................LLEQEVQFRYSEVIQLYRRA..

PF04628

TPPC2_CHICK/9-136IAHAALDLVDENMWL..................................SNN-----------MYLKTVDKF....NEWF
Q4X1U7_ASPFU/7-185IIHSSLDIVEEAQWM..................................NGN-----------MYLKHIDTYP..PASAY
Q6BW18_DEBHA/13-197LSHMALDIFASPSSTSLR...........................EQQQDME-----------ENGGAILLFI..QDDIT
Q7QCA5_ANOGA/9-136IAHAALDLIDEHKWK..................................TNN-----------TYLKSIDKF....NQWF
Q55XF0_CRYNB/19-171LNHAAVDVLEERLVMTS............................TPTRPAD-----------SYLGLLYSL....EDMA
Q57YJ1_TRYB2/2-125TLYASMDLLDDALWK..................................TGD-----------FFLPSIDKPL..DGKYS
Q5CFT6_CRYHO/9-137AVYSALDIIERKASGDA.............................MEGSLD-----------PYLGYLGPAISLSYEYE
Q4CQS2_TRYCC/4-127MLYASLDLLDDVLWK..................................TGD-----------FLLPAIDRPL..EGKYY
Q5B584_EMENI/11-172LLNSSLDIFEIRQKQ.................................TSVD-----------QDLGLLQAV....DERL
TRS20_YEAST/7-171ILHASLDIVEDLQWQINPTSQLNGNGGNG.....SNGGGGFLRSRAVNNTDN-----------CYLGKVDHF....YGLA
Q7RCP8_PLAYO/11-149IIHQSLDSVDELVWR..................................NNN-----------MFLKTVDSF....NNYS
Q6FVV2_CANGA/7-168ILHASLDIVEDLQWQQNAGTGVAGGA...........GNSFLRSRNNANTDN-----------CYLGKVDHF....YGLV
Q6BRP5_DEBHA/8-164ISNSSLDLIEDIQWS..................................TNQ-----------FSLGKIDSF....YGLL
Q5KAA6_CRYNJ/23-186VAHMSLDSVEEVIEG..................................TGA-----------LYLKGVDRH....NEWT
TPPC2_DICDI/8-131IAHGSLDIVEEHVWK..................................SNN-----------MYLKIIDKF....NKVQ
TPC2L_DICDI/9-139IVHCSLDIIEDKPGSN..............................KKLPSD-----------MYLGLLYPT....EDYK
A8X604_CAEBR/10-138IGHAALDIVDEHAFT..................................TTQ-----------MYLKMVDKF....NEWY
TPPC2_DROME/8-135IAHAALDLVDEHKWK..................................TAN-----------MQLKSIDRF....NQWF
TRS20_SCHPO/7-134IVHSSLDIVDQLQWT..................................SNA-----------FYMKTIDQF....HEMY
Q6CFC6_YARLI/9-134LAYMALDYLGQ......................................QQN-----------ENAGTVSLLY..VHKLA
Q5A920_CANAL/9-148IANSSLDLIDDQAFT..................................TNV-----------LNLGKIDQF....YGLS
Q651C7_ORYSJ/7-136VVHCSLDVIDERVNNPKR...........................NAPALNE-----------TFLGLLYPT....ENYK
Q4UE14_THEAN/25-171VAHQSLDVIEDLVWN..................................NPN-----------LFLKQVDAF....DFLS
Q5DDE1_SCHJA/12-164KAHSALDVIEDKLSKRTTS.........................GSNNDQLE-----------QYLGLLYPM....EDHR
Q6C760_YARLI/7-139ILHAAIDMVEQTASR..................................TNQ-----------LYLRTVDNF....YSHL
Q8IE05_PLAF7/20-159IIHQSLDSLDEIVWK..................................NSS-----------MFLKNIDSF....NNYS
Q74ZF3_ASHGO/7-174ILHASLDIIEDLQWQSTHSASLASSVGNSGSSGGGSFLRSRHTHGGAGAPGS-----------CYLSKVDNF....YGLS
TPC2L_HUMAN/7-138MVHTSLDVVDEKISAMGK...........................ALVDQRE-----------LYLGLLYPT....EDYK
Q6E4A0_CYNDA/9-133ILHAALDVVQDLAWT..................................TNA-----------MFLKSVDRF....NDLV
Q5DCH5_SCHJA/9-138VAHAALDMVDDHLWT..................................KAD-----------TYLKVVDKF....NEWL
Q6CQN4_KLULA/6-155IVHSTLDIMEYLQWQRQPQLDINTS.............SGGFLRSRHSTQEN-----------SYLGKVDSF....YGLA
Q4PCM0_USTMA/13-185FAHAALDVMDERSGVSS.............................SRANSE-----------QYLGLLYTI....EDLA

PF04099

Q20100_CAEEL/5-215ILSSMFHSLFTIAVQLSP............C------------------QKS...........SGVEVLET-----TQFK
Q9P3N1_NEUCS/3-158VLAGTFHGVHAITARLNPVKSAPERPLSNSI------------------PGVPGGILTRPEPPSGLEVLES-----ENFR
O77358_PLAF7/1-144RLASMLHGISTISEKINVYSLYEKKTN..IF------------------QSLE.........KKGIETIEG-----DGFK
TRS23_SCHPO/1-132VLAGTIHGVHAISTQISP............L------------------PGS...........SGIQLLEA-----GTFN
Q9VA95_DROME/3-137LTYGMLFSIKSFVSKISPHDPKEG.......------------------................FLYYKT-----NRYA
Q9LZ97_ARATH/4-134RVASLWHSMHAISQQLSP............V------------------NGC...........SGIELLEA-----DTFD
Q9VLI9_DROME/3-209FLASMFYPLFAIASQLSP............E------------------PKS...........SGIEILEA-----DTFT
Q9AWN0_ORYSJ/33-178LMFGLLFSLRSFTAKIDPTTAEKGNLGVPLL------------------PGQG..........CSFYSFKT-----NTYK
TPPC1_HUMAN/3-137LMYGMLFSIRSFVSKMSPLDMKDG.......------------------................FLAFQT-----SRYK
TPPC4_MOUSE/3-209MLASMFHSLFAIGSQLSP............E------------------QGS...........SGIEMLET-----DTFK
Q9SYB8_ARATH/23-168LMFGLLFSLKSLTAKMDPVNADKGNLGVPQL------------------PGQG..........CSFHSFRT-----NTYK

PF01217

AP3S_SCHPO/1-139LIGDIYAAVSTR...----------------------------------........PPTACNFLESNLIAG----KN..
AP1S1_MOUSE/1-142MVRELMQVVLARKPK----------------------------------M................CSFLEW----RD..
AP2S_YEAST/2-147AIAQIYRLISSRDHK----------------------------------HQ...............SNFVEF----SDS.
AP2S1_HUMAN/1-142LIEEVHAVVTVRDAK----------------------------------H................TNFVEF----RN..
AP3S_YEAST/1-160LLEQVYELISQRNSD----------------------------------FQSSFLVTPPSLLLSNENNNDEV----NNED
COPZ1_BOVIN/12-153AFEKNIFNKTHR.TD----------------------------------.................SEIALL----EG..
AP1S1_YEAST/3-146IVKDLTPTILARKPK----------------------------------M................CNIIEY----ND..

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240RLDNNEDAAATIVVEVKLS........GRS..ESLAAISWLDGVDSDEQSEGMSASQTT....GATTGITTQTIRRKVAE
Q17IT4_AEDAE/569-1266KIMNNSDLCLQNVGVSINV.........................PQNLRNNVFLTTDL.....GSPLQKISSQVQIDIGE
B4N3P6_DROWI/571-1279TISNPHNVYLQNVGVHLSV.........................PVALRNSVFLTTDI.....SAGRQKLHSQIQIDVGE
A2X8W8_ORYSI/587-1138TILSKGHTVHSGELKINLVDAKGGGLLMSP..REAEE..SESHHVELLGVSDVTTENGSKEEVDSIRKIQHSFGVVSVPT
B6H784_PENCW/663-1219GIHNEEDEAADISAEIRLF........GT...ESAAQIQWLDGDSNPELL.ESGASTPI........EGPSHYLKRSVGV
B8C9G3_THAPS/960-1719SQSNNNAIEGTVNRIMYKL.............QAGNHADCHDVRIRLKCSSSRMNAAVAEFAGERAEGTSSGIKPNQQPL
B0WFL7_CULQU/525-1276KISNNSDLCLQNVGVSVSV.........................PQTLRNSVFLTTDLDDGGTASPLQKINSCVQIDIGE
A4S1A2_OSTLU/578-1070TVLSVADEIEEGELALVVI.................................EGDKPSKNVQILTDSGDVIKDGKIIVGD
A5DBY9_PICGU/617-1163NISHEMIGENKINYGKVQL.............SAKVDIIG........GLDGEKDFITTQVNWDNLKDDEYLSLDDLS..
B4IX46_DROGR/568-1290TISNPYNVYLQNVYVHISV.........................PLELRNSVFLTTDV.....SAGRQKLHAQIQIDVGE
B3DLV7_XENTR/577-1097TIQSQETTVIRDVKITAGL........................KPGQDANLTQKTLVSLNGAELCDDSSPALLTDIPVGD
Q54KR2_DICDI/821-1497EIINNDAEIKGGTIRFEIQ..........QSQQTTTLLQQNPQQPLPQTQHSHHHHQQQQQQQQQQLQQQQLQQQQQQQQ
A4HUB1_LEIIN/384-917VISCALLGVRNGYMTLPHE.......................PKLFRAVCWASANEPLPVTE.......TGGQARYAVPD
A1CQK2_ASPCL/664-1234DVHNEEDEAADVTAEIRLF........GQS..KLGGQILWLEDEDETESH.RSRDSSPI........EGAHHFLRRSIGI
Q57YW4_TRYB2/511-1059VIDTNSDLRDDTSFVLTHL.......................PAVYEFV..GCDAGNCSLKERCDGGKGYVSLLLNNLPP
TPC11_DANRE/577-1097TIKSEEDTVGKDIKLTAGL........................KPGQDANLTQSTQITLNGSEVCDDSHPALLPDIPLGD
B0D8K9_LACBS/629-1224QVTNTDTRSFDIVVDILLQ................................PTEIDDAVNYIVVDDHQSSGLIKGIQLGV
Q0CCQ2_ASPTN/665-1233GIHNDEDEAADVLTETRLF........GRP..ESAAKISWLDEEDSAEPQ.DSGTSTPI........EGVAHFLKRPIGV
A8N717_COPC7/639-1200QVTNRDEKELDVTVDILLQ................................PSDIDYAVNSISIDDQVSTGLIKDIQLGK
A5B032_VITVI/377-937TVTSKGHAIYAGELKINLVDAK.GGFLVSP..RDMEPMSXDDHHVELXGIAGPEGEDECQTGPDNIRKIQHSFGLVSVPF
B3M5T6_DROAN/568-1287TVNNPYNVYLQNVGVHISV.........................PVALRSSVFLTTDI.....SPGRQKLHSQIQIDVGE
B3S6B6_TRIAD/573-1077LIQNDEKAEISDVRSVRFI...........................KCDLCLAFTAWLCIDNISDSSTHSKSVKDIHINN
B7P2U2_IXOSC/583-1086TIASEEVNPLTEVFLSLGL......................VDDLDPKYYSTSESSHFRSVCLDDSHEFSAASNLSTLGV
Q4D1A2_TRYCC/511-1062MVKSEQDLTGNGTLVIHDV.......................PSLYEFVWDACQEKKMKMGEGIR..KGYRTVILDNIAF
P90984_CAEEL/775-1075TVMNMNGIPMTSILNNCDH............................................................I
A9V4M9_MONBE/1582-1761QILAGQSALNIDEGACELY.............................................................
B2VQZ9_PYRTR/662-1229EILNQEEEDTEAVLEVRLL........GRS..KDTLAYTWVER.........PASSPMKEVPPPLDGSADMDLPGHVVGQ
A2QPY0_ASPNC/663-1233GVDNEEEEAADVSVETRLF........GRP..ESTAKIRWLDEESPPEMH.GSGESTPT........EGNSHYLKRPIGV
C4JTF4_UNCRE/662-1239QIENEEDEAAEISIEARLL........GQS..EDSAQIHWVDDPEACVQPRDSSPTSPT.....DDSGSLGQVKRKEIGA
Q2GSS2_CHAGB/391-959EVENGEEVEALAKLDVVLF........GEK..PPVFTALIPGHEEQASSTIRSEETRLS...............GAPMGT
Q7Q5C6_ANOGA/565-1322KIFNQSDLCLQNVGVSISV.........................PQLLRNNVFLTTDL.....NHPLQKIHSHVQIDIGE
C0SG01_PARBP/712-1287QIDNEEDDVAEIDVEIKMF........GVS..GTSAKFSWIKEADANSAIEDASASSPI.TLVEGVSSTLSK..RCRIGT
Q8L614_ARATH/276-832VVTSKGHAVYSGELKINLVDVG.GGGLFSP..REAEPFSLESHHVEICGIDGAEGNNESESETGSIKKIQQSFGLVSVPY
TPC11_BOVIN/577-1097TVQSHEKSPIRDVKLTAGL........................KPGQDANLTQKTHVTLHGTELCDESYPALLTDIPIGD
Q4N165_THEPA/627-1297RIGNYSSRLITGERPSRYLSHD..........GDGERILNMIYLSCNNYVSDVVDKELSAMDKAKELKIMNLNMKMKIFV
Q6CF42_YARLI/694-1263VVTNNESGPISMSLACKVA........................WNVRDGTDKNLPEDSPVLTWDEEGDKEIESMESATFK
Q7S6A3_NEUCR/636-1264DIYNAEDVEAPSKFDALLF........CDEDEASLTAPSFTVEVVSEEQQTKEEEENKKKSSTSSSSGRESKVSSYFLGD
Q5AH80_CANAL/196-781EINYKNPHHHVNKQIYLMA...............KIKSPS.........TATTATNDVVAINWDGFKDDEPLNL.IN...
Q2UPL2_ASPOR/663-1234EIHNEEDEAAEVTAEARLF........GRP..ESAAKVLWLDEEGSPWIQ.GSESSTPV........EGLSHFIKRPLGT
B9WKD3_CANDC/668-1247KINYKN.RHYVNKQTYIMV...............KIKSINQNQNQNQNHSHSHSHNEVIAINWDGFKDDEPLNLHPD...
B6QQY0_PENMQ/649-1211AIQNNEDDAAEVAMQIRIL........GQP..HSLLKVSWSDDAEEATEFGGVSVETTI............HLKSRSVGI
A6QX66_AJECN/503-1083QIDNDEDEAAEVDVEIKLF........GYT..ETSATFSWINETASDSIAAEDASPSSLDTPIEGGSSTLSK..RRTVGT
Q0UML5_PHANO/649-1218EIHNLEEEDTEAVLEVRLL........GRS..KDSLGYLWLDR.........PAASPMKEVPPALDGSAEVDLPGHVVGK
A6S8E4_BOTFB/493-1052EVKNGEETDSIVDLEARLL........GENI.PSNIVLRRLDKTDSPSDTESEEDDH.................ELSLGT
B9I0K4_POPTR/546-1104TVVSKDHAIFSGELKINLVDVK.GGGLFSP..REEEPFSMDSHHVELLGVSGPEGEDESLVGPDKIKKIQQSFGLVSVPV
B9T2L8_RICCO/584-1142TVASKGHSVFSGELKINLVDVR.GGGLFSP..REAEPFSMDSHHVELLGVSGPEGEGESQTGPDKIIKIQQSFGLISVPF
A1D3G8_NEOFI/665-1235DIYNEEDEAADVSAEVRLF........GHP..DSAAQILWLDEEGEAIPP.RSQDSSPI........EGARHVAKRSIGV
A2EKE8_TRIVA/370-552SIEQKEKFAGN.....................................................................
Q4SVC2_TETNG/484-996SVESQEDDVATDVKLTAGL........................KPGQDANLSQTTHVTLDGSNVCDEAAPALLPDVPLGD
A3LPF0_PICST/628-1173RINFKHPKNQKINYKSISL.............SPKVKVIA......DQKDFDFASRITTQVNWDGLKDDEALDLHPLVES
Q5BDK6_EMENI/657-1228VIDNGEDEAADVVAEARLF........GSP..DSAVNISWLDQEGSVQASTESRPNTPA........EEEPHSLKRSVGV

PF12584

A8NHA2_COPC7/992-1155INILSTPFSAK................................................QGPG.............APLS
A7F9J5_SCLS1/1351-1514LRLLQTASI......................................................A...........SSCAV
B2W2H3_PYRTR/1490-1643LILNSPRIA..................................................................SYTTI
B6H3B0_PENCW/1240-1399LQLQPKSTT......................................................D..........PGPSTH
B0XR26_ASPFC/1252-1410LRLKNLADQ....................................................................PRH
C5JCH6_AJEDS/1251-1399LTVAQPNHL.....................................................................TH
C5FEM2_ARTOC/1257-1416LVLKDISPG....................................................................QTH
C4JLA5_UNCRE/1213-1358LILHNVSST....................................................................QPH
Q6CDM8_YARLI/995-1119LTEDKPTTK......................................................................P
Q4P224_USTMA/1235-1382LSLGRCDSG......................................................S...........SQSAS
A8PWK6_MALGO/1105-1237ILAPERSHI.......................................................................
B8P4P6_POSPM/992-1139LRVTPNPWV......................................................SPQ.......AKNAALP
B0D3E6_LACBS/1015-1161VRLISTPFT......................................................NA........SSSEKFS
Q6BQQ9_DEBHA/1053-1205FEFERKPQY.......................................................................
A5DA23_PICGU/1047-1195FEYERKSQY.......................................................................
C4YB04_CLAL4/693-833FQFERKSQY.......................................................................
B9WGM9_CANDC/1083-1255YQYDKKQYT.......................................................................
C4R0Z1_PICPG/1026-1192FEPIEQNVQ......................................................................D
A7TMG8_VANPO/967-1085FFKESKETL.......................................................................
B9SID3_RICCO/54-178FLPLPSASL.......................................................................
A5AE80_VITVI/867-991FLPLTSGGL.......................................................................
Q9LSR1_ARATH/1141-1266FLPLPSDGL.......................................................................
B7FNC5_MEDTR/160-284FLPLPSDGL.......................................................................
Q2QNU0_ORYSJ/1110-1232FLPFSSDCL.......................................................................
A5BYI0_VITVI/102-216HQVFLWYLG.......................................................................
A9RFK8_PHYPA/1148-1278MLPIPSQCP.......................................................................
B3P0R7_DROER/977-1138YASLSQPDVWRTYGCAFD..................................LVDYTTLFKL.QAQ.......LEP.NEL
B0WLN5_CULQU/969-1132FADSSLPADVRYYIPYSVTF...............................DVMDYTTLFTI.CAK.......IEP.SEL
B4DI17_HUMAN/276-505FSPASEEQLSISLKPYTYEF...............................KVENFFTLYNV.KAEI.....FPPSGMEY
Q4SZ20_TETNG/1076-1303FSPLNQDVSVFKLFHHQFQ.................................LERVTTLYSV.RADI.....LPPAGEQH
A8PKV5_BRUMA/526-730LTHIQPGCKYRLVWILPSNKGKTDEVEHYELRFTYRVKSLDEHTNEEELIYDREYTLFDEFPPDYELCAQLLSSQPGAIL
A8Y1L1_CAEBR/135-260VLSQQPGAQ......................................................................L

PF08626

Q01I83_ORYSA/1-1138QDNAQRVSPVSFELEAALKLARYLCRRQ.................................CAKEVSDLLMGAADGAKAL
TR120_SCHPO/1-1173QPNDA..VPGLCFSESILRYAHLLTVVYSCKGFNDN.ALDHIIAQAPIRPVKKATTYVP..NKATICQWIMRAQGQHLNS
A3GI78_PICST/1-1320DFENM..VPDLVYVESILRTIKFMIGIYLGGNDSSSLLLQSIVFCK...SYSNTIVNSQFFSKSDILKEIDKVFQLQLVD
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244DIENM..VPDIVYVESILRRIKLLIGIHF....SSS..MEDIV..K...GTITPTPNGS.FPKIEIIDEIDKIFSLQITD
TPPC9_HUMAN/1-1108.......NAGVIELEACIKAVRVLAIQK.................................RSMEASEFLQNAVYINLRQ
Q6FUK5_CANGA/1-1224HNSEY..APQIVYSQFLSRTLSFMLCCNSAVVQSQN.VASSIINCNYSNKPLKDCENLS.FSNSDVYSFCGKVLLLKIDD
TR120_YEAST/1-1255HNSEY..APQVVYCEFLLKTLTFMTSCYKSSEFSKD.VLDNIVKNQH..RALSDIPNSPMFPRFEVYFYSNKLFELQLKE
A9TGF2_PHYPA/1-1085.......TALSFELEATLKLARFLCRKE.................................LAKEVMELVMGAVEWSKGL

PF04628

TPPC2_CHICK/9-136V.SAFAFVLHMRFI------------------------------------------------------------------
Q4X1U7_ASPFU/7-185I.SAFLTPSGTRFL------------------------------------------------------------------
Q6BW18_DEBHA/13-197V.YGYETNTGLKII------------------------------------------------------------------
Q7QCA5_ANOGA/9-136V.SGFVTASHLRFV------------------------------------------------------------------
Q55XF0_CRYNB/19-171F.YGFQTTTKLRIV------------------------------------------------------------------
Q57YJ1_TRYB2/2-125V.SAYVGFAPIKLL------------------------------------------------------------------
Q5CFT6_CRYHO/9-137I.YGFLSFSHVKII------------------------------------------------------------------
Q4CQS2_TRYCC/4-127V.SAYVGFAPIKLL------------------------------------------------------------------
Q5B584_EMENI/11-172ASYGWITTTGLKFL------------------------------------------------------------------
TRS20_YEAST/7-171I.TAYISYSGMKFV------------------------------------------------------------------
Q7RCP8_PLAYO/11-149V.SAYCTPGHIKLL------------------------------------------------------------------
Q6FVV2_CANGA/7-168V.TAYLTYGGKKFV------------------------------------------------------------------
Q6BRP5_DEBHA/8-164I.NAFITQGNIKFL------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186V.SAFIPTG.VKFI------------------------------------------------------------------
TPPC2_DICDI/8-131I.SSFVTAGHIKFL------------------------------------------------------------------
TPC2L_DICDI/9-139V.YGYLTNTKIKFI------------------------------------------------------------------
A8X604_CAEBR/10-138V.SAFVTASRIRFI------------------------------------------------------------------
TPPC2_DROME/8-135V.SAFITASQIRFI------------------------------------------------------------------
TRS20_SCHPO/7-134I.SAYVTPSNMRFM------------------------------------------------------------------
Q6CFC6_YARLI/9-134V.YGMLTNTANKIV------------------------------------------------------------------
Q5A920_CANAL/9-148I.NAYVLQSQVKFI------------------------------------------------------------------
Q651C7_ORYSJ/7-136V.YGYLTNTKVKFI------------------------------------------------------------------
Q4UE14_THEAN/25-171V.SAYVTCSHANFL------------------------------------------------------------------
Q5DDE1_SCHJA/12-164I.YGYVTNTKIKFI------------------------------------------------------------------
Q6C760_YARLI/7-139V.SAFVTAGDIKIM------------------------------------------------------------------
Q8IE05_PLAF7/20-159V.SAYCTPGHMKFL------------------------------------------------------------------
Q74ZF3_ASHGO/7-174I.TGYITYGNMKFV------------------------------------------------------------------
TPC2L_HUMAN/7-138V.YGYVTNSKVKFV------------------------------------------------------------------
Q6E4A0_CYNDA/9-133V.SVYVTAGHTRFM------------------------------------------------------------------
Q5DCH5_SCHJA/9-138I.SAFVTPGRLRFI------------------------------------------------------------------
Q6CQN4_KLULA/6-155V.SGFLTYGNIKFI------------------------------------------------------------------
Q4PCM0_USTMA/13-185I.YGFQTCTQLRFL------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215L-FCLQSRTGVKFV------------------------------------------------------------------
Q9P3N1_NEUCS/3-158L-QCFNTLTGVKFL------------------------------------------------------------------
O77358_PLAF7/1-144I-QCYDTLTGIKIF------------------------------------------------------------------
TRS23_SCHPO/1-132M-HILQTHTGMKFV------------------------------------------------------------------
Q9VA95_DROME/3-137L-HYLETPSGLKFV------------------------------------------------------------------
Q9LZ97_ARATH/4-134L-HCFQSLPGTKFF------------------------------------------------------------------
Q9VLI9_DROME/3-209L-HCFQTLTGIKFI------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178L-NFLESPSGIKLI------------------------------------------------------------------
TPPC1_HUMAN/3-137L-HYYETPTGIKVV------------------------------------------------------------------
TPPC4_MOUSE/3-209L-HCFQTLTGIKFV------------------------------------------------------------------
Q9SYB8_ARATH/23-168L-SFMETPSGIKII------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139.RIIYRQYATLYFV------------------------------------------------------------------
AP1S1_MOUSE/1-142LKVVYKRYASLYFC------------------------------------------------------------------
AP2S_YEAST/2-147TKLIYRRYAGLYFV------------------------------------------------------------------
AP2S1_HUMAN/1-142FKIIYRRYAGLYFC------------------------------------------------------------------
AP3S_YEAST/1-160IQIIYKNYATLYFT------------------------------------------------------------------
COPZ1_BOVIN/12-153LTVVYKSSIDLYFY------------------------------------------------------------------
AP1S1_YEAST/3-146HKVVYKRYASLYFI------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240IGPGEHTVLPAVII.........EAPHPMQYDLEISAFYHL....-------------------................
Q17IT4_AEDAE/569-1266LQMQSTSSVSYYVT..........SLVEGNIELRQRLYYQTENLH-------------------QT.......KPSPVLT
B4N3P6_DROWI/571-1279LSGQSSQTATYYIF..........SLKETEIKLQQRLTYTLDVDR-------------------PNGST....NVHATAV
A2X8W8_ORYSI/587-1138LYAGDSWSCKLEIK..........WHQAMSVMFYVSLGYSLDST.-------------------................
B6H784_PENCW/663-1219LERSSQKTLTIVLV.........DTQEATDFTLEVSTVYHL....-------------------................
B8C9G3_THAPS/960-1719FVQKSADSSTNHMT...............ESGVSIPVGWEPRQDI-------------------AT.......DDSHD..
B0WFL7_CULQU/525-1276LQMQSQTAISYYVT..........SLVEGNIELRQRLYYQTENLH-------------------QT.......KAASSSS
A4S1A2_OSTLU/578-1070IALREKWTGMICLR.........WTGECPPAALHASLTAKR....-------------------................
A5DBY9_PICGU/617-1163.AKNGSEEHKLNIA..LHTRPNGPSLDSKSYKMNISMQTWVKDSQ-------------------PE.......ATSE...
B4IX46_DROGR/568-1290LSAHGSNTATYYIF..........SLVETEIKLQQRLSYTLDVDR-------------------SG.......GGGGGGV
B3DLV7_XENTR/577-1097LQPGGKIEMPLYIC..........CGTEGTRIFLVYVSYLIETFV-------------------E...............
Q54KR2_DICDI/821-1497LQQQQQSVNIININ.........NQSCEKGIYLEPNRSTPL....-------------------................
A4HUB1_LEIIN/384-917LAADESVRLLVSIA..........CIRSAEFRLPIAFEY......-------------------................
A1CQK2_ASPCL/664-1234MERSSRRDLALVLT.........DTLEPSTYELEINCVYNL....-------------------................
Q57YW4_TRYB2/511-1059ILCGSPSRLTMRYK..........CNRAGKYVIPITFCA......-------------------................
TPC11_DANRE/577-1097LQPGQKIVKPLYIR..........CVSTGSRIFLFHVAYSVSATV-------------------E...............
B0D8K9_LACBS/629-1224LGPGASGKKTIHLF.........NSGAGGERMIDVSIQSRPNDLE-------------------DE.......TSEE...
Q0CCQ2_ASPTN/665-1233MESSARRELEIVLT.........GTEDASDYELEISCVYNL....-------------------................
A8N717_COPC7/639-1200LLPGMTASKILHLF.........SAGAVGDRALDISVTSSAIVLS-------------------EE.......SSDEEDA
A5B032_VITVI/377-937LNCGDSWTCKLEIK..........WHRPKSVMLYVSLGYSLHS..-------------------................
B3M5T6_DROAN/568-1287LPAHGSNTATFYIF..........SLAETEIKLQQRLSYTLDVDR-------------------GGSSAGTGTGSGGTGA
B3S6B6_TRIAD/573-1077IASGEKVSKLLFVK..........CQSNGQRVISVKITYKINIEV-------------------D...............
B7P2U2_IXOSC/583-1086SVEQRRQTILLRNS............EVGTRRIFVKVEYKTDVEV-------------------D...............
Q4D1A2_TRYCC/511-1062ISCDHPLYVTLNYR..........CLRAGKYMVPILFYY......-------------------................
P90984_CAEEL/775-1075LNASIQSAASIVIS...............................-------------------................
A9V4M9_MONBE/1582-1761.HEGDAFAEQLIFS...............................-------------------................
B2VQZ9_PYRTR/662-1229LAQGARTTEKIRFT.........APPDPADYALEVKVLYHV....-------------------................
A2QPY0_ASPNC/663-1233MERSSHQELTIVVT.........DTNDALDYELEVSALYNL....-------------------................
C4JTF4_UNCRE/662-1239LDSGGRKAISLNVT.........NTSVPLEYGLEISAFYHL....-------------------................
Q2GSS2_CHAGB/391-959IGSLKSLIVRTRLP.........PIERSSRYDLTLKVTYFL....-------------------................
Q7Q5C6_ANOGA/565-1322LQMQSSTTVSYYLA..........SLVAGNIELKQRMYYQMENLH-------------------QS.......KTEPGGG
C0SG01_PARBP/712-1287LARGACHTVLALFT.........NTSEPLDYEIEISAYYHL....-------------------................
Q8L614_ARATH/276-832LKEGESWSCKLEIK..........WHRPKPVMLFVSLGYLPHG..-------------------................
TPC11_BOVIN/577-1097LQPGEQLEKAVYVR..........CGTVGSRMFLVYVSYLINTAI-------------------E...............
Q4N165_THEPA/627-1297KNMVKKFMSPITIV.........LLFNHKFRQLYTQYSYQLHVND-------------------CE.......FYVFG..
Q6CF42_YARLI/694-1263FSLKVPNSKISGPA.........GSVPAAVVNLQFSSIYN.....-------------------................
Q7S6A3_NEUCR/636-1264IQPSTTTTVRLHFP.........PIERPSRYELTLRVVYHL....-------------------................
Q5AH80_CANAL/196-781.LQENDNIHTLYIF..........TRNWNQEYLNIELQTYTE...-------------------..........NENEEE
Q2UPL2_ASPOR/663-1234LETSSHRQLEIVLT.........DTRDASDYELEISSVYNL....-------------------................
B9WKD3_CANDC/668-1247.KNDNDNIHTLYIF..........TRNWNQEYLNIEFQTYTDN..-------------------..........NNN...
B6QQY0_PENMQ/649-1211LSPAAISEIPVILS.........NTVDALEYEVDISVHYFL....-------------------................
A6QX66_AJECN/503-1083LACGASRTLSILFT.........NTTLPLDYEVEISAFYHL....-------------------................
Q0UML5_PHANO/649-1218LAQGERITERIRFT.........APPDPADYALEVKVLYHV....-------------------................
A6S8E4_BOTFB/493-1052IASGSSITVEMVIS.........SIDLPAVYDLSLKASYNL....-------------------................
B9I0K4_POPTR/546-1104LKDGESWSCKLEIK..........WHRPKPVMLFVSLGYFPDS..-------------------................
B9T2L8_RICCO/584-1142LQDGESWSCKLEIK..........WHRPKPIMLFVSLGYFPDN..-------------------................
A1D3G8_NEOFI/665-1235MDRSSRRQLMLVLT.........DTLEPSTHELQITCVYNL....-------------------................
A2EKE8_TRIVA/370-552.............................................-------------------................
Q4SVC2_TETNG/484-996LKPAEKLEKSVYVK..........CVTTGPRVFLFHVAYSINTIV-------------------E...............
A3LPF0_PICST/628-1173DSNEATESHQLNVSVHCPPNLLNSRVSERGSTIVIDLKTIVSEIA-------------------DE..............
Q5BDK6_EMENI/657-1228IESSSQREIPIVIS.........GTESSFEYELEVSAAYNL....-------------------................

PF12584

A8NHA2_COPC7/992-1155LYAGQPINAELVIR------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514AAANEPIPASLHLK------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643ATVGQPLPATLRIS------------------------------------------------------------------
B6H3B0_PENCW/1240-1399AAVGQMIVAELCLR------------------------------------------------------------------
B0XR26_ASPFC/1252-1410AAVGQMIAAELVLR------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399ATVGEMIPATLAIH------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416VGVDDMIPTELIIR------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358CGVGEALSAELVLH------------------------------------------------------------------
Q6CDM8_YARLI/995-1119QRVGEAIDYTLNIN------------------------------------------------------------------
Q4P224_USTMA/1235-1382VIVGQPIELTVSIE------------------------------------------------------------------
A8PWK6_MALGO/1105-1237.SLGEPIDITIDVT------------------------------------------------------------------
B8P4P6_POSPM/992-1139LFAGQPISAVVSVT------------------------------------------------------------------
B0D3E6_LACBS/1015-1161LYAGQPISANLTIH------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205.LVGEPILMNLKIE------------------------------------------------------------------
A5DA23_PICGU/1047-1195.LVGEPIEIKLTIN------------------------------------------------------------------
C4YB04_CLAL4/693-833.FVGEPIEARLCID------------------------------------------------------------------
B9WGM9_CANDC/1083-1255..VGEPINVNLKIN------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192FRVEEPIQFALKLK------------------------------------------------------------------
A7TMG8_VANPO/967-1085.KIGESVKFKIQIK------------------------------------------------------------------
B9SID3_RICCO/54-178.RVGQLVTMKWRIE------------------------------------------------------------------
A5AE80_VITVI/867-991.RVGQLVTMKWRVE------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266.RVGKLITMQWRVE------------------------------------------------------------------
B7FNC5_MEDTR/160-284.RVGQLVKMQWRVE------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232.RVGQLVNMRWRVE------------------------------------------------------------------
A5BYI0_VITVI/102-216FNFESMITLKLSXC------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278.RVGQQVVFQWRVE------------------------------------------------------------------
B3P0R7_DROER/977-1138CRLRTVCNMNLKIT------------------------------------------------------------------
B0WLN5_CULQU/969-1132CRVNSVCHLNLRIS------------------------------------------------------------------
B4DI17_HUMAN/276-505CRTGSLCSLEVLIT------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303CRCGLLCKLEVFIT------------------------------------------------------------------
A8PKV5_BRUMA/526-730CRVDDACDMIVSLR------------------------------------------------------------------
A8Y1L1_CAEBR/135-260CRATSPCHFVISIR------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138IDASDRLILYIEIARLFGTLGYKRKAAFFSRQVAQLY...................................LQQDNAYA
TR120_SCHPO/1-1173LSIRERCRIYGAMANMLGSIGFSRLRVKMLRELVASLTPVLLETRRQNASKNGIHPEVIASHTAQSFKSTHYCNILPLIS
A3GI78_PICST/1-1320MGIIEQCRIYSTLASMYGDLDLVRKKAFILRFLIVGILPKL..........NASDGQIGKNDQNQSIRG........IFE
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244LNIVDQCRIYSALATMYADLGLMRKNAFILRLLISAILPHL............SSGELPA....QSIKE........VLE
TPPC9_HUMAN/1-1108LSEEEKIQRYSILSELYELIGFHRKSAFFKRVAAMQCVA.........................PSIAEPGWRACYKLLL
Q6FUK5_CANGA/1-1224MELEEQSSIFSLLSKAYASLQLTRKQAFTLRLLLVSISSHA..........EGLKWQ.......HSFQN........FLD
TR120_YEAST/1-1255MQVEAQIKIYSTMAEVYRLLGYKRKQLFVLRLLMVALLATP..........NKIAWH.......PDYRT........LID
A9TGF2_PHYPA/1-1085MDASDRLVVNVEAARIFAAIGYDRKAAFYARQVGLLY...................................QQQHSHWA

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240...........NSDPETPISKMIS...................LDLPFIQPF.EANY.....KFLPRLHPTPW...PDFF
Q17IT4_AEDAE/569-1266SV.........TDSPSTPNSEKEDLAKLLASDRTG........QKYTNSHNV.KIENLNE..EQVRKIKEDTI.VVPCVE
B4N3P6_DROWI/571-1279QVATAP.....TSSDSTPEHDNNNGKSMAIAA...........AAAAVISPV.QIEYVD...ETRLRKSRDDTLSVRCYM
A2X8W8_ORYSI/587-1138...........EEAALHRLNVHRS...................LQIEGKIPM.IVSQ.....QFLRPFRREPL.......
B6H784_PENCW/663-1219...........VSDTQTPIMKNTT...................VDLSFIRPF.EANY.....EFLPAIHPQPW...PNFF
B8C9G3_THAPS/960-1719...........VSTVVCPLLKAGTAML................LPLDLFRPL..........QHVSDNESDDD.ACSTDY
B0WFL7_CULQU/525-1276SSCSA......MDSPSTPNSEKEDLAKLLAAEQLRNGGGAGGSQKFSNSHNV.RIENLND..ELVRKIKEDTV.VVPCVE
A4S1A2_OSTLU/578-1070...........TGARMTELFKDKPRTAPVENV...........AQISCDAPF.TVKR.....AYLPAYRQSPL.......
A5DBY9_PICGU/617-1163...........EDDAEIAVYDTASF..................VYPIINKPL.RCGF.....SVFPRYRNEGTSDMPCPF
B4IX46_DROGR/568-1290ATNIGPITTPNNSAETTPEHVKTVVSS................SSLAAISPV.QIEYLD...DTRLRKSREDILTVRCSG
B3DLV7_XENTR/577-1097...........DRQIICKCHKDET...................VTIETVFPF..........EVAVKFVSIKF.......
Q54KR2_DICDI/821-1497...........SEMKLTTIKETKSFKKMFYVYS..........SVVDENKLLISISY.....ETKTGEISHTSKLFTIPV
A4HUB1_LEIIN/384-917...........STDRYGGVSCCRT...................LHISVDPPF.NAEH........SMIGGSLW.......
A1CQK2_ASPCL/664-1234...........VSDIQTPIIATHR...................VTVSVVRPF.EANY.....EFLPRLHPEPW...PDFF
Q57YW4_TRYB2/511-1059...........LSNTSAKVEITKN...................VQAHISCPF.IPSY........TLFKSIPWTMEAQNT
TPC11_DANRE/577-1097...........GKDITCKCHKDET...................VTVETVVPF..........EVAMKFVSSKF.......
B0D8K9_LACBS/629-1224...........DDDENDLLSDDKMETLRT..............LVIPTVNPF.KVTS.....DVSYRHKQEPW.......
Q0CCQ2_ASPTN/665-1233...........VSDVHTPIIATAR...................VSLSIIRPF.EANY.....EFHPRLHPLPW...PDFF
A8N717_COPC7/639-1200EE.........SEEPPSPTSLDKTAHQRT..............VIIPTIAPF.DISD.....NVVYARTRKEW.......
A5B032_VITVI/377-937...........NESTSQKVHIHKS...................LQIEGKTAI.VVGH.....RFMLPFRQDPL.......
B3M5T6_DROAN/568-1287RINTAP.....NSSESTPDHEVRS...VP..............QSLATISPV.QIEYLD...ETRLRKSRDDTLTVRCHG
B3S6B6_TRIAD/573-1077...........GKVTECKCKQTDS...................VTIETAIPF..........ETVINTVTTEL.......
B7P2U2_IXOSC/583-1086...........NQILCCSCLKEIY...................FDLECIEPF..........TFSTKILNLKF.......
Q4D1A2_TRYCC/511-1062...........KSGNYSDVEILKR...................IQLNVFYPF.STTY........TFLKVLPWMVTPIKG
P90984_CAEEL/775-1075................................................................................
A9V4M9_MONBE/1582-1761...........................................LRREVVEPT............................
B2VQZ9_PYRTR/662-1229...........LSDRDIPISKILV...................TDLVFNAPF.EASY.....DLNARVHPDPW...PSYF
A2QPY0_ASPNC/663-1233...........VSDVQTPIIASMR...................VGLSIIRPF.EANY.....EFLPRLHPQPW...PDFF
C4JTF4_UNCRE/662-1239...........LSDPETPIFKTVT...................LDLPFIRPF.EANY.....ELMPRVHPGPW...PDFF
Q2GSS2_CHAGB/391-959...........PTNPGTPISQTAV...................FQLNVVNPF.EANY.....DLLPRVHPDPW...PSLF
Q7Q5C6_ANOGA/565-1322SAANGGGPSAAADSPSTPNSEKEDLARLLANEKNL........AKYVNNHNV.KIEFLDTDGQVVRKIKEDTV.VVPCVE
C0SG01_PARBP/712-1287...........ISDVETQIFKTVS...................LDLSFIRPF.EANY.....EFLPRIHPAPW...PDFF
Q8L614_ARATH/276-832...........SEANTQKVHIHKS...................LQIEGKMPL.LISN.....RFMLPYRRDHL.......
TPC11_BOVIN/577-1097...........GKETVCKCHKDET...................VTIETVFPF..........DVAVKFVSTKF.......
Q4N165_THEPA/627-1297...........ETDAGYVISKTNI...................VDFDLEDSLMDLDYE....NLEIKLDSSKSHPKDILY
Q6CF42_YARLI/694-1263...........LGDPDSPIRFNKG...................YTRQLHRPL.VVGF.....SVSPAVHPDDW.......
Q7S6A3_NEUCR/636-1264...........STNPGTTIIQTAV...................FQLNVLNPF.EANY.....ELLPRVHPDPW...PSFF
Q5AH80_CANAL/196-781NDKDE..D...EDEDEVVVYDIATF..................TIPVLSKPF.SCQY.....VITPDFRDKAT.DMPSPF
Q2UPL2_ASPOR/663-1234...........VSDTQTPIIATLR...................VKIPIIRPF.EANY.....EFMPRLHPQPW...PDFF
B9WKD3_CANDC/668-1247NNNNEEED...EQEEELIIYDIANF..................TIPVLIKPF.SCQY.....IITPQFRNKAI.DMPSPF
B6QQY0_PENMQ/649-1211...........VSDPETPISKSIS...................ATLAFMRPF.EANY.....DLVPRIHPDAW...PNLF
A6QX66_AJECN/503-1083...........VSDVETKIFKTVS...................LDLSFIRPF.EANY.....EFLPRIHPAPW...PDFF
Q0UML5_PHANO/649-1218...........LSDRDIPISKIMI...................ADLVFNAPF.EASY.....DLNARVHPEPW...PSYF
A6S8E4_BOTFB/493-1052...........VTDLETPISQAMS...................AQLSILNPF.EANY.....DFSPRIHPGSW...PSFF
B9I0K4_POPTR/546-1104...........NESTSQRIHVHKS...................LQIEGKTAV.VFSH.....QFMLPFRQDPL.......
B9T2L8_RICCO/584-1142...........NEMTSQKVHVHKS...................LQIEGKNAL.LISH.....QFMLPFRQDPL.......
A1D3G8_NEOFI/665-1235...........LSDYQTPIIATHR...................LALSIIRPF.EANY.....DFLPRLHPEPW...PDFF
A2EKE8_TRIVA/370-552...........................................FSMIFDNPL............................
Q4SVC2_TETNG/484-996...........GQQVVCKCHKDET...................ITIETMVPF..........EVSVKFMSTKF.......
A3LPF0_PICST/628-1173...........DEDIEDSVYDTANY..................TLPIINSPF.KCSY.....IISPRYRADAI.DMPSPF
Q5BDK6_EMENI/657-1228...........FSDIQTPIIATTR...................LTLPIIRPF.EANY.....EFLPRLNPLPW...PDFF

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138AMNAMQVLTTTTTAYHVQSRKTSKMDHGLLKSVVSLFESQWSTLQMVVLREILMSSIRAADPLSSWSAAARLLRSFYPLI
TR120_SCHPO/1-1173EICQEYGL.LKTDGSLLNPELTKWG...............WSNLQFDVLNELISLCDSLSDYRSILLLISLFFLTSVQTA
A3GI78_PICST/1-1320YLFTIYGINLETESSPIDASIQSQGN..............WVSLQIQLLRLCLRTTETLKDYPFHLKLCTLLLTRYTHCL
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244NVFVLYDICDEPESFSEAARFHGQSN..............WTSLQIQLLRLALKVAENLNDQELLLKLCTLLLTRYTHCL
TPPC9_HUMAN/1-1108ETLPGYSLSLDPKDFSRGTHRG..................WAAVQMRLLHELVYASRRMGNPALSVRHLSFLLQTMLDFL
Q6FUK5_CANGA/1-1224TVMRLYDIHESADSNEVKSN..SLE...............WRELQKDIIELCLQISVSMKAESNMRDYGLLMLNKYNDML
TR120_YEAST/1-1255TIIELLNINESEAKINVDDP..SQST..............WLILQKKILQLCIKVSRKINDFEYVAKFSSILITKYTHLL
A9TGF2_PHYPA/1-1085AVSALQVMSLTAESYKCLSNKAEGKERQV.........GEWSTLQVDVLYDMLSAAVRAGDALAAWNAAARLLRNHFPLI

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240HIDESKDSKEWDRQRT..........NMQQRWLVNSTLVSFARE........ALLIEDV.....................
Q17IT4_AEDAE/569-1266EIKLSGRFYTLSRQSLTR.......AYKSEDFLLRVNMEVKAPD........GVDVLETQFISDHNIIEKPYKGQQRVAG
B4N3P6_DROWI/571-1279DFKFSARYYTLNRQPLPE.......VYKGENFLLRANTEVMALE........DIEILDSFFICDHNLVQSNYSFKRKKYT
A2X8W8_ORYSI/587-1138.........LLSRIRSSSDDDKKSSLAFNESNMLILSARNCTEV........PLRLHTM.....................
B6H784_PENCW/663-1219AVSDNLLEDGSAPSPG..........GLFQKWYLNSKVVSFALE........PLVIDKM.....................
B8C9G3_THAPS/960-1719DVVITYKQLRKGSSLPGEVGDRVMIVQQGSITWMKPFAATFSLA.EGLLKPFPCGVQHS.....................
B0WFL7_CULQU/525-1276EVKLSGRFYTLSRQPLTR.......AYKSEDFILRVNMEVKAPD........GVDILETQFISDHNLVEKPYRGQQRIAG
A4S1A2_OSTLU/578-1070................................VLQEDKCSKSP.........PVGVMLA.....................
A5DBY9_PICGU/617-1163VVSDGEEAQPTSMPIVTRLWQGSLRLAPVEDCFDGQ................LPEIVKT.....................
B4IX46_DROGR/568-1290DFKFSARFYTLNRRPLSQ.......VYRGENFLLRANTEVLAVD........ELEILDSFFICDHNLVQSNYSFKRKKYT
B3DLV7_XENTR/577-1097....................EHLDRVYTDIPFLLMTDILSTSPW........ALTIKSS.....................
Q54KR2_DICDI/821-1497VVGFNTQFQFFNEHLQLITDLYDQGVQTRENLLLLSEIKSQLPF........NIIIENT.....................
A4HUB1_LEIIN/384-917...GDAAAAMSVPSTSSSYAQYDKSVLVKAADIFSSPLVTNWKD.............DC.....................
A1CQK2_ASPCL/664-1234TMDEDSLEDDAVAKPR..........GLHQRWCLNSKVVSFALE........PLIIEKI.....................
Q57YW4_TRYB2/511-1059NDGGTSLVTLEVPEVSSPFVRSGSYTLLRPQDYINEDLS.........................................
TPC11_DANRE/577-1097....................EHLERVYVDIPFLLMMDILSASPW........PIELVES.....................
B0D8K9_LACBS/629-1224..........PGLADLQTFDAKFWDDRRGGEAIASIKIECSGPW........NLLLDGV.....................
Q0CCQ2_ASPTN/665-1233SVDDDMFEGQGTPKPA..........GLYQRWCLNSKLVSFALE........PLVIEKV.....................
A8N717_COPC7/639-1200..........PALADLSTFHEEGISAHEAS...ISLQCICTGPW........GIFVESA.....................
A5B032_VITVI/377-937.........LLPRMKPLPDADQLASLPLNEKSVLIVNARNCTDV........PLQLISM.....................
B3M5T6_DROAN/568-1287DFKFSARFYTLDRKPLAQ.......VYRGENFLLRANTEVLAVD........DVEILDSFFICDHNLVQSNYSFKQKKYS
B3S6B6_TRIAD/573-1077....................TKVDALCANEPYFIMACLKSVSPW........PITILNS.....................
B7P2U2_IXOSC/583-1086....................QPIEVLRAEEQFILQVDLESRCPL........PLELLSG.....................
Q4D1A2_TRYCC/511-1062DVIVGSETTLRVPEFSRVSIQHERFTLVHPRYSTRDDVS.........................................
P90984_CAEEL/775-1075................................................................................
A9V4M9_MONBE/1582-1761................................................................................
B2VQZ9_PYRTR/662-1229SLTEAESTAPPNPESPDA.......FGIAQKWGLRAKVASFADE........QLIVSDL.....................
A2QPY0_ASPNC/663-1233NVDDGLLPIGDEAKPG..........GLQQRWCLNSKVVSFAVE........PLVVEKM.....................
C4JTF4_UNCRE/662-1239HVDEPKLIDESEPRAH..........GLQQRWCLDCKLISFAHE........TLLIDKV.....................
Q2GSS2_CHAGB/391-959DPDTISLPITNDSDDTTP....QPPTGISQAWSLVTRYASFASE........PLLVTDV.....................
Q7Q5C6_ANOGA/565-1322EIKLTGRFYTLSREALGQ.......AYRDEDFLLRINVEVKSPD........PIDILETQFISDHNIVEKPYQGGASISG
C0SG01_PARBP/712-1287HYDDSPPEDDDAKEPKHD........GLQQLWCLNSKMVSFALE........PLVIEEV.....................
Q8L614_ARATH/276-832.........LLNRIKPAPDSEDVSSLPLNEKSVLVVSAKNCSEI........ALKLVSM.....................
TPC11_BOVIN/577-1097....................EHLERVYADIPFLLMTDLLSASPW........ALTIVSS.....................
Q4N165_THEPA/627-1297HLTNDKDCVTRPQQFDEEVLNYINIYSSNYDVYIIYGLININNI.ETQNVKLELFINDK.....................
Q6CF42_YARLI/694-1263..........PSFFVPAEGDEKSPSPIIKKRWRVDARITHYAQG.HAESDEIPLELVSA.....................
Q7S6A3_NEUCR/636-1264DAENIQPLSLPSQAEEEDKDAVVPYKGLHQSWSLLTRYASFASE........DLKVIDV.....................
Q5AH80_CANAL/196-781ILPNKTD...HNMPIAVRLWEGKLKIIDEYKEFMEESLRNKEQQQQQQQQQQQLEIVDI.....................
Q2UPL2_ASPOR/663-1234TVDDALLGNDSTPKLG..........GLQQRWCLNSKVVSFALT........PLVIEKI.....................
B9WKD3_CANDC/668-1247ILPNKTD...HNMPIVIRLWEGKLKIIDQYKQFMEE.........QQQEQEQTLEIVDI.....................
B6QQY0_PENMQ/649-1211QLDTDSDGEKADKPD...........GLQQRWCVSPKIVSFASE........PLVIENV.....................
A6QX66_AJECN/503-1083HYDDSPSEDSEEQEQKHN........GLQQLWCLNSKIVSFALE........PLIIEEV.....................
Q0UML5_PHANO/649-1218ALQEAESNINPESTDA.........FGIAQKWGLRAKVASFADE........ELVVKDL.....................
A6S8E4_BOTFB/493-1052THDESLEISQDGQDNDRE......AFGLAQKWCLTTRFASFATE........DVIVEDV.....................
B9I0K4_POPTR/546-1104.........LLSRIKSVPGSDQLAALPLNETSVLVIGAKNSSEV........PLLLQSM.....................
B9T2L8_RICCO/584-1142.........LLSKLKPNPNSDQSASLPLNETSVLVVSAKNCSEV........PLQLQSM.....................
A1D3G8_NEOFI/665-1235TIDDDLVEDETTSKPR..........GLRQRWCLNSKVVSFALE........PLVIEKI.....................
A2EKE8_TRIVA/370-552................................................................................
Q4SVC2_TETNG/484-996....................EPLEQIVVDIPFLLMADVRSSSPC........PLLLASS.....................
A3LPF0_PICST/628-1173ILSPSDDGQGTSMPIATRLWQGSLVVSDLYKKYEDSNS..............SLRILDT.....................
Q5BDK6_EMENI/657-1228TIDDDLTETQPNTEPR..........GLQQRWCLDTKVVSFARE........PLVIENM.....................

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138TPAGQSGLASSLSNSADKLPSGTRCADPCLPF..........................IRLHSFPLHPSQREIVKRNPNK
TR120_SCHPO/1-1173SSSQQISMFKAFRKTYLFAS..NAGIHINAPYWDPFMITDL...KFIGSS....................ENAELIHQRL
A3GI78_PICST/1-1320PSDDQHKLKGKIERILFLSN..RNNLKLSVPYWDPFLVRKV...KFINNRNRDEV...MPFLDYQN....NTINT.....
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244PTDDQIKLKNKVDSAL......KSNGGLSIPYWDPFLVRKV...KFVNSKPRGNL...IPM....K....ETLNS.....
TPPC9_HUMAN/1-1108SDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTK.................LPIVRHVKLLNLPASLRPHKMK
Q6FUK5_CANGA/1-1224SETEQKEILQVILKPL......IQNLKIK.EYWDPFILRGVTISR.LETDSASYDTLRIPN....E....NSIAT.....
TR120_YEAST/1-1255NQSEQDALFKEYIQPS......ITNESIT.SYWDPFILREVVINRILDSDPTSNE...IPL....E....SDVSSLESLE
A9TGF2_PHYPA/1-1085PPSSQSTLATALSMSAKRLDPGTRSVDPGIPF..........................VRLHSYTAMPADREIVKRSASN

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240..........ALRVLSEVAGKVCSITSDE.................SKQP.EDRSIGPEEPLSTDFI.------------
Q17IT4_AEDAE/569-1266TKLRPGTRFEDLRLLNSINCSRDWIMQGD.....YLNNDVQLTFSRSRTPDHGAALQVPASSNRVPPD------------
B4N3P6_DROWI/571-1279NRYQTGDKLETVIVLRTNATLKDWITSRDLDQKTKKFQNSLASKFRKEEVDSAAL.......APPTAP------------
A2X8W8_ORYSI/587-1138..........TIVSNDDGKQLCSVQQISG...................ISNEYAVIAPSEEY......------------
B6H784_PENCW/663-1219..........SLVLLEANGGVVCDVHSEE.................LVTP.GTPHLAPEELRESNFC.------------
B8C9G3_THAPS/960-1719.....SNVMVSSTAMQSTVGDPSEIISADGERVRMRFNLQTKGLGASVAATVQSVVNENETNEQQKEL------------
B0WFL7_CULQU/525-1276TRLRVNSRFEDLRLLNPVNTSREWVTQND.....YLNNDVQLTFNRGRTPD....LQSSNSTTRQPQD------------
A4S1A2_OSTLU/578-1070..........TLHVGGPAEITLDGVQSHD.................TKDPTNTMALATTETRSDATLY------------
A5DBY9_PICGU/617-1163..........TFNIRTKNQEVNIEKLGDV....................EENGDTMSQ..........------------
B4IX46_DROGR/568-1290NKYRAGDQLESVIVLRTNASLQDWSTARDLER..SKSDESVPSKFVSRQQKTQHQTCGHIGDAPLQQP------------
B3DLV7_XENTR/577-1097..........QLQLASSITSADQLESHVE.......................NIVLQTGESASECFCL------------
Q54KR2_DICDI/821-1497....KLSISTAAESARNATLLSPNVANNNPNTPNNNPNNNNPNNNPNNPNNNSGGVNNNIINNLNMIL------------
A4HUB1_LEIIN/384-917..........ALYFFTKETTAKEFVFQRG.....................DTVTLSSTFRCTAKRGIT------------
A1CQK2_ASPCL/664-1234..........SVVLLNLGSGAICNIGPEM.................VVSA.DEPEIRPEELRESNFT.------------
Q57YW4_TRYB2/511-1059..........TLHGNRSVTLYGAFTNREK..........CGDINF..SKGETIVVVMTMECRAFQGLT------------
TPC11_DANRE/577-1097..........EVQLASSMTAIDQPQSQVE.......................GVTLQTSECASECFLL------------
B0D8K9_LACBS/629-1224..........TLERQDNDQAKIIECSTDQ.....................DDAGMFPAEYLPGDEFCA------------
Q0CCQ2_ASPTN/665-1233..........SLVLLGIGGGSTCHIGPEE.................VASP.DTPEIRPEELRESNFT.------------
A8N717_COPC7/639-1200..........AVEIDKSNSRFKLLDSSID....................IEDCNLYPGEYLPGDEFSI------------
A5B032_VITVI/377-937..........SIEADNDGAGRSCSXRHGG..................EDIVAPTLLVPGEEF......------------
B3M5T6_DROAN/568-1287NRYSAGDQLESVIVLRTNSALRDWTTARDLDHRGKLEGKAVASKFI...RSSPAKLTSEESSAP..TP------------
B3S6B6_TRIAD/573-1077..........TFNLINQFESVDTDTQSQL......................SNVSLQKSEEARECFAI------------
B7P2U2_IXOSC/583-1086..........TLELVSQFLALRLWCACPL........................SRLKNGEVARDLFCL------------
Q4D1A2_TRYCC/511-1062..........MIQNNRDSLVYIAHTERED..........HSD.NFASSKGEEIILLASMECRAPQGLM------------
P90984_CAEEL/775-1075..........SVEFLMADVVTLCDTINGG......................SGKNLNDKVHSEEVICY------------
A9V4M9_MONBE/1582-1761....................................................................------------
B2VQZ9_PYRTR/662-1229..........CVKVHSIHGGATCDVTKEF...................TNVSPTEMDPHILTEWSFS.------------
A2QPY0_ASPNC/663-1233..........SLVLLGLGGAATCHIESEE.................VISP.EVAEIRPEELRESNFI.------------
C4JTF4_UNCRE/662-1239..........SVAVTGIEGGLVRHIGPEI.................HTGNVEAAELHPEQVRESQFI.------------
Q2GSS2_CHAGB/391-959..........DIAIQPSTTSRCTTTIKHT................NLPTSGTGRLIHPKTIEEATFN.------------
Q7Q5C6_ANOGA/565-1322TGLRPANRFEELKLLSAINCTRDWVSRGD.....YQSTDTRLVFNRSRSPDAPAAAALPSNR....PT------------
C0SG01_PARBP/712-1287..........SVVLLSVTAGNVCKIGKEM.................LKSP.ATPEFRPEELRESEFT.------------
Q8L614_ARATH/276-832..........SIEFDDEQGETSCLIQQGG................GCGDSPSSANLAPGEEF......------------
TPC11_BOVIN/577-1097..........ELQLAPSMTPVDQLESQVD.......................RVVLQTGESASECFCL------------
Q4N165_THEPA/627-1297..........NHNTQNITSGNSVSNVDNN..........NTKDNTNSVLESLDDKLLSLYVRKLDVDL------------
Q6CF42_YARLI/694-1263..........KLMFVSKSDHSVCEVVKEP..............CSELGDPLTGALVSRSDSGHGSFLS------------
Q7S6A3_NEUCR/636-1264..........DVKVLRQPQSQSQPSQTSSPEPMTCLITRHHDDDSTLPIEKGGHLMKPHTIETTSFD.------------
Q5AH80_CANAL/196-781..........EFNIVSKNPELIIDLINND....................TN.NTIENQQ.........------------
Q2UPL2_ASPOR/663-1234..........SLVLVGVGGGATCHVGPEA.................IVSP.GGPEIYLEELRESSFA.------------
B9WKD3_CANDC/668-1247..........EFNIVSKNPELIIDLVNND.......................NSIETQQ.........------------
B6QQY0_PENMQ/649-1211..........SVGLLEVNGGAICEIGSER.................LTTP.EATQILPEELRASEFI.------------
A6QX66_AJECN/503-1083..........NVSLLGITAGNICRIGTET.................LKSP.EAPTIGPEGLRESEFT.------------
Q0UML5_PHANO/649-1218..........NVQVHGVHGGATCDVTKEF....................EVEKMTVEPQVIHEWAFS.------------
A6S8E4_BOTFB/493-1052..........DVEILGLQGAIKCSTKRLT..................AIPEGGIKISPNELEEAQFD.------------
B9I0K4_POPTR/546-1104..........SIEVDDGVERPCTLQHSGM...................DLLSPAHLVPGEEF......------------
B9T2L8_RICCO/584-1142..........SIEVDDDTERLFSLQHSGE...................DLLGPACLVPGEEF......------------
A1D3G8_NEOFI/665-1235..........TLVLLSLGGGAVCDIGSEI.................VADP.HALEIRPEELRESSFI.------------
A2EKE8_TRIVA/370-552....................................................................------------
Q4SVC2_TETNG/484-996..........SLQTLTISSNTPQAPSQLQ.......................GVVLQTDECATECFCL------------
A3LPF0_PICST/628-1173..........EFSVKSRNPELKVVMVSSA....................FEKDGRIHQL.........------------
Q5BDK6_EMENI/657-1228..........SIAVLSLSGGAISQVGHEV.................LVSP.ETREIHPEDLRHSNFV.------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138KEWWTGGGPSGPFIYTPFTK......GGTSGTSKQEVNWIVGEPVQVMVELANPCSFDLIVESIYLSVHSGNF.......
TR120_SCHPO/1-1173RNGLPKSIEKGPFIYNPFNR........RQDQNQSKSVLVVDEQVAFSIYFRNPLSVSVEVQDVHLETKGVS........
A3GI78_PICST/1-1320....DEEVN.APF.FDPYNK......PLASSTFNKDKILIRDDVYQLKVQLQNPFAFEVEINDLTIVTEGNVTVQTLKNQ
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244....NNS.S.QPF.FDPYTK......KESDKAFV..PTLVKDDISQLKVTLQNPFAFEVEIHEITIVSEG.AQIETIKSL
TPPC9_HUMAN/1-1108SLLGQNVSTKSPFIYSPIIA....HNRGEERNKKIDFQWVQGDVCEVQLMVYNPMPFELRVENMGLLTSGVEF.......
Q6FUK5_CANGA/1-1224....AQKINPHEV.FNPFKQANSLNLKTSGSSDSKPKLFLVDDRAEFSCTIQNPYGFDITISDIHLPDEITDYCE.....
TR120_YEAST/1-1255NRQKTQDINPQEV.FNPFKRVQPTSFVSNNSTKVPILVFLVGDKAEFTCRVQNPFKFDFTINDIQLDEEISEFCE.....
A9TGF2_PHYPA/1-1085KEWWKGRTSTGPFIYTPFTA......KGDANT.RISVTWVVGEPVEVLVELANPCVFEVTVESIALSVEHTQF.......

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240--------------------------------------------------..............................
Q17IT4_AEDAE/569-1266--------------------------------------------------DQ.FNRSLLAKLPTNATIIGSTNANLTNQL
B4N3P6_DROWI/571-1279--------------------------------------------------PSASLSAYMSKSGLISKIPTTMTIINNN..
A2X8W8_ORYSI/587-1138--------------------------------------------------..............................
B6H784_PENCW/663-1219--------------------------------------------------..............................
B8C9G3_THAPS/960-1719--------------------------------------------------YSSNNCFFMDQTKEGTKLSMSYSITTHR..
B0WFL7_CULQU/525-1276--------------------------------------------------EQPFNRSLLAKLPTNATIIGSTNANLTNQL
A4S1A2_OSTLU/578-1070--------------------------------------------------D.............................
A5DBY9_PICGU/617-1163--------------------------------------------------..............................
B4IX46_DROGR/568-1290--------------------------------------------------PSAAMSKS.....LLAKIPTTMTIINNNPT
B3DLV7_XENTR/577-1097--------------------------------------------------QCPP..........................
Q54KR2_DICDI/821-1497--------------------------------------------------DDSINNLPVAQLLSDSNKLLKDVELSKNTT
A4HUB1_LEIIN/384-917--------------------------------------------------VLHAEVVAGDDVDVLSFCCGEESSFL....
A1CQK2_ASPCL/664-1234--------------------------------------------------..............................
Q57YW4_TRYB2/511-1059--------------------------------------------------LSSFDAVVSDNVVLLSLTAGTLPFQV....
TPC11_DANRE/577-1097--------------------------------------------------KCPP..........................
B0D8K9_LACBS/629-1224--------------------------------------------------ISR...........................
Q0CCQ2_ASPTN/665-1233--------------------------------------------------..............................
A8N717_COPC7/639-1200--------------------------------------------------SCRL..........................
A5B032_VITVI/377-937--------------------------------------------------..............................
B3M5T6_DROAN/568-1287--------------------------------------------------P.AGMSAYMSKS.LAAKIPTTMTIINSN..
B3S6B6_TRIAD/573-1077--------------------------------------------------..............................
B7P2U2_IXOSC/583-1086--------------------------------------------------V.............................
Q4D1A2_TRYCC/511-1062--------------------------------------------------VKNLDVVCTQDASLSSVVVSLLPCHV....
P90984_CAEEL/775-1075--------------------------------------------------..............................
A9V4M9_MONBE/1582-1761--------------------------------------------------..............................
B2VQZ9_PYRTR/662-1229--------------------------------------------------..............................
A2QPY0_ASPNC/663-1233--------------------------------------------------..............................
C4JTF4_UNCRE/662-1239--------------------------------------------------..............................
Q2GSS2_CHAGB/391-959--------------------------------------------------..............................
Q7Q5C6_ANOGA/565-1322--------------------------------------------------EEQYNKNLLSKLPTNATIIGSTSAQLTNQM
C0SG01_PARBP/712-1287--------------------------------------------------..............................
Q8L614_ARATH/276-832--------------------------------------------------..............................
TPC11_BOVIN/577-1097--------------------------------------------------RCPS..........................
Q4N165_THEPA/627-1297--------------------------------------------------RDLVNVNVNYKYYNNSNMMLYIDL......
Q6CF42_YARLI/694-1263--------------------------------------------------TC............................
Q7S6A3_NEUCR/636-1264--------------------------------------------------..............................
Q5AH80_CANAL/196-781--------------------------------------------------..............................
Q2UPL2_ASPOR/663-1234--------------------------------------------------..............................
B9WKD3_CANDC/668-1247--------------------------------------------------..............................
B6QQY0_PENMQ/649-1211--------------------------------------------------..............................
A6QX66_AJECN/503-1083--------------------------------------------------..............................
Q0UML5_PHANO/649-1218--------------------------------------------------..............................
A6S8E4_BOTFB/493-1052--------------------------------------------------..............................
B9I0K4_POPTR/546-1104--------------------------------------------------..............................
B9T2L8_RICCO/584-1142--------------------------------------------------..............................
A1D3G8_NEOFI/665-1235--------------------------------------------------..............................
A2EKE8_TRIVA/370-552--------------------------------------------------..............................
Q4SVC2_TETNG/484-996--------------------------------------------------RCPP..........................
A3LPF0_PICST/628-1173--------------------------------------------------..............................
Q5BDK6_EMENI/657-1228--------------------------------------------------..............................

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138..................................................DAFPVSVNL.PPNTSKLVLLSGIPTQVGQV
TR120_SCHPO/1-1173..................................................AKCSHSTFTMRPLSIERTTLTVTPTETGEL
A3GI78_PICST/1-1320IRPFNGTQYQQPTASRSINGSLNKARAVTTGSRKVTGANSTGMQP.SLVSSNTVNSAIVVPPCSSEHFVVGFKPLQVGEL
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244IRPLESIT.SKPSSTMP.NGNIVNNKLRGHPGKKSSSTTSVVHQGVSHTTSTNSASTFVLAPRSMESVMLSFKAISTGQV
TPPC9_HUMAN/1-1108..................................................ESLPAALSLPAESGLYPVTLVGVPQTTGTI
Q6FUK5_CANGA/1-1224......................LDTRSSVKDNPYVIGAKSV.........RNITLPIKIKKSTADDFLFLRYLRLSVLDL
TR120_YEAST/1-1255......................IDRKAVSYSGPYNVKAESI.........RSITLPLIIKKPTYKKIYEISCLKISILKL
A9TGF2_PHYPA/1-1085..................................................EAFPVSVTL.PPSSGQVVSLSGLPLSVGSL

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240................................................................................
Q17IT4_AEDAE/569-1266SLPL...................................................TSSSSSFNAASTGSSPQMEDFGKSL
B4N3P6_DROWI/571-1279.TAL................................................SNVLQAASA..VAKDEDTGEAV...ASQ
A2X8W8_ORYSI/587-1138................................................................................
B6H784_PENCW/663-1219................................................................................
B8C9G3_THAPS/960-1719................................................................................
B0WFL7_CULQU/525-1276NLPL............TSNSPQQNAA.......AGSPVPPSAGMMVSSTGSAEDFKVRPLPATGAATTGDQQKDDFSKAL
A4S1A2_OSTLU/578-1070................................................................................
A5DBY9_PICGU/617-1163................................................................................
B4IX46_DROGR/568-1290QQQL................................................SNSMHSDDGKLNITGPDDGAAV.LPATG
B3DLV7_XENTR/577-1097................................................................................
Q54KR2_DICDI/821-1497Y...............................................................................
A4HUB1_LEIIN/384-917................................................................................
A1CQK2_ASPCL/664-1234................................................................................
Q57YW4_TRYB2/511-1059................................................................................
TPC11_DANRE/577-1097................................................................................
B0D8K9_LACBS/629-1224................................................................................
Q0CCQ2_ASPTN/665-1233................................................................................
A8N717_COPC7/639-1200................................................................................
A5B032_VITVI/377-937................................................................................
B3M5T6_DROAN/568-1287.SAV................................................SNALQAANAGLQAEEVNLGEETSIAASN
B3S6B6_TRIAD/573-1077................................................................................
B7P2U2_IXOSC/583-1086................................................................................
Q4D1A2_TRYCC/511-1062................................................................................
P90984_CAEEL/775-1075................................................................................
A9V4M9_MONBE/1582-1761................................................................................
B2VQZ9_PYRTR/662-1229................................................................................
A2QPY0_ASPNC/663-1233................................................................................
C4JTF4_UNCRE/662-1239................................................................................
Q2GSS2_CHAGB/391-959................................................................................
Q7Q5C6_ANOGA/565-1322NQSLTHHPSHAALADTTTTNAPGDADGTAVKGGPAATTPSNATSMTTSTGSVDDFKVKPLPLNDASAVSGSKAATVGDEL
C0SG01_PARBP/712-1287................................................................................
Q8L614_ARATH/276-832................................................................................
TPC11_BOVIN/577-1097................................................................................
Q4N165_THEPA/627-1297................................................................................
Q6CF42_YARLI/694-1263................................................................................
Q7S6A3_NEUCR/636-1264................................................................................
Q5AH80_CANAL/196-781................................................................................
Q2UPL2_ASPOR/663-1234................................................................................
B9WKD3_CANDC/668-1247................................................................................
B6QQY0_PENMQ/649-1211................................................................................
A6QX66_AJECN/503-1083................................................................................
Q0UML5_PHANO/649-1218................................................................................
A6S8E4_BOTFB/493-1052................................................................................
B9I0K4_POPTR/546-1104................................................................................
B9T2L8_RICCO/584-1142................................................................................
A1D3G8_NEOFI/665-1235................................................................................
A2EKE8_TRIVA/370-552................................................................................
Q4SVC2_TETNG/484-996................................................................................
A3LPF0_PICST/628-1173................................................................................
Q5BDK6_EMENI/657-1228................................................................................

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138SIPGCIVHCFGVITEHLFKEVDCLLLGAAQGLVLSDPFRCCGSSKFKSVNF...............PSISVVPPLPLLVA
TR120_SCHPO/1-1173HIVGCRVKVFGCEPILQYVYEAKDKHKSLHVYLEKSKDVNAELRSLDTIDHLWTYFPFKKDLKTKSFDCIVIASQPKLSL
A3GI78_PICST/1-1320KIIGFNICIGVCEEQFFRIVDKELTKVALKVKDMDGRSAKKENTLDKVCQNLRNNSIDGR.ISTKNLVLHVIPPQPALSL
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244KITGFDVSIGNCQTQFFHIIDEEKFDHTIKLQKVNQKSKQTTSVLDKVVTNLQSQSVLGR.VMTSSLSLSIIPPQPSLTL
TPPC9_HUMAN/1-1108TVNGYHTTVFGVFSDCLLDNLPG......................................IKTSGSTVEVIPALPRLQI
Q6FUK5_CANGA/1-1224PLSRFDVYPMPQNGGIISPLNINL......................RTTPPLESEA..........LTFKILPEQPELEV
TR120_YEAST/1-1255PLQKFDI............IN.DS......................RRSNPVEEEAEYSK.CIYGKLKIKILPEQPQLEL
A9TGF2_PHYPA/1-1085TVRGCIVKCFGVITEHLFEEVCEW..GSVKGTALLDVFRS.GHKVHQPAQY...............EKVEVVPPLPMLVA

PF04628

TPPC2_CHICK/9-136-------------------------------------------------------------------MLHD.........
Q4X1U7_ASPFU/7-185-------------------------------------------------------------------LLHQPPQLPSTGT
Q6BW18_DEBHA/13-197-------------------------------------------------------------------VGLGMSQAVPEDK
Q7QCA5_ANOGA/9-136-------------------------------------------------------------------MVHD.........
Q55XF0_CRYNB/19-171-------------------------------------------------------------------LSVSM........
Q57YJ1_TRYB2/2-125-------------------------------------------------------------------LMKE.........
Q5CFT6_CRYHO/9-137-------------------------------------------------------------------VVLQ.........
Q4CQS2_TRYCC/4-127-------------------------------------------------------------------LMQE.........
Q5B584_EMENI/11-172-------------------------------------------------------------------IIVDLIGDQT...
TRS20_YEAST/7-171-------------------------------------------------------------------MIHGNS.......
Q7RCP8_PLAYO/11-149-------------------------------------------------------------------LLYKNKNEL....
Q6FVV2_CANGA/7-168-------------------------------------------------------------------MLHGSSVP.....
Q6BRP5_DEBHA/8-164-------------------------------------------------------------------LCYDLNGGN....
Q5KAA6_CRYNJ/23-186-------------------------------------------------------------------LLHD.........
TPPC2_DICDI/8-131-------------------------------------------------------------------LLHE.........
TPC2L_DICDI/9-139-------------------------------------------------------------------IVVL.........
A8X604_CAEBR/10-138-------------------------------------------------------------------ILHT.........
TPPC2_DROME/8-135-------------------------------------------------------------------IVHD.........
TRS20_SCHPO/7-134-------------------------------------------------------------------LLHQ.........
Q6CFC6_YARLI/9-134-------------------------------------------------------------------IGCE.........
Q5A920_CANAL/9-148-------------------------------------------------------------------LCYN.........
Q651C7_ORYSJ/7-136-------------------------------------------------------------------MVTT.........
Q4UE14_THEAN/25-171-------------------------------------------------------------------LVTRSHNPGSND.
Q5DDE1_SCHJA/12-164-------------------------------------------------------------------MIFESHILSS...
Q6C760_YARLI/7-139-------------------------------------------------------------------LLHE.........
Q8IE05_PLAF7/20-159-------------------------------------------------------------------LLYKNRNEG....
Q74ZF3_ASHGO/7-174-------------------------------------------------------------------MIHGTQ.......
TPC2L_HUMAN/7-138-------------------------------------------------------------------MVVDS........
Q6E4A0_CYNDA/9-133-------------------------------------------------------------------LLHD.........
Q5DCH5_SCHJA/9-138-------------------------------------------------------------------LLHD.........
Q6CQN4_KLULA/6-155-------------------------------------------------------------------MVHG.........
Q4PCM0_USTMA/13-185-------------------------------------------------------------------IMLSL........

PF04099

Q20100_CAEEL/5-215-------------------------------------------------------------------VITS---------
Q9P3N1_NEUCS/3-158-------------------------------------------------------------------LFTD---------
O77358_PLAF7/1-144-------------------------------------------------------------------IVHK---------
TRS23_SCHPO/1-132-------------------------------------------------------------------LFTE---------
Q9VA95_DROME/3-137-------------------------------------------------------------------LNTD---------
Q9LZ97_ARATH/4-134-------------------------------------------------------------------VVCE---------
Q9VLI9_DROME/3-209-------------------------------------------------------------------IISE---------
Q9AWN0_ORYSJ/33-178-------------------------------------------------------------------LITH---------
TPPC1_HUMAN/3-137-------------------------------------------------------------------MNTD---------
TPPC4_MOUSE/3-209-------------------------------------------------------------------VLAD---------
Q9SYB8_ARATH/23-168-------------------------------------------------------------------LVTH---------

PF01217

AP3S_SCHPO/1-139-------------------------------------------------------------------FVVD---------
AP1S1_MOUSE/1-142-------------------------------------------------------------------CAIE---------
AP2S_YEAST/2-147-------------------------------------------------------------------MGVD---------
AP2S1_HUMAN/1-142-------------------------------------------------------------------ICVD---------
AP3S_YEAST/1-160-------------------------------------------------------------------FIVD---------
COPZ1_BOVIN/12-153-------------------------------------------------------------------VIGS---------
AP1S1_YEAST/3-146-------------------------------------------------------------------VGMT---------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240.................................................VDIERLAIDDRQSAALTFELDIKWRR.....
Q17IT4_AEDAE/569-1266TK....LKNIYNHTIDCVQLTNNERNGFINAALC......................TVSPVVVLIFGVYCIRWCR.....
B4N3P6_DROWI/571-1279EAGLKSTRLIYNKAMEAIQATGHCRGFIKGVYSL...............EETPSN.......NPIFGIFCIRWRR.....
A2X8W8_ORYSI/587-1138.................................................KGIFSVNPHTISPSFFLGEICLSWSR.....
B6H784_PENCW/663-1219.................................................LDVQKLLLGDRRPTALTCTLEINWRR.....
B8C9G3_THAPS/960-1719.................................N...............TPHSNEFVTMPL.....GILNVKWKP...VG
B0WFL7_CULQU/525-1276QMQ...VKNVYNRAIDCVQLTNNERNGFVNATVSSNGASGNGGRGRSVEPGGGGSDAAAGERTVVFGVYCVRWCR.....
A4S1A2_OSTLU/578-1070.................................................GDAFLHVIPLRSHEHGEDAIRVMWHR.....
A5DBY9_PICGU/617-1163.................................................LFTSRSKSGSHRNVSVSTSVVIEWKR.....
B4IX46_DROGR/568-1290PDAPKSMRVIFNKALDAVQVTGHCRGFIKGVYTL...............DAVASTSVSAPLNPPKFGIFCIRWRR.....
B3DLV7_XENTR/577-1097........................................................VVSNQTGVATGCYVISWKR.....
Q54KR2_DICDI/821-1497.................................................SGWFNLIPLVISESISFGSFIIEWRR.....
A4HUB1_LEIIN/384-917.................................................EEGECVTMVTRFQAKRLGRFNPGFIR.....
A1CQK2_ASPCL/664-1234.................................................LDLQKLVLGDRRPTALNLALEIQWRR.....
Q57YW4_TRYB2/511-1059.................................................DYMESFTVTAKLRVLRTGRVSLGFVR.....
TPC11_DANRE/577-1097........................................................VQNGTSTVASGHYIISWKR.....
B0D8K9_LACBS/629-1224.................................................ISLATDEEISEDLILGPGRFVVKWRR.....
Q0CCQ2_ASPTN/665-1233.................................................LDMQKVVLGDRRPTAVNLALEIVWRR.....
A8N717_COPC7/639-1200.................................................ALIKSDLVSENQPIPSPGKFILSWRR.....
A5B032_VITVI/377-937.................................................KKVFHVIPEVKSSKLSIGTVFLRWRR.....
B3M5T6_DROAN/568-1287QEGPKTTRLVYNKALEAVQGTGHCRGFIKGIYTL...............EESPST.......LPIFGVFCIRWRR.....
B3S6B6_TRIAD/573-1077.....................................................KYKGSIEKSKLNIGKLRINWKR.....
B7P2U2_IXOSC/583-1086.......................................................TPGPVDCATSLGKYTLQWKR.....
Q4D1A2_TRYCC/511-1062.................................................EHLEVLTLSIKFRLLNAGKISLGFIR.....
P90984_CAEEL/775-1075.................................................SAVIRVLVKEDESETPLGRMSVEWRR.....
A9V4M9_MONBE/1582-1761................................................................TLGTVVATWLR.....
B2VQZ9_PYRTR/662-1229.................................................LDVRKNNLEERRATALDTTLDITWRR.....
A2QPY0_ASPNC/663-1233.................................................MDLQKEILGDRRPTALNLALEIRWRR.....
C4JTF4_UNCRE/662-1239.................................................LELQRLTLGDRQTTTLNLALEVKWRR.....
Q2GSS2_CHAGB/391-959.................................................LSAQKLTIDDRSHAPLDISLIIKWTR.....
Q7Q5C6_ANOGA/565-1322TAGKNVTKTIYNRALDCVQLTNNDRNGFINAQCNR..............PDGTGSTVAAGSTWPIFGMYCVRWCR.....
C0SG01_PARBP/712-1287.................................................VEIQRLALDDRSATTVNLALYIRWRR.....
Q8L614_ARATH/276-832.................................................KKVFTVIPTTRTPKLGLGSIHLKWRR.....
TPC11_BOVIN/577-1097........................................................VGNVEGGVATGHYVISWKR.....
Q4N165_THEPA/627-1297.................................V...............NNSEIVYELVNVNILYNNHVLISNTEGKLYG
Q6CF42_YARLI/694-1263.................................................QFDTYREDLEVRSVTVEAVLQIRWKR.....
Q7S6A3_NEUCR/636-1264.................................................IVAQKISLDDRGPAPLDLAMVIRWKR.....
Q5AH80_CANAL/196-781.................................................FITRSKSGFSHRNVTVVSSAIIKWKRRNHND
Q2UPL2_ASPOR/663-1234.................................................VDIHKTVLGDRRPTALNLALEIQWRR.....
B9WKD3_CANDC/668-1247.................................................FITRSKNGFSHRNVVVVNSAIIKWKRRNNND
B6QQY0_PENMQ/649-1211.................................................LDVQKTSLEDRRSVALDLSLNIKWRR.....
A6QX66_AJECN/503-1083.................................................MEIQRLALNNRQPSTLNLALDIRWRR.....
Q0UML5_PHANO/649-1218.................................................LDVRKNNLEERRSTALDTTLDITWQR.....
A6S8E4_BOTFB/493-1052.................................................AFTQKYSLDDRGTATVDLSLVIKWRR.....
B9I0K4_POPTR/546-1104.................................................KKVFTVIPEVESVSLDLGSVSLRWRR.....
B9T2L8_RICCO/584-1142.................................................KKVFTVIPEVESSNVNLGSVSLKWRR.....
A1D3G8_NEOFI/665-1235.................................................LEVQKLILGDRRPTALNLALEIQWRR.....
A2EKE8_TRIVA/370-552.............................................................EDKMIGFIDISYKI.....
Q4SVC2_TETNG/484-996.......................................................LKSDSSIAIATGQYLLLWRR.....
A3LPF0_PICST/628-1173.................................................FTVSSRSGFSHRNAPMVTSVSINWQR.....
Q5BDK6_EMENI/657-1228.................................................LDIQKIILGDRRPTSLNLALEIQWRR.....

PF12584

A8NHA2_COPC7/992-1155-------------------------------------------------------------------T.TLRWGS-----
A7F9J5_SCLS1/1351-1514-------------------------------------------------------------------S.TRNWDT-----
B2W2H3_PYRTR/1490-1643-------------------------------------------------------------------H.TRRWAT-----
B6H3B0_PENCW/1240-1399-------------------------------------------------------------------H.TRRWCS-----
B0XR26_ASPFC/1252-1410-------------------------------------------------------------------H.TRRWSS-----
C5JCH6_AJEDS/1251-1399-------------------------------------------------------------------H.TRRWCP-----
C5FEM2_ARTOC/1257-1416-------------------------------------------------------------------H.TRGWCK-----
C4JLA5_UNCRE/1213-1358-------------------------------------------------------------------H.TRQWCP-----
Q6CDM8_YARLI/995-1119-------------------------------------------------------------------..SKLWDS-----
Q4P224_USTMA/1235-1382-------------------------------------------------------------------T.STLWSC-----
A8PWK6_MALGO/1105-1237-------------------------------------------------------------------I.SLVWSQ-----
B8P4P6_POSPM/992-1139-------------------------------------------------------------------T.SFHWAP-----
B0D3E6_LACBS/1015-1161-------------------------------------------------------------------T.SFHWGS-----
Q6BQQ9_DEBHA/1053-1205-------------------------------------------------------------------S.ITKWSN-----
A5DA23_PICGU/1047-1195-------------------------------------------------------------------T.ISSWAL-----
C4YB04_CLAL4/693-833-------------------------------------------------------------------S.SPKWKS-----
B9WGM9_CANDC/1083-1255-------------------------------------------------------------------T.IIRWSP-----
C4R0Z1_PICPG/1026-1192-------------------------------------------------------------------T.DTRWSD-----
A7TMG8_VANPO/967-1085-------------------------------------------------------------------NLCHQWSQ-----
B9SID3_RICCO/54-178-------------------------------------------------------------------RLKGSGDD-----
A5AE80_VITVI/867-991-------------------------------------------------------------------RLKDFDEN-----
Q9LSR1_ARATH/1141-1266-------------------------------------------------------------------RLKELKES-----
B7FNC5_MEDTR/160-284-------------------------------------------------------------------RLKDLNER-----
Q2QNU0_ORYSJ/1110-1232-------------------------------------------------------------------RLKNPEDA-----
A5BYI0_VITVI/102-216-------------------------------------------------------------------HAVD....-----
A9RFK8_PHYPA/1148-1278-------------------------------------------------------------------RLKEGWAA-----
B3P0R7_DROER/977-1138-------------------------------------------------------------------KV......-----
B0WLN5_CULQU/969-1132-------------------------------------------------------------------KV......-----
B4DI17_HUMAN/276-505-------------------------------------------------------------------RLSDLLEV-----
Q4SZ20_TETNG/1076-1303-------------------------------------------------------------------RLSEPAEG-----
A8PKV5_BRUMA/526-730-------------------------------------------------------------------SL......-----
A8Y1L1_CAEBR/135-260-------------------------------------------------------------------FL......-----

PF08626

Q01I83_ORYSA/1-1138NVV................GGDGSILLYEGEIRDVLITLTNAG.TVPVEEANVALSGKNQDSVISIAHSTWKSAL.....
TR120_SCHPO/1-1173AF...............QNLTSGKFNFAEYETGELVYVIENTS.FVEASHISVLFEDSSSKAFEQAIA....DKSITADR
A3GI78_PICST/1-1320IGI..............S.MTNGWIMLLEGERFNFSIRLANNS.SVLINYLSFSFWDSTIEPLNKKLNASSGSQTLPASD
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244LEI..............S.ASNGCLMLLEGEKHNVTVTLANHS.AQSINYLTFSFWDSNIEFLNKKLT....NPNLTAAE
TPPC9_HUMAN/1-1108STSLPRSAHSLQPSSGDEISTNVSVQLYNGESQQLIIKLENIG.MEPLEKLEVT..................SKVLTTKE
Q6FUK5_CANGA/1-1224MNN..............GKVTGNSWMLLDGTKSQFTILIRNKSLSKSIDQLNVTAV.TNIEHALKADY....WKKMQPDD
TR120_YEAST/1-1255LST..............SKMTRNSWMMLDGTKTDFHITVRNKSLSCAINHIKIIPM.NNIEQMLKPDY....WKKMPPDD
A9TGF2_PHYPA/1-1085RVV................SGEGAAVLYEGEIREMQISLSNAG.VVPVVEAHMTLTGKQQQHVMCIGHSVLEDAL.....

PF04628

TPPC2_CHICK/9-136.........................................V--------------------------------------
Q4X1U7_ASPFU/7-185AGSGSSLLGSSFSVGGGSSSRASSSSIAANP........TSP--------------------------------------
Q6BW18_DEBHA/13-197RDDNK............SSPTPESKDSAQESTKESAKTPSST--------------------------------------
Q7QCA5_ANOGA/9-136.........................................N--------------------------------------
Q55XF0_CRYNB/19-171......................................VDAM--------------------------------------
Q57YJ1_TRYB2/2-125.........................................H--------------------------------------
Q5CFT6_CRYHO/9-137.......................................DHP--------------------------------------
Q4CQS2_TRYCC/4-127.........................................Q--------------------------------------
Q5B584_EMENI/11-172.........................SSVVNE.VR..GSVRAG--------------------------------------
TRS20_YEAST/7-171..............................A.N.....SSVV--------------------------------------
Q7RCP8_PLAYO/11-149...........................NNSI.N....ANMHV--------------------------------------
Q6FVV2_CANGA/7-168............................GGN.K....TTTTT--------------------------------------
Q6BRP5_DEBHA/8-164...........................PGSG.GS...NLQSK--------------------------------------
Q5KAA6_CRYNJ/23-186.........................................V--------------------------------------
TPPC2_DICDI/8-131.........................................K--------------------------------------
TPC2L_DICDI/9-139......................................DTSD--------------------------------------
A8X604_CAEBR/10-138.........................................H--------------------------------------
TPPC2_DROME/8-135.........................................N--------------------------------------
TRS20_SCHPO/7-134.........................................N--------------------------------------
Q6CFC6_YARLI/9-134........................................AQ--------------------------------------
Q5A920_CANAL/9-148.........................................S--------------------------------------
Q651C7_ORYSJ/7-136.......................................DLD--------------------------------------
Q4UE14_THEAN/25-171........................FVIYSSN.TS..PVDPQP--------------------------------------
Q5DDE1_SCHJA/12-164.........................QAAQFS.VS...VHQTH--------------------------------------
Q6C760_YARLI/7-139.........................................T--------------------------------------
Q8IE05_PLAF7/20-159...........................GTNL.TN...TNIYI--------------------------------------
Q74ZF3_ASHGO/7-174..............................N.G.....APVS--------------------------------------
TPC2L_HUMAN/7-138......................................SNTA--------------------------------------
Q6E4A0_CYNDA/9-133.........................................S--------------------------------------
Q5DCH5_SCHJA/9-138.........................................E--------------------------------------
Q6CQN4_KLULA/6-155.......................................NGT--------------------------------------
Q4PCM0_USTMA/13-185......................................TDHA--------------------------------------

PF04099

Q20100_CAEEL/5-215-----------------------------------------A--------------------------------------
Q9P3N1_NEUCS/3-158-----------------------------------------T--------------------------------------
O77358_PLAF7/1-144-----------------------------------------D--------------------------------------
TRS23_SCHPO/1-132-----------------------------------------K--------------------------------------
Q9VA95_DROME/3-137-----------------------------------------T--------------------------------------
Q9LZ97_ARATH/4-134-----------------------------------------P--------------------------------------
Q9VLI9_DROME/3-209-----------------------------------------T--------------------------------------
Q9AWN0_ORYSJ/33-178-----------------------------------------P--------------------------------------
TPPC1_HUMAN/3-137-----------------------------------------L--------------------------------------
TPPC4_MOUSE/3-209-----------------------------------------P--------------------------------------
Q9SYB8_ARATH/23-168-----------------------------------------P--------------------------------------

PF01217

AP3S_SCHPO/1-139----------------------------.EGESELGILDLIQ--------------------------------------
AP1S1_MOUSE/1-142----------------------------.GQDNELITLELIH--------------------------------------
AP2S_YEAST/2-147----------------------------.LLDDEPIYLCHIH--------------------------------------
AP2S1_HUMAN/1-142----------------------------.VNDNNLAYLEAIH--------------------------------------
AP3S_YEAST/1-160----------------------------.DQESELAILDLIQ--------------------------------------
COPZ1_BOVIN/12-153----------------------------.SYENELMLMTVLN--------------------------------------
AP1S1_YEAST/3-146----------------------------PDVDNELLTLEIIH--------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240.......GISEQDVSIADAPDPLPPN---VSLPPETATTSLA--------------------------------------
Q17IT4_AEDAE/569-1266.................SSS....PN---.....MINEAKFV--------------------------------------
B4N3P6_DROWI/571-1279................LNAK......---.....EENESKFT--------------------------------------
A2X8W8_ORYSI/587-1138.............DSSIGES....QD---.....SRVIMKER--------------------------------------
B6H784_PENCW/663-1219..............QSSESV....AS---SDAENSVTTTVLD--------------------------------------
B8C9G3_THAPS/960-1719LTLLVDSLPTIITTDEFSMS....HG---PLPLSDITPMIFY--------------------------------------
B0WFL7_CULQU/525-1276.................SST....PS---.....IVNESKFV--------------------------------------
A4S1A2_OSTLU/578-1070...............THGDS....RC---VKGVPTVILNEYC--------------------------------------
A5DBY9_PICGU/617-1163........PGQHERTNFFET....EE---.....WEIALPLS--------------------------------------
B4IX46_DROGR/568-1290................AGAK......---.....EENESKFI--------------------------------------
B3DLV7_XENTR/577-1097...............SSADN....SV---.....PVVNTMIT--------------------------------------
Q54KR2_DICDI/821-1497................KGQS....SK---.....IISTLPIQ--------------------------------------
A4HUB1_LEIIN/384-917.............IFFAPQR....TA---.....ARLYSDVC--------------------------------------
A1CQK2_ASPCL/664-1234..............SMEDTA....SP---ADHTSATTTTTLP--------------------------------------
Q57YW4_TRYB2/511-1059.............MLISPGS....ST---.....QRIVSDVS--------------------------------------
TPC11_DANRE/577-1097...............KSTFT....ET---.....SVVRTVIT--------------------------------------
B0D8K9_LACBS/629-1224LASVSFKRYFMPTTMKIRNS....QD---AELDDRLSTTFIS--------------------------------------
Q0CCQ2_ASPTN/665-1233.................SSD....ES---SENTHTSTTSTLA--------------------------------------
A8N717_COPC7/639-1200..............ILPDGS....HG---.....KLSTTTTL--------------------------------------
A5B032_VITVI/377-937.............ECGIKEQ....SS---CNTEAAGVLTKHG--------------------------------------
B3M5T6_DROAN/568-1287................ANGK......---.....EENESKFV--------------------------------------
B3S6B6_TRIAD/573-1077...............SKQEY....QQ---.....PEVETDIT--------------------------------------
B7P2U2_IXOSC/583-1086...............SVKEQ....WS---.....TVASQAVT--------------------------------------
Q4D1A2_TRYCC/511-1062.............MILAPGN....GA---.....QHIISDFP--------------------------------------
P90984_CAEEL/775-1075...............AVPNS......---.....CPVRSVAP--------------------------------------
A9V4M9_MONBE/1582-1761..........................---.PGCERRNTLRLE--------------------------------------
B2VQZ9_PYRTR/662-1229.........................T---SDPSAPLVTSSLP--------------------------------------
A2QPY0_ASPNC/663-1233..............SAIDDS....AP---DDGS.TTTTTTLD--------------------------------------
C4JTF4_UNCRE/662-1239..............QDAEAP....SS---SAVELFIPTTTLS--------------------------------------
Q2GSS2_CHAGB/391-959............PSPSTSTN....PT---TTPAPTPNTTALP--------------------------------------
Q7Q5C6_ANOGA/565-1322.................SRT....PN---.....VVNESKFI--------------------------------------
C0SG01_PARBP/712-1287..............PDSDSD......---.SNTTSSTTSTLA--------------------------------------
Q8L614_ARATH/276-832........................EG---GNITEAYVSTKHK--------------------------------------
TPC11_BOVIN/577-1097...............TSATD....GV---.....PVISTVIT--------------------------------------
Q4N165_THEPA/627-1297YKNRIESDQSVNLIYIIKNY....QN---.....YQSLGDNT--------------------------------------
Q6CF42_YARLI/694-1263................HGAE....LQ---ESFEYDANPLRLT--------------------------------------
Q7S6A3_NEUCR/636-1264........LPPSASPETTPPSPSPEK---EDTDETINTTTLP--------------------------------------
Q5AH80_CANAL/196-781....NDNDD..DEIINEFET....PE---.....WEITLPLS--------------------------------------
Q2UPL2_ASPOR/663-1234..............SATDES....ES---AMSSNGTTISTLA--------------------------------------
B9WKD3_CANDC/668-1247NNDNNDNNDNNDQIINEFET....PE---.....WEITLPLS--------------------------------------
B6QQY0_PENMQ/649-1211..................PS....SP---DQDEHTSTVTSLA--------------------------------------
A6QX66_AJECN/503-1083..............PDDDNND...QQ---SSSSSQSTISTLP--------------------------------------
Q0UML5_PHANO/649-1218.........................T---STPDAPTVTSSLP--------------------------------------
A6S8E4_BOTFB/493-1052.................NKD....GS---.....TINTCIVP--------------------------------------
B9I0K4_POPTR/546-1104.............DSEKEDL....ST---SDAKKDWVLTKHK--------------------------------------
B9T2L8_RICCO/584-1142.............DSQNKD.....QL---HSATEAWVSTRHK--------------------------------------
A1D3G8_NEOFI/665-1235..............IGTDAA....AS---SADSANVTTTTLP--------------------------------------
A2EKE8_TRIVA/370-552.........................E---NLDFPDLLHFSLM--------------------------------------
Q4SVC2_TETNG/484-996...............KSSSE....DS---.....PLIHTAVT--------------------------------------
A3LPF0_PICST/628-1173..........KDGLVNNFKS....ED---.....WEITLPLS--------------------------------------
Q5BDK6_EMENI/657-1228...............SGEET....DD---SGRSDRLTTTKLA--------------------------------------

PF12584

A8NHA2_COPC7/992-1155----------------------------------DDE.....--------------------------------------
A7F9J5_SCLS1/1351-1514----------------------------------AYQDDVAS--------------------------------------
B2W2H3_PYRTR/1490-1643----------------------------------PSLLVSAA--------------------------------------
B6H3B0_PENCW/1240-1399----------------------------------PATRENA.--------------------------------------
B0XR26_ASPFC/1252-1410----------------------------------PETRENA.--------------------------------------
C5JCH6_AJEDS/1251-1399----------------------------------PQHREP..--------------------------------------
C5FEM2_ARTOC/1257-1416----------------------------------VSEREA..--------------------------------------
C4JLA5_UNCRE/1213-1358----------------------------------KATREA..--------------------------------------
Q6CDM8_YARLI/995-1119----------------------------------N.......--------------------------------------
Q4P224_USTMA/1235-1382----------------------------------S.......--------------------------------------
A8PWK6_MALGO/1105-1237----------------------------------ASDDD...--------------------------------------
B8P4P6_POSPM/992-1139----------------------------------LEDE....--------------------------------------
B0D3E6_LACBS/1015-1161----------------------------------TAQD....--------------------------------------
Q6BQQ9_DEBHA/1053-1205----------------------------------NKVKAGSE--------------------------------------
A5DA23_PICGU/1047-1195----------------------------------EKSGLENE--------------------------------------
C4YB04_CLAL4/693-833----------------------------------TDVPSPIL--------------------------------------
B9WGM9_CANDC/1083-1255----------------------------------KDQDHEFD--------------------------------------
C4R0Z1_PICPG/1026-1192----------------------------------MDFGKQES--------------------------------------
A7TMG8_VANPO/967-1085----------------------------------........--------------------------------------
B9SID3_RICCO/54-178----------------------------------.QISEHD.--------------------------------------
A5AE80_VITVI/867-991----------------------------------.AVSQNN.--------------------------------------
Q9LSR1_ARATH/1141-1266----------------------------------EAVEQQH.--------------------------------------
B7FNC5_MEDTR/160-284----------------------------------.EISEQN.--------------------------------------
Q2QNU0_ORYSJ/1110-1232----------------------------------...SLLA.--------------------------------------
A5BYI0_VITVI/102-216----------------------------------........--------------------------------------
A9RFK8_PHYPA/1148-1278----------------------------------AQQHDFT.--------------------------------------
B3P0R7_DROER/977-1138----------------------------------H.......--------------------------------------
B0WLN5_CULQU/969-1132----------------------------------H.......--------------------------------------
B4DI17_HUMAN/276-505----------------------------------D.KDEALT--------------------------------------
Q4SZ20_TETNG/1076-1303----------------------------------EMAEESRS--------------------------------------
A8PKV5_BRUMA/526-730----------------------------------........--------------------------------------
A8Y1L1_CAEBR/135-260----------------------------------........--------------------------------------

PF08626

Q01I83_ORYSA/1-1138.............................PIKPGGEVTFAVTLRAWHLSPTDLEA...DGSRSPANSRRIAR........
TR120_SCHPO/1-1173LYELQFEEFNLPTFTVESSQPF.......SLSPGERREIHIKIRAKPN................................
A3GI78_PICST/1-1320VYEIEWYLLQFKP..FRILNKETIMEKYRTIDPQSEIKIDYE...................................I..
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244VHELEWKLLVFKP..FRILNKDVIGE...TINPGGVVELQCE...................................L..
TPPC9_HUMAN/1-1108KLYGDFLSWKLEETLAQF...........PLQPGKVATFTINIKVKLDFSCQENLLQDLSDDGISVSGFPLSSPFRQVVR
Q6FUK5_CANGA/1-1224LNILESNIMWMKNECIKILNKPE......HVQPNEIFELKLE...................................I..
TR120_YEAST/1-1255LYIMEKQLDWLSKSCVRIIKLPT......VIKPNETITFDLE...................................L..
A9TGF2_PHYPA/1-1085.............................PLPPGATVVVPVTLKAGAP..........TADIDLRNLVRLTK........

PF04628

TPPC2_CHICK/9-136-------------------------------------RQEDGIKNFFN-DVYDLYI------------------------
Q4X1U7_ASPFU/7-185-------------------------------------QTEEAVRQFMN-EVYENYV------------------------
Q6BW18_DEBHA/13-197-------------------------------------KKPMKLKDLFS-QLHKSYI------------------------
Q7QCA5_ANOGA/9-136-------------------------------------RNDEGIKNFFN-EMYETYI------------------------
Q55XF0_CRYNB/19-171-------------------------------------IKDADIVAIFR-AVHNLVL------------------------
Q57YJ1_TRYB2/2-125-------------------------------------ESDKETRLFLS-EAYGLCV------------------------
Q5CFT6_CRYHO/9-137-------------------------------------ENEIELRNFFH-NVYKAYV------------------------
Q4CQS2_TRYCC/4-127-------------------------------------EPNKNTRQFMN-EVYGLCV------------------------
Q5B584_EMENI/11-172-------------------------------------VREADLKPAFR-ALQAAYI------------------------
TRS20_YEAST/7-171-------------------------------------IDDNNMRSFYQ-EVHELYV------------------------
Q7RCP8_PLAYO/11-149-------------------------------------PSDDNIKSFFE-LVHENYI------------------------
Q6FVV2_CANGA/7-168-------------------------------------IDDSMVRSFYQ-EVHELYI------------------------
Q6BRP5_DEBHA/8-164-------------------------------------NEDNSIKQFFT-EVNELYV------------------------
Q5KAA6_CRYNJ/23-186-------------------------------------KNDDGIRLFFI-DLWEAYV------------------------
TPPC2_DICDI/8-131-------------------------------------KDEDAIKNFFV-EVHDLYL------------------------
TPC2L_DICDI/9-139-------------------------------------IKDSDLKLFFK-RLQTLFI------------------------
A8X604_CAEBR/10-138-------------------------------------RADEGIKQFFQ-EMYETYI------------------------
TPPC2_DROME/8-135-------------------------------------KNDEGIKNFFN-EMYDTYI------------------------
TRS20_SCHPO/7-134-------------------------------------QSADNIKLFFQ-ELHELYI------------------------
Q6CFC6_YARLI/9-134-------------------------------------EGSESIEQFAK-QVLKVLV------------------------
Q5A920_CANAL/9-148-------------------------------------KEESTIKQFFQ-EVNELYT------------------------
Q651C7_ORYSJ/7-136-------------------------------------VKDADARNFFR-KFHAAYV------------------------
Q4UE14_THEAN/25-171-------------------------------------PSSDNIRYFFR-EVHELYS------------------------
Q5DDE1_SCHJA/12-164-------------------------------------PRDVDIRAMFQ-RLHTAYI------------------------
Q6C760_YARLI/7-139-------------------------------------RNEESIRQFFQ-EVHDLYV------------------------
Q8IE05_PLAF7/20-159-------------------------------------PSDDHIKSFFE-TVHENYI------------------------
Q74ZF3_ASHGO/7-174-------------------------------------VDDGMLKSFYQ-EVHELYI------------------------
TPC2L_HUMAN/7-138-------------------------------------LRDNEIRSMFR-KLHNSYT------------------------
Q6E4A0_CYNDA/9-133-------------------------------------RSEDGIKTFFQ-EVHELYI------------------------
Q5DCH5_SCHJA/9-138-------------------------------------LNENRIKYFFQ-DTYEAYI------------------------
Q6CQN4_KLULA/6-155-------------------------------------VDDTVTRSFYY-EVYELYL------------------------
Q4PCM0_USTMA/13-185-------------------------------------VRDIDMLTLFR-AIYTSYL------------------------

PF04099

Q20100_CAEEL/5-215-------------------------------------ASNIAADSLLS-KMYELYT------------------------
Q9P3N1_NEUCS/3-158-------------------------------------TQ.TNVDVIIR-RIYDLYS------------------------
O77358_PLAF7/1-144-------------------------------------DLNIEMNTYLK-RVYELYS------------------------
TRS23_SCHPO/1-132-------------------------------------KT.TNARLQLQ-KFYELYS------------------------
Q9VA95_DROME/3-137-------------------------------------TAINVKELLQQ-LYAKVWV------------------------
Q9LZ97_ARATH/4-134-------------------------------------GT.PHMESLLR-YIYELYT------------------------
Q9VLI9_DROME/3-209-------------------------------------GL.NGIDLLLR-KVYELYS------------------------
Q9AWN0_ORYSJ/33-178-------------------------------------RTGDQRDTLKH-IYN.LYV------------------------
TPPC1_HUMAN/3-137-------------------------------------GVGPIRDVLHH-IYSALYV------------------------
TPPC4_MOUSE/3-209-------------------------------------RQ.AGIDSLLR-KIYEIYS------------------------
Q9SYB8_ARATH/23-168-------------------------------------KTGDLRESLKY-IYS.LYV------------------------

PF01217

AP3S_SCHPO/1-139-------------------------------------VFVEALDRCFN.NVCELDL------------------------
AP1S1_MOUSE/1-142-------------------------------------RYVELLDKYFG.SVCELDI------------------------
AP2S_YEAST/2-147-------------------------------------LFVEVLDAFFG.NVCELDI------------------------
AP2S1_HUMAN/1-142-------------------------------------NFVEVLNEYFH.NVCELDL------------------------
AP3S_YEAST/1-160-------------------------------------TFVESLDRCFT.EVNELDL------------------------
COPZ1_BOVIN/12-153-------------------------------------CLFDSLSQMLRKNVEKRAL------------------------
AP1S1_YEAST/3-146-------------------------------------RFVETMDTYFG.NVCELDI------------------------

PF12742

B3DLV7_XENTR/1041-1095----------------------------------------------------SLVQ-DIEI......AV-----------
TPC11_MOUSE/1035-1095----------------------------------------------------HLQN-KTDLVQDVEISV-----------
Q4SVC2_TETNG/940-994----------------------------------------------------ALVQ-EVE......MAV-----------
A2FUL4_TRIVA/291-348----------------------------------------------------.ARK-DSELL....IEV-----------
A2FF60_TRIVA/460-517----------------------------------------------------DTEK-ACGIIH...IIV-----------
A2EKE8_TRIVA/494-550----------------------------------------------------HAKT-PLDLF....MLV-----------
A2EQW1_TRIVA/475-534----------------------------------------------------GLPN-ESELLNF.TLCV-----------

PF07919

C5G0L5_ARTOC/657-1240-------------IPRF.VIPMSEPRALASL......GATTGLPGLIQ-INYTLEN.PSMHFLTFSLTM.----------
Q17IT4_AEDAE/569-1266-------------INGI.EVIDPPLNIYCYL......EEKMYVRVPMT-LRVTLKN.PTRRIIQLQALL.----------
B4N3P6_DROWI/571-1279-------------LSGL.NIVEPALNIYCTI......EEKMFVKMPMA-FKVVLKN.PTKQVLHLIATL.----------
A2X8W8_ORYSI/587-1138-------------LPEV.HIEEPPLVVTMEC......PPYAILGIPFT-FHVKIYN.STSLLQEIKYSL.----------
B6H784_PENCW/663-1219-------------IPRF.VVPMGEPRVLASA......TPSSSMAGLIH-MGYVLEN.PSTHFLTFNLVM.----------
B8C9G3_THAPS/960-1719-------------GPQC.KVLNAPFTVKLLKY.....QS.PRVGSQFR-MSYHVQN.QTAQSQNLIFSLG----------
B0WFL7_CULQU/525-1276-------------INGIAEVVDPPLNIYCYL......EEKMYVRVPMT-LRITLKN.PTRKILHLQALL.----------
A4S1A2_OSTLU/578-1070-------------LPNV.TGSQPPLVVELRC......PPKLFVGDPFT-YEVRVSN.ATTANYDIKISV.----------
A5DBY9_PICGU/617-1163-------------DPRV......LLEIEEED............TQSVK-LKYILEN.PTPRIFTFTTSLA----------
B4IX46_DROGR/568-1290-------------ISGL.DIAEPPLNIYCTI......EEKMFVKMPMA-FKVVLKN.PTMHVLHMIATL.----------
B3DLV7_XENTR/577-1097-------------LPHV.MVETIPLHIRADL......PSFGRVRESLP-VKYHLQN.KTSLVQDIEIAV.----------
Q54KR2_DICDI/821-1497-------------LPYI.RTTPNPFLAKVHV......PSFGIVGQPLT-QSIIIKN.NTNFLQEFDLQVI----------
A4HUB1_LEIIN/384-917-------------IPTV.YIEDFGVQVSAKY......PLVTPYGSPLE-LDVSIYN.AAGVPFIGELLL.----------
A1CQK2_ASPCL/664-1234-------------IPRF.IVPTGEPRILASA......VASQTLNGVIH-LDYTLEN.PSTHFLTFNLAM.----------
Q57YW4_TRYB2/511-1059-------------LPEV.ETDDHVLELTLEC......PSTVASGSYVT-LVCNVVN.KTAIPQSCQLTL.----------
TPC11_DANRE/577-1097-------------LPHV.MVENIPLYVHAEV......PSFGRVRESLP-VRYHLEN.RTGLVQDVEISV.----------
B0D8K9_LACBS/629-1224-------------LPSL.RHPSDGLVALLDV......PPVATLHDPIT-LFLTIRNYHPSRSANITVQL.----------
Q0CCQ2_ASPTN/665-1233-------------VPRF.VVPSGEPRVLASA......VGSNALPGLVH-VDYTLEN.PSTHFLTFNLTM.----------
A8N717_COPC7/639-1200-------------LPIL.QPPMDELVALMDI......EPTGVLHKPMP-MTIIVRNNHPHRSANVTVQL.----------
A5B032_VITVI/377-937-------------LPDV.NVELSPLIVRLEC......PPHAILGVPFT-YIIKIQN.QTHLLQEIKFSL.----------
B3M5T6_DROAN/568-1287-------------ISGL.DIAEPPLNIYCTI......EEKMFVKMPMA-FKVVLKN.PTTHVLHLIANL.----------
B3S6B6_TRIAD/573-1077-------------LPTV.LIDTSPIYIVIDK......PAYGCLRTALP-VTYELHN.RTNLVQEVEINI.----------
B7P2U2_IXOSC/583-1086-------------LPCV.EVQGCPLLLELQA......PAHGSVRTPLT-VSYLVHN.RTLLVQDIELVM.----------
Q4D1A2_TRYCC/511-1062-------------LPEV.KVEDTPFVLSLRG......PSIAIIGSPIL-ISFDITN.KTENFQNCELLV.----------
P90984_CAEEL/775-1075-------------LCRI.PVLACPISISSHIK.....TNPAIVRQPIE-ICFELKS.HSKEAVEISTNF.----------
A9V4M9_MONBE/1582-1761-------------LPEI.VAQEMRLRAHVQA......PSTCRSGETVK-VELVVRA.RSGYIEEAELLM.----------
B2VQZ9_PYRTR/662-1229-------------IPRI.QIPSSEPRVLASS......TLSDEIPCLVH-LDYYLEN.PTMHFLVFELAM.----------
A2QPY0_ASPNC/663-1233-------------IPRF.VIPAGEPRVLASA......KASDTLSGLIH-LDYTLEN.PSMHFLTFNLSM.----------
C4JTF4_UNCRE/662-1239-------------VPRF.VIPMGEPRVLATV......TRASALPNFIH-LDYTLEN.PSIHFLTFTITM.----------
Q2GSS2_CHAGB/391-959-------------IPRF.TLFGTEPRVLASVAHR...RGGRGTTPLIT-LTITIEN.ASNHFLTFGLAM.----------
Q7Q5C6_ANOGA/565-1322-------------INGI.EVIDPPLNLYCYI......EQRMYVRLPMT-LRITLRN.PTRRILHLQAIL.----------
C0SG01_PARBP/712-1287-------------ISRF.LVPLGEPRVLASA......TPSPQLPGFLH-LDYTLEN.PSLHFLTFNLTM.----------
Q8L614_ARATH/276-832-------------LPEV.NVEASPLVMSLDS......PPYVILGEPFT-YAVRICN.QTQLLQEAKFGL.----------
TPC11_BOVIN/577-1097-------------LPHV.IVENIPLHVNADL......PSFGRVRESLP-VRYHLQN.KTDLVQDVEISV.----------
Q4N165_THEPA/627-1297-------------VQKFVKVEKLNNKIQLLLKH....RNIVHLGEPFE-LHAEIIN.NTNNTIEYVVFL.----------
Q6CF42_YARLI/694-1263-------------LPIL......EPRCIAHLP.....NGSVSRGESFQ-MDYYIEN.ATAHVLTFMMTLG----------
Q7S6A3_NEUCR/636-1264-------------CPRF.SLFGIEPRVLAHVTYLDTYNPEDSFTPLIL-LRVIIEN.ASNHFLTFGVSM.----------
Q5AH80_CANAL/196-781-------------EPRV......LFRIIEQEQEQ...EQDAKHNNGYK-LQYILEN.PTPRVFTFTTQLT----------
Q2UPL2_ASPOR/663-1234-------------IPRF.VVPGGEPRVLASA......MTSQIRSGLIH-LDYTIEN.PSMHFLTFNLTM.----------
B9WKD3_CANDC/668-1247-------------EPRV......LFHI..........EQDIKYNNIYK-LQYILEN.PTPRIFTFITQLT----------
B6QQY0_PENMQ/649-1211-------------MPRF.TIPTGEPRVLASA......SPSKEHPGLIH-MDYTLEN.PSMHTLTFSLTM.----------
A6QX66_AJECN/503-1083-------------IPRF.LVPLVEPRVLAHT......TPSTTLPGFLH-LDYTLEN.PSMHFLTFNITM.----------
Q0UML5_PHANO/649-1218-------------IPRI.QIPSSEPRVLASA......AVSGAVNSLVH-LDYTLEN.PTMHFLTFELSM.----------
A6S8E4_BOTFB/493-1052-------------VPRL.LVSSSEPRVLAAV......TYSSTIPSMIH-FDVTIEN.PSHHFLSFAITM.----------
B9I0K4_POPTR/546-1104-------------LPDI.KVESPPLVLSLEC......PPYAVLGDPIM-YLIKIRN.QTRLLQEVKFSL.----------
B9T2L8_RICCO/584-1142-------------LPDV.NVELSPLVLIVEC......PPYAILGDPFT-YSVKIRN.QTPLLQELNFSL.----------
A1D3G8_NEOFI/665-1235-------------IPRF.VMPAGEPRVLASA......LASEAIPGLIH-LDYTLEN.PSMHFLTFNLAM.----------
A2EKE8_TRIVA/370-552-------------LPKA.TVVSREIEVKTDF......PLQTSQYIETE-FSIEITS.HAKTPLDLFMLV.----------
Q4SVC2_TETNG/484-996-------------LPSV.NLETIPLYIYADL......PSFGRVRESLS-VRYHIQN.RTALVQEVEMAV.----------
A3LPF0_PICST/628-1173-------------DPRV......LLVL..........DEDVKEAGKVK-LTYILEN.PTPRIFTFTTQMD----------
Q5BDK6_EMENI/657-1228-------------IPRF.VIPAGEPRVLASA......ISSRKFPGLIH-VEYTLEN.PSLHFLTFSLTM.----------

PF12584

A8NHA2_COPC7/992-1155-------------.........................SARRH....V-LNYHI.E------------------------
A7F9J5_SCLS1/1351-1514-------------........................P.EEDL....E-FVYEV.T------------------------
B2W2H3_PYRTR/1490-1643-------------SI....................DTP.TDPI....D-FYYTI.D------------------------
B6H3B0_PENCW/1240-1399-------------..........................DQPL....E-CSYEI.H------------------------
B0XR26_ASPFC/1252-1410-------------..........................GGTL....E-FSYEI.H------------------------
C5JCH6_AJEDS/1251-1399-------------..........................ESSL....E-FSYEL.L------------------------
C5FEM2_ARTOC/1257-1416-------------..........................QPSL....E-FMYEV.I------------------------
C4JLA5_UNCRE/1213-1358-------------..........................QPSL....E-FMYEI.I------------------------
Q6CDM8_YARLI/995-1119-------------.........................LAPDT....R-FFYEI.L------------------------
Q4P224_USTMA/1235-1382-------------.........................SHEGE....I-MVYDI.V------------------------
A8PWK6_MALGO/1105-1237-------------..........................DVST....V-LQYNI.L------------------------
B8P4P6_POSPM/992-1139-------------.........................KPQGC....L-LRYDI.E------------------------
B0D3E6_LACBS/1015-1161-------------.........................TGRRY....N-LRFNI.E------------------------
Q6BQQ9_DEBHA/1053-1205-------------DEIEI..............LAESSPSKPEKPSVQK-ENFQLSI------------------------
A5DA23_PICGU/1047-1195-------------EIL.................ASSSP.KRGEPVKKK-HSFQASL------------------------
C4YB04_CLAL4/693-833-------------ASS.................SPVAK.KTPA....S-RNFHFSV------------------------
B9WGM9_CANDC/1083-1255-------------YSENQSQPLAVSSPQRNKSKNSNENMDNSTPVVTK-DQFQLVI------------------------
C4R0Z1_PICPG/1026-1192-------------CSELSNDDKETVDKTTGEEKKVELNRNINK....K-YCFSLEV------------------------
A7TMG8_VANPO/967-1085-------------.........................CESQG....S-FCFEI..------------------------
B9SID3_RICCO/54-178-------------........................G.........E-VLYEV.S------------------------
A5AE80_VITVI/867-991-------------........................D.........E-VLYEV.N------------------------
Q9LSR1_ARATH/1141-1266-------------........................D.........E-VLYEV.N------------------------
B7FNC5_MEDTR/160-284-------------........................D.........E-VLYEV.N------------------------
Q2QNU0_ORYSJ/1110-1232-------------........................D.........E-ILYQV.D------------------------
A5BYI0_VITVI/102-216-------------..................................E-VLYEV.N------------------------
A9RFK8_PHYPA/1148-1278-------------........................EKNDSE....D-LYYEL.K------------------------
B3P0R7_DROER/977-1138-------------.........................ENPYT....D-LMYEV.L------------------------
B0WLN5_CULQU/969-1132-------------.........................ANPFT....D-LMYEV.L------------------------
B4DI17_HUMAN/276-505-------------E......................SDEHFST....K-LMYEV.V------------------------
Q4SZ20_TETNG/1076-1303-------------D......................LDGLKTT....K-LMYQV.A------------------------
A8PKV5_BRUMA/526-730-------------.........................TNRVE....T-VVVGI.D------------------------
A8Y1L1_CAEBR/135-260-------------.........................KESSC....S-LLIVL.D------------------------

PF08626

Q01I83_ORYSA/1-1138.............EGSNPFLDIHYAGP...SGNSESNDVSLPPGRRLV-VPLNICVVQGMRLVRARLLSMELPARFTDAH
TR120_SCHPO/1-1173......................SQEGLILFESSVHKPEDTEFYVRRLR-IPVSLNISKRVDLKQWSAFMD..........
A3GI78_PICST/1-1320.............NGRRG...MKESKIILEYAHKESEDLSKNYIKYVN-IPLNVSIMPSLEIVGCDILPL.........F
B9HAT3_POPTR/1-113................................................-...............................
Q5ACN8_CANAL/1-1244.............TSRKF...MNESKIILEYAHK..SDTEQSFMKNLN-IPLNVSVMPSIDVVGCEMLPA.........I
TPPC9_HUMAN/1-1108PRVEGKPVNPPESNKAGDYSHVKTLEAVLNFKYSGGPGHTEGYYRNLS-LGLHVEVEPSVFFTRVSTLPA..........
Q6FUK5_CANGA/1-1224.............DTVRAPFEFESFIVVVEYGMQE.EDKSCFYMKKLK-IPYEVTLRRSIEVPNMDLIPL.........N
TR120_YEAST/1-1255.............DNTAVPFNFTGFDLLIEYGMSA.TDESCIYLKKLS-IPYEVTLRRTIEVPSMDIIPL.........N
A9TGF2_PHYPA/1-1085.............DTASPMLVIHYAGPLLQEG......ADPPPGRRVA-LPLQLHVLKGLCLVQAKFLSMEVAANISSSL

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240--------------------------------------------------------------------............
Q17IT4_AEDAE/569-1266--------------------------------------------------------------------............
B4N3P6_DROWI/571-1279--------------------------------------------------------------------............
A2X8W8_ORYSI/587-1138--------------------------------------------------------------------............
B6H784_PENCW/663-1219--------------------------------------------------------------------............
B8C9G3_THAPS/960-1719--------------------------------------------------------------------DTTSGDSTN...
B0WFL7_CULQU/525-1276--------------------------------------------------------------------............
A4S1A2_OSTLU/578-1070--------------------------------------------------------------------............
A5DBY9_PICGU/617-1163--------------------------------------------------------------------PN..........
B4IX46_DROGR/568-1290--------------------------------------------------------------------............
B3DLV7_XENTR/577-1097--------------------------------------------------------------------............
Q54KR2_DICDI/821-1497--------------------------------------------------------------------NPPS........
A4HUB1_LEIIN/384-917--------------------------------------------------------------------............
A1CQK2_ASPCL/664-1234--------------------------------------------------------------------............
Q57YW4_TRYB2/511-1059--------------------------------------------------------------------............
TPC11_DANRE/577-1097--------------------------------------------------------------------............
B0D8K9_LACBS/629-1224--------------------------------------------------------------------............
Q0CCQ2_ASPTN/665-1233--------------------------------------------------------------------............
A8N717_COPC7/639-1200--------------------------------------------------------------------............
A5B032_VITVI/377-937--------------------------------------------------------------------............
B3M5T6_DROAN/568-1287--------------------------------------------------------------------............
B3S6B6_TRIAD/573-1077--------------------------------------------------------------------............
B7P2U2_IXOSC/583-1086--------------------------------------------------------------------............
Q4D1A2_TRYCC/511-1062--------------------------------------------------------------------............
P90984_CAEEL/775-1075--------------------------------------------------------------------............
A9V4M9_MONBE/1582-1761--------------------------------------------------------------------............
B2VQZ9_PYRTR/662-1229--------------------------------------------------------------------............
A2QPY0_ASPNC/663-1233--------------------------------------------------------------------............
C4JTF4_UNCRE/662-1239--------------------------------------------------------------------............
Q2GSS2_CHAGB/391-959--------------------------------------------------------------------............
Q7Q5C6_ANOGA/565-1322--------------------------------------------------------------------............
C0SG01_PARBP/712-1287--------------------------------------------------------------------............
Q8L614_ARATH/276-832--------------------------------------------------------------------............
TPC11_BOVIN/577-1097--------------------------------------------------------------------............
Q4N165_THEPA/627-1297--------------------------------------------------------------------............
Q6CF42_YARLI/694-1263--------------------------------------------------------------------DATAPVAATGMI
Q7S6A3_NEUCR/636-1264--------------------------------------------------------------------............
Q5AH80_CANAL/196-781--------------------------------------------------------------------............
Q2UPL2_ASPOR/663-1234--------------------------------------------------------------------............
B9WKD3_CANDC/668-1247--------------------------------------------------------------------............
B6QQY0_PENMQ/649-1211--------------------------------------------------------------------............
A6QX66_AJECN/503-1083--------------------------------------------------------------------............
Q0UML5_PHANO/649-1218--------------------------------------------------------------------............
A6S8E4_BOTFB/493-1052--------------------------------------------------------------------............
B9I0K4_POPTR/546-1104--------------------------------------------------------------------............
B9T2L8_RICCO/584-1142--------------------------------------------------------------------............
A1D3G8_NEOFI/665-1235--------------------------------------------------------------------............
A2EKE8_TRIVA/370-552--------------------------------------------------------------------............
Q4SVC2_TETNG/484-996--------------------------------------------------------------------............
A3LPF0_PICST/628-1173--------------------------------------------------------------------AD..........
Q5BDK6_EMENI/657-1228--------------------------------------------------------------------............

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
B0XR26_ASPFC/1252-1410--------------------------------------------------------------------------------
C5JCH6_AJEDS/1251-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
Q6CDM8_YARLI/995-1119--------------------------------------------------------------------------------
Q4P224_USTMA/1235-1382--------------------------------------------------------------------------------
A8PWK6_MALGO/1105-1237--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
Q6BQQ9_DEBHA/1053-1205--------------------------------------------------------------------------------
A5DA23_PICGU/1047-1195--------------------------------------------------------------------------------
C4YB04_CLAL4/693-833--------------------------------------------------------------------------------
B9WGM9_CANDC/1083-1255--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A7TMG8_VANPO/967-1085--------------------------------------------------------------------------------
B9SID3_RICCO/54-178--------------------------------------------------------------------------------
A5AE80_VITVI/867-991--------------------------------------------------------------------------------
Q9LSR1_ARATH/1141-1266--------------------------------------------------------------------------------
B7FNC5_MEDTR/160-284--------------------------------------------------------------------------------
Q2QNU0_ORYSJ/1110-1232--------------------------------------------------------------------------------
A5BYI0_VITVI/102-216--------------------------------------------------------------------------------
A9RFK8_PHYPA/1148-1278--------------------------------------------------------------------------------
B3P0R7_DROER/977-1138--------------------------------------------------------------------------------
B0WLN5_CULQU/969-1132--------------------------------------------------------------------------------
B4DI17_HUMAN/276-505--------------------------------------------------------------------------------
Q4SZ20_TETNG/1076-1303--------------------------------------------------------------------------------
A8PKV5_BRUMA/526-730--------------------------------------------------------------------------------
A8Y1L1_CAEBR/135-260--------------------------------------------------------------------------------

PF08626

Q01I83_ORYSA/1-1138LRSVSSKDNLSNGSDAIRNDISLLKIDPYKGSWDLRLLELELFNPTDVVFDVDVSVHLDGTSVEQKILPEDKTASSACHK
TR120_SCHPO/1-1173............................TEGDPSYCLVLLNFYNHFSE..PLF..............VTVKTASTDESRS
A3GI78_PICST/1-1320SDLILENLD.NVLSFITKVIKADTE.....EISDYCLFLVDIRNSWNE..KLS..........CSLSYSFDETSSFDVNE
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244S.....ISD.NVPHSIGQALKC.VK.....NVDDYCLLVLDLRNSWGE..RLE..........CNLKY.....NEFELSE
TPPC9_HUMAN/1-1108..............................TSTRQCHLLLDVFNSTEH..ELT...................VSTRSSEA
Q6FUK5_CANGA/1-1224HMNFTNTSDSSWIAYIQS.LSNKSNDAFSYSAKDYMLLLLDFRNSWID..GIH..........IEVTY.....EDFVSKG
TR120_YEAST/1-1255ELFSSQVENVDWIEYVMSKIRAESN....LHSRDFILLLLDFRNSWID..GIK..........LNVQF.....EDFTSNE
A9TGF2_PHYPA/1-1085PDSVARDQPSESE.......ESLVKMDPYRGSWGMRLLELELWNATDVLFEIVVTSKEAGEGGSMV.....EDAECLYPR

PF04628

TPPC2_CHICK/9-136---KF--AM-NPFY..........................ELNS............PI----------------------
Q4X1U7_ASPFU/7-185---KT--AM-NPFY..........................RQGM............EI----------------------
Q6BW18_DEBHA/13-197---HI--IC-NPFTNLS....................GSLADNE............TI----------------------
Q7QCA5_ANOGA/9-136---KY--LM-NPFY..........................MPNT............PI----------------------
Q55XF0_CRYNB/19-171---IA--CN-NPFLSLPP.................SFHAISANKHADGQAENLTNPSL----------------------
Q57YJ1_TRYB2/2-125---RY--LM-NPFS..........................SLKT............PV----------------------
Q5CFT6_CRYHO/9-137---DS--IC-NPFL..............................L..........RTI----------------------
Q4CQS2_TRYCC/4-127---RY--LL-NPFS..........................FPNT............PV----------------------
Q5B584_EMENI/11-172---RL--LQ-NPFY..........................SPDDHAIINGAVQGTRPS----------------------
TRS20_YEAST/7-171---KT--LM-NPFY..........................KITD............PI----------------------
Q7RCP8_PLAYO/11-149---KV--LL-NPLY..........................EPNG............II----------------------
Q6FVV2_CANGA/7-168---KT--IM-NPFY..........................QEGD............EL----------------------
Q6BRP5_DEBHA/8-164---KC--LL-NPFY..........................SVND............AI----------------------
Q5KAA6_CRYNJ/23-186---KI--LL-NPFF..........................TTNT............PI----------------------
TPPC2_DICDI/8-131---KI--LL-NPFY..........................EYNK............PI----------------------
TPC2L_DICDI/9-139---NT--TS-NPFY..........................KPNS............KV----------------------
A8X604_CAEBR/10-138---KH--AM-NPFY..........................EIDD............VI----------------------
TPPC2_DROME/8-135---KN--SM-NAFY..........................RINT............PI----------------------
TRS20_SCHPO/7-134---KT--LM-SPFY..........................QPNQ............PI----------------------
Q6CFC6_YARLI/9-134---AY--KS-NPFY..........................DETE............TS----------------------
Q5A920_CANAL/9-148---KC--LM-NPFY..........................NVDD............AI----------------------
Q651C7_ORYSJ/7-136---DA--VS-NPFH..........................VPGK............KI----------------------
Q4UE14_THEAN/25-171---KQ--LM-NPLY..........................VFNT............SL----------------------
Q5DDE1_SCHJA/12-164---DL--VC-SPFY..........................KPGT............PI----------------------
Q6C760_YARLI/7-139---KT--LL-SPFY..........................FVNQ............PI----------------------
Q8IE05_PLAF7/20-159---KV--LL-NPLY..........................EPNG............II----------------------
Q74ZF3_ASHGO/7-174---KT--LM-NPFY..........................KVDE............PI----------------------
TPC2L_HUMAN/7-138---DV--MC-NPFY..........................NPGD............RI----------------------
Q6E4A0_CYNDA/9-133---KI--FL-NPLY..........................LPGS............RI----------------------
Q5DCH5_SCHJA/9-138---KL--AL-NPFF..........................ERDK............PI----------------------
Q6CQN4_KLULA/6-155---KT--LM-NPFY..........................KVND............PI----------------------
Q4PCM0_USTMA/13-185---KY--SA-NPFHSLPPAAFAPEKDQQKEDSQARALRLQEESQSRQQSNLAVNCRQI----------------------

PF04099

Q20100_CAEEL/5-215---DF--ALKNPFY--------------------------SIDM------------PI----------------------
Q9P3N1_NEUCS/3-158---DY--VMKNPFY--------------------------QLEM------------PI----------------------
O77358_PLAF7/1-144---DI--ILKNPFY--------------------------DIDM------------PI----------------------
TRS23_SCHPO/1-132---DY--VLKNPFY--------------------------TLEM------------PI----------------------
Q9VA95_DROME/3-137---EF--VVRDPLW--------------------------TPGT------------VV----------------------
Q9LZ97_ARATH/4-134---DY--VLKNPFY--------------------------EIEM------------PI----------------------
Q9VLI9_DROME/3-209---DY--VLKNPFY--------------------------SLEM------------PI----------------------
Q9AWN0_ORYSJ/33-178---EY--VVKNPLY--------------------------APGT------------PI----------------------
TPPC1_HUMAN/3-137---EL--VVKNPLC--------------------------PLGQ------------TV----------------------
TPPC4_MOUSE/3-209---DF--ALKNPFY--------------------------SLEM------------PI----------------------
Q9SYB8_ARATH/23-168---EY--VVKNPIY--------------------------SPGS------------PI----------------------

PF01217

AP3S_SCHPO/1-139---VF--KFQEIHA--------------------------ILAE------------VV----------------------
AP1S1_MOUSE/1-142---IF--NFEKAYF--------------------------ILDE------------FL----------------------
AP2S_YEAST/2-147---VF--NFYKVYM--------------------------IMDE------------MF----------------------
AP2S1_HUMAN/1-142---VF--NFYKVYT--------------------------VVDE------------MF----------------------
AP3S_YEAST/1-160---IF--NWQTLES--------------------------VLEE------------IV----------------------
COPZ1_BOVIN/12-153---LE--NMEGLFL--------------------------AVDE------------IV----------------------
AP1S1_YEAST/3-146---IF--NFSKVYD--------------------------ILNE------------MI----------------------

PF12742

B3DLV7_XENTR/1041-1095---EP..SDA--FM--------------------------FSGLK------MIRLQ-I-----------------LP---
TPC11_MOUSE/1035-1095---EP..SDA--FM--------------------------FSGLK------QIRLR-I-----------------LP---
Q4SVC2_TETNG/940-994---EP..SDA--FM--------------------------FSGLK------QVRLR-I-----------------VR---
A2FUL4_TRIVA/291-348---RENSNEN--FI--------------------------VCGMT------KSNFH-M-----------------DA---
A2FF60_TRIVA/460-517---DK..SSQ--FA--------------------------EIGPS------EVNTV-V-----------------WS---
A2EKE8_TRIVA/494-550---GE..SKN--FF--------------------------IKGPN------LLPIS-L-----------------LP---
A2EQW1_TRIVA/475-534---EK..TPN--FF--------------------------LEGPG------KLNFH-M-----------------WR---

PF07919

C5G0L5_ARTOC/657-1240...EA--SDQ..FA--------------------------FSGPK......SLAVQ.L-----------------VP...
Q17IT4_AEDAE/569-1266...NS--SDS..FM--------------------------FSGHR......QLNVT.I-----------------FA...
B4N3P6_DROWI/571-1279...SI--SSTDNFI--------------------------CSGHK......QLDLS.I-----------------MA...
A2X8W8_ORYSI/587-1138...VD--SQN..FV--------------------------FSGAH......NHAAS.I-----------------LP...
B6H784_PENCW/663-1219...EA--SEH..FA--------------------------FSGPK......TTVVQ.L-----------------VP...
B8C9G3_THAPS/960-1719...TT--DSR..VL--------------------------VTGKL......KGELH.M-----------------AP...
B0WFL7_CULQU/525-1276...NS--SDS..FM--------------------------FSGHR......QLNVT.I-----------------FA...
A4S1A2_OSTLU/578-1070...TD--STG..FV--------------------------FAGIK......RGTMY.V-----------------PP...
A5DBY9_PICGU/617-1163...ET--TDGTSWD--------------------------VSDTRNTSPLEQPAFP.V-----------------LP...
B4IX46_DROGR/568-1290...AI--SKSDNFI--------------------------CSGHK......QLDIS.I-----------------MA...
B3DLV7_XENTR/577-1097...EP--SDA..FM--------------------------FSGLK......MIRLQ.I-----------------LP...
Q54KR2_DICDI/821-1497...YG--NSDIPFF--------------------------FSGDK......QSTFS.I-----------------HP...
A4HUB1_LEIIN/384-917...DP--QTD.DFV--------------------------CAATT......RRSLQ.I-----------------GP...
A1CQK2_ASPCL/664-1234...EA--SEN..FA--------------------------FSGPK......TMVVQ.L-----------------VP...
Q57YW4_TRYB2/511-1059...ER--NGE.FFL--------------------------VGGIE......QWNFP.I-----------------GP...
TPC11_DANRE/577-1097...EP--SDA..FM--------------------------FSGLK......QVRMR.I-----------------LP...
B0D8K9_LACBS/629-1224...ET--DALDGFI--------------------------VAGLR......SGRIPVL-----------------LP...
Q0CCQ2_ASPTN/665-1233...EA--SEH..FA--------------------------FSGPK......TMVVQ.L-----------------VP...
A8N717_COPC7/639-1200...DP--DSGDGFV--------------------------VSGVR......AARVPVL-----------------LP...
A5B032_VITVI/377-937...GD--SPS..FV--------------------------LSGSH......NDTIF.V-----------------IP...
B3M5T6_DROAN/568-1287...SI--SKTDNFI--------------------------CSGHK......QLDIS.I-----------------MA...
B3S6B6_TRIAD/573-1077...DP--CES..FM--------------------------FTGLK......QVNLR.I-----------------LP...
B7P2U2_IXOSC/583-1086...DS--SDA..FM--------------------------YSGNK............L-----------------VCHAS
Q4D1A2_TRYCC/511-1062...EK--NNG.CFL--------------------------MNGRT......QWSFC.L-----------------AP...
P90984_CAEEL/775-1075...DL--NDV..FM--------------------------FSGER......KVTMT.V-----------------LP...
A9V4M9_MONBE/1582-1761...EQ--TPD..FM--------------------------LAGDP......NQVLR.I-----------------LPGAA
B2VQZ9_PYRTR/662-1229...EA--SED..FG--------------------------FSGAK......LRTLH.C-----------------LP...
A2QPY0_ASPNC/663-1233...EA--SEN..FA--------------------------FSGPK......TMVVQ.L-----------------VP...
C4JTF4_UNCRE/662-1239...EA--SDQ..FA--------------------------FSGPK......SLAVQ.L-----------------VP...
Q2GSS2_CHAGB/391-959...EP--SET..FA--------------------------FSGPK......LTTAS.L-----------------LP...
Q7Q5C6_ANOGA/565-1322...NS--SDS..FM--------------------------FAGHR......QLNVS.I-----------------FA...
C0SG01_PARBP/712-1287...EA--SDQ..FA--------------------------FHGPK......SMALQ.L-----------------VP...
Q8L614_ARATH/276-832...AD--AQS..FV--------------------------LSGSH......SNTVS.V-----------------LP...
TPC11_BOVIN/577-1097...EP--SDA..FM--------------------------FSGLK......QIRLR.I-----------------LP...
Q4N165_THEPA/627-1297...DE--CEDRVYI--------------------------ISGPL......SLNLV.A-----------------LP...
Q6CF42_YARLI/694-1263PPKDT--PAD..FL--------------------------YDGPR......KFSLR.L-----------------LP...
Q7S6A3_NEUCR/636-1264...DT--SAE..FA--------------------------FSGPK......LSAVP.V-----------------LP...
Q5AH80_CANAL/196-781...DY--EDQ..WI--------------------------FNNSKNIVPLIQPPFP.V-----------------LP...
Q2UPL2_ASPOR/663-1234...EA--SEN..FA--------------------------FSGPK......TLVVQ.L-----------------VP...
B9WKD3_CANDC/668-1247...DY--ENQ..WI--------------------------FNDSKNIIPLIQPQFP.V-----------------LP...
B6QQY0_PENMQ/649-1211...DA--SEH..FA--------------------------FSGSK......TRALQ.L-----------------VP...
A6QX66_AJECN/503-1083...EA--SDQ..FA--------------------------FHGPK......ATTLQ.L-----------------VP...
Q0UML5_PHANO/649-1218...EA--SEE..FG--------------------------FSGAK......LRSLH.L-----------------LP...
A6S8E4_BOTFB/493-1052...DP--SEQ..FA--------------------------FSGVK......QSTLQ.L-----------------VP...
B9I0K4_POPTR/546-1104...AD--AQS..FV--------------------------LSGSH......SDTVF.V-----------------LP...
B9T2L8_RICCO/584-1142...AD--VQS..FV--------------------------LAGSH......SDTVF.V-----------------LP...
A1D3G8_NEOFI/665-1235...EA--SEH..FA--------------------------FSGPK......TAVVQ.L-----------------VP...
A2EKE8_TRIVA/370-552...GE--SKN..FF--------------------------IKGPN......LLPIS.L-----------------LP...
Q4SVC2_TETNG/484-996...EP--SDA..FM--------------------------FSGLK......QVRLR.I-----------------VR...
A3LPF0_PICST/628-1173...DP--SST..WD--------------------------FSDVRNIVPVKQAAFP.V-----------------LP...
Q5BDK6_EMENI/657-1228...EA--SEY..FA--------------------------FSGPK......TMVVQ.L-----------------AP...

PF12584

A8NHA2_COPC7/992-1155---DM--TRE--WL--------------------------IGGIK------QGDFI-AEVLLYSRLGKNTMLTTLQN---
A7F9J5_SCLS1/1351-1514---GP--SDT--WL--------------------------IGGKR------KGHFK-VPRR............IDGK---
B2W2H3_PYRTR/1490-1643---AN--PDV--WL--------------------------VAGPR------RAQFS-A.................KE---
B6H3B0_PENCW/1240-1399---AN--PDQ--WQ--------------------------IGGRR------RGNFL-A.................RD---
B0XR26_ASPFC/1252-1410---AN--PEL--WL--------------------------IGGRR------RGNFV-A.................SE---
C5JCH6_AJEDS/1251-1399---VN--PDI--WL--------------------------VGGRR------RGNFT-A.................TE---
C5FEM2_ARTOC/1257-1416---AN--PEL--WV--------------------------IGGRR------RGNFS-C.................AE---
C4JLA5_UNCRE/1213-1358---TN--PDT--WL--------------------------VGGRR------RGNFS-A.................EE---
Q6CDM8_YARLI/995-1119---PL--PDT--WT--------------------------VYGRR------KGHFV-P.................AD---
Q4P224_USTMA/1235-1382---PD--FET--WL--------------------------VDGCK------RGSFK-V.................KP---
A8PWK6_MALGO/1105-1237---TD--FDN--WL--------------------------VWGNK------KGMWE-IPA..............QQL---
B8P4P6_POSPM/992-1139---DM--TGD--WL--------------------------VSGCK------RSDFQ-A.................ED---
B0D3E6_LACBS/1015-1161---EM--VRE--WL--------------------------VSGPK------RGDFI-A.................MD---
Q6BQQ9_DEBHA/1053-1205---QT--DDN--WL--------------------------ISGFR------KESFQ-IDY..............VAN---
A5DA23_PICGU/1047-1195---LY--DEN--WL--------------------------ISGFK------REIFE-VDY..............STG---
C4YB04_CLAL4/693-833---VQ--EEN--WI--------------------------ISGFK------KQSFE-ID................ES---
B9WGM9_CANDC/1083-1255---QQ--DDN--WL--------------------------MSGFR------RFTF.-..................SG---
C4R0Z1_PICPG/1026-1192---QD--SDT--WL--------------------------ISGIT------TFTYE-VD...............FSR---
A7TMG8_VANPO/967-1085---TN--SNE--WV--------------------------VHGRK------KLRFS-T.................PE---
B9SID3_RICCO/54-178---AN--SEN--WM--------------------------IAGRK------RGHVS-LS...............TEQ---
A5AE80_VITVI/867-991---AN--SEN--WM--------------------------IAGRK------RGHVS-LS...............TKQ---
Q9LSR1_ARATH/1141-1266---AN--SEN--WM--------------------------IAGRK------RGHVS-LS...............EEQ---
B7FNC5_MEDTR/160-284---AN--SGN--WM--------------------------IAGRK------RGHVS-LS...............KNQ---
Q2QNU0_ORYSJ/1110-1232---AN--PQN--WM--------------------------VAGRK------CGHVS-LS...............NKQ---
A5BYI0_VITVI/102-216---AN--SEN--WM--------------------------IVGXK------RGHVS-LS...............TKQ---
A9RFK8_PHYPA/1148-1278---AN--EDY--WM--------------------------IAGRR------KGFIS-LS...............PSV---
B3P0R7_DROER/977-1138---ND--QNL--WA--------------------------VCGRS------AGVVS-M.................KD---
B0WLN5_CULQU/969-1132---AD--QNM--WV--------------------------VVGRT------AGVIS-M.................EE---
B4DI17_HUMAN/276-505---DN--SSN--WA--------------------------VCGKS------CGVIS-MP...............VAA---
Q4SZ20_TETNG/1076-1303---DS--NSN--WA--------------------------VCGKS------SGLVS-MP...............VAT---
A8PKV5_BRUMA/526-730---AD--PCF--WT--------------------------ISQKH------K.LVH-V.................KE---
A8Y1L1_CAEBR/135-260---AD--DRM--WT--------------------------LVERT------K.MVT-V.................KD---

PF08626

Q01I83_ORYSA/1-1138TRIDR--DYSARVL--------------------------IPLEHFKLPVLDTSFFVKENGSDEPLGSRA...ATLA---
TR120_SCHPO/1-1173VLIKP--KADNVIL--------------------------FRLKRFIMSSEEIN.LDIPNLSTKQFVLSSGFKKSIE---
A3GI78_PICST/1-1320.VIEP--GKTTRFL--------------------------LPVKRVSSKDVDLT.KPIPSL.RNKQFVKN.YTITEA---
B9HAT3_POPTR/1-113.....--.......--------------------------.....................................---
Q5ACN8_CANAL/1-1244.PMQA--GKTQRFI--------------------------IPIKRI...EVDIT.KTIPSL.RNKQFIKN.YNISDE---
TPPC9_HUMAN/1-1108LILHA--GECQRMA--------------------------IQVDK.......FNFESFPESPGEKGQFAN.PKQLEE---
Q6FUK5_CANGA/1-1224HLVES--NRNLRII--------------------------VPIRKIDVEKINFSNKPIPRIFKERQFLQS..GMDEN---
TR120_YEAST/1-1255YHVEA--SHTSRII--------------------------VPIKKIDYKKYNFENTPIPRIYPGRQFIQS..GLNEE---
A9TGF2_PHYPA/1-1085TRIDR--DYAARVL--------------------------IPLERFKLAGLDKASLARVSIRRESM.IQS...KDGI---

PF04628

TPPC2_CHICK/9-136--R.-SS.....AFERKVQFLGK------------------------------------------K--------------
Q4X1U7_ASPFU/7-185--R.-SP.....VFRARVVAAGK------------------------------------------K--------------
Q6BW18_DEBHA/13-197--LQ-SA.....KFDKSISKIVD------------------------------------------S--------------
Q7QCA5_ANOGA/9-136--K.-SL.....AFEKKAQLYGK------------------------------------------K--------------
Q55XF0_CRYNB/19-171--PT-SK.....MFATNPEEIKP------------------------------------------I--------------
Q57YJ1_TRYB2/2-125--R.-A......VLAENLRRLYQ------------------------------------------R--------------
Q5CFT6_CRYHO/9-137--E.-TP.....KLIGKIDRLIS------------------------------------------N--------------
Q4CQS2_TRYCC/4-127--R.-S......TLGEKVRRLYE------------------------------------------R--------------
Q5B584_EMENI/11-172--QI-TD....QRFIAEVNRIGN------------------------------------------S--------------
TRS20_YEAST/7-171--R.-SP.....AFDSRVRTLAR------------------------------------------K--------------
Q7RCP8_PLAYO/11-149--T.-SS.....LFDQNVHLAAK------------------------------------------N--------------
Q6FVV2_CANGA/7-168--R.-SP.....LFDTRVKALAK------------------------------------------K--------------
Q6BRP5_DEBHA/8-164--T.-SP.....DFDMRLKMLAR------------------------------------------K--------------
Q5KAA6_CRYNJ/23-186--K.-SP.....AFEARVKSIAK------------------------------------------R--------------
TPPC2_DICDI/8-131--T.-ST.....AFDAKVRKIGT------------------------------------------K--------------
TPC2L_DICDI/9-139--E.-SK.....KFLQEVTNLVP------------------------------------------S--------------
A8X604_CAEBR/10-138--E.-SI.....AFEQKAALYGR------------------------------------------K--------------
TPPC2_DROME/8-135--K.-SP.....MFEKKSEIFGR------------------------------------------K--------------
TRS20_SCHPO/7-134--R.-SQ.....AFDLKVRSIAR------------------------------------------R--------------
Q6CFC6_YARLI/9-134--ID-SQ.....GFRKEMAKVVD------------------------------------------K--------------
Q5A920_CANAL/9-148--V.-SP.....DFDLKIKQLAR------------------------------------------K--------------
Q651C7_ORYSJ/7-136--A.-SR.....SFGARVSTIVK------------------------------------------S--------------
Q4UE14_THEAN/25-171--D.-SS.....NFKSKVHQAAK------------------------------------------K--------------
Q5DDE1_SCHJA/12-164--QP-EKSSAAYRFDQCISTLLA------------------------------------------T--------------
Q6C760_YARLI/7-139--T.-SP.....VFDQRIKSLAK------------------------------------------K--------------
Q8IE05_PLAF7/20-159--T.-SS.....LFDQNVHLAAK------------------------------------------K--------------
Q74ZF3_ASHGO/7-174--T.-SP.....TFDWKVKQLAK------------------------------------------K--------------
TPC2L_HUMAN/7-138--QS-SR.....AFDNMVTSMMI------------------------------------------Q--------------
Q6E4A0_CYNDA/9-133--T.-SS.....HFDTKVRALAR------------------------------------------R--------------
Q5DCH5_SCHJA/9-138--N.-SP.....SFSRRVQRIAN------------------------------------------K--------------
Q6CQN4_KLULA/6-155--S.-NS.....AFDSKVRVLSK------------------------------------------R--------------
Q4PCM0_USTMA/13-185--K.-SA.....AFDARINRIVF------------------------------------------G--------------

PF04099

Q20100_CAEEL/5-215--R--AQ-----KFDEAIKTLLE------------------------------------------RA-------------
Q9P3N1_NEUCS/3-158--R--CD-----MFDRKLLSYIR------------------------------------------EV-------------
O77358_PLAF7/1-144--R--SA-----VFNEQIEKLFS------------------------------------------NI-------------
TRS23_SCHPO/1-132--K--CQ-----LFDEQLKRYID------------------------------------------SH-------------
Q9VA95_DROME/3-137--T--SE-----LFQSKLDEFVR------------------------------------------QS-------------
Q9LZ97_ARATH/4-134--R--CE-----LFDINLTQAVQ------------------------------------------SD-------------
Q9VLI9_DROME/3-209--R--CE-----LFDNKLQELLA------------------------------------------QV-------------
Q9AWN0_ORYSJ/33-178--K--CE-----LFNKHLDQYVK------------------------------------------TL-------------
TPPC1_HUMAN/3-137--Q--SE-----LFRSRLDSYVR------------------------------------------SL-------------
TPPC4_MOUSE/3-209--R--CE-----LFDQNLKLALE------------------------------------------VA-------------
Q9SYB8_ARATH/23-168--K--SE-----LFNTALDQYVR------------------------------------------SI-------------

PF01217

AP3S_SCHPO/1-139--SG.GL-----VLETNLNEIV.------------------------------------------...-.L..AA-----
AP1S1_MOUSE/1-142--MG.GD-----VQDTSKKSVLK------------------------------------------AIE-QADLLQ-----
AP2S_YEAST/2-147--IG.GE-----IQEISKDMLLE------------------------------------------RLS-ILDRLD-----
AP2S1_HUMAN/1-142--LA.GE-----IRETSQTKVLK------------------------------------------QLL-MLQSLE-----
AP3S_YEAST/1-160--QG.GM-----VIETNVNRIVA------------------------------------------SVD-ELNKAA-----
COPZ1_BOVIN/12-153--DG.GV-----ILESDPQQVVH------------------------------------------RVA-LRGEDV-----
AP1S1_YEAST/3-146--MCDGS-----IAESSRKEVLH------------------------------------------HVT-VMDTME-----

PF12742

B3DLV7_XENTR/1041-1095--GTEQE------MLYNFYPLMA-------------GYQ--------------------------QLP-SLNI-------
TPC11_MOUSE/1035-1095--GTKQE------MLYNFYPLMA-------------GYQ--------------------------QLP-SLNI-------
Q4SVC2_TETNG/940-994--GSEQR------MLYNYYPLMA-------------GYQ--------------------------TLP-QLNI-------
A2FUL4_TRIVA/291-348--GEIRK------LIFNFTPLKI-------------GLH--------------------------KLP-EIRV-------
A2FF60_TRIVA/460-517--SKVTQ------IPITFIPMVA-------------GSY--------------------------ILP-KITI-------
A2EKE8_TRIVA/494-550--GEEEI------IEFSFYAINH-------------GLL--------------------------YFP-KIFI-------
A2EQW1_TRIVA/475-534--NQKKE------IPIKYIPLTT-------------GFL--------------------------YLP-KINI-------

PF07919

C5G0L5_ARTOC/657-1240..LSRHT------VQYSLLATRR.............GVW..........................IQP.QLIVVD-----
Q17IT4_AEDAE/569-1266..FSSYD------LLFNLYPLKA.............GWQ..........................PLP.ELQLSY-----
B4N3P6_DROWI/571-1279..FDEKE------LVYNLYPLHV.............GWQ..........................ELP.TLSLEY-----
A2X8W8_ORYSI/587-1138..KTEHI------VSHKLVPLGS.............GSQ..........................QLP.RITITS-----
B6H784_PENCW/663-1219..LSRHT------VNFNLFAAKR.............GLW..........................IQP.QLVVID-----
B8C9G3_THAPS/960-1719..FEAKL------FSFTFLSMVA.............GKV..........................RCP.PLVLSS-----
B0WFL7_CULQU/525-1276..FSSYD------LLFNLYPLKA.............GWQ..........................PLP.ELHLEY-----
A4S1A2_OSTLU/578-1070..LSTAS------FYFLLVPIVT.............GSA..........................ILP.ELSLGA-----
A5DBY9_PICGU/617-1163..FNRHT------MVYYCRCSNE.............SETV.........................DLP.RFKVYD-----
B4IX46_DROGR/568-1290..YDEKE------LVYNLYPLQV.............GWQ..........................ELP.VLTLEY-----
B3DLV7_XENTR/577-1097..GTEQE------MLYNFYPLMA.............GYQ..........................QLP.SLNINL-----
Q54KR2_DICDI/821-1497..DSTHE------IKHILLPLVA.............GKL..........................NLP.HFKIIS-----
A4HUB1_LEIIN/384-917..TEGSV------TRYVLTPLRA.............GEL..........................KLP.RFHVRC-----
A1CQK2_ASPCL/664-1234..LSRHT------VRYNLLASKR.............GLW..........................IQP.QLIVVD-----
Q57YW4_TRYB2/511-1059..LAVYS------TRIVLKPLAV.............GVL..........................QLP.SLHLRH-----
TPC11_DANRE/577-1097..GAEQE------MLYNFYPLMA.............GYQ..........................VLP.QLNINL-----
B0D8K9_LACBS/629-1224..GAEER------LLWRLIPVEC.............GHV..........................RIP.RLKIFN-----
Q0CCQ2_ASPTN/665-1233..LSRHT------VRYNLLASKR.............GQW..........................IQP.QLLVVD-----
A8N717_COPC7/639-1200..GSEER------ITWSIIPLEC.............GYV..........................RVP.RIRVLD-----
A5B032_VITVI/377-937..KTEHS------LSYMLVPLAS.............GSQ..........................QLP.RVTVTS-----
B3M5T6_DROAN/568-1287..YEEKE------LVYNLYPLQV.............GWQ..........................ELP.VLSLEY-----
B3S6B6_TRIAD/573-1077..SDIHA------LRYVMYPLTT.............GYV..........................TLP.RLKLNL-----
B7P2U2_IXOSC/583-1086FFLGRRC------VGFRQAVFL...............FC..........................RIP...YLFD-----
Q4D1A2_TRYCC/511-1062..NTFKS------TEIILQPICI.............GTI..........................KLP.SVYLRH-----
P90984_CAEEL/775-1075..GATRR------VTVVVMALSA.............GRL..........................NFP.KISLKS-----
A9V4M9_MONBE/1582-1761GQEAMSQ------VRFDLLPLTT.............GQL..........................KLP.SVTLVD-----
B2VQZ9_PYRTR/662-1229..MSRMV------VRFNLLVGDAEDGSSGKDGEGDGGRW..........................INP.CLKVMD-----
A2QPY0_ASPNC/663-1233..LSRHT------VRYNLLASKR.............GLW..........................IQP.QLLVVD-----
C4JTF4_UNCRE/662-1239..LSRHT------VRYNLLAAGN.............QKW..........................IQP.QLMVVD-----
Q2GSS2_CHAGB/391-959..VSRRA------VEYRLLPFEV.............G..............................P....VGD-----
Q7Q5C6_ANOGA/565-1322..YSSYD------LLFNLCPLKA.............GWQ..........................PLP.ELELEY-----
C0SG01_PARBP/712-1287..LSRHT------VRYNLLANVR.............GAW..........................IQP.QLSVVD-----
Q8L614_ARATH/276-832..KSEHV------LSYKLVPLTC.............GEQ..........................QLP.KITLTS-----
TPC11_BOVIN/577-1097..GTEQE------MLYNFYPLMA.............GYQ..........................QLP.SLNINL-----
Q4N165_THEPA/627-1297..RSSDT------LSWRIVATKC.............EPF..........................KLP.IVRVSN-----
Q6CF42_YARLI/694-1263..FSRRL------ISAQLVHQENPNAGLGL......TWF..........................KLP.NIKVYD-----
Q7S6A3_NEUCR/636-1264..VSRRE------VEYRLLPTSL.............G..............................PGSGDTEE-----
Q5AH80_CANAL/196-781..FSRHY------MDFIGEYLPA.............SEGMSDSNSNLGCGSESGCGSRSRCGLGLKLP.KFKVFD-----
Q2UPL2_ASPOR/663-1234..LSRHT------VRYNLLASKR.............GLW..........................IQP.QLVVVD-----
B9WKD3_CANDC/668-1247..FSRHY------MDFIGEYLPP.............VSEI.DSNSN................LGLKLP.KFKVFD-----
B6QQY0_PENMQ/649-1211..LSRHK------VRYNIFAFKS.............GMW..........................IQP.HLVVVD-----
A6QX66_AJECN/503-1083..LSRHT------VRYNLLANVR.............GKW..........................IQP.QLAVVD-----
Q0UML5_PHANO/649-1218..MSRQT------VRFSVYPLVT.............GVW..........................ISP.NLKVTD-----
A6S8E4_BOTFB/493-1052..LSRRT------VKFRLLPTVR.............GEW..........................IGPIRCVIRD-----
B9I0K4_POPTR/546-1104..KSEHT------LSYKLVPLAS.............GSQ..........................QLP.RVTVTS-----
B9T2L8_RICCO/584-1142..KSEHL------LGYKIVPLAS.............GLQ..........................QLP.RVTVTS-----
A1D3G8_NEOFI/665-1235..LSRHT------VRYNLLASKR.............GLW..........................IQP.QLNVVD-----
A2EKE8_TRIVA/370-552..GEEEI------IEFSFYAINH.............GLL..........................YFP.KIFIAE-----
Q4SVC2_TETNG/484-996..GSEQR------MLYNYYPLMA.............GYQ..........................TLP.QLNISL-----
A3LPF0_PICST/628-1173..FGRHF------MEFYAKTSEA.............GEKI.........................QLP.TFKVYD-----
Q5BDK6_EMENI/657-1228..VSRQT------VRYNLLASKR.............GLW..........................IQP.QLLVVD-----

PF12584

A8NHA2_COPC7/992-1155--NGKFT......LPLTLMALHH-------------GEF--------------------------GLP-KVHVQPRV...
A7F9J5_SCLS1/1351-1514--NNKLT......YPIVLIPLRE-------------GFL--------------------------QYP-TVEIKALPSTR
B2W2H3_PYRTR/1490-1643--DEVME......WDIVLIPLRA-------------GNA--------------------------LMP-NVEVRAKVK..
B6H3B0_PENCW/1240-1399--GASTR......FTVLLLPQKP-------------GHL--------------------------LLP-GVEIRTFLPPA
B0XR26_ASPFC/1252-1410--NETQT......FAVMLLPQKA-------------GHL--------------------------LLP-GLEIKSYVPAA
C5JCH6_AJEDS/1251-1399--GERRT......FTVMLLPQRP-------------GHL--------------------------LLP-GLEVKTFVTQA
C5FEM2_ARTOC/1257-1416--GEERR......FQLLLLPQRA-------------GHL--------------------------LLP-TVDVKSFATGP
C4JLA5_UNCRE/1213-1358--GEQRR......FSLMLIPQVP-------------GHL--------------------------LLP-SVEVKSFVSQ.
Q6CDM8_YARLI/995-1119--NVVEN........LQLVPLKT-------------GRI--------------------------ALP-EVVIRPAD...
Q4P224_USTMA/1235-1382--NSAPLACDVFSVTLTIVALRT-------------GRL--------------------------PLP-TVQVRPLS...
A8PWK6_MALGO/1105-1237--ESHHT......IHATLLPVRT-------------GWL--------------------------LYP-RIRIAPIG...
B8P4P6_POSPM/992-1139--GSTFT......MPVTLIALHH-------------GEL--------------------------SLP-KIAINALP...
B0D3E6_LACBS/1015-1161--GGIHV......IPITLIALHH-------------GEF--------------------------SLP-KVTVTALP...
Q6BQQ9_DEBHA/1053-1205--ENKSN......FEVVLIPLTV-------------GRL--------------------------LLP-KINVRTLD...
A5DA23_PICGU/1047-1195--FSEND......FSLVLIPLNV-------------GKL--------------------------ELP-KIGIKSAS...
C4YB04_CLAL4/693-833--GGHRE......FSITLIPLNV-------------GHL--------------------------QLP-KVFIRPNS...
B9WGM9_CANDC/1083-1255--GQETT......KQLTLIPLNV-------------GKI--------------------------PLP-QVVIKELADG.
C4R0Z1_PICPG/1026-1192--GKNITTF..DEMRFVLIPLKT-------------GQL--------------------------LLP-KVEIKHGD...
A7TMG8_VANPO/967-1085--EE.........IEVSIIPLKK-------------GYL--------------------------TLP-KIEITNYKG..
B9SID3_RICCO/54-178--GSRIV......ISILCVPLVA-------------GYV--------------------------RPP-RLGLPNVD...
A5AE80_VITVI/867-991--GSRIV......ISILCMPLVA-------------GYV--------------------------HPP-KLGLPNVD...
Q9LSR1_ARATH/1141-1266--GSRVV......ISILCVPLVA-------------GYV--------------------------RPP-QLGLPNVE...
B7FNC5_MEDTR/160-284--GARII......ITVLCMPLVA-------------GYV--------------------------RPP-LLGLPEIE...
Q2QNU0_ORYSJ/1110-1232--GSRIE......ITVTCVPLVS-------------GYV--------------------------HPP-QLGLPHVG...
A5BYI0_VITVI/102-216--GSRIV......ISILCMPLMA-------------GYV--------------------------HPP-KLGLPNVD...
A9RFK8_PHYPA/1148-1278--GSRIV......LSMACVPLVA-------------GHV--------------------------HPP-ALRLVNIG...
B3P0R7_DROER/977-1138--VDSHS......ISLDVMPLST-------------GFL--------------------------PMP-SIRLSKYTAGG
B0WLN5_CULQU/969-1132--VESHS......ITLDVLPLAA-------------GFL--------------------------PLP-NIRLSKYISKS
B4DI17_HUMAN/276-505--RATHR......VHMEVMPLFA-------------GYL--------------------------PLP-DVRLFKYLPHH
Q4SZ20_TETNG/1076-1303--GSSQK......VQIEVMPLFA-------------GHL--------------------------PYP-RINVLRYLPHT
A8PKV5_BRUMA/526-730--SGLGQ......ISFTVFPKMI-------------GFL--------------------------PYP-IISVYSCRHKR
A8Y1L1_CAEBR/135-260--SGLGQ......LALTIIPVVA-------------GFL--------------------------PFP-NVSIYECH...

PF08626

Q01I83_ORYSA/1-1138--EKNAKAELNASINNLISKIKV-------------KWHSGRNS.....SGELNIKDAIQTALQASIMDILLPDPLTFSF
TR120_SCHPO/1-1173--DSYTMKKRFWIKEYFLKEVQA-------------SWKTDDNL....HHGEIYLRNHI...LSDEMANNLSILPIRIQA
A3GI78_PICST/1-1320--EEMQMREIFWLRNSLLEKLSN-------------HWKTIETKATGKRAGSIDLRAI..R.LSTKMSNVLVYSKIRLLT
B9HAT3_POPTR/1-113--.....................-------------............................................
Q5ACN8_CANAL/1-1244--EEKHMKKLFWLRNSILENLVG-------------SWK......LGRRHGVIDLRPI..R.LTTKMANILSYENIQVHN
TPPC9_HUMAN/1-1108--ERREARGL.....EIHSKLGI-------------CWRIPSLK....RSGEASVEGL....LNQLVLEHLQLAPLQWDV
Q6FUK5_CANGA/1-1224--TEITMRECFWTREYILERLSC-------------RWELSTDSLI...RGEVDFRKYIEK.FDNRTVANLYKGKLPFSI
TR120_YEAST/1-1255--QTIEMRQKFWCREHIISKLKC-------------NWKLTTDQSV...TGSVDFNKFIEK.FDHKMVYTIYPGRLFYGV
A9TGF2_PHYPA/1-1085--ERQAKVELNAAIDELSSKICV-------------RWTSGRNS.....AGELPIKDALREALQASVLKILLPDSLTFGF

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q55XF0_CRYNB/19-171--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q5CFT6_CRYHO/9-137--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
Q5B584_EMENI/11-172--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q5DDE1_SCHJA/12-164--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q8IE05_PLAF7/20-159--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6E4A0_CYNDA/9-133--------------------------------------------------------------------------------
Q5DCH5_SCHJA/9-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q4PCM0_USTMA/13-185--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
Q9P3N1_NEUCS/3-158--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF12742

B3DLV7_XENTR/1041-1095--------------------------------------------------------------------------------
TPC11_MOUSE/1035-1095--------------------------------------------------------------------------------
Q4SVC2_TETNG/940-994--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/460-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/494-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/475-534--------------------------------------------------------------------------------

PF07919

C5G0L5_ARTOC/657-1240--------------------------------------------------------------------------------
Q17IT4_AEDAE/569-1266--------------------------------------------------------------------------------
B4N3P6_DROWI/571-1279--------------------------------------------------------------------------------
A2X8W8_ORYSI/587-1138--------------------------------------------------------------------------------
B6H784_PENCW/663-1219--------------------------------------------------------------------------------
B8C9G3_THAPS/960-1719--------------------------------------------------------------------------------
B0WFL7_CULQU/525-1276--------------------------------------------------------------------------------
A4S1A2_OSTLU/578-1070--------------------------------------------------------------------------------
A5DBY9_PICGU/617-1163--------------------------------------------------------------------------------
B4IX46_DROGR/568-1290--------------------------------------------------------------------------------
B3DLV7_XENTR/577-1097--------------------------------------------------------------------------------
Q54KR2_DICDI/821-1497--------------------------------------------------------------------------------
A4HUB1_LEIIN/384-917--------------------------------------------------------------------------------
A1CQK2_ASPCL/664-1234--------------------------------------------------------------------------------
Q57YW4_TRYB2/511-1059--------------------------------------------------------------------------------
TPC11_DANRE/577-1097--------------------------------------------------------------------------------
B0D8K9_LACBS/629-1224--------------------------------------------------------------------------------
Q0CCQ2_ASPTN/665-1233--------------------------------------------------------------------------------
A8N717_COPC7/639-1200--------------------------------------------------------------------------------
A5B032_VITVI/377-937--------------------------------------------------------------------------------
B3M5T6_DROAN/568-1287--------------------------------------------------------------------------------
B3S6B6_TRIAD/573-1077--------------------------------------------------------------------------------
B7P2U2_IXOSC/583-1086--------------------------------------------------------------------------------
Q4D1A2_TRYCC/511-1062--------------------------------------------------------------------------------
P90984_CAEEL/775-1075--------------------------------------------------------------------------------
A9V4M9_MONBE/1582-1761--------------------------------------------------------------------------------
B2VQZ9_PYRTR/662-1229--------------------------------------------------------------------------------
A2QPY0_ASPNC/663-1233--------------------------------------------------------------------------------
C4JTF4_UNCRE/662-1239--------------------------------------------------------------------------------
Q2GSS2_CHAGB/391-959--------------------------------------------------------------------------------
Q7Q5C6_ANOGA/565-1322--------------------------------------------------------------------------------
C0SG01_PARBP/712-1287--------------------------------------------------------------------------------
Q8L614_ARATH/276-832--------------------------------------------------------------------------------
TPC11_BOVIN/577-1097--------------------------------------------------------------------------------
Q4N165_THEPA/627-1297--------------------------------------------------------------------------------
Q6CF42_YARLI/694-1263--------------------------------------------------------------------------------
Q7S6A3_NEUCR/636-1264--------------------------------------------------------------------------------
Q5AH80_CANAL/196-781--------------------------------------------------------------------------------
Q2UPL2_ASPOR/663-1234--------------------------------------------------------------------------------
B9WKD3_CANDC/668-1247--------------------------------------------------------------------------------
B6QQY0_PENMQ/649-1211--------------------------------------------------------------------------------
A6QX66_AJECN/503-1083--------------------------------------------------------------------------------
Q0UML5_PHANO/649-1218--------------------------------------------------------------------------------
A6S8E4_BOTFB/493-1052--------------------------------------------------------------------------------
B9I0K4_POPTR/546-1104--------------------------------------------------------------------------------
B9T2L8_RICCO/584-1142--------------------------------------------------------------------------------
A1D3G8_NEOFI/665-1235--------------------------------------------------------------------------------
A2EKE8_TRIVA/370-552--------------------------------------------------------------------------------
Q4SVC2_TETNG/484-996--------------------------------------------------------------------------------
A3LPF0_PICST/628-1173--------------------------------------------------------------------------------
Q5BDK6_EMENI/657-1228--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155...............................................NWRDITVASQAPPN-------------------
A7F9J5_SCLS1/1351-1514GV.......................................RPGSSGGGEESVKNKSRPVT-------------------
B2W2H3_PYRTR/1490-1643.............................................PKDESAKKGDEAEPLN-------------------
B6H3B0_PENCW/1240-1399PQP.....................................PTSPPAADAAGSMAPARRSIP-------------------
B0XR26_ASPFC/1252-1410PPSTA..................................TTSQPGNLAVGGAPSLQRRQIP-------------------
C5JCH6_AJEDS/1251-1399P..........................................AGGEAELVSGAVQRRVVP-------------------
C5FEM2_ARTOC/1257-1416GHQQPL................................SPTGGEHLQLDTSFAPRQRRAIS-------------------
C4JLA5_UNCRE/1213-1358.............................................EHPPEAQHALQRRPIS-------------------
Q6CDM8_YARLI/995-1119.......................................................SETPIS-------------------
Q4P224_USTMA/1235-1382..............................................TVEAATNPKTGQLPT-------------------
A8PWK6_MALGO/1105-1237......................................................PAARPFR-------------------
B8P4P6_POSPM/992-1139...............................................TQGGPRMGSSSVPS-------------------
B0D3E6_LACBS/1015-1161...............................................MAGDVTMGSMAVPS-------------------
Q6BQQ9_DEBHA/1053-1205......................................................NLENDFS-------------------
A5DA23_PICGU/1047-1195......................................................AQEQEIS-------------------
C4YB04_CLAL4/693-833......................................................AQEQS..-------------------
B9WGM9_CANDC/1083-1255............................................VNPINDDDDEEENDSDD-------------------
C4R0Z1_PICPG/1026-1192.......................................................PGESLR-------------------
A7TMG8_VANPO/967-1085.............................................DL..............-------------------
B9SID3_RICCO/54-178..............................................E..............-------------------
A5AE80_VITVI/867-991..............................................E..............-------------------
Q9LSR1_ARATH/1141-1266..............................................E..............-------------------
B7FNC5_MEDTR/160-284..............................................E..............-------------------
Q2QNU0_ORYSJ/1110-1232..............................................E..............-------------------
A5BYI0_VITVI/102-216..............................................X..............-------------------
A9RFK8_PHYPA/1148-1278..............................................R..............-------------------
B3P0R7_DROER/977-1138K..........................................SKTD....GHSKVHPFPP-------------------
B0WLN5_CULQU/969-1132...........................................KTND....THPRLQPFPP-------------------
B4DI17_HUMAN/276-505SAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEH.KGLPMPRLQALPA-------------------
Q4SZ20_TETNG/1076-1303AGVFNQPDPDSCMENDSLSLL..DDQTDTASIRSRGSVHSVGSSEHQQRGIAMPRLDSFGP-------------------
A8PKV5_BRUMA/526-730S..........................................DSDISQLSTESTYDFGPQ-------------------
A8Y1L1_CAEBR/135-260..................................................FASDTIIPGKD-------------------

PF08626

Q01I83_ORYSA/1-1138RHAKDGTTAKTDSSKEPGDGSSRSADESVLRCKDPIFANEMTHMEVQIRNNTKETIQ.........MNLSISCKDVAGEN
TR120_SCHPO/1-1173WVSYDSEKV..........................TTVCPREPFKLVLEFFGHADTN............MRYKISWTQLN
A3GI78_PICST/1-1320TILDDGQQQPVAKEGTQ..............YLLK..IDEFYTLRTTIINNTESTINGILRHLPFPMSILSNTVVHSANL
B9HAT3_POPTR/1-113................................................................................
Q5ACN8_CANAL/1-1244TVLTDDDLQ.VDSIGKS..............YNLS..TDQFYVLKTTIINHSKKPINGIVRQLPFP...IHNTPTKSSS.
TPPC9_HUMAN/1-1108LVDGQPCDR.....................EAVAACQVGDPVRLEVRLTNRSPRSVG.........PFALTVVPFQDHQN
Q6FUK5_CANGA/1-1224TLSSSSKSS...TTGEL..............NRISCQISPQTVQRQHSRIQQTALLN............FF...IFEHFS
TR120_YEAST/1-1255QLLLDEPKV...KVGEI..............INLKIITEPTSTCRR....KQNSTVN............FLDIVIFDSKT
A9TGF2_PHYPA/1-1085RLAKTSISAPSLRSADDGGLST........DNKGGFGVRELAPIEMLVRNNTNEAVK.........MTLSVTCRDVTGTS

PF04628

TPPC2_CHICK/9-136----------------------------------------
Q4X1U7_ASPFU/7-185----------------------------------------
Q6BW18_DEBHA/13-197----------------------------------------
Q7QCA5_ANOGA/9-136----------------------------------------
Q55XF0_CRYNB/19-171----------------------------------------
Q57YJ1_TRYB2/2-125----------------------------------------
Q5CFT6_CRYHO/9-137----------------------------------------
Q4CQS2_TRYCC/4-127----------------------------------------
Q5B584_EMENI/11-172----------------------------------------
TRS20_YEAST/7-171----------------------------------------
Q7RCP8_PLAYO/11-149----------------------------------------
Q6FVV2_CANGA/7-168----------------------------------------
Q6BRP5_DEBHA/8-164----------------------------------------
Q5KAA6_CRYNJ/23-186----------------------------------------
TPPC2_DICDI/8-131----------------------------------------
TPC2L_DICDI/9-139----------------------------------------
A8X604_CAEBR/10-138----------------------------------------
TPPC2_DROME/8-135----------------------------------------
TRS20_SCHPO/7-134----------------------------------------
Q6CFC6_YARLI/9-134----------------------------------------
Q5A920_CANAL/9-148----------------------------------------
Q651C7_ORYSJ/7-136----------------------------------------
Q4UE14_THEAN/25-171----------------------------------------
Q5DDE1_SCHJA/12-164----------------------------------------
Q6C760_YARLI/7-139----------------------------------------
Q8IE05_PLAF7/20-159----------------------------------------
Q74ZF3_ASHGO/7-174----------------------------------------
TPC2L_HUMAN/7-138----------------------------------------
Q6E4A0_CYNDA/9-133----------------------------------------
Q5DCH5_SCHJA/9-138----------------------------------------
Q6CQN4_KLULA/6-155----------------------------------------
Q4PCM0_USTMA/13-185----------------------------------------

PF04099

Q20100_CAEEL/5-215----------------------------------------
Q9P3N1_NEUCS/3-158----------------------------------------
O77358_PLAF7/1-144----------------------------------------
TRS23_SCHPO/1-132----------------------------------------
Q9VA95_DROME/3-137----------------------------------------
Q9LZ97_ARATH/4-134----------------------------------------
Q9VLI9_DROME/3-209----------------------------------------
Q9AWN0_ORYSJ/33-178----------------------------------------
TPPC1_HUMAN/3-137----------------------------------------
TPPC4_MOUSE/3-209----------------------------------------
Q9SYB8_ARATH/23-168----------------------------------------

PF01217

AP3S_SCHPO/1-139----------------------------------------
AP1S1_MOUSE/1-142----------------------------------------
AP2S_YEAST/2-147----------------------------------------
AP2S1_HUMAN/1-142----------------------------------------
AP3S_YEAST/1-160----------------------------------------
COPZ1_BOVIN/12-153----------------------------------------
AP1S1_YEAST/3-146----------------------------------------

PF12742

B3DLV7_XENTR/1041-1095----------------------------------------
TPC11_MOUSE/1035-1095----------------------------------------
Q4SVC2_TETNG/940-994----------------------------------------
A2FUL4_TRIVA/291-348----------------------------------------
A2FF60_TRIVA/460-517----------------------------------------
A2EKE8_TRIVA/494-550----------------------------------------
A2EQW1_TRIVA/475-534----------------------------------------

PF07919

C5G0L5_ARTOC/657-1240----------------------------------------
Q17IT4_AEDAE/569-1266----------------------------------------
B4N3P6_DROWI/571-1279----------------------------------------
A2X8W8_ORYSI/587-1138----------------------------------------
B6H784_PENCW/663-1219----------------------------------------
B8C9G3_THAPS/960-1719----------------------------------------
B0WFL7_CULQU/525-1276----------------------------------------
A4S1A2_OSTLU/578-1070----------------------------------------
A5DBY9_PICGU/617-1163----------------------------------------
B4IX46_DROGR/568-1290----------------------------------------
B3DLV7_XENTR/577-1097----------------------------------------
Q54KR2_DICDI/821-1497----------------------------------------
A4HUB1_LEIIN/384-917----------------------------------------
A1CQK2_ASPCL/664-1234----------------------------------------
Q57YW4_TRYB2/511-1059----------------------------------------
TPC11_DANRE/577-1097----------------------------------------
B0D8K9_LACBS/629-1224----------------------------------------
Q0CCQ2_ASPTN/665-1233----------------------------------------
A8N717_COPC7/639-1200----------------------------------------
A5B032_VITVI/377-937----------------------------------------
B3M5T6_DROAN/568-1287----------------------------------------
B3S6B6_TRIAD/573-1077----------------------------------------
B7P2U2_IXOSC/583-1086----------------------------------------
Q4D1A2_TRYCC/511-1062----------------------------------------
P90984_CAEEL/775-1075----------------------------------------
A9V4M9_MONBE/1582-1761----------------------------------------
B2VQZ9_PYRTR/662-1229----------------------------------------
A2QPY0_ASPNC/663-1233----------------------------------------
C4JTF4_UNCRE/662-1239----------------------------------------
Q2GSS2_CHAGB/391-959----------------------------------------
Q7Q5C6_ANOGA/565-1322----------------------------------------
C0SG01_PARBP/712-1287----------------------------------------
Q8L614_ARATH/276-832----------------------------------------
TPC11_BOVIN/577-1097----------------------------------------
Q4N165_THEPA/627-1297----------------------------------------
Q6CF42_YARLI/694-1263----------------------------------------
Q7S6A3_NEUCR/636-1264----------------------------------------
Q5AH80_CANAL/196-781----------------------------------------
Q2UPL2_ASPOR/663-1234----------------------------------------
B9WKD3_CANDC/668-1247----------------------------------------
B6QQY0_PENMQ/649-1211----------------------------------------
A6QX66_AJECN/503-1083----------------------------------------
Q0UML5_PHANO/649-1218----------------------------------------
A6S8E4_BOTFB/493-1052----------------------------------------
B9I0K4_POPTR/546-1104----------------------------------------
B9T2L8_RICCO/584-1142----------------------------------------
A1D3G8_NEOFI/665-1235----------------------------------------
A2EKE8_TRIVA/370-552----------------------------------------
Q4SVC2_TETNG/484-996----------------------------------------
A3LPF0_PICST/628-1173----------------------------------------
Q5BDK6_EMENI/657-1228----------------------------------------

PF12584

A8NHA2_COPC7/992-1155-------------------------VETYQEHGAVKVLVL
A7F9J5_SCLS1/1351-1514-------------------------CETDSKNTGETIRII
B2W2H3_PYRTR/1490-1643-------------------------CETDYWSYGDVVVVV
B6H3B0_PENCW/1240-1399-------------------------CEVDYRNHGETVLVL
B0XR26_ASPFC/1252-1410-------------------------SEVDYRNHGETVLVL
C5JCH6_AJEDS/1251-1399-------------------------CEVDYQNHAETVLVS
C5FEM2_ARTOC/1257-1416-------------------------SELDYRSHGETILVS
C4JLA5_UNCRE/1213-1358-------------------------SEVEYCNHGETVLVT
Q6CDM8_YARLI/995-1119-------------------------MEVDNRIGVKYVVVA
Q4P224_USTMA/1235-1382-------------------------CETYISNAAQRVNVV
A8PWK6_MALGO/1105-1237-------------------------CETYMRQADQGIYVV
B8P4P6_POSPM/992-1139-------------------------CETYQMHGAEKVLVL
B0D3E6_LACBS/1015-1161-------------------------IETYQVHGAEKVLVL
Q6BQQ9_DEBHA/1053-1205-------------------------MDINFKNGLETLLVV
A5DA23_PICGU/1047-1195-------------------------MDTILKNGSETLLVV
C4YB04_CLAL4/693-833-------------------------MDVVNENALETVLVV
B9WGM9_CANDC/1083-1255-------------------------LDIEFINGLETILVI
C4R0Z1_PICPG/1026-1192-------------------------YEVDYKNGSESILVV
A7TMG8_VANPO/967-1085-------------------------TRIDNPNAYETFLVY
B9SID3_RICCO/54-178-------------------------SNISSNPPGPHLVCV
A5AE80_VITVI/867-991-------------------------ANISCNPAGPHLELV
Q9LSR1_ARATH/1141-1266-------------------------ANVSSNPSGPHLVCV
B7FNC5_MEDTR/160-284-------------------------ANIRCKPSGPHLVCV
Q2QNU0_ORYSJ/1110-1232-------------------------ANISCNPAGPHLVCV
A5BYI0_VITVI/102-216-------------------------ANISCNPAGPHLGIQ
A9RFK8_PHYPA/1148-1278-------------------------AHVSRSPAGPHLVCI
B3P0R7_DROER/977-1138-------------------------GQVYNCTKSMQIHVI
B0WLN5_CULQU/969-1132-------------------------GQIYNSTKSMQIHVL
B4DI17_HUMAN/276-505-------------------------GQVFNSSSGTQVLVI
Q4SZ20_TETNG/1076-1303-------------------------GEVFNHSHMQQVLVL
A8PKV5_BRUMA/526-730-------------------------LSSFVRTNGKQVHVL
A8Y1L1_CAEBR/135-260-------------------------ILFFNRTAGKQIRVL

PF08626

Q01I83_ORYSA/1-1138CFD..ENSATVLWAGVLSDIYLE..VQPLQEVVHPFSIYF
TR120_SCHPO/1-1173TQANTSSFNGLILDGPEEDIVCF..NNSKCHVVIERNMFA
A3GI78_PICST/1-1320IKAQMSIDRKILINGVLQSPVCKKGIEPGDKIDLDLGFVI
B9HAT3_POPTR/1-113......................................YF
Q5ACN8_CANAL/1-1244SRPQLSIDKKMLVNGTLQNKFPE..IAPGDQLVLETSFVI
TPPC9_HUMAN/1-1108GVHNYDLHDTVSFVGSSTFYLDA..VQPSGQSACLGALLF
Q6FUK5_CANGA/1-1224SKLLPKSNRRLLYNGSLSQK.....FSTNSESTVCLDVIP
TR120_YEAST/1-1255SKILPRSNRRILYNGSLTKP.....ISTTKVSEINLEIIP
A9TGF2_PHYPA/1-1085CLGAAGTKATVLWAGTLDRVNVE..VGALGEVVHRFSLCF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window