Sequence alignment for CL0212

PF12584

A8NHA2_COPC7/992-1155---------------------------------------------PVDVPVKDIVATASINILS----------------
A7F9J5_SCLS1/1351-1514---------------------------------------------PVDVPSVTVVHTADLRLLQ----------------
B2W2H3_PYRTR/1490-1643---------------------------------------------TVSIPQTHILHTASLILNS----------------
B6H3B0_PENCW/1240-1399---------------------------------------------PVDVPEVQVVHTADLQLQP----------------
C5FEM2_ARTOC/1257-1416---------------------------------------------PVDIPDVQVVHTAKLVLKD----------------
C4JLA5_UNCRE/1213-1358---------------------------------------------PVDIPEIQVVHRAELILHN----------------
A0A0D1DNV8_USTMA/1235-1382---------------------------------------------PVDVPTVDYVNAVTLSLGR----------------
B8P4P6_POSPM/992-1139---------------------------------------------PVDVPRMHILAAAHLRVTP----------------
B0D3E6_LACBS/1015-1161---------------------------------------------PVDVPYMNIVAAACVRLIS----------------
C4R0Z1_PICPG/1026-1192---------------------------------------------DVPMPSIDILHVVDFEPIE----------------
A8PKV5_BRUMA/843-1047---------------------------------------------SLQIPAK..LLNPNLTHIQ----------------
B4HE09_DROSE/978-1138---------------------------------------------.HELPVVKVHFVIKYASLS----------------
F7CPS6_CALJA/149-377---------------------------------------------.EPPPSLHCRFSVGFSPAS----------------
H3CJ11_TETNG/1022-1246---------------------------------------------...PSCLQCVFSTDFSPLN----------------
Q4WSJ6_ASPFU/1252-1410---------------------------------------------PVDIPKIQVLHTAELRLKN----------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247INLRT.RDIMSCISITAEFAVTEGHVAEPIFAQIAIRSNAHKGSNPIILNNLVVEFKGPLGSIKLTHA.......ETDGG
R7YHS6_CONA1/667-1263VSLTS.KSTLSPLSTSFTFAHDEGHVGEPLRAQLVFQSRAQRSSAPVVLSAVKVGLTGSLEEIRISHKPSPSGPPSSPGK
C5G0L5_ARTOC/657-1267IVLKD.KDVASCISTSFTFISSRGNVGELLEGQLVLRSDSRRTSAPIYLSEVKITFEGCLPPIRILADDDA....EASEA
G2YB15_BOTF4/638-1224IVLHA.EEVQSFLTASYAFEKSEGKVGEHSLSQLAIRSSALASSTPVTISEIRIEFTGSMKPILLRHKANTES.SETVKS
M1WIS4_CLAP2/616-1226IQLSD.DVASPLISSSFVFRTKESKAGDYCKAQLALTSHAMPGSSPIRLSSVRVDFQTGLKPITVDHASSETGDEASTSR
C4JTF4_UNCRE/662-1266VVFKEDEEVVPCLSASFAFERSEGNVGEPLLAQLVITSTAHETASAIRLSEVIVAFEGSLRPIKLQASPVAA...TVSDN
H1V6N2_COLHI/632-1214VTIND.DLVSSFISASFIFKTEDGKAGETCQAQLAIKSDAFSDAKPVTLKGLKIHFEGSLKTITLDHETH..SASGTEKC
B8M738_TALSN/646-1234IVLKA.EDVLTCLSASMVFQKGEGNVGQALQLQMAITSHAHQHAAPLKLSQVKVIFEGGLRPITIQADDATG...KPNSS
A0A0C4E0J0_MAGP6/633-1227VDIVD.ESSLPLLSSSFVFRSEEGNAGRTSQGQLAITSNAQPSSAPIVLSGIQITFDGSIKTIHLKHDTAEAE..KRQCG
G4NCT1_MAGO7/630-1218VVISD.DSSLPLLTTSFIFRTEEGNAGRACLAQLSIKSNAAPMSAPLVLSSLQIVFDGSIKTVQLKHDAGQET..KTQNG
G3JHI1_CORMM/630-1211VDVSD.GSATGFISTSFVFRNKESRAGDFCQAQLSLASNAMPGSAPVTLSNVRVEFEGSLKPITLEHAPSDEKGAGC...
E3QU68_COLGM/632-1215VMIND.NVISSFISASFIFKTEDGKAGEACQAQLAIKSDAFPDAATVTLKGLRIDFEGSLKTITLDHEAG..STKGTEKG
Q2UPL2_ASPOR/663-1261VVLRA.EDIISSVTASFTFERPEGNVGEPLHGQLVITSCAQRSSSPIRFSEIKIAFEGCLRPIKLQSNHVAE...TDATT
G7XKR2_ASPKW/663-1260VVLRA.EDIVPSVTASFVFQSSEGNVGEPSKGQLIITSCAQPSSSPLTFSEVKVVFEGCLRPIRLQSDCNVD...ADTAT
N4VGT4_COLOR/632-1208VTIND.DTVSSFMSASFIFKGEDGKAGETSQAQLALKSEAFSDAAAVVFKGLRVDFEGSLKTITLDHSL...DVSAREKG
A6QX66_AJECN/503-1110VILKG.EDSVSCLAASFVFAKSEGNVGEPLQSQLVIRSCAHAGSSPIRLTEVKVAFEGNIRPIKLLASENES...SSSSS
S0E618_GIBF5/633-1211ISLSD.DKTGSFISASFVFRNKEGKAGETCTAQLALTSHTFLDAAPITFESLKVEFSGSLRPILLEQGASE.DEDSSLAS
T5AEY3_OPHSC/622-1204VSLSD.DSASSFVSASFVFRNKEGKAGEKGTAQVAIYSEALPCSSPVTFSSLRVDFTGSLKPVIIKHRDSETPGDSC.GS
C7YM27_NECH7/633-1211ISLSD.DKSGSFVSASFVFRNKESKAGETCTAQLALTSHTFLDAAPITLDSLKIEFSGNLKPLLLEHEEPESDEDSS.KS
E4ZMR8_LEPMJ/666-1245VNLNA.KDHMSPLIITFAFSESEGNVGEPLQSQMTITSNARQGSAPVTLSSLSYHFSGALSEVQLSHERDE....KTAVT
L8G4R2_PSED2/136-727VVLQG.RDIHSFLCATFVFEQAEGKVGEPCTSQLSVMSFASKGSSPVTMAEIKIKFEGSLKPVTIRHSS.EAQDVEVRPD
G9NXZ6_HYPAI/630-1207ISISD.DLASSFLSASFVFRAKEGRAGETCLAQLSLNSEALSGAAPVTLSSIRVEFEGHLKPITLVHDSALQMNSA..EG
T0LUP2_COLGC/632-1210VTIND.D.ISSFISASFIFKGEDGKAGETCQAQLAIKSDAFSDAAPVTLKGLRVDFEGSLKTITLDHAAE..PNAATVKG
G9MPU4_HYPVG/630-1207ITISD.DLASSFISASFAFRTKEGRAGETCLAQLSLKSEALQVAAPVTLSSIRVEFEGHLKPITLVHDSDLPTNSS..KE
K1XTU1_MARBU/632-1208VVLHS.NEIHSFLSATYTFEHAEGKVGELCPSQLVVTSVAIPTAASVTISDIKITFNGSMKPVVLSHRAIDDG..LDQSP
A1CQK2_ASPCL/664-1261VVLKA.EDVISCVTATFVFEKSEGNVGEPLKGQLILTSCAQRSSDPIRLSEVKIVFEGCLRPLKIQADQDVN...ADAKT
Q0CCQ2_ASPTN/665-1260IVLKA.EDIISCVTASFVIQNAEGNVGEPLSVQLVIRSCAQPSSAPIRFSAVKVVFEGCLRPIKLESSDDES...SDTTS
F2PXY2_TRIEC/646-1249IVLTD.KDVASCISMSFIFNSSSGNVGEPLRGQLVLQSDCSRKSSPIHLSEVKITFEGGLPSVRILADGNPA...DASES
B6QQY0_PENMQ/649-1238IVLKA.EDVVTCLSAAMVFQRGEGNVGQALQLQLAITSHAHQQATPLRLSEVKIVFEGGLRPITLHAKDIT....DDTNP
J3P062_GAGT3/633-1226VDIID.ESSLPLLSSSFVFRSEEGNAGRTARGQLSITSNAQPSSAPIVLSGIQITFDGSIKTIHLKHDTAQAK..KRQCG
U7Q1R6_SPOS1/669-1328VKLPEGTPPPSFLSAAFVFKNGEGKAGEAALAQLTIRSDALANSVPIVLEELHLQFNSSIKPIVLRHSA.DATATFFTKG
M2SXX2_COCSN/666-1245VNLNT.KEHISCLSVSFAFSEAEGNVGEPLQSQIAITSNARPGSAPITLSFLQYQFSGGLAEVRLTHQEGE....ELSDH
V5G1J1_BYSSN/642-1241VALRS.EDVVSCLTASLVFERPHGNVGEPLRLQLAITSRAQPESLPIRLSEVKVVFEGGLRPIKLLADESAP...GGSPG
A0A0E1RX69_COCIM/661-1263IVFKE.EEVISFLSASFAFQKLEGNVGEPLQSQLVIGSCAHGSASPISLTEVKVTFEGSLRPIKLQASHEAA...IVACN
Q5BDK6_EMENI/657-1255IVIKA.EDVVSSVTATFIFQKAEGNVGEPLQCQLVLRSCAQKSSVPVRFAELRVAFEGCLRPIRLQSDQNID...ADTST
K9FSR4_PEND2/663-1258LVLRA.EDVITSLAASLVFERSDGNVGEPLQAQLSITSCAHKSSASIRLSEVKLVFEGCLRPVKIQSDQNQD...ADTTT
C5GAE4_AJEDR/665-1268VILKG.EDSVSCLAASFVFAKSEGNVGEPLQSQLVIRSCAQAGSSPIRLTEVKVVFEGSIRPIKLLPSEDAT...SSSST
S3D1H3_GLAL2/625-1196VVLHE.SEVHSFLSATFLFERLEGKVGEASRSQCVVTSSALPTSTPVTMTSLQIDFEGSMKPIIIRHKAMEETRSAPGNP
G2X5V0_VERDV/635-1221VSLSN.DNMTSFVSASFVFKTEEGKAGETCQAQLAVTSTAFPDSAPIVLKQLRVDFAGSLQTITLDHSIEEKTKGSMEKH
E4V6J7_ARTGP/54-658ILLTE.KDVASCISMSFTFNSSKGNVGEPLKGQLVLQSDCTRKSSPIHISEVKITFEGGLPPIRILADGNAA...AASGS
H6BX93_EXODN/653-1252VVIDM.DEAVSPLVPAFAFSTHNVFVGEPLECQLSIESRARQGLSPIQLTEARVVFEGSLKPICLVSGEVQHQ..ENDAS
E9E0X1_METAQ/607-1181IQLSD.ASSSHLISSSFVFRSKENKAGDQCLAQFTLTSNAMADSMPISFSSVKILFEGSLKPILLQHGSSGEE.......
S8BAM7_PENO1/662-1256VVLRA.EDVMTSLTASIVFEKPEGNVGEPLQAQLIISSCAQPTSAPIRLSEVKLVFEGCLRPLKLQSASELE...PDTTS
G0RNV0_HYPJQ/637-1222ITISD.DLASSFVAASFAFRSKEGRAGETCLAQLSLKSDAHQVATPVTLASIRIEFEGHLKPITIVHDSSAPSTNSS.GE

PF04628

TPPC2_CHICK/9-136----------------------------------------------IVGHHDNPVFEMEFLPPG..KAESKD........
Q4X1U7_ASPFU/7-185----------------------------------------------ILSPTDVPLFNIAFGTSK..GGGDGIARFR....
Q6BW18_DEBHA/13-197----------------------------------------------LISRKDVPLYIQSFDIGP..MDSENPQ.......
Q7QCA5_ANOGA/9-136----------------------------------------------IVGHNDNPIFETEFVTVN..KEAKKE........
Q57YJ1_TRYB2/2-125----------------------------------------------VVGPDDSTLFECEKFSDN..DS............
Q4CQS2_TRYCC/4-127----------------------------------------------VIGPDDASLFECAKSVDG..ES............
TRS20_YEAST/7-171----------------------------------------------IIGKKDNPVYEIEFTNAENPQGFPQD........
Q7RCP8_PLAYO/11-149----------------------------------------------IIGKGDIPIYEADLSING..KKDIS.........
Q6FVV2_CANGA/7-168----------------------------------------------IIGDHDRPLYEAEFTQGP..QGFVQE........
Q6BRP5_DEBHA/8-164----------------------------------------------IIGTRDNPLYELEFSSFK..TAVSSSTSTNNIA.
Q5KAA6_CRYNJ/23-186----------------------------------------------VVSPRDSPLFELAFASAK..PPPPPAAAPPAFPS
TPPC2_DICDI/8-131----------------------------------------------IIGKNDNPLYEIEFPITV..QKKE..........
TPC2L_DICDI/9-139----------------------------------------------IVGKGNNPLFIQDFSSSI..TDE...........
A8X604_CAEBR/10-138----------------------------------------------IIGHSDQPIFEMDFPAGE..RKTKESE.......
TPPC2_DROME/8-135----------------------------------------------IVGQNDNPIYEKEFSTVN..KELRKE........
TRS20_SCHPO/7-134----------------------------------------------IIGTKDNPVYELEMGPIN..EKLDRS........
Q6CFC6_YARLI/9-134----------------------------------------------IISRENTPLFIGIYPGEG..ETT...........
Q5A920_CANAL/9-148----------------------------------------------IIGTKDNPLYELEFSSFK..SAN..ISTTDNVP.
Q651C7_ORYSJ/7-136----------------------------------------------VVGHQNNPLYLQSFTEAD................
Q4UE14_THEAN/25-171----------------------------------------------IVGKDDKPLLIEDLSTPG..RRSDP.........
Q6C760_YARLI/7-139----------------------------------------------IVGTEDNPIYTQEFGTYR..QGGDGNSRF.....
Q74ZF3_ASHGO/7-174----------------------------------------------IIGHKDNPIYEVEFISLQ..QSFPPD........
TPC2L_HUMAN/7-138----------------------------------------------VIAKENYPLYI....RST..PTE...........
Q6CQN4_KLULA/6-155----------------------------------------------IIGTSDNPIYEAEFTTAK..NTFQPE........
Q7F8Z0_ORYSJ/9-132----------------------------------------------IVSKNDIPIYEAEVGSAP..KKE..D........

PF04099

Q20100_CAEEL/5-215-----------------------------------------IQHLFIINRAGSLIYSWEARTET--PEVEKTYEWPIDVH
O77358_PLAF7/1-144-----------------------------------------MYSLYVNNQHGTLVYQKHFSEEI--..............
TRS23_SCHPO/1-132-----------------------------------------MHALIIINRAGSLIFQREFGSS.--..............
Q9VA95_DROME/3-137-----------------------------------------IFNLYIFDKFGTLLHYAEWNRTK--KSG...........
Q9LZ97_ARATH/4-134-----------------------------------------IYSLYIINKSGGLIFYKDCG...--..............
Q9VLI9_DROME/3-209-----------------------------------------IYGVYIVSKSGGLIFNLDNNVPR--IEHEKTFTYPLDLV
Q9AWN0_ORYSJ/33-178-----------------------------------------AQVLYVFNRGGVCLLYREWHRPL--RT............
TPPC1_HUMAN/3-137-----------------------------------------VHNLYLFDRNGVCLHYSEWHRKK--QAG...........
TPPC4_MOUSE/3-209-----------------------------------------IFSVYVVNKAGGLIYQWDSYSPR--AEAEKTFSYPLDLL
Q9SYB8_ARATH/23-168-----------------------------------------AHMMYVFNRNGVCLLYKEWNRPL--HT............
A7UW60_NEUCR/3-157-----------------------------------------VFSLVIINKAGGLIYNRTFHEGG--..............

PF01217

AP3S_SCHPO/1-139----------------------------------------MIYAVFIFNNKGKPRLTKFY.TPI----------------
AP1S1_MOUSE/1-142----------------------------------------MMRFMLLFSRQGKLRLQKWY.LAT----------------
AP2S_YEAST/2-147----------------------------------------AVQFILCFNKQGVVRLVRWFDVHS----------------
AP2S1_HUMAN/1-142----------------------------------------MIRFILIQNRAGKTRLAKWY.MQF----------------
AP3S_YEAST/1-160----------------------------------------MIHAVLIFNKKCQPRLVKFY.TPV----------------
COPZ1_BOVIN/12-153----------------------------------------TVKAILILDNDGDRLFAKYYDDTY----------------
AP1S1_YEAST/3-146----------------------------------------QLKYLLLVSRQGKIRLKKWY.TAM----------------

PF09201

C5E0Z1_ZYGRC/1-156----------------------------------------MLEQFVVFTSGGQVVYQFNCLGKK----------------
A7TFS7_VANPO/1-148----------------------------------------MFDQLVIFTPTGEVLYEYNPLNKK----------------
G8JRB0_ERECY/1-141----------------------------------------MIDQLAIFTVQGQLLCKYNALGKK----------------
G0VGX2_NAUCC/1-143----------------------------------------MFDQLTIFTPQGQVLFKYNCQGKK----------------
G8BTK8_TETPH/1-155----------------------------------------MFDQLAIFTPQGEVLYQYNPSGKK----------------
Q6CTR2_KLULA/1-140----------------------------------------MIDQFAVFTPAGNLLYGYNSLNKK----------------
G0W8F2_NAUDC/1-150----------------------------------------MFEQLAIFTLQGIILYQYNCQGKK----------------
I2GXE9_TETBL/1-153----------------------------------------MFEQLAILTPQGTVLYQYNPLGKK----------------
G8ZVC5_TORDC/1-153----------------------------------------MFEQFCIFTPQGDVIYQFNCAGKK----------------
SRPR_YEAST/1-155----------------------------------------MFDQLAVFTPQGQVLYQYNCLGKK----------------
C5DM67_LACTC/1-140----------------------------------------MIDQFVVFTLKGQVLYHFNPQGRK----------------
Q6FSE1_CANGA/1-148----------------------------------------MFEQLTIFTPQGEVLYYYNCYDRK----------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
A0A0D1DNV8_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247NSPITELDLTEA...............EEQTSA..TVPSFKGDADLTLSAGEVRVFVFPVVFKEAGEVFVENASFEIETS
R7YHS6_CONA1/667-1263RFSMVEVDLQEN................IDSAISKIPSRLAGNADLTFYPGQTKVFVFAINFKEAGDVGAVDSTFIVEAE
C5G0L5_ARTOC/657-1267SHTLSSVVLGDA.........VSVPSDDQTPKA...CTEMRGNANLSLFAGQTSAVTLTLVPREAGHVRVASITLVVADD
G2YB15_BOTF4/638-1224GVLFKKTSLVDE..........STVEKGHDPDDPPTRHTLTNYEDLTLSPGQVKAFEFVNLLREAGDAKALKVTFSIASE
M1WIS4_CLAP2/616-1226KTQLAEIILEEA............FTKSDSGSD..VASQFSGACDLTLAAGQTRVLEMAIPLREPGEAGVSSVGMHYESE
C4JTF4_UNCRE/662-1266QTRISHTMLVDS........QSSDAASIQSPTL.GGTLSMTGTVDLAFPPGQTKAFNLTCIPREAGKVQVTSITLMIEDE
H1V6N2_COLHI/632-1214DVTLSNVPLAQA...........ARAAAEEGEE..GSSGLSGSANLSLKPGHTNIYEMAIPLREPGEAQASSVTLILEAE
B8M738_TALSN/646-1234SSQIFDIKLRDS.......AHSTESSTLLSPTG..HVSSMIGQADLTFRPSEARVFNMTAIPRESGESRIASITIAIEEE
A0A0C4E0J0_MAGP6/633-1227NAIVSGVSLQEQ.....SVEALRGDDPGKAKTAPAAVSVLVGSCDLTLPPGQTIVYEMDVPLREPGDAKALATTLSVSND
G4NCT1_MAGO7/630-1218NVKISTVTLREE..........TMQSSDPDTGASASISLLVGSCDLTLLPGHTMVYEMGVVLREPGEAKAASTTLSLSTE
G3JHI1_CORMM/630-1211PVSIRLVTLDEE.............FLDDSNDD..LPTKLNGSCDLTLQAGQRVVIEMAIPLREAGDVEPSTVTLNMNTK
E3QU68_COLGM/632-1215NVTLSRVPLTEK...........ARADAEEGDE..GTSGLGGSADLSVKPGHISVYEMAIPLREPGEAHASSVTLVLETD
Q2UPL2_ASPOR/663-1261PCTISSPSLREP.......STSSDTASLQSPTN..FLTPLIGTADLTIGPCQTKVFNVACIPREAGESRVASITLLIEEE
G7XKR2_ASPKW/663-1260PCTITSPMLRDP.......STAEDPAALQSPTS..GLTALTGLADLTFGPSQTKVYDITCIPREAGESRVASITLTVEEE
N4VGT4_COLOR/632-1208SISLSDVALTET...............PRESEE..GASVLGGSANLSLKPGHTNVYEMAIPLREPGEALAASVTLTVETD
A6QX66_AJECN/503-1110GCEIVPVSLQDS........VNLDASTVQSPTA..GLPQMVGATNLSFGPKQTRAFNLVSVPREPGEAQVASITLRIEQE
S0E618_GIBF5/633-1211KISILLLSLTED.............YAEGSEDE..LPTLLKGTSNLTLRPGQTRVFEMKIPLREPGTATASSVTLSHSNA
T5AEY3_OPHSC/622-1204SVCVDTLALDEE.............FSKGSEDE..LPSQLRGQSDLTLKPGQRRVLEVAIPLREAGDAEASSVTLSYQCE
C7YM27_NECH7/633-1211GVFISSISLQED.............FAGESEDD..LPSLLRGQSNLVLQPGQTRVFEMKIPLREPGTATASSVTLSHSND
E4ZMR8_LEPMJ/666-1245TSRMLACTLEET.................STSG..QKPQWAGVSDLTIYPGQTNVYTFPLIFREAGDVDADSCVFEVNTD
L8G4R2_PSED2/136-727NTSFTKVALREE....HGNSEDTAMSVGKERGL..RFSTLVGDESLIFLPGQTRVFELSCPLREPGKAKAISATFALAAP
G9NXZ6_HYPAI/630-1207PISLAAEEDADE................DKKDE..KEDRLTGRCDLTLRPGHRQVFEMNIPLREPGEASASTLILSYKAD
T0LUP2_COLGC/632-1210AVSLSNVTLKET.............ARAGEDEE..GASVLSGSANLTIVPGSTNVYEMAIPLREPGEARADSVTLLLETD
G9MPU4_HYPVG/630-1207PVSVTAVAETKD.................EEDE..KEGQLTGKCNITLRPGHRQVLEMNIPLREPGQASASRVILTYKTE
K1XTU1_MARBU/632-1208VVALQSVPLTEA....................TPDERSVLIGHASLVFGPGQTRIFEFSTVLREDGEAKAISATFSMATD
A1CQK2_ASPCL/664-1261PCIISSLTLREP........TSADSTSLNSPTI..GLTALVGLGDLTLGPSQTKVFNVTSIPREAGESRVASITLLIDEE
Q0CCQ2_ASPTN/665-1260PCTISSISLQEP.......RLSADVSSLQSPTS..HLETLTGVADLTIGPSQTKVYNLICTPREAGESRVASVTLLIEEE
F2PXY2_TRIEC/646-1249SHTHASISLADG...............QTGPSS..LLQEIKGNANLTLFPGQTRAFTLTLIPREASDVRVASITLIVADD
B6QQY0_PENMQ/649-1238LSHIYNVKLHDL.......ASSTESSTFLSPTA..HMASMIGQADLIFKPGETRVFNMTAIPREPGESRIASITLAIEEE
J3P062_GAGT3/633-1226KATVSDVSLQEQ.....SVEALRGDDPGKEKTTPAAVSVLLGSCDLTLPPGQTVVYEMDVPLREPGDAKALATTLSVAND
U7Q1R6_SPOS1/669-1328KTTHSTIHLEEEDEDDPGAGTKTINGGDDDDET..RVLGLHGSANLTLQPQSTLVFELAIPLRQPGDAHAVSADLVYRCP
M2SXX2_COCSN/666-1245ASRMYSCTLDEV.................QSAI..GKSQWTGTADLTLHADQTKVYSVPLIFRESGDVDVTACILGVSTE
V5G1J1_BYSSN/642-1241RILILPVTLRDS.......VTSTDSSALQSPTN..SLASMTGTTDLSVQSSQTKVFDLTSIPREAGEARIASITLMIEEE
A0A0E1RX69_COCIM/661-1263QTEISNITLSDS........LLSDSASILSHPS..NLPSMTSTADLTLAPGQTRVFNLISIPREAGEVKVSSITLMFEDE
Q5BDK6_EMENI/657-1255TCLISSPSLRDP.......SATSDSSVHQSTTS..ALNALTGIADLTLGPAQTKVYNLACIPRESGESRVASIALLVSQE
K9FSR4_PEND2/663-1258PCCVATLPLREP.........SNSDTAIQSPTG..GLTALVGIADLTLGPSQTKVFNLTCIPREAGGARVASITMLIEEE
C5GAE4_AJEDR/665-1268SCEIISVPLQDS........AKVDASSVRSPTA..GLSLMAGFTNLSFNPKQTRAFNLVSVPREPGEARVASITLRIEEE
S3D1H3_GLAL2/625-1196RV.FSEISLAET....................VENTRSNQSGEADLCFAPGQSKVYEFQTPLRDDGEVKATSVTFSMNTE
G2X5V0_VERDV/635-1221NTSLAAIALVET.........TGPESEDVEETE..RGSVLNGRADLEIKPGCTSVYEMAIPLRESGEARAASVVLNFDTD
E4V6J7_ARTGP/54-658SRTHASISLGDG................QATAT..SSQEIKGHANLSLSPGQTRAYTLTLIPREASHVQVASITLIVADD
H6BX93_EXODN/653-1252RARFCDVALEDS.......SSTAVLASKRSSTE..TVPSLIGVGDLIIAPGHTIIYRFRVIPREAGEISIASIALKIQDE
E9E0X1_METAQ/607-1181SSFITKVALEEQ.............FSTDGPGD....LPLSGICDLTLKPGEKRVFEMAIPLRESGEAEASTVVATYEHK
S8BAM7_PENO1/662-1256PCCIFSSSLRET..........TPAGEVQSPTA..GLATLVGDADLTIGPSQTKVYNLTCIPREAGEAQIASITMLIDEE
G0RNV0_HYPJQ/637-1222SPSVSAVSLTER...............LPESNE..KDAYLTGTCDLTLKPGHRRVLEMDIPLREPGQVSASRVILTYKAD

PF04628

TPPC2_CHICK/9-136.............................DHR------------------------------------------------
Q4X1U7_ASPFU/7-185..........................FPDTAQ------------------------------------------------
Q6BW18_DEBHA/13-197............................NANK------------------------------------------------
Q7QCA5_ANOGA/9-136.............................DHR------------------------------------------------
Q57YJ1_TRYB2/2-125...............................V------------------------------------------------
Q4CQS2_TRYCC/4-127...............................T------------------------------------------------
TRS20_YEAST/7-171..............................LK------------------------------------------------
Q7RCP8_PLAYO/11-149...............................E------------------------------------------------
Q6FVV2_CANGA/7-168..............................IK------------------------------------------------
Q6BRP5_DEBHA/8-164......................GRSNFPTSVK------------------------------------------------
Q5KAA6_CRYNJ/23-186WAAFAAAADPHDAPPAPAGPLIESRTAQQRDR------------------------------------------------
TPPC2_DICDI/8-131...............................T------------------------------------------------
TPC2L_DICDI/9-139...............................N------------------------------------------------
A8X604_CAEBR/10-138.............................GTR------------------------------------------------
TPPC2_DROME/8-135.............................DHR------------------------------------------------
TRS20_SCHPO/7-134.............................LNS------------------------------------------------
Q6CFC6_YARLI/9-134...............................T------------------------------------------------
Q5A920_CANAL/9-148......................GKSQFPQSTK------------------------------------------------
Q651C7_ORYSJ/7-136...............................D------------------------------------------------
Q4UE14_THEAN/25-171...............................P------------------------------------------------
Q6C760_YARLI/7-139...........................SPEMK------------------------------------------------
Q74ZF3_ASHGO/7-174..............................LK------------------------------------------------
TPC2L_HUMAN/7-138...............................N------------------------------------------------
Q6CQN4_KLULA/6-155..............................IK------------------------------------------------
Q7F8Z0_ORYSJ/9-132..............................LA------------------------------------------------

PF04099

Q20100_CAEEL/5-215LEEVDQKAVVVFGEKDGIKLRYYVKSVNGETVSGTRLQLGAQQVNVLEYLQEEDHYPVTVKFAAP---------------
O77358_PLAF7/1-144.................................................................---------------
TRS23_SCHPO/1-132...............................................................PT---------------
Q9VA95_DROME/3-137.................................................................---------------
Q9LZ97_ARATH/4-134..............................................................TKG---------------
Q9VLI9_DROME/3-209LDYDSKKVSVSFNRKDGINVGHVL...VAVNGMPVNGVTLDDGRDVRTTLDAPENYPINLKFSRP---------------
Q9AWN0_ORYSJ/33-178.................................................................---------------
TPPC1_HUMAN/3-137.................................................................---------------
TPPC4_MOUSE/3-209LKLHDERVLVAFGQRDGIRVGHAV...LAINGMDVNGKYTADGKEVLEYLGNPANYPVSIRFGRP---------------
Q9SYB8_ARATH/23-168.................................................................---------------
A7UW60_NEUCR/3-157...............................................................LN---------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
A0A0D1DNV8_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247RFHLA.......CT..SEAPQENTSPFWWYLTTTGLKTKRLGRIMDD.PAIKVLPKPPKMEVRL...........PNLQK
R7YHS6_CONA1/667-1263RFVLT.......YT..SAVEGPETMPVWWYTARNLLKTKRLRAAAAA..STKILPKPPKMQIFL...........PNLQK
C5G0L5_ARTOC/657-1267KFGLT.......YT...NTNSSYPQPRRWTKSKGGAIARRIGKDRDP.SYCHILPKPPKVLISV...........PGLRD
G2YB15_BOTF4/638-1224LFDFD.......YV...HSFDRPSFPEMWY.GEHATKKKIVRARPSS...IHVLPKPPKLELRI...........LEFQE
M1WIS4_CLAP2/616-1226AFDLQ.......HT...RVFKETDPVTGWY.VRGDDKPHALRAHART...LRIHPRPPKLQMTL...........LDPST
C4JTF4_UNCRE/662-1266MFNLT.......SV...ISSQSFKDPVWWSPGIKGAISRRIGKDRDT.ITCDILPKPPKVRILT...........PTLHD
H1V6N2_COLHI/632-1214AFTLH.......YT...VAFHDLGAADFWF.SPSLSRRRIVRQSAHV...IQVQARPPKLEIKL...........AQPLD
B8M738_TALSN/646-1234KFNLL.......YV...ITNHEQGMSFWWRDGLRGPSKKRIGKGRDT.TACKILPKPPNIQIQL...........PDLKP
A0A0C4E0J0_MAGP6/633-1227AFSLD.......YE...VPYKDTSVAGIWH..GPGRPRKIPRANSHS...IRILPRPPNVEIKV...........TSAIE
G4NCT1_MAGO7/630-1218TFGLD.......CI...VRHRDSGVAGLWY.SQDGKPRKIHRVNSHT...VRILPRPPNVDIKV...........NNIMD
G3JHI1_CORMM/630-1211TFDLT.......SN...LPFRDTDAAVGWF.IPGSSKPRKVRADSRM...LTIQPRPPKLDIKI...........ARQLQ
E3QU68_COLGM/632-1215TFTLN.......YT...IAFRNLEAADFWF.SPSLSRRRIVRQSAHV...IQVQARPPKLEIKL...........AQPLE
Q2UPL2_ASPOR/663-1261KFDLT.......CA...MTDLTQRDCFWWKQTKNSVARRRVGKNRDT.GRCKIKPKPPNIRITT...........PNLME
G7XKR2_ASPKW/663-1260KFDLT.......NA...ITDLTPYESYWWQQTSKGPSRRRVGKGRDT.GRCKILPKPPKIRVEL...........LNLRE
N4VGT4_COLOR/632-1208TFTME.......YT...TVFRDLGAEDIWF.SPSLAKRRIVRGNAHV...IQVQPRPPKMEIKL...........AQPLD
A6QX66_AJECN/503-1110NFDLS.......CV...ISEQNRDESVWWRMGKQGPIARRTGKDRDT.SVSRILPKPPKVRIST...........PRSRN
S0E618_GIBF5/633-1211SFDLD.......AK...IGIRDTDPIVGWY.IQGSSKPRSSRPEAGT...IRIQPRPPKMEIKL...........LEPSA
T5AEY3_OPHSC/622-1204TYDLS.......YT...MRFRETDVTVGWY.SAGSGVPRKPRSNSRL...LRVQPRPPKMQISI...........PDKLP
C7YM27_NECH7/633-1211AFDLD.......YK...LKFRETDPVVGWY.IQGSSKPRNSRPEAGT...IQIQPRPPKMEIKL...........VKPLA
E4ZMR8_LEPMJ/666-1245HFNLT.......CS..DTDLHSSPNPAWWVTSNGAVKPRKYKGAGGL..SVHILPKPPKVEIRL...........PDVRT
L8G4R2_PSED2/136-727LFDLE.......CI...IEFDHITTRDMWW.SQKPARKRVVRADPHS...ITILPKPPKMEIKF...........QALKD
G9NXZ6_HYPAI/630-1207TFELD.......YK...LSLSELGKVSGWF.AQGSAKPRLSRPNGHI...LHIQPRPPKMKLRL...........IEPLE
T0LUP2_COLGC/632-1210AFRLD.......YT...VDFRDLGVADFWF.SPSLARRIIVRQSAHV...IQVQPRPPKMEIKL...........AKPLD
G9MPU4_HYPVG/630-1207TFELD.......YT...LSLSDLGKVTGWF.VRGAAKPRLSRPDGHI...LHIQPRPPKMKLRL...........VEPLG
K1XTU1_MARBU/632-1208HFDLE.......YV...NTFDQKIAPDVWW.GETSIKKRVVRLDATA...ITILPKPPKIQLRI...........VGMQE
A1CQK2_ASPCL/664-1261KFDLA.......CA...ITELARQEAYWWQETTHGAVRRRVGKGRDT.SRCKIMPKPPKIRIKT...........SGIKS
Q0CCQ2_ASPTN/665-1260KFDLA.......CA...VRDLGDRNSFWWQQSPNGMTRRRVGKGRDT.TQCRILPKPPKIRITT...........PNLKD
F2PXY2_TRIEC/646-1249KFDLT.......YTISSTSNDAYALPRWWAESKGSITSRRIGKGRDP.SSCQILPKPPKVLISV...........PGLRD
B6QQY0_PENMQ/649-1238KFNFL.......YV...MTNHERDMSFWWRHGPRGSYKKRIGKGRDT.AICKILPKPPNIQIQL...........PNLKP
J3P062_GAGT3/633-1226IFSLD.......YE...VPCKDTSVAGIWH..APVRPRKIPRANSHS...IRILPRPPNVEIKV...........KNAME
U7Q1R6_SPOS1/669-1328LYSLQMKLPLASYV...AGEGSRGRTPTWFLPRAGGRVSVPRADSQA...IKILPRPPKLDIQLLHAPVATAAATPIPTV
M2SXX2_COCSN/666-1245RFDLV.......SS..NTDIEIPIHPLWWIQSNNKIKPRSLKHGSGM..SVHILPKPPKMEISL...........PDVRD
V5G1J1_BYSSN/642-1241KFDLA.......YS...ITDLSQPESSWWQDTGKGPIRKRIGKDRDT.HACKILPKPPKIRLAI...........PNVKE
A0A0E1RX69_COCIM/661-1263RFDIT.......YV...VTQQPSKESVWWTLGKKGAMSRRIGKDRDT.SACNILPKPPKVLITT...........PSLRN
Q5BDK6_EMENI/657-1255DFDLT.......YA...ITDLAQQEAFWWQQTTKGPARRRVGKGRDV.DRCKIQPKPPKIRLTI...........PNLKS
K9FSR4_PEND2/663-1258KFDLG.......YA...ITEPNQRESFWWQQTQKGVTRRRVGKNRDT.SRCKVLPKPPKIRLTT...........PNLKE
C5GAE4_AJEDR/665-1268NFDLA.......CI...ISEQNREESVWWRMGKQGPISRRTGKDRDT.SVAQILPKPPKVRITT...........PNLRN
S3D1H3_GLAL2/625-1196NFDLE.......YV...HAFEQTTLADIWW.GEKGMQKKIARPDTST...LRVLPKPPKMELRF...........RGLQG
G2X5V0_VERDV/635-1221AFTLD.......YT...IGFQAANVADVWF.GPSLSKRRIPRLSSHA...IHVRPKPPKMEIRR...........SAILQ
E4V6J7_ARTGP/54-658KFDLS.......YTTTSTSNDAYTLPRWWTESKGRVVARRIGKDRHP.SRCQILPKPPKVLISV...........PGLRD
H6BX93_EXODN/653-1252KFTLT.......VS...SSDSGHSTARWWEARNGIPIARPFGQESNAFNTIDVKPKPPKLQIEA...........PDLKP
E9E0X1_METAQ/607-1181SFDIQ.......YT...MSFRDTDQVTGWY.IKTSDRPRQLRPDARI...LHIKPRPPKLLVSL...........PESSG
S8BAM7_PENO1/662-1256HFDLA.......YV...VTNHLTQKAYWWQETKKGPSRRRVGKDRDT.TRCKIMPKPPKIRISL...........PNLKA
G0RNV0_HYPJQ/637-1222AFELD.......YT...LSLSELGKVGAWY.VHGLAKPRLSRPDGHI...LQIQPRPPKMKLAL...........VEPMD

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
A0A0D1DNV8_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247RYYATEPVVLELEVENGEDEETEAGLEFIL.........MDDQRKELEFSW.LSSPDAGATS..........DDKSANLP
R7YHS6_CONA1/667-1263AYYTDELVTLDIEIFNGEEEETEAVLEVRF.........FGRVESTLAFSWKIMEEAEQGNGSAEQAD...NANSEIDLP
C5G0L5_ARTOC/657-1267MYYSGERAGLNIRLDNNEDAAATIVVEVKL.........SGRSESLAAISW.LDGVDSDEQS.........EGMSASQTT
G2YB15_BOTF4/638-1224QYYTNELIYLNLEVKNGEETDSIVDLEARL.........LGENIPSNIVLRRLDKTDSPSDTESE......EDDHELS..
M1WIS4_CLAP2/616-1226QFYTDETIRIDVEMRNDEDEAALVKLGTQL.........KGEAVPSFTLQV..GEEEVAGTAA.EVDEEDIQARSAAVFT
C4JTF4_UNCRE/662-1266HYYTDEHAVLDIQIENEEDEAAEISIEARL.........LGQSEDSAQIHW.VDDPEACVQP..........RDSSPTSP
H1V6N2_COLHI/632-1214QFYANEPMDLVLDVVNAEDTEAIAKLEVHV.........FGEQIPPFRVCI.EDDEEHTAEAG.K......EETKLTGLS
B8M738_TALSN/646-1234HYYTSERVSLTVAIQNNEDDAAEVAMQIRV.........RGQPDSPLKISW.SDDADETT..............EFDGVS
A0A0C4E0J0_MAGP6/633-1227QYYTNEAIDLELEIINAEDASAELRLNVVI.........AGEESPDFRLAA.GDEESAVAEADTA......GEYKEMTIP
G4NCT1_MAGO7/630-1218QYYTNEAIELEFEIINAEDADAQLEVGVVI.........AGQEPPAFRVTSGGDIDVSATDINSA......DDSRQVTAP
G3JHI1_CORMM/630-1211QYYANEPIALNVVLENNEDEAATTKLDIHV.........LGKLIPKLHVGA..GGKDYATETRVE......EEAELTGIN
E3QU68_COLGM/632-1215QFYANEPMDLLLDVINAEDADAVAKLEVHV.........FGEQIPPFRVHI.ENGEEHTAEAG.K......EEAKLAGLS
Q2UPL2_ASPOR/663-1261TYYTDERIVLKVEIHNEEDEAAEVTAEARL.........FGRPESAAKVLW.LDEEGSPWIQ...........GSESSTP
G7XKR2_ASPKW/663-1260TYYTNEEIILRVGVDNEEEEAADVSVETRL.........FGRPESTAKIRW.LDEENSSEIH...........GSGESTP
N4VGT4_COLOR/632-1208QFYANEPMELVLDVVNAEDTEAIAKLDVHV.........FGEQIPPFRVQV.EDQDDHDAQPG.Q......EEAKLTGVP
A6QX66_AJECN/503-1110HYYTDEKVVLDVQIDNDEDEAAEVDVEIKL.........FGYTETSATFSW.INETASDSIA.........AEDASPSSL
S0E618_GIBF5/633-1211QYYANEAIELEVELINAEDESATAKLDIHL.........FGKEIPAIRVVT..EGNEGSAEST.T......EEAKILGLP
T5AEY3_OPHSC/622-1204QYYTNEVVELKVELRNDEDEPAGVKLDVIM.........SGDQHPGFRVLV..EGEERSAECG.Q......DECWVTGIP
C7YM27_NECH7/633-1211QYYANEAIDLHIELLNAEEESASVKLDIHV.........FGKEVPAIRIEA..DGHEGSSEAQ.E......EESKISGLV
E4ZMR8_LEPMJ/666-1245QYFTDEPVTLAIEILNQEEEDTEAVLEVRL.........LGRQQDALGFAW....LERPASSPMKEVPPQVDGFKDVDLP
L8G4R2_PSED2/136-727QYYTNEPIDLNVDIFNGEDEESLASLEVTISN.....DGVGTPQLPFKIIIPTAPESNVEYTP........DDETPPSAK
G9NXZ6_HYPAI/630-1207QYYANEPIALRIGLYNEEDDSANVKLDIRI.........IGKGIPRFQVQA..GEHKREVDAT.E......EESQVTDLT
T0LUP2_COLGC/632-1210QFYANEPMELLLDVFNAEDEEAVAKLEVHV.........FGEQIPAFRVQA.ADQDEHKAEAG.Q......EEAKLTGLP
G9MPU4_HYPVG/630-1207QFYANEPIPLKIGLHNEEDDSANVKLDIRI.........VGKIIPRFRVDA..GEHKREVDAA.E......EESQVTGLA
K1XTU1_MARBU/632-1208QYYTNEQIVLKVEVTNGEDVESIVNLEVRL.........VGDDVPTVTLKL..DDKENNEITELE......SGNQLAGTP
A1CQK2_ASPCL/664-1261TYYTNERVILQMDVHNEEDEAADVTAEIRL.........FGQSKLGGQILW.LEDEDETESH...........RSRDSSP
Q0CCQ2_ASPTN/665-1260NYYTNERIVLKLGIHNDEDEAADVLTETRL.........FGRPESAAKISW.LDEEDSAEPQ...........DSGTSTP
F2PXY2_TRIEC/646-1249AYYFGEKAGLNIRLDNNEDASASIVVELKL.........SGRSEYPAAISW.LDGADVEEHS..........KETEELSA
B6QQY0_PENMQ/649-1238HYYTNERVSLAVAIQNNEDDAAEVAMQIRI.........LGQPHSLLKVSW.SDDAEEAT..............EFGGVS
J3P062_GAGT3/633-1226QYYSNEAIELELEIVNAEDASAELRLNVII.........TGEEPPDFRLAA.GDEESAVAEPDTA......GESKEMMIP
U7Q1R6_SPOS1/669-1328QYYTNEAIDLALELVNAEDADASVKLDVIMEGGSDEAGASGSSTPGFTLLVAGDEIDTAEPQTTDIASPTPPTAMLRSVP
M2SXX2_COCSN/666-1245QYYTDEQVTLAIEIINQEDEDTEAVLEVRI.........LGRSKDSLRYTW....VDRPASSPMKEVPPALDGSTDVDLP
V5G1J1_BYSSN/642-1241AYYTNEHVCLDISIQNEEDEMADLSMDVRL.........FGHPESVAKLAW.ADEEVPTETS.........DEDAADGSP
A0A0E1RX69_COCIM/661-1263HYYTDEHMVLDILVDNEEDEPAEISVEVRL.........LGQSEASAQIHW.ADEPEADAQS..........NKFAPTTP
Q5BDK6_EMENI/657-1255TYYTNERIVLNLVIDNGEDEAADVVAEARL.........FGSPDSAVNISW.LDQEGSVQAS..........TESRPNTP
K9FSR4_PEND2/663-1258TYYTNERVMLQIGIHNEEDEAADVSTEIRI.........FG.TESTAQIQW.LDTDSDLDLL...........ESRASTP
C5GAE4_AJEDR/665-1268HYYTDEKVVFDVHIDNDEDEAAEIDVEMKL.........FGHTGTSATFSW.INETAADSEA.........SEDAGSSTP
S3D1H3_GLAL2/625-1196QYYTSEGISLELEVLNAEDVDAITNLEVYL.........RGEDAPPIEIRA..SEALSAPEEQDE......VEKSLEGTP
G2X5V0_VERDV/635-1221QYYANEPIELPLDIFNAEDADATAKLELHV.........FGEHVPALRVQV.DGLEEQSVEAA.K......EESKFQGLT
E4V6J7_ARTGP/54-658VYYSGERAGLNIRLDNNEDAAASIVVELKL.........SGRSEYPAAISW.LDGADSGEQP..........EEAKEMSA
H6BX93_EXODN/653-1252TYYTNESFNIDFDILNGEDEEVVVSVEVRM.........IGSVEGAAQIRWHSSETNEAVDPS........SDTGSPTLP
E9E0X1_METAQ/607-1181LYYTNETVELGVELRNEEEEPAHVKLDVQL.........YGKSVPSLKLLV..GEHERNGETG.E......EATKALGVP
S8BAM7_PENO1/662-1256TYYTNERVVLKLDLQNEEDESASVSVEIRL.........FGSPESSAKLQW.LDGSSGST.............ESGASSP
G0RNV0_HYPJQ/637-1222QYYANEPIPLRISLLNEEHDAANVKLDVRI.........VGKTIPRFRVEA..GEHKREVDAA.E......EESQVTGLT

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155-------------------------------------------------------------------------------T
A7F9J5_SCLS1/1351-1514-------------------------------------------------------------------------------T
B2W2H3_PYRTR/1490-1643-------------------------------------------------------------------------------P
B6H3B0_PENCW/1240-1399-------------------------------------------------------------------------------K
C5FEM2_ARTOC/1257-1416-------------------------------------------------------------------------------I
C4JLA5_UNCRE/1213-1358-------------------------------------------------------------------------------V
A0A0D1DNV8_USTMA/1235-1382-------------------------------------------------------------------------------C
B8P4P6_POSPM/992-1139-------------------------------------------------------------------------------N
B0D3E6_LACBS/1015-1161-------------------------------------------------------------------------------T
C4R0Z1_PICPG/1026-1192-------------------------------------------------------------------------------Q
A8PKV5_BRUMA/843-1047-------------------------------------------------------------------------------P
B4HE09_DROSE/978-1138-------------------------------------------------------------------------------Q
F7CPS6_CALJA/149-377-------------------------------------------------------------------------------E
H3CJ11_TETNG/1022-1246-------------------------------------------------------------------------------Q
Q4WSJ6_ASPFU/1252-1410-------------------------------------------------------------------------------L

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247GH.............FIGKLESGAKRTHAVHFIAPIDSGELLFEAKVVYHTIGEPDVPISKTIVGELAIIDPFEATYDFT
R7YHS6_CONA1/667-1263GH.............QVGKISSAARCTQSITFRTPPDPAEYTLEIKVLYHLITDLETPISKTLTTDFFFADPWEAAYDFS
C5G0L5_ARTOC/657-1267GATTGITTQTIRR..KVAEIGPGEHTVLPAVIIEAPHPMQYDLEISAFYHLNSDPETPISKMISLDLPFIQPFEANYKFL
G2YB15_BOTF4/638-1224................LGTIASGSSITVEMVISSIDLPAVYDLSLKASYNLVTDLETPISQAMSAQLSILNPFEANYDFS
M1WIS4_CLAP2/616-1226................MGAIASGATAKFRLTISSTSTSSTLDLLLRATYHLESDAATTILQVLSVPLNIVGPFEANYDLV
C4JTF4_UNCRE/662-1266TDDSGSLGQVKRK..EIGALDSGGRKAISLNVTNTSVPLEYGLEISAFYHLLSDPETPIFKTVTLDLPFIRPFEANYELM
H1V6N2_COLHI/632-1214................LGTLATSQSTRVKIGLDPVQLTTSYDVTLRVFYHLVTDPATLIMQILPVQLTVVNPFEANYDLI
B8M738_TALSN/646-1234...VESTNHLKSR..SVGTLSPAAISEIPIILSNTADALEYEVEISVNYFLVSDPETPISKSISATLVFIRPFEANYDFL
A0A0C4E0J0_MAGP6/633-1227................LGTVAAAASVRATVHIDAVDFPASFDVAFVASYHLITDPTTPIIKTEDFKLTLVNPFEANYDLL
G4NCT1_MAGO7/630-1218................LGLVPSTGIVKGVIHIDPMDFSTTYELAISASYSLVTDPDTPVIQTMDFRLELVNPFEANYDLL
G3JHI1_CORMM/630-1211................LGKIESSASQEIVLGIEPIDGPMTYELQLRATYHLETDSATPIIQVSTVQLNLVNAFEANYDLV
E3QU68_COLGM/632-1215................LGTLATSQTTRINISLDPVQLTTSYDVTLRIFYHLTTDPATLIMQILPAQLTVVNPFEANYDLI
Q2UPL2_ASPOR/663-1261...VEGLSHFIKR..PLGTLETSSHRQLEIVLTDTRDASDYELEISSVYNLVSDTQTPIIATLRVKIPIIRPFEANYEFM
G7XKR2_ASPKW/663-1260...TEGNSHHLKR..PIGVMERSSHQELTIVVTDTNDALDYELEVSALYNLVSDVQTPIIASMRVGLSIIRPFEANYEFL
N4VGT4_COLOR/632-1208................LGTFGTAQSTRVKVKLDPVQLTTSYDVTLRVFYHLVSDPATLIMQILPVQVSVANPFEANYDLI
A6QX66_AJECN/503-1110DTPIEGGSSTLSKRRTVGTLACGASRTLSILFTNTTLPLDYEVEISAFYHLVSDVETKIFKTVSLDLSFIRPFEANYEFL
S0E618_GIBF5/633-1211................LGAIKSTASVKMVLHIDAAPGPTTFDLHLKTSYHLDSDVATPIMQLLTVQLNVVNAFEANYDLV
T5AEY3_OPHSC/622-1204................LGVIENGSLRSLVVRIDAVDVACLHDVQLRASYHLESDAATPMAQALPLQLSIVTPFEVNYDLV
C7YM27_NECH7/633-1211................LGTMEKASSSQLVLHMDPPTGPTTFDLHLRASYHLDSDAVTPIMQMLAVQVNVVNAFEANYDLV
E4ZMR8_LEPMJ/666-1245GH.............VVGKLSQGASTVEKIHFTAPPDPADFALEVKVLYHLLSDRDIPISKIMVADLVFNAPFEASYDLN
L8G4R2_PSED2/136-727................LGSISSSNTISAIVVLGPILIQSTYEITLQLKYNLASDLETPITRTAAIRFNIGSPFEANYDFS
G9NXZ6_HYPAI/630-1207................LGHIASSSSLEASIRLEPALAPTVYELQIRADYHLESDAATPIVQVLPIHLNIVNAFEANYDLM
T0LUP2_COLGC/632-1210................LGTLGTSQSTRVKVSLDPIQLTTSYDVTLRVFYHLVSDPATLVMQILPVQLHVVNPFEANYDLI
G9MPU4_HYPVG/630-1207................LGNIGSSSSLELSIHLDPAPAPTVYEIQIRADYHLESDAATPIVQVLPIHLNVVNAFEANYDLM
K1XTU1_MARBU/632-1208................IGRIASTAATIVDVVIPALDLPAVYDLSLKAAYNLVTDLETPVYQSMATQLEVINPFEANYDFS
A1CQK2_ASPCL/664-1261...IEGAHHFLRR..SIGIMERSSRRDLALVLTDTLEPSTYELEINCVYNLVSDIQTPIIATHRVTVSVVRPFEANYEFL
Q0CCQ2_ASPTN/665-1260...IEGVAHFLKR..PIGVMESSARRELEIVLTGTEDASDYELEISCVYNLVSDVHTPIIATARVSLSIIRPFEANYEFH
F2PXY2_TRIEC/646-1249SQTKEVATQTIRR..KIAELGADEHTILPAVVVEAPHPIQYDLEISVFYHLSSDPEAAISKAISLDLPFIQPFEANYNFL
B6QQY0_PENMQ/649-1238...VETTIHLKSR..SVGILSPAAISEIPVILSNTVDALEYEVDISVHYFLVSDPETPISKSISATLAFMRPFEANYDLV
J3P062_GAGT3/633-1226................LGAVAAADSTRVTVHISAVDFPASFDVTFVASYHLLTDPATPIIQTEDFKLTLVNPFEANYDLL
U7Q1R6_SPOS1/669-1328................LGHVKAGHSVAIAIRIPPTTPSMDLDLTLRAAYHLVSDTATPITQQLSVKLSLSNPFEANYDLL
M2SXX2_COCSN/666-1245GH.............VVGKLAQGARTTERIRFTAPADPADYALEVKVLYHVLSDRDIPISKIMVADIVFNAPFEASYDLN
V5G1J1_BYSSN/642-1241...MGRARHSLKR..SIGTMESASRQNLSLVLSDTTDAFDYELELSVLYHLVSDPETPISKTLTAELSFVRPFEANYEFL
A0A0E1RX69_COCIM/661-1263TGSDPSLGQIKRR..SIGIVDATCRRTLPLMFTDTSMPQDYELEISAFYHLVSDPATPIFKTVTLDLSFIRPFEANYELM
Q5BDK6_EMENI/657-1255...AEEEPHSLKR..SVGVIESSSQREIPIVISGTESSFEYELEVSAAYNLFSDIQTPIIATTRLTLPIIRPFEANYEFL
K9FSR4_PEND2/663-1258...IEGPSHYLKR..AVGVLERFSNKTLTIVLDDTQETTDFTLEVSAVYHLVSDIQTPIMKNITVDLSFIRPFEANYEFL
C5GAE4_AJEDR/665-1268STPIEGDSSALSKQCTVGTLGRGASRTLSVLFTNTTQPLDYEVEISAFYHLVSDIETQIFKTVSLDLSFIRPFEANYEFL
S3D1H3_GLAL2/625-1196................LGRIASSASSVVHIIIPPIDLPYVYELAVKASYNLVSDLETPVSRSITMQLEVINPFEANYDFS
G2X5V0_VERDV/635-1221................LGSIDASQSKRAVLHLSPSDAPTSYEITARVGYHLVTDPATPILQVMTFQVTIVNPFEANYDIV
E4V6J7_ARTGP/54-658SQTTGAATQTIRR..KITGLGAGEHTILPALVIEVPQPIQYDLEISAFYHLTSDPETPISKAISLDLPFIQPFEANYDFL
H6BX93_EXODN/653-1252SR.............ELGAIPSSGKTTVSLIVTGTAVAVDYEIEITARYALISEPETILTKTTTVDVTVIRPFEANYEFT
E9E0X1_METAQ/607-1181................IGVISSGAAAELKLIIDPTTAPTTYDLHIQATYHLESDTATPIIQVLSLSLDLVGPFEANYDLL
S8BAM7_PENO1/662-1256...TEGSSHFLRE..SIGVMERASRKELVVVLADTHDAANYVLEISAEYHLVSDIQTPIMKTVNAEISFVRPFEANYEFK
G0RNV0_HYPJQ/637-1222................LGRVASSSSMEVSIHLDPAPAPTVYDIEVQADYHLESDAATPIFQVLPVHLNVVNAFEANYDLM

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155PFSAKQ.............................................................GPGA-PLSLYAG-
A7F9J5_SCLS1/1351-1514ASIA.................................................................SS-CAVAAAN-
B2W2H3_PYRTR/1490-1643RIAS..................................................................Y-TTIATVG-
B6H3B0_PENCW/1240-1399STTDP................................................................GP-STHAAVG-
C5FEM2_ARTOC/1257-1416SPG....................................................................-QTHVGVD-
C4JLA5_UNCRE/1213-1358SST....................................................................-QPHCGVG-
A0A0D1DNV8_USTMA/1235-1382DSGS.................................................................SQ-SASVIVG-
B8P4P6_POSPM/992-1139PWVSPQ.............................................................AKNA-ALPLFAG-
B0D3E6_LACBS/1015-1161PFTNAS..............................................................SSE-KFSLYAG-
C4R0Z1_PICPG/1026-1192NVQ....................................................................-..DFRVE-
A8PKV5_BRUMA/843-1047GCKYRLVWILPSNKGKTDEVEHYELRFTYRVKSLDEHTNEEELIYDREYTLFDEFPPDYELCAQLLSSQPG-AILCRVD-
B4HE09_DROSE/978-1138PDVWRTYGCAFDLVD...........................................YTTLFKLQAQLEP-NELCRLR-
F7CPS6_CALJA/149-377EQLSISLKPYTYEFQVEN.....................................FFTLYNVKAEISPPSG-MEYCRTG-
H3CJ11_TETNG/1022-1246DVSVFKLFHHQFQLERV.......................................TTLYSVRADILPPAG-EQHCRCG-
Q4WSJ6_ASPFU/1252-1410ADQ....................................................................-PRHAAVG-

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247PQVHPDPWPSFFLVDDAQVPEGSTDAA...ATKA..FGLTARYLMNVRIGSYAEEDLIIQDAELSVHEVAG.GAVARVS.
R7YHS6_CONA1/667-1263PRVHPDLWPSFFHVDEKQSLEAPAEASIDTA.....VGIAQIWLATARLENFAEEDLVVEDLSLVLQAVNG.GAICAIS.
C5G0L5_ARTOC/657-1267PRLHPTPWPDFFHIDES......KDSK...EWDRQRTNMQQRWLVNSTLVSFAREALLIEDVALRVLSEVA.GKVCSIT.
G2YB15_BOTF4/638-1224PRIHPGSWPSFFTHDESLE..ISQDGQ...DNDREAFGLAQKWCLTTRFASFATEDVIVEDVDVEILGLQG.AIKCSTK.
M1WIS4_CLAP2/616-1226PRLHPDPWPSLFDCDGIPI.PSTADDE...ATAVRPKGLAQQWCLLCHYASFASEDLVVVGMETQVVSCTG.AVQCHVL.
C4JTF4_UNCRE/662-1266PRVHPGPWPDFFHVDEPKL....IDES...EPRA..HGLQQRWCLDCKLISFAHETLLIDKVSVAVTGIEG.GLVRHIG.
H1V6N2_COLHI/632-1214PRLHPDPWPSLFDHEGVQD...PSVDE....AALQPRGLAQKWCLVCHFASFATEDLEIVSMDAEVVACHN.HARCTTA.
B8M738_TALSN/646-1234PRINPNAWPNLFHLN........TDSD...GDKP..DGLQQRWCVSPKIVSFASEPLVIQKVNVGLLEIHG.GAICDIG.
A0A0C4E0J0_MAGP6/633-1227PRLHSDPWPSVFDHEGVQG...LYVDD...GSYVQPRGLFQTWCLVTRYASFASEDLVVMGVDVTIAPTL..GVQTRTS.
G4NCT1_MAGO7/630-1218PRLHSDPWPSIFDHEGVQA..LFVDDD...TYHVQPRGLCQTWCLVTRYASFASEDLKVAGVAVSISPGP..DVHTRIS.
G3JHI1_CORMM/630-1211PRLHPDPWPSLFDPEGLDD...IHEED...GKQRRPIGLIQRWCLLSHYASFAQEDVRVLDTEVEVTETVG.SARSVVR.
E3QU68_COLGM/632-1215PRLHSDPWPSLFDHEGVQD...PSVDE....AAVQPRGLAQRWCLVCHFASFATDDLELVGMDAEVVACQN.NARCTTV.
Q2UPL2_ASPOR/663-1261PRLHPQPWPDFFTVDDALL....GNDS...TPKL..GGLQQRWCLNSKVVSFALTPLVIEKISLVLVGVGG.GATCHVG.
G7XKR2_ASPKW/663-1260PRLHPQPWPDFFTVDDELL....PNGD...EVKP..GGLQQRWCLNSKVVSFAVEPLVVEKMSLVLLGLGG.AATCHIG.
N4VGT4_COLOR/632-1208PRLHPDPWPNLFDHEGVQD...PAAED...TAAALPRGLAQKWCLVCHFASFASEDLEIVSMDADVLACNS.NARCTTA.
A6QX66_AJECN/503-1110PRIHPAPWPDFFHYDDSPS....EDSE...EQEQKHNGLQQLWCLNSKIVSFALEPLIIEEVNVSLLGITA.GNICRIG.
S0E618_GIBF5/633-1211PRLHPGPWPSLFDSEGLGD...........TEEGVARGFTQKWCLLCHYASFAQEDLKVLGMDLTVVSCVG.GARCNVS.
T5AEY3_OPHSC/622-1204PRVHPEPWPSLFDEAGVED...PLEED...AASMPARGLAQQWCLVCHYASFAMEDLCVLEMDTVVSPAEG.RARCHMV.
C7YM27_NECH7/633-1211PRLHPEPWPSLFDSEGLGD...........TEEGVARGFAQKWCLLCHYASFAQEDLKVLGMDMKVTSCVG.GARCNVV.
E4ZMR8_LEPMJ/666-1245ARVHPEPWPSYFELRDAESNFNPESAD...A.....FGIAQKWGLRAKVASFADEQLTVSDLAVKVHGVHG.GATCDVT.
L8G4R2_PSED2/136-727PRLDSRSWPSFFDPKDGKT......SS...TGEVAALGLPQKWNLTARYCSFAGEALIVEDVSLAILSLNG.GVACSGI.
G9NXZ6_HYPAI/630-1207PRLHPDSWPSLFDYEDVQD...VSEGD.....AVPAKGLTQQWCLVCHYASFATEDLDVLGLDMQVASVTP.GGRCRVI.
T0LUP2_COLGC/632-1210PRLHPDPWPSLFDHEGVQD...PNITD...DAAIQPRGLAQKWCLVCHFASFASEDLEIISMDAEVLSCQN.NARCTTI.
G9MPU4_HYPVG/630-1207PRLHPDPWPSLFDYEDLQD...VSDGD.....VIQARGLAQQWCLVCHYASFATEDLDVVGLDMVVTAVTP.GGRCRVV.
K1XTU1_MARBU/632-1208PRIHPDPWPSLFTHEEVEA.....ATD...PQEVKAQGLAQKWCLTARYASFARDELIVNDVDVEVLGSNG.GIQCYTK.
A1CQK2_ASPCL/664-1261PRLHPEPWPDFFTMDEDSL....EDDA...VAKP..RGLHQRWCLNSKVVSFALEPLIIEKISVVLLNLGS.GAICNIG.
Q0CCQ2_ASPTN/665-1260PRLHPLPWPDFFSVDDDMF....EGQG...TPKP..AGLYQRWCLNSKLVSFALEPLVIEKVSLVLLGIGG.GSTCHIG.
F2PXY2_TRIEC/646-1249PQLHLSPWPDFFNIDESEV.................SNTQQRWLLNSTLMSFAREALVIEDVKLRVVAIEV.GKVCSITT
B6QQY0_PENMQ/649-1238PRIHPDAWPNLFQLD........TDSDGEKADKP..DGLQQRWCVSPKIVSFASEPLVIENVSVGLLEVNG.GAICEIG.
J3P062_GAGT3/633-1226PRLHPDPWPSVFDHEGVQG...LFVDD...SSYVQPRGLFQTWCLVTRYASFASEDLVVVSVDVSIAPTL..GVQTRAS.
U7Q1R6_SPOS1/669-1328PRMHPAAWPSLFDHEGIVATGTPEDAD...AVNRGFHGLTQAWALVTRYASFATEDLRVVDLDLVIQPEPRISVQHTRTD
M2SXX2_COCSN/666-1245ARVHPDPWPSYFELQEAESNMSPESSD...A.....FGIAQKWGLRAKVASFADEHLIVSDLAVEVHSIHG.GATCDVT.
V5G1J1_BYSSN/642-1241PRLHPQPWPNFFRVDEEPG....EESA...TSPP..NGLQQRWCLNSKLVSFAPEPLVVEKVALVLLGING.GANCEIS.
A0A0E1RX69_COCIM/661-1263PRVHPDAWPDFFHLDEPGF....SDES...ESRA..HGLQQRWCLNCKIISFAHEALLIDEVEVTVNGIAG.GLVRQVG.
Q5BDK6_EMENI/657-1255PRLNPLPWPDFFTIDDDLT....ETQP...NTEP..RGLQQRWCLDTKVVSFAREPLVIENMSIAVLSLSG.GAISQVG.
K9FSR4_PEND2/663-1258PAIHPQPWPNFFAVGDTLP....ENSS...APSP..IGLFQRWYLNSKVVSFAVEPLVIDKMSLILLEANG.GAICEVH.
C5GAE4_AJEDR/665-1268PRIHPAPWPDFFHCDDSPS....EDSE...AKEQKLNGLQQLWCLNSKMVSFALEPLIIEEVNVTLLGITA.GNVCKIG.
S3D1H3_GLAL2/625-1196PRIHPDSWPSFFTHEDSTD....ADGS......EVARGLAQKWCLTARYASFATEDLLVEDIDVEVIGMNG.GIQSSTK.
G2X5V0_VERDV/635-1221PRLHPEPWPSLFDFEGTSE...TADRE...ELVTHPRGLAQRWSLVCHFASFATEDLQVVEMEAKVLSCLP.GARGHAA.
E4V6J7_ARTGP/54-658PRLHPAPWPDFFHIDESGV.................SSTQQRWLVSSTLMSFARETLLIEDVKLRSIAIEA.GKVCSITT
H6BX93_EXODN/653-1252PRLDADPWPNFFEAPPSD............SDSASALGLRHRYVMAASICSFAAEPIVIEAILLTATKVVG.GAVCSTS.
E9E0X1_METAQ/607-1181PRLRPEPWPSLFDYEGLHL...VTENE...AAAPPAKGFAQQWCLVCHYASFAMEDLTVLGVELQVVSCTG.GARCTVT.
S8BAM7_PENO1/662-1256PCVHPAPWPDFFSVDDSLI....CDDP...STVP..GGLVQRWCLNSKLVSFAQEALVIEDMSLRLLTLTG.GAVSTIE.
G0RNV0_HYPJQ/637-1222PRLHPDAWPSLFDYEDVQD...LTEGE.....VIPAKGLAQQWCLVCHYASFATEELDVVGLDLLVTGVTP.GGRCQVV.

PF04628

TPPC2_CHICK/9-136------------------------------------------------------------------------HL...NQ-
Q4X1U7_ASPFU/7-185------------------------------------------------------------------------YM...NQ-
Q6BW18_DEBHA/13-197------------------------------------------------------------------------YL..KYN-
Q7QCA5_ANOGA/9-136------------------------------------------------------------------------HL...NQ-
Q57YJ1_TRYB2/2-125------------------------------------------------------------------------NM..SHQ-
Q4CQS2_TRYCC/4-127------------------------------------------------------------------------HL..SRQ-
TRS20_YEAST/7-171------------------------------------------------------------------------EL...NP-
Q7RCP8_PLAYO/11-149------------------------------------------------------------------------HL...SQ-
Q6FVV2_CANGA/7-168------------------------------------------------------------------------EL...NP-
Q6BRP5_DEBHA/8-164------------------------------------------------------------------------EI...LP-
Q5KAA6_CRYNJ/23-186------------------------------------------------------------------------AL...CQ-
TPPC2_DICDI/8-131------------------------------------------------------------------------YV...LQ-
TPC2L_DICDI/9-139------------------------------------------------------------------------KL..KLH-
A8X604_CAEBR/10-138------------------------------------------------------------------------HL...NH-
TPPC2_DROME/8-135------------------------------------------------------------------------HL...TQ-
TRS20_SCHPO/7-134------------------------------------------------------------------------HL...NQ-
Q6CFC6_YARLI/9-134------------------------------------------------------------------------QLEYDYS-
Q5A920_CANAL/9-148------------------------------------------------------------------------EL...LP-
Q651C7_ORYSJ/7-136------------------------------------------------------------------------AL..KLH-
Q4UE14_THEAN/25-171------------------------------------------------------------------------HL...SS-
Q6C760_YARLI/7-139------------------------------------------------------------------------EL...AP-
Q74ZF3_ASHGO/7-174------------------------------------------------------------------------EL...NP-
TPC2L_HUMAN/7-138------------------------------------------------------------------------EL..KFH-
Q6CQN4_KLULA/6-155------------------------------------------------------------------------EL...NP-
Q7F8Z0_ORYSJ/9-132------------------------------------------------------------------------YQ...HQ-

PF04099

Q20100_CAEEL/5-215------------------------------------------------------------------------TVSTNEK-
O77358_PLAF7/1-144------------------------------------------------------------------------KLNSNEE-
TRS23_SCHPO/1-132------------------------------------------------------------------------ALTPNEY-
Q9VA95_DROME/3-137------------------------------------------------------------------------ITREEEA-
Q9LZ97_ARATH/4-134------------------------------------------------------------------------RMDTNDS-
Q9VLI9_DROME/3-209------------------------------------------------------------------------KMTTNEK-
Q9AWN0_ORYSJ/33-178------------------------------------------------------------------------LDPTQDQ-
TPPC1_HUMAN/3-137------------------------------------------------------------------------IPKEEEY-
TPPC4_MOUSE/3-209------------------------------------------------------------------------RLTSNEK-
Q9SYB8_ARATH/23-168------------------------------------------------------------------------LNPQQDH-
A7UW60_NEUCR/3-157------------------------------------------------------------------------KISTNDY-

PF01217

AP3S_SCHPO/1-139------------------------------------------------------------------------DESIQ.Q-
AP1S1_MOUSE/1-142------------------------------------------------------------------------SDKER.K-
AP2S_YEAST/2-147------------------------------------------------------------------------SDPQRSQ-
AP2S1_HUMAN/1-142------------------------------------------------------------------------DDDEK.Q-
AP3S_YEAST/1-160------------------------------------------------------------------------DLPKQ.K-
COPZ1_BOVIN/12-153------------------------------------------------------------------------PSVKE.Q-
AP1S1_YEAST/3-146------------------------------------------------------------------------SAGEK.A-

PF09201

C5E0Z1_ZYGRC/1-156------------------------------------------------------------------------FAETQIN-
A7TFS7_VANPO/1-148------------------------------------------------------------------------AMLNQVN-
G8JRB0_ERECY/1-141------------------------------------------------------------------------FSEQQFN-
G0VGX2_NAUCC/1-143------------------------------------------------------------------------FAELQIN-
G8BTK8_TETPH/1-155------------------------------------------------------------------------FAETQVN-
Q6CTR2_KLULA/1-140------------------------------------------------------------------------FSETQIN-
G0W8F2_NAUDC/1-150------------------------------------------------------------------------FSEHQIN-
I2GXE9_TETBL/1-153------------------------------------------------------------------------FQEAQIN-
G8ZVC5_TORDC/1-153------------------------------------------------------------------------FLESQIN-
SRPR_YEAST/1-155------------------------------------------------------------------------FSEIQIN-
C5DM67_LACTC/1-140------------------------------------------------------------------------LAENHIN-
Q6FSE1_CANGA/1-148------------------------------------------------------------------------FAEAQVN-

PF12584

A8NHA2_COPC7/992-1155--------------------------------------------------------------------------------
A7F9J5_SCLS1/1351-1514--------------------------------------------------------------------------------
B2W2H3_PYRTR/1490-1643--------------------------------------------------------------------------------
B6H3B0_PENCW/1240-1399--------------------------------------------------------------------------------
C5FEM2_ARTOC/1257-1416--------------------------------------------------------------------------------
C4JLA5_UNCRE/1213-1358--------------------------------------------------------------------------------
A0A0D1DNV8_USTMA/1235-1382--------------------------------------------------------------------------------
B8P4P6_POSPM/992-1139--------------------------------------------------------------------------------
B0D3E6_LACBS/1015-1161--------------------------------------------------------------------------------
C4R0Z1_PICPG/1026-1192--------------------------------------------------------------------------------
A8PKV5_BRUMA/843-1047--------------------------------------------------------------------------------
B4HE09_DROSE/978-1138--------------------------------------------------------------------------------
F7CPS6_CALJA/149-377--------------------------------------------------------------------------------
H3CJ11_TETNG/1022-1246--------------------------------------------------------------------------------
Q4WSJ6_ASPFU/1252-1410--------------------------------------------------------------------------------

PF12742

TPC11_MOUSE/1036-1095--------------------------------------------------------------------------------
A2FUL4_TRIVA/291-348--------------------------------------------------------------------------------
A2FF60_TRIVA/461-517--------------------------------------------------------------------------------
A2EKE8_TRIVA/495-550--------------------------------------------------------------------------------
A2EQW1_TRIVA/476-534--------------------------------------------------------------------------------
H3CLI1_TETNG/1011-1064--------------------------------------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247.....KKPVEEPEVE.............IAPQAVQLRTFCVDVQKIALEDRRSSALATSISVTWRRKQPMSPHAEAS...
R7YHS6_CONA1/667-1263..................KESPANTDTVIPQQELREYNFSLEVRKLTLEDRRPVSLDLHLDIKWRRKTGG..........
C5G0L5_ARTOC/657-1267.SDESKQP.EDRS...............IGPEEPLSTDFIVDIERLAIDDRQSAALTFELDIKWRRGISEQDVSIADAPD
G2YB15_BOTF4/638-1224.........RLTAIP.EGG.......IKISPNELEEAQFDAFTQKYSLDDRGTATVDLSLVIKWRRNKDGS.........
M1WIS4_CLAP2/616-1226.........PRPEEG.TKGDDSSDNNITVSPKTMYEAQFHLVAQKLSLDDRQPVTLDLAFIIKWRRQRKTAAAAAAEPSP
C4JTF4_UNCRE/662-1266.PEIHTGNVEAAE...............LHPEQVRESQFILELQRLTLGDRQTTTLNLALEVKWRRQDAEAPSSSAVEL.
H1V6N2_COLHI/632-1214.........TRPEVP.EGG.......LRVPPKQMQEARFDLVAQKFSLDDRGPASLDVAFVLKWRRTKSSTSTA......
B8M738_TALSN/646-1234.PEKLTTP.EAKQ...............ILPEELRTSEFILNVQKISLDDRRSVALDLSLNIEWRRPSSADGDEEI....
A0A0C4E0J0_MAGP6/633-1227.........AKQTLP.KGG.......HTVKPKTIEEVQFDITAQKYSLDERDSVNLDVSLIINWRRAGDEKSS.......
G4NCT1_MAGO7/630-1218.........EANEFP.SEG.......LLVKPKTIEEVKFDITAQRYSLDERDPLSLDVTFMISWRRPSDSDD........
G3JHI1_CORMM/630-1211.........KMTEITEPDG.......LLVEPKTMHEAQFEIEAQKMQLEDRSPVSIDLAFKIKWRRADAAPES.......
E3QU68_COLGM/632-1215.........SGPEVP.EGG.......LRIPPRQMQEAQFDLVAQKFSLDDKGPASLDVAFVLRWRRVKSPSSAAA.....
Q2UPL2_ASPOR/663-1261.PEAIVSP.GGPE...............IYLEELRESSFAVDIHKTVLGDRRPTALNLALEIQWRRSATDESESAMSSN.
G7XKR2_ASPKW/663-1260.SEEIISP.EVAE...............IRPEELRESNFIMDLQKEILGDRRPTALNLALEIRWRRSATDDGALNDGS..
N4VGT4_COLOR/632-1208.........TRPNIP.EGG.......LRVSPKSMHEAQFDLVAQKFSLDDRGPASLDVAFVLKWRRTSSASA........
A6QX66_AJECN/503-1110.TETLKSP.EAPT...............IGPEGLRESEFTMEIQRLALNNRQPSTLNLALDIRWRRPDDDNNDQQSSSSS
S0E618_GIBF5/633-1211.........QGPDVS.QEG.......VIVAPKTMHEAQFDLIAQKLTMEDRHPVTLELAFVIRWQRQNRSDG........
T5AEY3_OPHSC/622-1204.........GRPQVP.EEG.......IVAAPRTMGEAQFHVVVQKLSLDDRHPVAIDTAFIIKWRRKKAGADG.......
C7YM27_NECH7/633-1211.........KGPSVS.PEG.......VVVAPKTMHEAQFDLVAQKLTMEDRHPVTLDLAFVIRWQRQSRDDE........
E4ZMR8_LEPMJ/666-1245.KEFEAGE..................QAMDPQILSEWAFSLDVRKNNLEERRSTALDTTLNITWQRTSIPNA........
L8G4R2_PSED2/136-727......HPLPNTSLG...........LPILPEALAESHFDVLTQKLSLDGRRSASLDLSLLIQWRRDVPES.........
G9NXZ6_HYPAI/630-1207.........SKPEFS.ADG.......MIVAPKTMYEARFDLVAEKVTLDDKHPVAIDLALVVRWRRRRSMDGETG.....
T0LUP2_COLGC/632-1210.........SRPELA.ADG.......LRISPKQMQEAQFNLVAQKYSLDDRGPASLDIAFVLKWRRTSSTSS........
G9MPU4_HYPVG/630-1207.........SQPELS.ADG.......MIVAPKTMYEARFGLVAQKVTLDDRHPVAIDLAFVVRWRRRRQVADGESN....
K1XTU1_MARBU/632-1208.........KLTSIP.STG.......LRVSPKSLDEAQFDTFTQKISLDDRGTATLDVSLAIKWRRSNRDSTSAS.....
A1CQK2_ASPCL/664-1261.PEMVVSA.DEPE...............IRPEELRESNFTLDLQKLVLGDRRPTALNLALEIQWRRSMEDTASPADHTS.
Q0CCQ2_ASPTN/665-1260.PEEVASP.DTPE...............IRPEELRESNFTLDMQKVVLGDRRPTAVNLALEIVWRRSSDESSENTH....
F2PXY2_TRIEC/646-1249ASDSSKEP.GNRY...............IRPEEPQSTDFIVVIERLVMEDRLQTGVSFELEIKWRRDEQQDVLEAEATS.
B6QQY0_PENMQ/649-1238.SERLTTP.EATQ...............ILPEELRASEFILDVQKTSLEDRRSVALDLSLNIKWRRPSSPDQDEH.....
J3P062_GAGT3/633-1226.........GKQMLP.DGG.......RTVKPKTIEEAQFDITAQKYSLDERDPVNLDVSFIINWRRADDQES........
U7Q1R6_SPOS1/669-1328AASHNGNDNGTPQTRDADGA......LTIKPQTMEESRFDLVVQKASLDDRDPVQLDVSFVITWQRLAPPGSPAGSAGSV
M2SXX2_COCSN/666-1245.KEFEISE..................TCMEPQVLSEWSFSLDIRKNNLEERRSTALDTTLNITWQRTSDPSA........
V5G1J1_BYSSN/642-1241.SESLLSP.ETPV...............ISLEELRESEFVLNIQKLSLEDRRSVSLNLALEIQWRRADSEDGPESTST..
A0A0E1RX69_COCIM/661-1263.PGLRKDN.NAAE...............ILPEQVRECDFNIELQRLALDDRQTTTLNLSLDIRWRRQGAEAASSSTIEA.
Q5BDK6_EMENI/657-1255.HEVLVSP.ETRE...............IHPEDLRHSNFVLDIQKIILGDRRPTSLNLALEIQWRRSGEETDDSGRSD..
K9FSR4_PEND2/663-1258.SEELVSP.ETPH...............LAPEELRESNFCLDVQKLVLGDRRPTALTCALEVNWRRQSSGSAAYSDADN.
C5GAE4_AJEDR/665-1268.PETLKSP.ETPT...............IGPEELRESEFAIEIQRHALDDRQASTLNLSLDIRWRRPDDDDGGPQSS...
S3D1H3_GLAL2/625-1196.........RISPLS.EGG.......IKVTPRTLEEAQFDAFTQKLSLDDRGTATLDVTLLIKWRRDVKDS.........
G2X5V0_VERDV/635-1221.........GQPDLP.PAG.......LIIPPKSMQEVKFDLIVQKLSLDDRGPASLDVAFVLHWRRGTADPSS.......
E4V6J7_ARTGP/54-658SSEASKQP.GTRS...............IRLEDPLATDFMVDIERLAVDDRQQTGVTFELEVKWRRDGQQDASEAETAS.
H6BX93_EXODN/653-1252......TGIVRKEDDTQADKDAAAISSIILPDQTQIFDFELTIQKLKLGDRHTVGLDLALEIGWRRQGTE..........
E9E0X1_METAQ/607-1181.........RRTEVA.SDG.......ITISPQTIHEAQFDLVAQKFSLDDRHPVTLDLAFVIKWKRKTASVDS.......
S8BAM7_PENO1/662-1256.SEVLVSP.EAPQ...............INSEELRESNFFLNMQKISLGDRRPAALNVALDITWHRQSDETDGSSDSESN
G0RNV0_HYPJQ/637-1222.........NQPEFS.ADG.......MPVAPQKMYEARFDLVAQKATLDDRHPVAIDLAFAVRWRRRQRQRQQQPTGGES

PF04628

TPPC2_CHICK/9-136--------------------------------------------------------------------------------
Q4X1U7_ASPFU/7-185--------------------------------------------------------------------------------
Q6BW18_DEBHA/13-197--------------------------------------------------------------------------------
Q7QCA5_ANOGA/9-136--------------------------------------------------------------------------------
Q57YJ1_TRYB2/2-125--------------------------------------------------------------------------------
Q4CQS2_TRYCC/4-127--------------------------------------------------------------------------------
TRS20_YEAST/7-171--------------------------------------------------------------------------------
Q7RCP8_PLAYO/11-149--------------------------------------------------------------------------------
Q6FVV2_CANGA/7-168--------------------------------------------------------------------------------
Q6BRP5_DEBHA/8-164--------------------------------------------------------------------------------
Q5KAA6_CRYNJ/23-186--------------------------------------------------------------------------------
TPPC2_DICDI/8-131--------------------------------------------------------------------------------
TPC2L_DICDI/9-139--------------------------------------------------------------------------------
A8X604_CAEBR/10-138--------------------------------------------------------------------------------
TPPC2_DROME/8-135--------------------------------------------------------------------------------
TRS20_SCHPO/7-134--------------------------------------------------------------------------------
Q6CFC6_YARLI/9-134--------------------------------------------------------------------------------
Q5A920_CANAL/9-148--------------------------------------------------------------------------------
Q651C7_ORYSJ/7-136--------------------------------------------------------------------------------
Q4UE14_THEAN/25-171--------------------------------------------------------------------------------
Q6C760_YARLI/7-139--------------------------------------------------------------------------------
Q74ZF3_ASHGO/7-174--------------------------------------------------------------------------------
TPC2L_HUMAN/7-138--------------------------------------------------------------------------------
Q6CQN4_KLULA/6-155--------------------------------------------------------------------------------
Q7F8Z0_ORYSJ/9-132--------------------------------------------------------------------------------

PF04099

Q20100_CAEEL/5-215--------------------------------------------------------------------------------
O77358_PLAF7/1-144--------------------------------------------------------------------------------
TRS23_SCHPO/1-132--------------------------------------------------------------------------------
Q9VA95_DROME/3-137--------------------------------------------------------------------------------
Q9LZ97_ARATH/4-134--------------------------------------------------------------------------------
Q9VLI9_DROME/3-209--------------------------------------------------------------------------------
Q9AWN0_ORYSJ/33-178--------------------------------------------------------------------------------
TPPC1_HUMAN/3-137--------------------------------------------------------------------------------
TPPC4_MOUSE/3-209--------------------------------------------------------------------------------
Q9SYB8_ARATH/23-168--------------------------------------------------------------------------------
A7UW60_NEUCR/3-157--------------------------------------------------------------------------------

PF01217

AP3S_SCHPO/1-139--------------------------------------------------------------------------------
AP1S1_MOUSE/1-142--------------------------------------------------------------------------------
AP2S_YEAST/2-147--------------------------------------------------------------------------------
AP2S1_HUMAN/1-142--------------------------------------------------------------------------------
AP3S_YEAST/1-160--------------------------------------------------------------------------------
COPZ1_BOVIN/12-153--------------------------------------------------------------------------------
AP1S1_YEAST/3-146--------------------------------------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156--------------------------------------------------------------------------------
A7TFS7_VANPO/1-148--------------------------------------------------------------------------------
G8JRB0_ERECY/1-141--------------------------------------------------------------------------------
G0VGX2_NAUCC/1-143--------------------------------------------------------------------------------
G8BTK8_TETPH/1-155--------------------------------------------------------------------------------
Q6CTR2_KLULA/1-140--------------------------------------------------------------------------------
G0W8F2_NAUDC/1-150--------------------------------------------------------------------------------
I2GXE9_TETBL/1-153--------------------------------------------------------------------------------
G8ZVC5_TORDC/1-153--------------------------------------------------------------------------------
SRPR_YEAST/1-155--------------------------------------------------------------------------------
C5DM67_LACTC/1-140--------------------------------------------------------------------------------
Q6FSE1_CANGA/1-148--------------------------------------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155----------QPINAELVIRT.TLRWGSDDE..............................SARRHVLN--YHI.EDM--
A7F9J5_SCLS1/1351-1514----------EPIPASLHLKS.TRNWDTAYQDDVA........................SP.EEDLEFV--YEV.TGP--
B2W2H3_PYRTR/1490-1643----------QPLPATLRISH.TRRWATPSLLVSAAS....................IDTP.TDPIDFY--YTI.DAN--
B6H3B0_PENCW/1240-1399----------QMIVAELCLRH.TRRWCSPATREN..........................A.DQPLECS--YEI.HAN--
C5FEM2_ARTOC/1257-1416----------DMIPTELIIRH.TRGWCKVSEREA............................QPSLEFM--YEV.IAN--
C4JLA5_UNCRE/1213-1358----------EALSAELVLHH.TRQWCPKATREA............................QPSLEFM--YEI.ITN--
A0A0D1DNV8_USTMA/1235-1382----------QPIELTVSIET.STLWSCS................................SHEGEIMV--YDI.VPD--
B8P4P6_POSPM/992-1139----------QPISAVVSVTT.SFHWAPLEDE.............................KPQGCLLR--YDI.EDM--
B0D3E6_LACBS/1015-1161----------QPISANLTIHT.SFHWGSTAQD.............................TGRRYNLR--FNI.EEM--
C4R0Z1_PICPG/1026-1192----------EPIQFALKLKT.DTRWSDMDFGKQESCSELSNDDKETVDKTTGEEKKVELNRNINKKYC--FSLEVQD--
A8PKV5_BRUMA/843-1047----------DACDMIVSLRS.L......................................TNRVETVV--VGI.DAD--
B4HE09_DROSE/978-1138----------TVCNMNLKITK.V.....H................................ENPYTDLM--YEV.LND--
F7CPS6_CALJA/149-377----------SLCSLEVLITRLSDLLEVD.KDEALT......................ESDEHVTTKLM--YEV.VDN--
H3CJ11_TETNG/1022-1246----------LLCKLEVFITRLSEPAEGEMAEESRS......................DLDGLKTTKLM--YQV.ADS--
Q4WSJ6_ASPFU/1252-1410----------QMIAAELVLRH.TRRWSSPETREN...........................AGGTLEFS--YEI.HAN--

PF12742

TPC11_MOUSE/1036-1095-------------------------------------------------------------LQNKTDLVQDVEISVEP..
A2FUL4_TRIVA/291-348-------------------------------------------------------------ARKDSELL....IEVRENS
A2FF60_TRIVA/461-517-------------------------------------------------------------TEKACGII...HIIVDK..
A2EKE8_TRIVA/495-550-------------------------------------------------------------AKTPLDLF....MLVGE..
A2EQW1_TRIVA/476-534-------------------------------------------------------------LPNESELLN.FTLCVEK..
H3CLI1_TETNG/1011-1064-------------------------------------------------------------LVQEVE......MAVEP..

PF07919

K2S4Z6_MACPH/666-1247..........SNVRSVIANPRLIAANSEPRVLASARPS.......SAVPSLIH...LDYTLENPTMHFL-TFDVTMEA--
R7YHS6_CONA1/667-1263..........ASITSSKPCPRFVVPSSEPRVLCTATQSPPTATATSQTPPLIT...LSYTLENPTMHFL-AFELTMEA--
C5G0L5_ARTOC/657-1267PLPPNVSLPPETATTSLAIPRFVIPMSEPRALASLGAT.......TGLPGLIQ...INYTLENPSMHFL-TFSLTMEA--
G2YB15_BOTF4/638-1224..........TINTCIVPVPRLLVSSSEPRVLAAVTYS.......STIPSMIH...FDVTIENPSHHFL-SFAITMDP--
M1WIS4_CLAP2/616-1226ED........EVNTTLMPVGQYLVLGSEPRVLATATMDPLSA...TASSRLLH...LDLTIENPSSHFL-TFGLTMDP--
C4JTF4_UNCRE/662-1266..........FIPTTTLSVPRFVIPMGEPRVLATVTRA.......SALPNFIH...LDYTLENPSIHFL-TFTITMEA--
H1V6N2_COLHI/632-1214..........AVNTTRMLVPRYIVLGTEPRVLASYSLA.......NSQTGLIN...LDVTIENPSSHFL-TFGLGMDP--
B8M738_TALSN/646-1234..........ITTATSLAMPRFMIPMGEPRVLASASAS.......KELPGLIH...LDYTLENPSMHTL-TFSLTMDA--
A0A0C4E0J0_MAGP6/633-1227..........RVNKTTLPVPRLDIFGPEPRVLASVSYARAGVE..RAKLGLVH...LHITIENPSSHFL-TFGTNMEP--
G4NCT1_MAGO7/630-1218..........HVNITKLPVPRLGIFGAEPRVLATVAYPKM.....ESMGDMVQ...LDIMIENASNHFL-TFGLNMEP--
G3JHI1_CORMM/630-1211..........PANTTTLPVGRYLVLGSEPRVLATTFHGE......PDETSTIQ...LDISIENPSNHLL-TFGLTMDP--
E3QU68_COLGM/632-1215..........AVNTTRMLVPRYIVLGAEPRVLASYSLA.......SPLTGLIN...LNITIENPSSHFL-TFGLSMDP--
Q2UPL2_ASPOR/663-1261..........GTTISTLAIPRFVVPGGEPRVLASAMTS.......QIRSGLIH...LDYTIENPSMHFL-TFNLTMEA--
G7XKR2_ASPKW/663-1260..........TTTTTTLDIPRFVMPAGEPRVVASAKAS.......DTLSGLIH...LDYTLENPSMHFL-TFNLSMEA--
N4VGT4_COLOR/632-1208..........PINTTTMLVPRYIILGTEPRVLASYSLA.......NPATGLVH...LDVTIENASSHFL-TFGLTMDP--
A6QX66_AJECN/503-1110..........QSTISTLPIPRFLVPLVEPRVLAHTTPS.......TTLPGFLH...LDYTLENPSMHFL-TFNITMEA--
S0E618_GIBF5/633-1211..........AVNTTTMPVGKYLVLGTEPRVLASVYRATKAE...DGMPGLMQ...LDMTVENPSNHFL-TFGLSMEP--
T5AEY3_OPHSC/622-1204..........PVNTTRLPVGQYLVLGVEPRVLGSVVCETR.....DTWPSLMY...LDITIENPSQHFL-TFGLTMEP--
C7YM27_NECH7/633-1211..........VVNTTTMPVGKYLVLGTEPRVLASAYHNHESE...DGVPGLMQ...LDMTIENPSNHFL-TFGLSMEP--
E4ZMR8_LEPMJ/666-1245..........PVVTSCLPIPRIQIPSSEPRVLASVQYS.......TSVASLVH...LDYTLENPTMHFL-TFEVNMEA--
L8G4R2_PSED2/136-727..........PSNTSTLPIPRLLVASSEPRVLTKLSYSEN.....TTQPMVLH...MEYMIENPSMHFL-TFSVVMEP--
G9NXZ6_HYPAI/630-1207..........PVNVTTMIVGQYMVLGTEPRVLASVLHSS......QEKTGLVR...LDITIENPSSHFL-TFGLAMEP--
T0LUP2_COLGC/632-1210..........TVNTTTMLVPRYIVLGTEPRVLASYTLA.......NPATGLVN...LNVTIENASSHFL-TFGLSMEP--
G9MPU4_HYPVG/630-1207..........AINATTMTVGQYMVLGTEPRVLASVLHSS......QEQSGLVR...LDITIENPSSHFL-TFGLAMEP--
K1XTU1_MARBU/632-1208..........PINTTILAVPRLLVSSSEPRVLAAVSYS.......NKIASMIH...FDVTIENPSNHFL-TFGLTMEP--
A1CQK2_ASPCL/664-1261..........ATTTTTLPIPRFIVPTGEPRILASAVAS.......QTLNGVIH...LDYTLENPSTHFL-TFNLAMEA--
Q0CCQ2_ASPTN/665-1260..........TSTTSTLAVPRFVVPSGEPRVLASAVGS.......NALPGLVH...VDYTLENPSTHFL-TFNLTMEA--
F2PXY2_TRIEC/646-1249...PEISLPTESVVTSLAVPRFSIPMSEPRVLASLGPETSHGN..DGVPGLIQ...LNYTLENPSMHFL-TFNLIMET--
B6QQY0_PENMQ/649-1238..........TSTVTSLAMPRFTIPTGEPRVLASASPS.......KEHPGLIH...MDYTLENPSMHTL-TFSLTMDA--
J3P062_GAGT3/633-1226..........RANKTTLPVPRLDIFGPEPRVLASVSYARAGGD..RAQLGLAH...LHITIENPSSHFL-TFGTNMEP--
U7Q1R6_SPOS1/669-1328APL.......PTNTTTLPVPQLSLFGTEPRVLASVAYSRP.....SAPVPAIQ...LTLAIENASNHFL-TFGVSMEP--
M2SXX2_COCSN/666-1245..........LPVTSSLPIPRIQIPSSEPRVLARSHFS.......PSIPSLIH...LDYVLENPTMHFL-TFELAMEA--
V5G1J1_BYSSN/642-1241..........LSATTPLAIPRFVVPMGEPRILASAISS.......ETIPEFIH...LDYTLENPSLHFL-TFSLTMEV--
A0A0E1RX69_COCIM/661-1263..........FIPTTTLPIPRFVIPMGEPRVLATVMPSS......SAIPGFIH...LNYTLENPSMHLL-TFNITMEA--
Q5BDK6_EMENI/657-1255..........RLTTTKLAIPRFVIPAGEPRVLASAISS.......RKFPGLIH...VEYTLENPSLHFL-TFSLTMEA--
K9FSR4_PEND2/663-1258..........SITTTVLDIPRFVVPMGEPRVLASATSS.......SNMPGLIH...MDYVLENSSTHFL-TFNLVMEA--
C5GAE4_AJEDR/665-1268...........STTSTLPIPRFLLPLGEPRVLASATPS.......PTFPGFLH...LDYTLENPSMHFL-TFNLTMEA--
S3D1H3_GLAL2/625-1196..........PLNISKLAVPRLLVSSSEPRVLAAVSYS.......ATISSMIH...FDVTIENPSNHFL-TFGLTMEP--
G2X5V0_VERDV/635-1221..........PVNTTTMSVPRSIVLGTEPRVLASVSYV.......NAATGLMH...LDVTIENASSHFL-TFGLSLEP--
E4V6J7_ARTGP/54-658...PDITLPLESATTLLAIPRFTIPMSEPRALASLGSKSSSNDSSSSLPGLVQ...VNYTLENPSMHFL-TFNLTMEA--
H6BX93_EXODN/653-1252..........IVNTTVLEVSKLLAPMAEPRVLLTTTDM.......AVDLSEMHTRQLKFTIENPSMHFL-TFNISMEA--
E9E0X1_METAQ/607-1181..........QTSATTMPVGQYLVLGTEPRVLASALYSNP.....TASTNLLH...LDITIENPSNHFL-TFGLSMEP--
S8BAM7_PENO1/662-1256..........FSTTTILEVPRFVAAMGEPRVLASASAS.......TSLPGLLH...LDYTLENPSTHFL-TFNLIMEA--
G0RNV0_HYPJQ/637-1222G.........TVNVTTMTVGQYMVLGTEPRVLASVLHSS......PEQAGLVR...LDITIENPSSHFL-TFGLAMEP--

PF04628

TPPC2_CHICK/9-136----------FIAHAALDLVDENMWL..................................SNNMYLKTV--DKF..NE--
Q4X1U7_ASPFU/7-185----------FIIHSSLDIVEEAQWM..................................NGNMYLKHI--DTYPPAS--
Q6BW18_DEBHA/13-197----------FLSHMALDIFASPSSTSLR...........................EQQQDMEENGGAI--LLFIQDD--
Q7QCA5_ANOGA/9-136----------FIAHAALDLIDEHKWK..................................TNNTYLKSI--DKF..NQ--
Q57YJ1_TRYB2/2-125----------LTLYASMDLLDDALWK..................................TGDFFLPSI--DKPLDGK--
Q4CQS2_TRYCC/4-127----------LMLYASLDLLDDVLWK..................................TGDFLLPAI--DRPLEGK--
TRS20_YEAST/7-171----------FILHASLDIVEDLQWQINPTSQLNGNGGNG.....SNGGGGFLRSRAVNNTDNCYLGKV--DHF..YG--
Q7RCP8_PLAYO/11-149----------FIIHQSLDSVDELVWR..................................NNNMFLKTV--DSF..NN--
Q6FVV2_CANGA/7-168----------FILHASLDIVEDLQWQQNAGTGVAGGA...........GNSFLRSRNNANTDNCYLGKV--DHF..YG--
Q6BRP5_DEBHA/8-164----------FISNSSLDLIEDIQWS..................................TNQFSLGKI--DSF..YG--
Q5KAA6_CRYNJ/23-186----------MVAHMSLDSVEEVIEG..................................TGALYLKGV--DRH..NE--
TPPC2_DICDI/8-131----------YIAHGSLDIVEEHVWK..................................SNNMYLKII--DKF..NK--
TPC2L_DICDI/9-139----------YIVHCSLDIIEDKPGSN..............................KKLPSDMYLGLL--YPT..ED--
A8X604_CAEBR/10-138----------YIGHAALDIVDEHAFT..................................TTQMYLKMV--DKF..NE--
TPPC2_DROME/8-135----------FIAHAALDLVDEHKWK..................................TANMQLKSI--DRF..NQ--
TRS20_SCHPO/7-134----------FIVHSSLDIVDQLQWT..................................SNAFYMKTI--DQF..HE--
Q6CFC6_YARLI/9-134----------SLAYMALDYLGQ......................................QQNENAGTV--SLLYVHK--
Q5A920_CANAL/9-148----------FIANSSLDLIDDQAFT..................................TNVLNLGKI--DQF..YG--
Q651C7_ORYSJ/7-136----------HVVHCSLDVIDERVNNPKR...........................NAPALNETFLGLL--YPT..EN--
Q4UE14_THEAN/25-171----------FVAHQSLDVIEDLVWN..................................NPNLFLKQV--DAF..DF--
Q6C760_YARLI/7-139----------FILHAAIDMVEQTASR..................................TNQLYLRTV--DNF..YS--
Q74ZF3_ASHGO/7-174----------FILHASLDIIEDLQWQSTHSASLASSVGNSGSSGGGSFLRSRHTHGGAGAPGSCYLSKV--DNF..YG--
TPC2L_HUMAN/7-138----------YMVHTSLDVVDEKISAMGK...........................ALVDQRELYLGLL--YPT..ED--
Q6CQN4_KLULA/6-155----------YIVHSTLDIMEYLQWQRQPQLDINTS.............SGGFLRSRHSTQENSYLGKV--DSF..YG--
Q7F8Z0_ORYSJ/9-132----------FILHAALDVVQDLAWS..................................TNAMFLKSV--DRF..ND--

PF04099

Q20100_CAEEL/5-215----------IILSSMFHSLFTIAVQLSP............CQKS.....----------......SGV--EVLETTQ--
O77358_PLAF7/1-144----------IRLASMLHGISTISEKINVYSLYEKKT..NIFQSLE....----------.....KKGI--ETIEGDG--
TRS23_SCHPO/1-132----------LVLAGTIHGVHAISTQISP............LPGS.....----------......SGI--QLLEAGT--
Q9VA95_DROME/3-137----------KLTYGMLFSIKSFVSKISPHDPKEG...............----------........F--LYYKTNR--
Q9LZ97_ARATH/4-134----------LRVASLWHSMHAISQQLSP............VNGC.....----------......SGI--ELLEADT--
Q9VLI9_DROME/3-209----------IFLASMFYPLFAIASQLSP............EPKS.....----------......SGI--EILEADT--
Q9AWN0_ORYSJ/33-178----------KLMFGLLFSLRSFTAKIDPTTAEKGNLGVPLLPGQ.....----------.....GCSF--YSFKTNT--
TPPC1_HUMAN/3-137----------KLMYGMLFSIRSFVSKMSPLDMKDG...............----------........F--LAFQTSR--
TPPC4_MOUSE/3-209----------LMLASMFHSLFAIGSQLSP............EQGS.....----------......SGI--EMLETDT--
Q9SYB8_ARATH/23-168----------KLMFGLLFSLKSLTAKMDPVNADKGNLGVPQLPGQ.....----------.....GCSF--HSFRTNT--
A7UW60_NEUCR/3-157----------LVLAGTFHGVHAITARLNPVKSAPERPLSNSIPGVPGGIL----------TRPEPPSGL--EVLESEN--

PF01217

AP3S_SCHPO/1-139----------KLIGDIYAAVSTR...........PPTACNFLESNLIA------------GKN...RII--YRQYATL--
AP1S1_MOUSE/1-142----------KMVRELMQVVLARKPKM................CSFLE------------WRD..LKVV--YKRYASL--
AP2S_YEAST/2-147----------DAIAQIYRLISSRDHKHQ...............SNFVE------------FSDS.TKLI--YRRYAGL--
AP2S1_HUMAN/1-142----------KLIEEVHAVVTVRDAKH................TNFVE------------FRN..FKII--YRRYAGL--
AP3S_YEAST/1-160----------LLLEQVYELISQRNSDFQSSFLVTPPSLLLSNENNNDE------------VNNEDIQII--YKNYATL--
COPZ1_BOVIN/12-153----------KAFEKNIFNKTHR.TD.................SEIAL------------LEG..LTVV--YKSSIDL--
AP1S1_YEAST/3-146----------KIVKDLTPTILARKPKM................CNIIE------------YND..HKVV--YKRYASL--

PF09201

C5E0Z1_ZYGRC/1-156----------RFISHLLSSPTIHNEDSS......RKYRIVEIAGNSNTSGGNKAQ-----SRGFCSMYH--VSRRPEL--
A7TFS7_VANPO/1-148----------AFISHLVNMPVSKKDDIN......SKLTIINVTQEKST.......-----.RSFSAMFH--ISKQPEL--
G8JRB0_ERECY/1-141----------KFIHTLIAQSIATSN.........SKFPTLSV.............-----.DSHTFMFH--ETKQPFL--
G0VGX2_NAUCC/1-143----------TFISKIITSPVTQRG.........SKFNILNITNDSLSKSNV...-----.RPFCSMFH--VTKQPEL--
G8BTK8_TETPH/1-155----------AFINHLMNSPISKKNDVH......SKFSLVNISPTVGDSSNSSK.-----.LNFSSMFY--ISKQPEL--
Q6CTR2_KLULA/1-140----------RFVSEFISQPVKDVT.........SKFPIIST.............-----.SDTSYMYH--ETKQPHL--
G0W8F2_NAUDC/1-150----------AFISKLITAPATRDTTTA.....GGKFTILNVTNDSTLSTTNAY.-----SRSFCSMFY--KTKQPEI--
I2GXE9_TETBL/1-153----------AFINQLIVSPATKKDDIT......KKFSVFVVNSSVSSKKSV...-----.KNFCAMFH--VNKQPEI--
G8ZVC5_TORDC/1-153----------RFLSQYITSPAPNEETY.......KKYNLLSVSGGLSGPGVQGP.-----.RGFSAMFH--ISKQPEL--
SRPR_YEAST/1-155----------SFISQLITSPVTRKESVANANTDGFDFNLLTINSEHKNS......-----.PSFNALFY--LNKQPEL--
C5DM67_LACTC/1-140----------KVISHLITSPSKKEES........GKYLLFKL.............-----.DNFAAACF--IGKQPPL--
Q6FSE1_CANGA/1-148----------AVISHLLTSPISRDHGS.......SKYKLLSIPSVSKNA......-----.KPFTVLSH--VSKQPEL--

PF12584

A8NHA2_COPC7/992-1155TREWLIGGIKQGDFIAEVLLYSRLGKNTMLTTLQNN-------------------------------------------G
A7F9J5_SCLS1/1351-1514SDTWLIGGKRKGHFKVPR............RIDGKN-------------------------------------------N
B2W2H3_PYRTR/1490-1643PDVWLVAGPRRAQFSA.................KED-------------------------------------------E
B6H3B0_PENCW/1240-1399PDQWQIGGRRRGNFLA.................RDG-------------------------------------------A
C5FEM2_ARTOC/1257-1416PELWVIGGRRRGNFSC.................AEG-------------------------------------------E
C4JLA5_UNCRE/1213-1358PDTWLVGGRRRGNFSA.................EEG-------------------------------------------E
A0A0D1DNV8_USTMA/1235-1382FETWLVDGCKRGSFKV.................KPN-------------------------------------------S
B8P4P6_POSPM/992-1139TGDWLVSGCKRSDFQA.................EDG-------------------------------------------S
B0D3E6_LACBS/1015-1161VREWLVSGPKRGDFIA.................MDG-------------------------------------------G
C4R0Z1_PICPG/1026-1192SDTWLISGITTFTYEVD...............FSRG-------------------------------------------K
A8PKV5_BRUMA/843-1047PCFWTISQKHK.LVHV.................KES-------------------------------------------G
B4HE09_DROSE/978-1138QNLWAVCGRSAGVVSM.................KDV-------------------------------------------D
F7CPS6_CALJA/149-377SSNWAVCGKSCGVISMP...............VAAQ-------------------------------------------A
H3CJ11_TETNG/1022-1246NSNWAVCGKSSGLVSMP...............VATG-------------------------------------------S
Q4WSJ6_ASPFU/1252-1410PELWLIGGRRRGNFVA.................SEN-------------------------------------------E

PF12742

TPC11_MOUSE/1036-1095SDAFMFSGLKQIRLRI-----------------LPG-------------------------------------------T
A2FUL4_TRIVA/291-348NENFIVCGMTKSNFHM-----------------DAG-------------------------------------------E
A2FF60_TRIVA/461-517SSQFAEIGPSEVNTVV-----------------WSS-------------------------------------------K
A2EKE8_TRIVA/495-550SKNFFIKGPNLLPISL-----------------LPG-------------------------------------------E
A2EQW1_TRIVA/476-534TPNFFLEGPGKLNFHM-----------------WRN-------------------------------------------Q
H3CLI1_TETNG/1011-1064SDAFMFSGLKQVRLRI-----------------VRG-------------------------------------------S

PF07919

K2S4Z6_MACPH/666-1247SEEFAFAGPKLTALHL-----------------LPH-------------------------------------------S
R7YHS6_CONA1/667-1263SEEFAFSGPKAGAVQL-----------------LPM-------------------------------------------S
C5G0L5_ARTOC/657-1267SDQFAFSGPKSLAVQL-----------------VPL-------------------------------------------S
G2YB15_BOTF4/638-1224SEQFAFSGVKQSTLQL-----------------VPL-------------------------------------------S
M1WIS4_CLAP2/616-1226SDSFGFSGPKHTTVHL-----------------LPV-------------------------------------------S
C4JTF4_UNCRE/662-1266SDQFAFSGPKSLAVQL-----------------VPL-------------------------------------------S
H1V6N2_COLHI/632-1214SDEFAFSGSKQTTVHV-----------------LPV-------------------------------------------S
B8M738_TALSN/646-1234SEHFAFSGAKTRALQL-----------------VPL-------------------------------------------S
A0A0C4E0J0_MAGP6/633-1227NDDFAFSGSKMGTVHL-----------------LPC-------------------------------------------S
G4NCT1_MAGO7/630-1218SEQFAFSGPKLVTTHL-----------------LPV-------------------------------------------S
G3JHI1_CORMM/630-1211SDEFAFSGAKQTTLHM-----------------LPM-------------------------------------------S
E3QU68_COLGM/632-1215SDEFAFSGSKQTTMHV-----------------LPV-------------------------------------------S
Q2UPL2_ASPOR/663-1261SENFAFSGPKTLVVQL-----------------VPL-------------------------------------------S
G7XKR2_ASPKW/663-1260SENFAFSGPKTMVVQL-----------------VPL-------------------------------------------S
N4VGT4_COLOR/632-1208SDEFAFSGAKQTTVHV-----------------LPV-------------------------------------------S
A6QX66_AJECN/503-1110SDQFAFHGPKATTLQL-----------------VPL-------------------------------------------S
S0E618_GIBF5/633-1211SEDFAFSGSKQTTLSL-----------------LPQ-------------------------------------------S
T5AEY3_OPHSC/622-1204SDTFAFSGAKQTTMHL-----------------LPM-------------------------------------------S
C7YM27_NECH7/633-1211SDEFAFSGAKQTTLNL-----------------LPQ-------------------------------------------S
E4ZMR8_LEPMJ/666-1245SEEFGFSGPKLRTLHL-----------------LPM-------------------------------------------S
L8G4R2_PSED2/136-727NDKFAFSGAKQSTIQL-----------------LPL-------------------------------------------S
G9NXZ6_HYPAI/630-1207SDAFAFSGSKQTTMHL-----------------LPM-------------------------------------------S
T0LUP2_COLGC/632-1210SDEFAFSGAKQTTMHV-----------------LPV-------------------------------------------S
G9MPU4_HYPVG/630-1207SDAFAFSGSKQTTVHL-----------------LPM-------------------------------------------S
K1XTU1_MARBU/632-1208SEKFAFSGTKQSTLQL-----------------VPL-------------------------------------------S
A1CQK2_ASPCL/664-1261SENFAFSGPKTMVVQL-----------------VPL-------------------------------------------S
Q0CCQ2_ASPTN/665-1260SEHFAFSGPKTMVVQL-----------------VPL-------------------------------------------S
F2PXY2_TRIEC/646-1249SDQFAFSGPKSMTLRL-----------------VPL-------------------------------------------S
B6QQY0_PENMQ/649-1238SEHFAFSGSKTRALQL-----------------VPL-------------------------------------------S
J3P062_GAGT3/633-1226SDDFAFSGSKTATLHL-----------------LPC-------------------------------------------S
U7Q1R6_SPOS1/669-1328SADFAFSGAKLTTIHV-----------------LPM-------------------------------------------S
M2SXX2_COCSN/666-1245SETFGFSGPKLRTLHL-----------------LPM-------------------------------------------S
V5G1J1_BYSSN/642-1241SDQFAFSGPKSTTVQL-----------------VPL-------------------------------------------S
A0A0E1RX69_COCIM/661-1263SDQFAFSGPKSIAVQL-----------------VPL-------------------------------------------S
Q5BDK6_EMENI/657-1255SEYFAFSGPKTMVVQL-----------------APV-------------------------------------------S
K9FSR4_PEND2/663-1258SEHFAFSGPKTTVVQL-----------------VPL-------------------------------------------S
C5GAE4_AJEDR/665-1268SDQFAFHGPKSTTVQL-----------------VPL-------------------------------------------S
S3D1H3_GLAL2/625-1196NEKFAFSGMKQSTLQL-----------------VPL-------------------------------------------S
G2X5V0_VERDV/635-1221SEEFAFSGAKQTTLHV-----------------LPV-------------------------------------------S
E4V6J7_ARTGP/54-658SDQFAFSGPKSLTVQL-----------------VPL-------------------------------------------S
H6BX93_EXODN/653-1252SEDFAFSGPKICAPSL-----------------VPI-------------------------------------------S
E9E0X1_METAQ/607-1181SDTFGFSGAKQTTINL-----------------LPM-------------------------------------------S
S8BAM7_PENO1/662-1256SEQFAFSGPKTTVVQL-----------------VPL-------------------------------------------S
G0RNV0_HYPJQ/637-1222SDAFAFSGPKQTTMHL-----------------LPM-------------------------------------------S

PF04628

TPPC2_CHICK/9-136WFVSAFAFVLHMRFIM-----------------LHD...........................................V
Q4X1U7_ASPFU/7-185AYISAFLTPSGTRFLL-----------------LHQPPQLPSTGTAGSGSSLLGSSFSVGGGSSSRASSSSIAANP.TSP
Q6BW18_DEBHA/13-197ITVYGYETNTGLKIIV-----------------GLGMSQAVPEDKRDDNKSSPT.....PESKDSAQESTKESAKTPSST
Q7QCA5_ANOGA/9-136WFVSGFVTASHLRFVM-----------------VHD...........................................N
Q57YJ1_TRYB2/2-125YSVSAYVGFAPIKLLL-----------------MKE...........................................H
Q4CQS2_TRYCC/4-127YYVSAYVGFAPIKLLL-----------------MQE...........................................Q
TRS20_YEAST/7-171LAITAYISYSGMKFVM-----------------IHGNS....................................ANSSVV
Q7RCP8_PLAYO/11-149YSVSAYCTPGHIKLLL-----------------LYKNKNELN.............................NSINANMHV
Q6FVV2_CANGA/7-168LVVTAYLTYGGKKFVM-----------------LHGSSVPG...............................GNKTTTTT
Q6BRP5_DEBHA/8-164LLINAFITQGNIKFLL-----------------CYDLNGGNP............................GSGGSNLQSK
Q5KAA6_CRYNJ/23-186WTVSAFIPTG.VKFIL-----------------LHD...........................................V
TPPC2_DICDI/8-131VQISSFVTAGHIKFLL-----------------LHE...........................................K
TPC2L_DICDI/9-139YKVYGYLTNTKIKFII-----------------VVL........................................DTSD
A8X604_CAEBR/10-138WYVSAFVTASRIRFII-----------------LHT...........................................H
TPPC2_DROME/8-135WFVSAFITASQIRFII-----------------VHD...........................................N
TRS20_SCHPO/7-134MYISAYVTPSNMRFML-----------------LHQ...........................................N
Q6CFC6_YARLI/9-134LAVYGMLTNTANKIVI-----------------GCE..........................................AQ
Q5A920_CANAL/9-148LSINAYVLQSQVKFIL-----------------CYN...........................................S
Q651C7_ORYSJ/7-136YKVYGYLTNTKVKFIM-----------------VTT.........................................DLD
Q4UE14_THEAN/25-171LSVSAYVTCSHANFLL-----------------VTRSHNPGSNDFV.....................IYSSNTSPVDPQP
Q6C760_YARLI/7-139HLVSAFVTAGDIKIML-----------------LHE...........................................T
Q74ZF3_ASHGO/7-174LSITGYITYGNMKFVM-----------------IHGTQ....................................NGAPVS
TPC2L_HUMAN/7-138YKVYGYVTNSKVKFVM-----------------VVDS.......................................SNTA
Q6CQN4_KLULA/6-155LAVSGFLTYGNIKFIM-----------------VHG.........................................NGT
Q7F8Z0_ORYSJ/9-132LVVSVYVTAGHARFML-----------------LHD...........................................S

PF04099

Q20100_CAEEL/5-215FKLFCLQSRTGVKFVV-----------------ITS-------------------------------------------A
O77358_PLAF7/1-144FKIQCYDTLTGIKIFI-----------------VHK-------------------------------------------D
TRS23_SCHPO/1-132FNMHILQTHTGMKFVL-----------------FTE-------------------------------------------K
Q9VA95_DROME/3-137YALHYLETPSGLKFVL-----------------NTD-------------------------------------------T
Q9LZ97_ARATH/4-134FDLHCFQSLPGTKFFV-----------------VCE-------------------------------------------P
Q9VLI9_DROME/3-209FTLHCFQTLTGIKFII-----------------ISE-------------------------------------------T
Q9AWN0_ORYSJ/33-178YKLNFLESPSGIKLIL-----------------ITH-------------------------------------------P
TPPC1_HUMAN/3-137YKLHYYETPTGIKVVM-----------------NTD-------------------------------------------L
TPPC4_MOUSE/3-209FKLHCFQTLTGIKFVV-----------------LAD-------------------------------------------P
Q9SYB8_ARATH/23-168YKLSFMETPSGIKIIL-----------------VTH-------------------------------------------P
A7UW60_NEUCR/3-157FRLQCFNTLTGVKFLL-----------------FTD-------------------------------------------T

PF01217

AP3S_SCHPO/1-139YFVFVVD.EGESELGI-----------------LDL------------------------------------------IQ
AP1S1_MOUSE/1-142YFCCAIE.GQDNELIT-----------------LEL------------------------------------------IH
AP2S_YEAST/2-147YFVMGVD.LLDDEPIY-----------------LCH------------------------------------------IH
AP2S1_HUMAN/1-142YFCICVD.VNDNNLAY-----------------LEA------------------------------------------IH
AP3S_YEAST/1-160YFTFIVD.DQESELAI-----------------LDL------------------------------------------IQ
COPZ1_BOVIN/12-153YFYVIGS.SYENELML-----------------MTV------------------------------------------LN
AP1S1_YEAST/3-146YFIVGMTPDVDNELLT-----------------LEI------------------------------------------IH

PF09201

C5E0Z1_ZYGRC/1-156YYVVTYA.EQSLQLNQ-----------------EAE-------------------------------------------E
A7TFS7_VANPO/1-148YFVITYA.EQSLELNN-----------------EAE-------------------------------------------S
G8JRB0_ERECY/1-141YYVVSYSSSESLELNQ-----------------EAE-------------------------------------------Q
G0VGX2_NAUCC/1-143YFVITYA.EQTIDLDK-----------------EAE-------------------------------------------K
G8BTK8_TETPH/1-155YYLVTFP.EQKLDLKN-----------------EAE-------------------------------------------E
Q6CTR2_KLULA/1-140FLVVSFASSESIQLTA-----------------EAE-------------------------------------------S
G0W8F2_NAUDC/1-150YFVITYA.EQTIELDK-----------------EAE-------------------------------------------K
I2GXE9_TETBL/1-153YFVVTYA.ELSLELNR-----------------DSE-------------------------------------------E
G8ZVC5_TORDC/1-153YYVVTYA.EQSLQLNE-----------------EAA-------------------------------------------E
SRPR_YEAST/1-155YFVVTFA.EQTLELNQ-----------------ETQ-------------------------------------------Q
C5DM67_LACTC/1-140VYLVTYA.AQDLELNQ-----------------EAE-------------------------------------------Q
Q6FSE1_CANGA/1-148YFIITYP.EPSMELNN-----------------EAQ-------------------------------------------E

PF12584

A8NHA2_COPC7/992-1155KFT......LPLTLMALHHGEFGLP-KVHVQPRV..............................................
A7F9J5_SCLS1/1351-1514KLT......YPIVLIPLREGFLQYP-TVEIKALPSTRGV......................................RPG
B2W2H3_PYRTR/1490-1643VME......WDIVLIPLRAGNALMP-NVEVRAKVK.............................................
B6H3B0_PENCW/1240-1399STR......FTVLLLPQKPGHLLLP-GVEIRTFLPPAPQP....................................PTSP
C5FEM2_ARTOC/1257-1416ERR......FQLLLLPQRAGHLLLP-TVDVKSFATGPGHQQPL...............................SPTGGE
C4JLA5_UNCRE/1213-1358QRR......FSLMLIPQVPGHLLLP-SVEVKSFVSQ............................................
A0A0D1DNV8_USTMA/1235-1382APLACDVFSVTLTIVALRTGRLPLP-TVQVRPLS..............................................
B8P4P6_POSPM/992-1139TFT......MPVTLIALHHGELSLP-KIAINALP..............................................
B0D3E6_LACBS/1015-1161IHV......IPITLIALHHGEFSLP-KVTVTALP..............................................
C4R0Z1_PICPG/1026-1192NITTF..DEMRFVLIPLKTGQLLLP-KVEIKHGD..............................................
A8PKV5_BRUMA/843-1047LGQ......ISFTVFPKMIGFLPYP-IISVYSCRHKRS.........................................D
B4HE09_DROSE/978-1138SHS......ISLDVMPLSTGFLPMP-SIRLSKYTAG............................................
F7CPS6_CALJA/149-377THR......VHMEVMPLFAGYLPLP-DVRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDEQPDSSSLKSRGSVHSVC
H3CJ11_TETNG/1022-1246SQK......VQIEVMPLFAGHLPYP-RINVLRYLPHTAGVFNQPDPDSCMENDSLSLL.DDQTDTASIRSRGSVHSVGSS
Q4WSJ6_ASPFU/1252-1410TQT......FAVMLLPQKAGHLLLP-GLEIKSYVPAAPPSTA.................................TTSQP

PF12742

TPC11_MOUSE/1036-1095KQE------MLYNFYPLMAGYQQLP-SLNI--------------------------------------------------
A2FUL4_TRIVA/291-348IRK------LIFNFTPLKIGLHKLP-EIRV--------------------------------------------------
A2FF60_TRIVA/461-517VTQ------IPITFIPMVAGSYILP-KITI--------------------------------------------------
A2EKE8_TRIVA/495-550EEI------IEFSFYAINHGLLYFP-KIFI--------------------------------------------------
A2EQW1_TRIVA/476-534KKE------IPIKYIPLTTGFLYLP-KINI--------------------------------------------------
H3CLI1_TETNG/1011-1064EQR------MLYNYYPLMAGYQTLP-QLNI--------------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247RQT------VRYNVLPLVKGAWIYP.QLKV--------------------------------------------------
R7YHS6_CONA1/667-1263RQD------VKFRILPLVRGAWISP.QLRV--------------------------------------------------
C5G0L5_ARTOC/657-1267RHT------VQYSLLATRRGVWIQP.QLIV--------------------------------------------------
G2YB15_BOTF4/638-1224RRT------VKFRLLPTVRGEWIGPIRCVI--------------------------------------------------
M1WIS4_CLAP2/616-1226RRS------IRYRLLPFVSGDYVRP.GIVV--------------------------------------------------
C4JTF4_UNCRE/662-1266RHT------VRYNLLAAGNQKWIQP.QLMV--------------------------------------------------
H1V6N2_COLHI/632-1214RRS------VTYRLLPFTRGDYIRP.TLVV--------------------------------------------------
B8M738_TALSN/646-1234RHT------VRYNIFAFRSGMWIQP.HLVV--------------------------------------------------
A0A0C4E0J0_MAGP6/633-1227RRV------VTYSILPLVRGAWVRP.SLTV--------------------------------------------------
G4NCT1_MAGO7/630-1218RRK------VTWRLVPLVRGVWVRP.NLTV--------------------------------------------------
G3JHI1_CORMM/630-1211RRT------ATYRLLPYQRGCYIRP.GLVV--------------------------------------------------
E3QU68_COLGM/632-1215RRT------ITYRLLPLVRGDYIRP.TLVV--------------------------------------------------
Q2UPL2_ASPOR/663-1261RHT------VRYNLLASKRGLWIQP.QLVV--------------------------------------------------
G7XKR2_ASPKW/663-1260RHT------VRYNLLASKRGLWIQP.QLLV--------------------------------------------------
N4VGT4_COLOR/632-1208RRT------VTYRLLPMVRGDYIRP.SLVV--------------------------------------------------
A6QX66_AJECN/503-1110RHT------VRYNLLANVRGKWIQP.QLAV--------------------------------------------------
S0E618_GIBF5/633-1211RRT------TTYRLLPHVNGVWIRP.KLTV--------------------------------------------------
T5AEY3_OPHSC/622-1204RRA------TRYRLLPLVRGAYLRP.GLVV--------------------------------------------------
C7YM27_NECH7/633-1211RRT------TTYRLLPQVSGDYIRP.RLTV--------------------------------------------------
E4ZMR8_LEPMJ/666-1245RQT------VCYSLLPLVTATWITP.HLKV--------------------------------------------------
L8G4R2_PSED2/136-727RRG------MSFNLLPNVRGEWVRP.QLVV--------------------------------------------------
G9NXZ6_HYPAI/630-1207RRT------QTYRLMPLVRGVYVRP.GLVV--------------------------------------------------
T0LUP2_COLGC/632-1210RRS------ATYRLLPLVRGAFIRP.SLVV--------------------------------------------------
G9MPU4_HYPVG/630-1207RRT------KTYRLLPLTRGVYIRP.GLVV--------------------------------------------------
K1XTU1_MARBU/632-1208RRT------VGFRLLPTVRGEWVGPIQCVI--------------------------------------------------
A1CQK2_ASPCL/664-1261RHT------VRYNLLASKRGLWIQP.QLIV--------------------------------------------------
Q0CCQ2_ASPTN/665-1260RHT------VRYNLLASKRGQWIQP.QLLV--------------------------------------------------
F2PXY2_TRIEC/646-1249RHT------LQYSLLATRRGVWIQP.QLVI--------------------------------------------------
B6QQY0_PENMQ/649-1238RHK------VRYNIFAFKSGMWIQP.HLVV--------------------------------------------------
J3P062_GAGT3/633-1226RRV------VTYSILPLVRGAWVRP.SLTV--------------------------------------------------
U7Q1R6_SPOS1/669-1328RRA------TSYRLVPLVRGAWIRP.ALVV--------------------------------------------------
M2SXX2_COCSN/666-1245RQT------VRYNLLSSVEGDWITP.NLKV--------------------------------------------------
V5G1J1_BYSSN/642-1241RHT------IRYNLLASKRGEWIQP.QLVV--------------------------------------------------
A0A0E1RX69_COCIM/661-1263RHT------IQYNLLATGKDKWIQP.QLVV--------------------------------------------------
Q5BDK6_EMENI/657-1255RQT------VRYNLLASKRGLWIQP.QLLV--------------------------------------------------
K9FSR4_PEND2/663-1258RHT------VNFNLFAAKRGLWIQP.QLVV--------------------------------------------------
C5GAE4_AJEDR/665-1268RHT------VRYNLLANVTGTWIQP.QLVV--------------------------------------------------
S3D1H3_GLAL2/625-1196RRT------VRFRLLPAIRGDWIGPINCVI--------------------------------------------------
G2X5V0_VERDV/635-1221RRA------VTYRLLPLVRGTYVRP.NLVV--------------------------------------------------
E4V6J7_ARTGP/54-658RHT------VQYSLLATRRGIWIQP.QLVV--------------------------------------------------
H6BX93_EXODN/653-1252RHT------ITYQIFPYKRDQWVAV.QLKV--------------------------------------------------
E9E0X1_METAQ/607-1181RRT------ARYRLLPFVQGDYIRP.GLVV--------------------------------------------------
S8BAM7_PENO1/662-1256RHT------VRYTILPAKRGLWIQP.QLVV--------------------------------------------------
G0RNV0_HYPJQ/637-1222RRT------KTYRLLPLVRGVFIRP.GLVV--------------------------------------------------

PF04628

TPPC2_CHICK/9-136RQE------DGIKNFFN-DVYDLYI-KFAM--------------------------------------------------
Q4X1U7_ASPFU/7-185QTE------EAVRQFMN-EVYENYV-KTAM--------------------------------------------------
Q6BW18_DEBHA/13-197KKP------MKLKDLFS-QLHKSYI-HIIC--------------------------------------------------
Q7QCA5_ANOGA/9-136RND------EGIKNFFN-EMYETYI-KYLM--------------------------------------------------
Q57YJ1_TRYB2/2-125ESD------KETRLFLS-EAYGLCV-RYLM--------------------------------------------------
Q4CQS2_TRYCC/4-127EPN------KNTRQFMN-EVYGLCV-RYLL--------------------------------------------------
TRS20_YEAST/7-171IDD------NNMRSFYQ-EVHELYV-KTLM--------------------------------------------------
Q7RCP8_PLAYO/11-149PSD------DNIKSFFE-LVHENYI-KVLL--------------------------------------------------
Q6FVV2_CANGA/7-168IDD------SMVRSFYQ-EVHELYI-KTIM--------------------------------------------------
Q6BRP5_DEBHA/8-164NED------NSIKQFFT-EVNELYV-KCLL--------------------------------------------------
Q5KAA6_CRYNJ/23-186KND------DGIRLFFI-DLWEAYV-KILL--------------------------------------------------
TPPC2_DICDI/8-131KDE------DAIKNFFV-EVHDLYL-KILL--------------------------------------------------
TPC2L_DICDI/9-139IKD------SDLKLFFK-RLQTLFI-NTTS--------------------------------------------------
A8X604_CAEBR/10-138RAD------EGIKQFFQ-EMYETYI-KHAM--------------------------------------------------
TPPC2_DROME/8-135KND------EGIKNFFN-EMYDTYI-KNSM--------------------------------------------------
TRS20_SCHPO/7-134QSA------DNIKLFFQ-ELHELYI-KTLM--------------------------------------------------
Q6CFC6_YARLI/9-134EGS------ESIEQFAK-QVLKVLV-AYKS--------------------------------------------------
Q5A920_CANAL/9-148KEE------STIKQFFQ-EVNELYT-KCLM--------------------------------------------------
Q651C7_ORYSJ/7-136VKD------ADARNFFR-KFHAAYV-DAVS--------------------------------------------------
Q4UE14_THEAN/25-171PSS------DNIRYFFR-EVHELYS-KQLM--------------------------------------------------
Q6C760_YARLI/7-139RNE------ESIRQFFQ-EVHDLYV-KTLL--------------------------------------------------
Q74ZF3_ASHGO/7-174VDD------GMLKSFYQ-EVHELYI-KTLM--------------------------------------------------
TPC2L_HUMAN/7-138LRD------NEIRSMFR-KLHNSYT-DVMC--------------------------------------------------
Q6CQN4_KLULA/6-155VDD------TVTRSFYY-EVYELYL-KTLM--------------------------------------------------
Q7F8Z0_ORYSJ/9-132RSE------DGIKSFFQ-EVHELYI-KIFL--------------------------------------------------

PF04099

Q20100_CAEEL/5-215ASN------IAADSLLS-KMYELYT-DFAL--------------------------------------------------
O77358_PLAF7/1-144DLN------IEMNTYLK-RVYELYS-DIIL--------------------------------------------------
TRS23_SCHPO/1-132KT.------TNARLQLQ-KFYELYS-DYVL--------------------------------------------------
Q9VA95_DROME/3-137TAI------NVKELLQQ-LYAKVWV-EFVV--------------------------------------------------
Q9LZ97_ARATH/4-134GT.------PHMESLLR-YIYELYT-DYVL--------------------------------------------------
Q9VLI9_DROME/3-209GL.------NGIDLLLR-KVYELYS-DYVL--------------------------------------------------
Q9AWN0_ORYSJ/33-178RTG------DQRDTLKH-IYN.LYV-EYVV--------------------------------------------------
TPPC1_HUMAN/3-137GVG------PIRDVLHH-IYSALYV-ELVV--------------------------------------------------
TPPC4_MOUSE/3-209RQ.------AGIDSLLR-KIYEIYS-DFAL--------------------------------------------------
Q9SYB8_ARATH/23-168KTG------DLRESLKY-IYS.LYV-EYVV--------------------------------------------------
A7UW60_NEUCR/3-157TQ.------TNVDVIIR-RIYDLYS-DYVM--------------------------------------------------

PF01217

AP3S_SCHPO/1-139VFV------EALDRCFN.NVCELDL-VFKF--------------------------------------------------
AP1S1_MOUSE/1-142RYV------ELLDKYFG.SVCELDI-IFNF--------------------------------------------------
AP2S_YEAST/2-147LFV------EVLDAFFG.NVCELDI-VFNF--------------------------------------------------
AP2S1_HUMAN/1-142NFV------EVLNEYFH.NVCELDL-VFNF--------------------------------------------------
AP3S_YEAST/1-160TFV------ESLDRCFT.EVNELDL-IFNW--------------------------------------------------
COPZ1_BOVIN/12-153CLF------DSLSQMLRKNVEKRAL-LENM--------------------------------------------------
AP1S1_YEAST/3-146RFV------ETMDTYFG.NVCELDI-IFNF--------------------------------------------------

PF09201

C5E0Z1_ZYGRC/1-156TLQ------VGINLWESLGLSEGVL-DNI.--------------------------------------------------
A7TFS7_VANPO/1-148TLN------LVLALWDSLDLNQSIL-ENM.--------------------------------------------------
G8JRB0_ERECY/1-141VLN------IAIKLWDSLGLNDAIR-KNQD--------------------------------------------------
G0VGX2_NAUCC/1-143TLD------LALKLWDSLDLNEEIQ-SNL.--------------------------------------------------
G8BTK8_TETPH/1-155TLN------LALSLWDSLGLNDSIL-QNLK--------------------------------------------------
Q6CTR2_KLULA/1-140VVV------LATKLWESLGLNEVIL-DNI.--------------------------------------------------
G0W8F2_NAUDC/1-150TLD------LATKLWNSLEINKSIQ-ENL.--------------------------------------------------
I2GXE9_TETBL/1-153LLK------LAIDLWDSLELSTSVS-ENLN--------------------------------------------------
G8ZVC5_TORDC/1-153ILR------LSISLWNSLNVNEEIV-RNL.--------------------------------------------------
SRPR_YEAST/1-155TLA------LVLKLWNSLHLSESIL-KNR.--------------------------------------------------
C5DM67_LACTC/1-140VLD------LGFGLWDSLKLNNSVL-QNL.--------------------------------------------------
Q6FSE1_CANGA/1-148VLD------VAIALWDSLPINDIII-KAA.--------------------------------------------------

PF12584

A8NHA2_COPC7/992-1155...NWRDI------TVASQAPP-NVETYQEHGA-VKVLVL------
A7F9J5_SCLS1/1351-1514SSGGGEES------VKNKSRPV-TCETDSKNTG-ETIRII------
B2W2H3_PYRTR/1490-1643.PKDESAK------KGDEAEPL-NCETDYWSYG-DVVVVV------
B6H3B0_PENCW/1240-1399PAADAAGS------MAPARRSI-PCEVDYRNHG-ETVLVL------
C5FEM2_ARTOC/1257-1416HLQLDTSF------APRQRRAI-SSELDYRSHG-ETILVS------
C4JLA5_UNCRE/1213-1358.EHPPEAQ------HALQRRPI-SSEVEYCNHG-ETVLVT------
A0A0D1DNV8_USTMA/1235-1382..TVEAAT------NPKTGQLP-TCETYISNAA-QRVNVV------
B8P4P6_POSPM/992-1139...TQGGP------RMGSSSVP-SCETYQMHGA-EKVLVL------
B0D3E6_LACBS/1015-1161...MAGDV------TMGSMAVP-SIETYQVHGA-EKVLVL------
C4R0Z1_PICPG/1026-1192........------...PGESL-RYEVDYKNGS-ESILVV------
A8PKV5_BRUMA/843-1047SDISQLST------ESTYDFGP-QLSSFVRTNG-KQVHVL------
B4HE09_DROSE/978-1138.GKSKTDG------HSKVHPFP-PGQVYNSTKS-MQIHVI------
F7CPS6_CALJA/149-377SSEHKGLP------MPRLQALP-AGQVFNSSSG-TQVLVI------
H3CJ11_TETNG/1022-1246EHQQRGIA------MPRLDSFG-PGEVFNHSHM-QQVLVL------
Q4WSJ6_ASPFU/1252-1410GNLAVGGA------PSLQRRQI-PSEVDYRNHG-ETVLVL------

PF12742

TPC11_MOUSE/1036-1095----------------------------------------------
A2FUL4_TRIVA/291-348----------------------------------------------
A2FF60_TRIVA/461-517----------------------------------------------
A2EKE8_TRIVA/495-550----------------------------------------------
A2EQW1_TRIVA/476-534----------------------------------------------
H3CLI1_TETNG/1011-1064----------------------------------------------

PF07919

K2S4Z6_MACPH/666-1247---QDRYF------NKILKPAP.TEGMRQDKKG.VAVWAD------
R7YHS6_CONA1/667-1263---VDRYF------GKVLKVLP.TEGLRADKGA.VGVWVD------
C5G0L5_ARTOC/657-1267---VDSYY------NKTLHVLP.TDGMRTDEKG.LLVWVD------
G2YB15_BOTF4/638-1224---RDRYF------QKVLKIAP.TEGMKSDKEG.LLIWVP------
M1WIS4_CLAP2/616-1226---RDKYF------QKVLRIIP.TEAMKIDKDG.LLVWVP------
C4JTF4_UNCRE/662-1266---VDSYY------NKTLRVLP.TEGMRADKKG.ILVYTA------
H1V6N2_COLHI/632-1214---RDKYF------QKVLRIIP.TEGMKIDKDG.LLVWIP------
B8M738_TALSN/646-1234---VDTYF------NKTLRVLP.TEGMRADKKG.ILVWVD------
A0A0C4E0J0_MAGP6/633-1227---RDKYF------QKVLRVIP.TEGMKLDKEG.FLVWIP------
G4NCT1_MAGO7/630-1218---RDKYF------QKLLRVIP.TAGMKLDKEG.FLIWIP------
G3JHI1_CORMM/630-1211---RDKYF------QKVLRIIP.TEGMKIDKDG.LLVWVP------
E3QU68_COLGM/632-1215---RDKYF------QKVLRIIP.TEGMKIDKEG.LQVWIP------
Q2UPL2_ASPOR/663-1261---VDTYF------NKTLRVLP.TEDMRSDKKG.PLIWVD------
G7XKR2_ASPKW/663-1260---VDTYF------NKTLRVLP.TEDMRSDKKG.ILVWVD------
N4VGT4_COLOR/632-1208---RDKYF------QKVLRIIP.TEGMKIDKEG.LLVWIP------
A6QX66_AJECN/503-1110---VDSYF------NKTLRVLP.TEGMMGDKKG.ILVWVD------
S0E618_GIBF5/633-1211---RDKYF------QKVLRIIP.TEGMKIDEEG.LLVWVP------
T5AEY3_OPHSC/622-1204---RDKYF------QKTLRVIP.TEGMKIDKDG.LLVWVP------
C7YM27_NECH7/633-1211---RDKYF------QKVLRIIP.TEGMKIDKDG.LLVWIP------
E4ZMR8_LEPMJ/666-1245---MDRYF------NKTLKVQA.TEGLRMEKKG.VGVWIP------
L8G4R2_PSED2/136-727---TDRYF------QKVLKVAP.GDGMKSDKEG.ILIWIP------
G9NXZ6_HYPAI/630-1207---RDKYF------QKVLRVIP.TEGMKIDKDG.LLVWIP------
T0LUP2_COLGC/632-1210---RDKYF------QKVLRIIP.TEGMKIDKDG.LLIWIP------
G9MPU4_HYPVG/630-1207---RDKYF------QKVLRVIP.TEGMKIDKDG.LLVWIP------
K1XTU1_MARBU/632-1208---RDRYF------QKVLRIAP.TEGMKSEKEG.LLVWVP------
A1CQK2_ASPCL/664-1261---VDTYF------NKTLRVQP.TEEMRSDKKG.ILVWVD------
Q0CCQ2_ASPTN/665-1260---VDTYF------NKSLRVLP.TEDMRSDKKG.IWVWVD------
F2PXY2_TRIEC/646-1249---VDTYF------NKTLRILP.TESIKSDAKG.ILIWVD------
B6QQY0_PENMQ/649-1238---VDTYF------NKTLRVLP.TEGMRADKKG.ILVWVD------
J3P062_GAGT3/633-1226---RDKYF------QKVLRVIP.TEGMKLDKEG.FLIWIP------
U7Q1R6_SPOS1/669-1328---RDKYF------QKVLRILP.TEGMKMDKDG.ILIWVP------
M2SXX2_COCSN/666-1245---TDRYF------NKTLKVQG.TEGMRGDKKG.VGIWVP------
V5G1J1_BYSSN/642-1241---VDTYF------NKTLRILP.TEGMRSDKRG.ILIWVD------
A0A0E1RX69_COCIM/661-1263---VDSYY------NKTLRVLP.TEGMKADKKG.ILIHIA------
Q5BDK6_EMENI/657-1255---VDTYF------NKSLRVLP.TEDMRSDKKG.ILIWVD------
K9FSR4_PEND2/663-1258---IDTYF------NKTLRVLP.TGDVKSDKKG.ILVWVD------
C5GAE4_AJEDR/665-1268---VDSYF------NKTLRVLP.TEGMRGDKKG.ILVWVD------
S3D1H3_GLAL2/625-1196---KDRYF------QKTLKIAP.TEGMKMDKEG.ILIWVP------
G2X5V0_VERDV/635-1221---RDKYF------QKVLRIIP.TEGMKIDKEG.LLLWVP------
E4V6J7_ARTGP/54-658---VDSYY------NKTLHVLP.TEGMRSDAKG.ILIWAD------
H6BX93_EXODN/653-1252---VDAYF------GQTLKVLPGGEGVKVDKKGNLLVKV.------
E9E0X1_METAQ/607-1181---RDKYF------QKVLRIIP.TEGMKIDKDG.LLVWVP------
S8BAM7_PENO1/662-1256---VDTYF------NKTLRVLP.TGEMRSDKKG.ILVWID------
G0RNV0_HYPJQ/637-1222---RDKYF------QKVLRVIP.TEGMKIDKDG.LLVWVP------

PF04628

TPPC2_CHICK/9-136----NPFY......ELNSPIR.-SSAFERKVQF-LGKK--------
Q4X1U7_ASPFU/7-185----NPFY......RQGMEIR.-SPVFRARVVA-AGKK--------
Q6BW18_DEBHA/13-197----NPFTNLSGSLADNETILQ-SAKFDKSISK-IVDS--------
Q7QCA5_ANOGA/9-136----NPFY......MPNTPIK.-SLAFEKKAQL-YGKK--------
Q57YJ1_TRYB2/2-125----NPFS......SLKTPVR.-A.VLAENLRR-LYQR--------
Q4CQS2_TRYCC/4-127----NPFS......FPNTPVR.-S.TLGEKVRR-LYER--------
TRS20_YEAST/7-171----NPFY......KITDPIR.-SPAFDSRVRT-LARK--------
Q7RCP8_PLAYO/11-149----NPLY......EPNGIIT.-SSLFDQNVHL-AAKN--------
Q6FVV2_CANGA/7-168----NPFY......QEGDELR.-SPLFDTRVKA-LAKK--------
Q6BRP5_DEBHA/8-164----NPFY......SVNDAIT.-SPDFDMRLKM-LARK--------
Q5KAA6_CRYNJ/23-186----NPFF......TTNTPIK.-SPAFEARVKS-IAKR--------
TPPC2_DICDI/8-131----NPFY......EYNKPIT.-STAFDAKVRK-IGTK--------
TPC2L_DICDI/9-139----NPFY......KPNSKVE.-SKKFLQEVTN-LVPS--------
A8X604_CAEBR/10-138----NPFY......EIDDVIE.-SIAFEQKAAL-YGRK--------
TPPC2_DROME/8-135----NAFY......RINTPIK.-SPMFEKKSEI-FGRK--------
TRS20_SCHPO/7-134----SPFY......QPNQPIR.-SQAFDLKVRS-IARR--------
Q6CFC6_YARLI/9-134----NPFY......DETETSID-SQGFRKEMAK-VVDK--------
Q5A920_CANAL/9-148----NPFY......NVDDAIV.-SPDFDLKIKQ-LARK--------
Q651C7_ORYSJ/7-136----NPFH......VPGKKIA.-SRSFGARVST-IVKS--------
Q4UE14_THEAN/25-171----NPLY......VFNTSLD.-SSNFKSKVHQ-AAKK--------
Q6C760_YARLI/7-139----SPFY......FVNQPIT.-SPVFDQRIKS-LAKK--------
Q74ZF3_ASHGO/7-174----NPFY......KVDEPIT.-SPTFDWKVKQ-LAKK--------
TPC2L_HUMAN/7-138----NPFY......NPGDRIQS-SRAFDNMVTS-MMIQ--------
Q6CQN4_KLULA/6-155----NPFY......KVNDPIS.-NSAFDSKVRV-LSKR--------
Q7F8Z0_ORYSJ/9-132----NPLY......LPGSRIT.-SSHFDTKVRA-LAR.--------

PF04099

Q20100_CAEEL/5-215---KNPFY------SIDMPIR--AQKFDEAIKT-LLERA-------
O77358_PLAF7/1-144---KNPFY------DIDMPIR--SAVFNEQIEK-LFSNI-------
TRS23_SCHPO/1-132---KNPFY------TLEMPIK--CQLFDEQLKR-YIDSH-------
Q9VA95_DROME/3-137---RDPLW------TPGTVVT--SELFQSKLDE-FVRQS-------
Q9LZ97_ARATH/4-134---KNPFY------EIEMPIR--CELFDINLTQ-AVQSD-------
Q9VLI9_DROME/3-209---KNPFY------SLEMPIR--CELFDNKLQE-LLAQV-------
Q9AWN0_ORYSJ/33-178---KNPLY------APGTPIK--CELFNKHLDQ-YVKTL-------
TPPC1_HUMAN/3-137---KNPLC------PLGQTVQ--SELFRSRLDS-YVRSL-------
TPPC4_MOUSE/3-209---KNPFY------SLEMPIR--CELFDQNLKL-ALEVA-------
Q9SYB8_ARATH/23-168---KNPIY------SPGSPIK--SELFNTALDQ-YVRSI-------
A7UW60_NEUCR/3-157---KNPFY------QLEMPIR--CDMFDRKLLS-YIRE.-------

PF01217

AP3S_SCHPO/1-139---QEIHA------ILAEVVSG.GLVLETNLNE-IV.....L..AA
AP1S1_MOUSE/1-142---EKAYF------ILDEFLMG.GDVQDTSKKS-VLKAIEQADLLQ
AP2S_YEAST/2-147---YKVYM------IMDEMFIG.GEIQEISKDM-LLERLSILDRLD
AP2S1_HUMAN/1-142---YKVYT------VVDEMFLA.GEIRETSQTK-VLKQLLMLQSLE
AP3S_YEAST/1-160---QTLES------VLEEIVQG.GMVIETNVNR-IVASVDELNKAA
COPZ1_BOVIN/12-153---EGLFL------AVDEIVDG.GVILESDPQQ-VVHRVALRGEDV
AP1S1_YEAST/3-146---SKVYD------ILNEMIMCDGSIAESSRKE-VLHHVTVMDTME

PF09201

C5E0Z1_ZYGRC/1-156---NGKGS------RNERNCIDVLTDLEEELEK-FDQYL-------
A7TFS7_VANPO/1-148---KGKSG------KNEHNYCEVLQDLNETIKT-FDKYF-------
G8JRB0_ERECY/1-141---HAKSK------KNRHNYTWLLEGAEDKLLQ-FEQFF-------
G0VGX2_NAUCC/1-143---.....------.KNKQHVDILYGMNEDLSK-FDKYL-------
G8BTK8_TETPH/1-155---NRTET------KNWHNYIDLLYGTENDFKK-FKEYF-------
Q6CTR2_KLULA/1-140---SGKGK------KNVHNFRFITEGASDQISK-FGSYF-------
G0W8F2_NAUDC/1-150---.....------.NSRDHIDILDGVNDGISK-FDQYF-------
I2GXE9_TETBL/1-153---QYKTN------ANEHSQVFILNDMEEDLSK-YDKYL-------
G8ZVC5_TORDC/1-153---SGRGS------KNEHNFTDVVDGLDKDIET-FDKYL-------
SRPR_YEAST/1-155---QGQNE------KNKHNYVDILQGIEDDLKK-FEQYF-------
C5DM67_LACTC/1-140---SGKGV------KNRHNYTWILEGCDSNLNK-FDEYF-------
Q6FSE1_CANGA/1-148---KGTGK------KNAFNCIDISGEISEDIEK-FDNYL-------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window