Sequence alignment for CL0214

PF02845

Q4WY44_ASPFU/59-100------------YSNDL..PTLK-ELF-P-D---W----TD-----E-D-LVFALE------------------------
VPS9_YEAST/409-450------------RKDTL..NTLQ-NMF-P-D---M----DP-----S-L-IEDVCI------------------------
Q75DK5_ASHGO/3-44------------PDEAV..QFLQ-ELF-P-D---R----TA-----S-V-LAQVLR------------------------
TOLIP_DANRE/232-273------------SEEDL..KALQ-DMF-P-N---L----DK-----E-V-IRTVLE------------------------
ASCC2_DICDI/564-605------------NTVKI..DQVK-SLF-P-D---L----GD-----W-F-VHCCLK------------------------
DEF1_DEBHA/28-69------------SSTEL..TSLL-EMF-P-D---W----ES-----D-D-LSSLLA------------------------
A5DPP2_PICGU/21-62------------TPDEL..GNLV-EMF-P-D---W----ES-----D-D-LASLLS------------------------
A3GGA0_PICST/22-63------------NSAEL..ASLA-EMF-A-D---W----DA-----D-E-LAGLLA------------------------
Q0UHZ6_PHANO/76-117------------QQQAQ..NTLI-EAF-P-D---I----DS-----N-V-IKAVLV------------------------
A3GFZ4_PICST/86-127------------LVKIT..NELK-DAF-P-A---I----EE-----K-I-VTAVLI------------------------
A5DQI0_PICGU/124-165------------VTQIT..KDLK-DAF-P-N---I----ED-----K-Y-ITAVLV------------------------
TAB3_HUMAN/9-50------------DIQVL..HDLR-QRF-P-E---I----PE-----G-V-VSQCML------------------------
Q0U670_PHANO/46-87------------NPAQI..DQIA-AMF-P-Q---L----SR-----R-D-IAWDLQ------------------------
Q6BNF2_DEBHA/604-645------------YSSDV..RTLK-EIF-P-E---Y----DF-----E-V-LRKILN------------------------
Q299A9_DROPS/168-209------------FFDEA..EALQ-EMF-P-D---A----AY-----V-E-IKHCIA------------------------
Q29HR0_DROPS/452-492------------IDLEV..SAVL-DVL-P-D---L----GM-----G-F-IRSLLT------------------------
A5DKD2_PICGU/326-367------------KESDI..DTLL-DLF-P-Q---M----TR-----G-Q-AKTILF------------------------
Q2H1C9_CHAGB/67-108------------YGSKV..AVIK-EMF-P-D---W----SS-----V-D-ILFALQ------------------------
Q6CCF1_YARLI/36-77------------YPTQL..VTLK-ELF-P-D---W----KD-----D-D-LLTVLS------------------------
A6QRJ9_AJECN/60-101------------HAGNL..STIK-ELF-A-D---W----TD-----E-D-LVFALE------------------------
A2QDL6_ASPNC/61-102------------YSDTL..PMLK-ELF-S-D---W----TD-----E-D-LVFALE------------------------
Q0UJ69_PHANO/56-97------------YQGQL..SMLK-ELF-P-D---W----TD-----A-D-LVLAIE------------------------
A7EMB9_SCLS1/61-102------------HGSKV..STIQ-ELF-P-G---W----TD-----E-D-VVMALE------------------------
YGVA_SCHPO/78-119------------RDSQL..SVLQ-ELF-P-S---W----TI-----D-D-LSFALE------------------------
Q5K6W5_CRYNJ/9-50------------YTSQL..QQLT-AIF-P-D---W----DE-----Q-D-LLFTLQ------------------------
Q55BS4_DICDI/38-79------------HREEI..RKVR-DVY-P-L---W----SE-----D-D-IVSALQ------------------------
DEF1_CANAL/24-65------------TSTEL..TNLV-EMF-P-D---W----EA-----D-E-LQGLLS------------------------
DEF1_LODEL/31-72------------ASPEL..TSLT-EMF-P-D---W----ES-----D-E-LNSLLQ------------------------
Q6CAS3_YARLI/132-173------------FSQAQ..AHLK-EAF-P-D---T----EE-----S-I-IKAVLV------------------------
A7UXH9_NEUCR/73-114------------EQKNQ..QILK-EAF-P-S---I----DL-----T-V-IKAVLR------------------------
Q2GVS7_CHAGB/75-116------------EQKSQ..QMLK-EAF-P-T---V----DD-----S-V-IKAVLR------------------------
CUE5_SCHPO/18-59------------AEKAR..ATLK-EAF-P-N---T----DD-----A-I-IRAVLA------------------------
CUE5_YEAST/98-139------------ENPIL..QELK-DAF-P-N---L----EE-----K-Y-IKAVII------------------------
Q75C34_ASHGO/99-140------------ENSIL..SELK-AAF-P-N---V----EE-----K-I-VKAVII------------------------
Q6CJT9_KLULA/91-132------------ENPML..KQLK-EAF-P-N---I----EE-----K-Y-VKAVLI------------------------
A7TLU9_VANPO/108-149------------GNPLF..NQLK-EAF-P-N---I----DE-----N-S-IKAVLI------------------------
Q5A2E6_CANAL/123-164------------TQEII..DDMK-QAF-P-N---I----EE-----K-Y-IIATLI------------------------
A5DWM8_LODEL/145-186------------TQQVI..KDLQ-DAF-P-S---I----EE-----K-I-ITAVLI------------------------
Q6BQ94_DEBHA/157-198------------LTQIK..QDLK-DAF-P-N---V----EE-----K-L-VTAVLI------------------------
A4HRE2_LEIIN/565-606------------RHNAL..LTLI-SLF-P-G---V----DP-----V-A-VEAVLS------------------------
A4H345_LEIBR/550-591------------RQNAL..LTLL-SLF-P-A---V----EP-----A-A-VEAVLS------------------------
A2VCY9_XENTR/9-50------------DFQVL..HNLR-QKF-P-E---V----PE-----V-V-VSRCMQ------------------------
TAB2_DANRE/9-50------------DNQVL..HHLR-QKF-P-E---V----PE-----D-V-VCECVL------------------------
A7SCG6_NEMVE/14-55------------KHDSV..KALQ-SRF-P-E---L----PL-----D-V-IAKFLS------------------------
CUE3_SCHPO/272-313------------NPGDV..KSLI-ELF-P-Q---L----SV-----E-E-AVEHLS------------------------
A0A0D1ED14_USTMA/88-129------------VPPAV..SELK-VMF-P-D---L----DR-----D-T-IAAVLS------------------------
Q5KNC6_CRYNJ/50-91------------NNPKV..SELH-AMF-P-T---V----EL-----S-V-IELVLE------------------------
A6RDW9_AJECN/50-91------------DPAHV..EQLS-QMF-P-Q---L----DR-----R-D-LMWDLQ------------------------
A1C6F4_ASPCL/48-89------------DPAQV..EQIS-QMF-P-Q---L----ST-----R-E-ILWDLQ------------------------
A7TT41_VANPO/62-102------------TDDMI..EVVQ-SLA-P-S---L----HV-----E-Q-IRYSL.------------------------
CUE1_ASHGO/66-106------------NDDMI..EVVQ-ALA-P-H---L----HS-----E-Q-IRYDL.------------------------
CUE1_CANGA/71-111------------TPEMI..ETVR-NVI-P-A---L----HP-----E-Q-IRYDL.------------------------
Q6FP56_CANGA/67-107------------TEGMI..EIVS-TLA-P-H---L----DV-----E-Q-IKYDL.------------------------
A3LVB3_PICST/67-107------------TDSMV..EVVQ-TIA-P-G---L----TR-----D-Q-IVFDL.------------------------
A5E2L2_LODEL/84-124------------TDSMI..EVVQ-TIA-P-S---L----TV-----E-Q-IRYDL.------------------------
CUE1_DEBHA/71-111------------SDDMI..EVVQ-TIA-P-Q---L----TR-----G-Q-IRMDL.------------------------
CUE1_CANAL/73-113------------SESMI..EVVQ-SIA-P-M---L----TV-----E-Q-IRYDL.------------------------
Q6C131_YARLI/77-117------------TQSMI..EVVQ-AIA-P-N---V----SV-----A-Q-IRWDL.------------------------
A0A0D1E3W1_USTMA/47-87------------PQHMV..DSIK-ALF-P-H---I----PD-----A-S-IRYDL.------------------------
Q5KCQ0_CRYNJ/38-78------------TPSMV..ETVH-SAF-P-H---I----PV-----P-N-IVYHL.------------------------
CUE4_SCHPO/49-89------------NSEHV..HLVK-TVF-P-H---L----ES-----S-A-IAYDL.------------------------
Q69PX0_ORYSJ/530-570------------VLSMV..DRVR-EVL-P-H---I----PD-----E-L-IIEDL.------------------------
A7SP29_NEMVE/363-403------------VEAMA..HQVH-AMF-P-H---V----PI-----N-I-ITEDL.------------------------
A0NBH3_ANOGA/443-483------------VRNMA..RHVQ-EMF-P-R---Y----PL-----S-V-LIGDL.------------------------
HRDL1_CAEEL/433-473------------LQTML..EQVR-EMF-P-Q---M----SV-----D-I-IMTDL.------------------------
AUP1_RAT/297-337------------LTILA..QRVK-EVL-P-H---V----PL-----N-V-IQRDL.------------------------
AUP1_DANRE/305-345------------IARLA..QQVK-EVL-P-D---V----PV-----S-V-ITRDL.------------------------
A7SVC7_NEMVE/299-339------------LLRMA..QQVR-EVL-P-Q---V----PI-----D-V-IQRDL.------------------------
AUP1_CAEEL/306-346------------MDECA..MRIK-QSF-P-S---F----HL-----S-A-IRRDLE------------------------
Q5KMK2_CRYNJ/337-378------------TEDEI..GTLS-AMF-P-N---L----GR-----E-T-IVRALQ------------------------
Q2UU48_ASPOR/479-520------------HNNMV..ETLS-NMF-P-N---L----DR-----D-V-IDDVVK------------------------
A7EMQ6_SCLS1/756-797------------HENVV..ETLA-GMF-P-D---L----DR-----E-I-ISDVVT------------------------
Q6FRP6_CANGA/412-453------------HQETV..ETLT-SMF-P-D---L----DV-----E-I-IEDVCI------------------------
A7TR29_VANPO/415-456------------HMNVF..ESLQ-SMF-P-D---I----EK-----E-I-IEDVCI------------------------
Q6CRC1_KLULA/395-436------------QENTL..QTLQ-LMF-P-D---L----DP-----D-L-IRDVCI------------------------
Q75BB6_ASHGO/370-411------------HREML..QNLQ-GMF-P-D---L----DP-----G-L-IHDVCI------------------------
CUE2_YEAST/56-97------------VDNEL..HQLY-DMF-P-Q---L----DC-----S-V-IKDQFV------------------------
A0DAV7_PARTE/22-65------------RQQQLPPQTLY-DMF-P-S---F----DK-----E-L-IEQCYR------------------------
Q86A70_DICDI/5-46------------FEQAI..EELS-TIF-G-G---F----DK-----E-I-IETVLR------------------------
A2FNQ7_TRIVA/4-45------------YEAAI..EQLS-EMF-P-N---H----QK-----S-T-IASTLR------------------------
Q8SZU6_DROME/8-49------------FSQAM..TDFK-KMF-P-D---I----DR-----E-V-IEAILR------------------------
Q16JC1_AEDAE/9-50------------FAQAM..ADFK-NMF-P-D---M----DR-----D-V-IEAVLR------------------------
CUED1_HUMAN/47-88------------FNQAM..DDFK-TMF-P-N---M----DY-----D-I-IECVLR------------------------
A7S4P0_NEMVE/32-73------------FGSAM..KDFK-SMF-P-E---M----DD-----E-V-IEAVLR------------------------
YR75_CAEEL/21-62------------FDRAM..LDFQ-AMF-P-S---L----SN-----S-H-IEYVLR------------------------
A2EJZ8_TRIVA/9-49------------MSESL..KMLS-EMF-P-A---V----DT-----E-T-IRLML.------------------------
Q2UM38_ASPOR/129-170------------EEDKI..GYLS-EMF-P-S---V----DK-----F-T-IQHALR------------------------
TOLIP_CHICK/230-271------------NEEDL..KSIQ-DMF-P-N---M----DR-----E-V-IRSVLE------------------------
A4RVM3_OSTLU/5-46------------FEESV..IALK-SMF-P-D---L----SE-----V-V-VRATLE------------------------
A3LVI3_PICST/205-246------------YHRDV..YELK-HIF-P-D---H----DF-----E-V-LNQQLQ------------------------
A2EPF6_TRIVA/5-46------------NHSKV..KQLQ-EMF-P-N---R----SI-----E-T-IRRVLL------------------------
Q6CVA0_KLULA/1-42------------MDQHV..ESLG-QLF-P-D---L----PE-----V-K-LRNALT------------------------
Q6FJ08_CANGA/4-45------------DNNLL..MQLA-EMF-P-D---H----RL-----E-T-LARCLE------------------------
A2DJ73_TRIVA/268-309------------RNQGI..KQLL-EIF-P-G---T----DP-----D-F-IATILD------------------------
Q6CVA0_KLULA/50-91------------QTDHV..RELM-SMF-P-N---L----SK-----D-S-IKKALD------------------------
A7SKY0_NEMVE/412-453------------LDSMV..TSVR-DLL-P-E---L----GD-----G-F-VIKCLQ------------------------
Q0CKT2_ASPTN/332-373------------KMSLV..TQVQ-DLF-P-D---L----GS-----G-Y-VVRLLD------------------------
Q7S3G0_NEUCR/343-384------------RMSQI..SQIQ-DLF-P-D---L----GS-----G-F-ISKLLD------------------------
Q16FQ3_AEDAE/441-481------------IEANV..RKVL-DIL-P-D---L----GD-----G-Y-VRKILA------------------------
A7TEC3_VANPO/313-354------------NEEDV..NMLA-ELF-P-I---F----TH-----Y-Q-LSELLV------------------------
CUE3_YEAST/317-358------------NEEQL..SALM-ELF-P-Q---F----SK-----Y-Q-LSQTLL------------------------
Q754U5_ASHGO/313-354------------DKAAL..ATVH-ELF-P-Q---V----TE-----Y-Q-VAQLLL------------------------
Q6CKH8_KLULA/314-355------------NVEQI..DTIK-ELF-P-D---L----TS-----N-Q-ITKLLQ------------------------
Q54MZ0_DICDI/3-44------------TNNEI..STIL-DLF-P-N---L----TI-----K-Q-ATDCLK------------------------
A5DWX4_LODEL/377-418------------KNEDI..SVLM-DLF-P-D---L----DA-----R-K-ARHFLK------------------------
A2CEX4_DANRE/479-518------------.ESLL..SHIR-DLL-P-D---L----GE-----G-F-ILACLE------------------------
AUP1_XENTR/288-327------------.MQMA..QHVK-EVL-P-Q---V----PL-----S-A-IHRDL.------------------------
E7LT08_YEASV/86-124------------...VL..KELK-IAF-P-E---V----DD-----T-L-IKAILI------------------------
E7LYK2_YEASV/64-103------------NSDMV..EIVM-TMA-P-H---V----PQ-----E-K-VVQDL.------------------------
E7QH78_YEASZ/9-49------------HESKL..SILM-DMF-P-A---I----SK-----S-K-LQVHLL------------------------
E7QIN9_YEASZ/67-105------------.TQMV..ETVQ-NLA-P-N---L----HP-----E-Q-IRYSL.------------------------
F1QPQ8_DANRE/61-102------------RDEII..QRMQ-EMF-S-H---L----DP-----E-V-ICMVLS------------------------
F1REE7_DANRE/37-77------------.SQAM..DDFK-TMF-P-S---M----EH-----E-V-IECVLR------------------------
F6T5I7_XENTR/457-497------------.DSLV..SQVK-DLL-P-D---L----GE-----G-F-ILCCLE------------------------
F8W3V1_DANRE/12-51------------..QIL..QDLR-QRF-P-E---I----PE-----T-V-VSQYLL------------------------
H3DD27_TETNG/468-507------------.DSLL..SAIK-DLL-P-D---L----GD-----G-F-LLACLQ------------------------
I1NXY6_ORYGL/54-94------------REALL..HHLL-SLF-P-H---M----DP-----Q-L-LERALE------------------------
K7EV76_PONAB/340-379------------.DSLI..SQVK-DLL-P-D---L----GE-----G-F-ILACLE------------------------
Q0WL28_ARATH/310-351------------MQSKI..SQIK-DIF-P-E---Y----GN-----G-F-LAACLE------------------------
Q4WTH8_ASPFU/65-105------------RQQAE..NTLK-EAF-P-T---I----EA-----S-V-IRAVLV------------------------
Q7RWL8_NEUCR/143-181------------..DKV..ERLR-LVF-P-N---F----KE-----H-T-LKFVLK------------------------
R4GNG2_HUMAN/114-153------------.NAMA..HQIQ-EMF-P-Q---V----PY-----H-L-VLQDL.------------------------

PF00627

I1LWN1_SOYBN/167-203-----------IDEEIL--QEVV-NM.-.-G...F----DR-----N.Q-LVESLS------------------------
OSK3_ORYSJ/291-327-----------IDEDTL--QDVV-NL.-.-G...Y----GK-----D.H-VCESLR------------------------
KIN11_ARATH/294-330-----------INEEIV--QEVV-NM.-.-G...F----DR-----N.Q-VLESLR------------------------
MARK1_RAT/331-367-----------NDAKRI--DIMV-TM.-.-G...F----AR-----D.E-INDALV------------------------
MARK2_HUMAN/324-360-----------KDPRRT--ELMV-SM.-.-G...Y----TR-----E.E-IQDSLV------------------------
MARK3_HUMAN/327-363-----------SDQKRI--DIMV-GM.-.-G...Y----SQ-----E.E-IQESLS------------------------
A0D390_PARTE/179-215-----------YDQAML--EKLV-AM.-.-D...F----EE-----S.A-CKEALI------------------------
Q9VBQ3_DROME/422-458-----------VNPRSI--IRLM-EM.-.-G...Y----ER-----R.L-VVEALK------------------------
LATS1_HUMAN/101-138-----------VNPQML--QDLQ-AA.-.-G...F----DE-----D.M-VIQALQ------------------------
PTH2_CAEEL/129-166-----------VNNEYL--AHLL-DL.-.-G...F----DE-----Y.T-AVLALK------------------------
Q9VXR3_DROME/1468-1503-----------LNADHI--KTLT-DM.-.-G...F----MH-----Y.H-VIEAL.------------------------
Q9VZU7_DROME/696-732-----------ANPESL--AMLM-SM.-.-G...F----DE-----R.Q-AVAALK------------------------
RHP23_SCHPO/146-182-----------QRNVAV--ENMV-EM.-.-G...Y----ER-----S.E-VERAMR------------------------
RAD23_YEAST/147-183-----------ERNETI--ERIM-EM.-.-G...Y----QR-----E.E-VERALR------------------------
Q9V3W9_DROME/158-194-----------EYNQTV--LSMV-EM.-.-G...Y----PR-----E.Q-VERAMA------------------------
RD23A_MOUSE/162-198-----------EYETML--TEIM-SM.-.-G...Y----ER-----E.R-VVAALR------------------------
Q23451_CAEEL/128-164-----------EQEENV--LAIT-GM.-.-G...Y----DR-----E.Q-TIAALR------------------------
RAD23_ORYSJ/157-196-----------NLEATI--QSIL-EM.-.-GGGIW----DR-----D.I-VLHALS------------------------
Q9STA6_SOLLC/154-193-----------NLETTV--QQIL-DM.-.-GGGSW----DR-----D.T-VVRALR------------------------
RD23A_ARATH/145-184-----------SIEQMV--QQIM-EM.-.-GGGSW----DK-----E.T-VTRALR------------------------
RAD23_DICDI/162-198-----------ELEATI--KNIT-DM.-.-G...F----AR-----D.Q-VLRALR------------------------
Q9VCD5_DROME/110-146-----------PNDQWV--SDLM-SM.-.-G...Y----GE-----E.E-VRSALR------------------------
UBP5_HUMAN/723-759-----------PPEDCV--TTIV-SM.-.-G...F----SR-----D.Q-ALKALR------------------------
UBP13_HUMAN/728-764-----------PPEEIV--AIIT-SM.-.-G...F----QR-----N.Q-AIQALR------------------------
UCP12_SCHPO/277-312-----------PDTSIV--NDLI-SL.-.-G...F----RD-----I.H-AKEACQ------------------------
Q9VBQ3_DROME/475-511-----------VDESLL--TTLQ-HL.-.-G...F----SE-----I.S-ARDALE------------------------
UBP14_YEAST/586-623-----------PNQCSI--SQLI-EM.-.-G...F----TQ-----N.A-SVRALF------------------------
Q9SDB9_ORYSJ/250-286-----------PPESSI--AMLV-SM.-.-G...F----DG-----N.A-ARQALM------------------------
UBP5_HUMAN/655-692-----------LDESVI--IQLV-EM.-.-G...F----PM-----D.A-CRKAVY------------------------
UBP13_HUMAN/653-690-----------IDESSV--MQLA-EM.-.-G...F----PL-----E.A-CRKAVY------------------------
Q9VZU7_DROME/629-666-----------FDEAVM--SELL-TM.-.-G...F----PP-----E.A-CKRACY------------------------
P91502_CAEEL/595-631-----------SVRFVA--GELM-LM.-.-G...F----CE-----N.A-CYRAAY------------------------
UBPA_DICDI/629-666-----------FNQEVL--DTLL-SM.-.-D...F----PL-----V.R-CKKALL------------------------
UBS3A_DROME/20-57-----------QHLTPL--QTLL-QM.-.-G...F----PR-----H.R-AEKALA------------------------
Q9VSC5_DROME/1-36-----------MSE..V--QTLM-DM.-.-G...F----PR-----E.R-VEYALE------------------------
UBPA_DICDI/701-737-----------FNSQDV--DNII-GM.-.-G...F----TD-----S.Q-AKLALK------------------------
NUB1_MOUSE/374-410-----------IDPSKV--HNLL-QL.-.-G...F----TA-----Q.E-ARLGLR------------------------
Q9VBQ3_DROME/352-388-----------MNDTEL--STLV-EM.-.-G...Y----EE-----S.D-ARLALR------------------------
Q9VRF3_DROME/353-391-----------INNDQL--ALLV-DM.-.-G...F----EP-----S.E-ARMALR------------------------
UBP14_SCHPO/640-676-----------VSEENV--QSLC-EF.-.-G...F----TV-----A.Q-ARKGLL------------------------
UCP7_SCHPO/183-218-----------SSNEMY--EKLR-DL.-.-G...F----SD-----D.Q-SRLALE------------------------
Q43780_SOLLC/155-191-----------AADDKI--QKLV-EM.-.-G...F----PE-----A.Q-VRSTLE------------------------
UBC27_ARATH/153-189-----------SLEEKV--KRLV-EM.-.-G...F----GD-----A.Q-VRSAIE------------------------
GTS1_YEAST/194-231-----------RYSRQL--AELK-DM.-.-G...F----GD-----TNK-NLDALS------------------------
DSK2_SCHPO/313-350-----------RYAEQL--SQLN-EM.-.-G...F----VD-----FER-NVQALR------------------------
DSK2B_ARATH/508-545-----------RYATQL--QQLQ-EM.-.-G...F----YD-----RAE-NIRALL------------------------
UBQL1_HUMAN/546-583-----------RFQQQL--EQLS-AM.-.-G...F----LN-----REA-NLQALI------------------------
P90879_CAEEL/263-300-----------GYEQQA--ATLR-EF.-.-G...F----EN-----DEL-IQLALE------------------------
RHP23_SCHPO/321-357-----------EESESI--DRLC-QL.-.-G...F----DR-----N.I-VIQAYL------------------------
RAD23_YEAST/356-392-----------EDDQAI--SRLC-EL.-.-G...F----ER-----D.L-VIQVYF------------------------
RD23A_HUMAN/319-355-----------QEKEAI--ERLK-AL.-.-G...F----PE-----S.L-VIQAYF------------------------
Q23451_CAEEL/278-316-----------EEAAAI--ERIK-AIV-V-N...A----PE-----A.V-VVEAYF------------------------
RAD23_DICDI/298-335-----------EESEAI--QRLQ-AL.-T-G...M----DK-----S.T-VIEAYF------------------------
Q9STA6_SOLLC/344-380-----------EEREAI--ERLE-AM.-.-G...F----DR-----A.L-VLEVYF------------------------
Q9VCD5_DROME/245-281-----------EETAAV--GRLE-AL.-.-G...F----ER-----V.M-AVQAYL------------------------
RD23A_ARATH/323-359-----------EEQESI--ERLE-AM.-.-G...F----DR-----A.I-VIEAFL------------------------
Q9VXF9_DROME/409-445-----------FTEQDV--TDLM-AL.-.-G...Y----PR-----S.D-VLTVLR------------------------
NUB1_MOUSE/489-525-----------PSQESI--NQLV-YM.-.-G...F----DT-----V.V-AEAALR------------------------
CBL_MOUSE/863-899-----------QLSSEI--ERLM-SQ.-.-G...Y----SY-----Q.D-IQKALV------------------------
GAWKY_DROME/549-585-----------KQSKQY--RILV-EN.-.-G...F----KK-----E.D-VERALV------------------------
NUB1_MOUSE/430-466-----------RRLENV--NTLR-GM.-.-G...Y----ST-----Q.A-AKQALH------------------------
RHBD3_HUMAN/324-359-----------VSSLRL--QQLE-RM.-.-G...F----PT-----E.Q-AVVALA------------------------
EDE1_YEAST/1341-1377-----------PKSLAV--EELS-GM.-.-G...F----TE-----E.E-AHNALE------------------------
UBE2K_MOUSE/161-197-----------EYTKKI--ENLC-AM.-.-G...F----DR-----N.A-VIVALS------------------------

PF09288

Q6C353_YARLI/158-210----DEIARLGLDRDAV--EGFA-SM----G---F----GK-----D-K-IIAVFKKLQIK-------------------
Q6CSQ8_KLULA/173-227----DEADLYGIDQDLV--TQFV-NQ----G---F----DR-----Q-N-VIEVLKRLNIK-------------------
UBC1_YEAST/161-215----EESDLYGIDHDLI--DEFE-SQ----G---F----EK-----D-K-IVEVLRRLGVK-------------------
Q6FVM7_CANGA/159-213----DEAQLYGIDPEIV--KEFE-SQ----G---F----EK-----N-K-IVEALRRLGVK-------------------
A0A0D1D151_USTMA/174-227----DPILLAGLKREHV--DQFV-NM----G---F----ET-----N-K-VIEALKKLNYR-------------------
Q759V3_ASHGO/157-211----EEAQLYGIDKGLV--DTLV-AQ----G---F----ER-----E-K-VVQALRRLGIK-------------------

PF03474

B4K652_DROMO/130-166-------------QSAI--DMLA-QLF-P-Q---R----KR-----S-V-LELVLK------------------------
G3UKZ4_LOXAF/136-172-------------RPPL--DVLK-KIF-P-N---Q----KP-----T-V-LELILK------------------------
T1KDU7_TETUR/274-308-------------..GI--EMLS-RVF-P-T---Q----KR-----T-I-LELVLQ------------------------
C3YCF3_BRAFL/233-268-------------.SPR--EFLV-RAF-P-H---V----NP-----S-F-LELILQ------------------------
A8X4G6_CAEBR/147-183-------------FSPI--ELLH-TIF-N-E---Q----ER-----H-V-LELMLD------------------------
Q0V986_XENTR/274-310-------------RDPL--EILR-KVF-P-N---Q----KQ-----S-S-LQSILQ------------------------
I3N5R0_ICTTR/319-355-------------RDPL--DILI-RIF-P-R---Y----RL-----T-W-LESVLR------------------------
H2RIW9_TAKRU/200-236-------------RDPT--DIMA-KIF-P-H---H----KR-----D-T-LESMVR------------------------
W5KUC2_ASTMX/234-270-------------RDPV--QILL-KIF-P-H---L----KV-----E-T-VEVTLQ------------------------
G1KXF8_ANOCA/239-275-------------RDPL--DILI-RVF-P-N---H----KQ-----S-R-LAKVLH------------------------
F6YPT9_HORSE/128-164-------------RTPL--DILT-RVF-P-G---P----RR-----G-V-LELVLQ------------------------
B7P132_IXOSC/113-149-------------RSPL--ETLA-RVF-P-S---R----TQ-----A-S-LAAVLD------------------------
D6WS24_TRICA/256-292-------------RSPI--DVLM-RVF-P-G---K----RR-----S-D-VEALLQ------------------------
Q178S9_AEDAE/156-192-------------RSPV--DVLL-RVF-P-N---R----RR-----T-E-VEQLLQ------------------------
B7PCX2_IXOSC/435-470-------------.SPL--STLT-RVF-P-S---H----RP-----G-F-LQLVLR------------------------
K1RAP5_CRAGI/198-234-------------KNPI--EMLQ-RIF-P-H---M----KR-----S-V-LQLILQ------------------------
H3AVL7_LATCH/180-216-------------RTPI--DILT-KVF-P-T---H----KR-----S-V-LELVLQ------------------------
DMRTA_MOUSE/314-350-------------RDPL--GILT-RIF-P-G---Y----KH-----S-R-LEGILQ------------------------
Q18248_CAEEL/144-180-------------FSPI--ELLM-TLF-C-E---H----EK-----H-V-LELVLE------------------------
C3YCF4_BRAFL/285-320-------------.PPI--YTLS-KLF-P-S---H----KT-----D-V-LHLVLK------------------------
J9JUU4_ACYPI/243-279-------------RSAV--DVLR-RVF-P-Y---K----RR-----V-D-IENVLQ------------------------
W5KZ34_ASTMX/208-244-------------RPPL--EVLK-KIF-P-G---H----KP-----A-V-LDLILR------------------------
V8NZ77_OPHHA/110-146-------------RDPL--NILT-KVF-P-N---H----KS-----S-R-LERVLQ------------------------
F6SHF2_CIOIN/285-320-------------RSNL--VMLC-RVF-P-Q---K----NP-----S-E-LETILR------------------------
E0VFK2_PEDHC/93-129-------------RSPV--DILI-RAF-P-N---K----RR-----S-D-IEAVLQ------------------------
B3S3S8_TRIAD/89-124-------------.SPL--NVLY-RVF-P-H---R----NR-----S-F-LQLILQ------------------------
W4XD00_STRPU/320-356-------------RPPI--EVLC-RLF-P-T---Q----KR-----A-V-LELMLQ------------------------
W5N4B2_LEPOC/277-313-------------RDPT--DIMM-KIF-P-H---H----KR-----D-T-LEAVVK------------------------
A7SV97_NEMVE/49-83-------------..AM--NILT-RLF-P-E---Q----KL-----N-V-LELILK------------------------
G6DMI7_DANPL/197-233-------------KSPI--DVLI-KVF-P-R---R----SR-----Q-E-IEAILA------------------------
H3AN28_LATCH/286-322-------------RDPL--AILT-KVF-P-S---H----KR-----A-T-LEAILQ------------------------
W5JJ55_ANODA/54-89-------------QNAL--DMLA-QLF-P-H---R----KR-----S-V-LELILK------------------------
G3R135_GORGO/329-365-------------RDPL--DILT-KIF-P-N---Y----RR-----S-R-LEGVLR------------------------
T1J9X3_STRMM/252-288-------------RNPI--DILA-RVF-P-S---H----KR-----N-F-LQAILN------------------------
E9G633_DAPPU/363-399-------------RVPL--DTLA-RLF-P-Q---T----KR-----A-T-LKSTLD------------------------
B3MTG8_DROAN/378-414-------------RSPI--DVLM-RVF-P-N---R----RR-----S-D-VEQLMQ------------------------

PF08587

U9USK8_RHIID/258-299-----------IDSNIV--TELQ-KKM-.-G---F----SR-----N-T-IYQALQ------------------------
I2H4T8_TETBL/344-389-----------IDNELV--VALS-KTM-.-G---Y----EI-----D-E-IYEALQ------------------------
B6K4E5_SCHJY/289-331-----------VDTKIL--KKLS-ETM-.-G---F----SE-----E-E-VLNALH------------------------
M3D916_SPHMS/360-401-----------IHQSVV--GKLG-KTM-.-G---Y----AA-----D-D-VQEALQ------------------------
SNF1_CANGA/322-367-----------IDDEMV--VTLS-KTM-.-G---Y----DK-----D-E-IYEALE------------------------
E7KM91_YEASL/249-294-----------IDDNLV--NILS-STM-.-G---Y----EK-----D-E-IYESLE------------------------
K0KNS0_WICCF/293-334-----------IDENLI--NILV-KTM-.-G---Y----DK-----N-E-ILETLN------------------------
S7ZEF0_PENO1/367-408-----------IHQIAV--SKLE-RSM-.-G---Y----DR-----E-D-IEDALR------------------------
C5MH31_CANTT/329-386-----------IDEDVI--SALS-LTM-.-G---Y----DR-----D-E-IINVIE------------------------
F0XT12_GROCL/367-408-----------LHDEVT--EKIS-KTM-.-G---Y----GR-----K-D-VQEALE------------------------
M3J3A3_CANMX/335-387-----------IDEDVI--SALN-VTM-.-G---Y----DR-----D-E-IINVIE------------------------
W1QLV1_OGAPD/298-341-----------.SEDVV--NALA-IAM-.-G---Y----SR-----E-E-IIDAIK------------------------
D8PL66_SCHCM/313-356-----------IEENIV--DDLA-SRM-I-G---V----DK-----D-D-IWEALR------------------------
A7TNZ1_VANPO/325-371-----------IDDEAV--TILS-QTM-.-N---Y----EK-----E-E-IHEALK------------------------
U4KV91_PYROM/363-404-----------LHDNVV--SKLG-VTM-.-G---Y----PK-----D-D-IQDALT------------------------
Q6CAK0_YARLI/302-345-----------IDDKVV--GALS-DTM-.-G---Y----DR-----D-Q-VYEALK------------------------
A5E2E8_LODEL/348-397-----------IDEDVI--SALT-ITM-.-G---Y----DR-----D-E-VISVIN------------------------
Q6BPA5_DEBHA/329-378-----------VDEDVI--TALQ-STM-.-G---Y----DR-----D-E-IVNVIN------------------------
D4B296_ARTBC/353-394-----------IHENAV--NKLE-RRM-.-G---Y----GK-----D-D-IQDALR------------------------
G8BR28_TETPH/317-364-----------IDEEAI--DILT-KTM-.-N---Y----SK-----E-E-IYESLQ------------------------
B8MA84_TALSN/374-415-----------IHDFAI--TKLE-HSM-.-G---Y----KK-----E-E-IEDALR------------------------
J7S3J7_KAZNA/333-378-----------IDDDLV--NALS-RTM-.-G---Y----DK-----E-E-IYESLE------------------------
F2Z677_KLULA/321-366-----------IDDSLV--QTLS-NTM-.-G---Y----DV-----D-E-IYEALE------------------------
G0RE22_HYPJQ/314-355-----------LHNEVT--EKIS-KTM-.-G---Y----GK-----D-D-VEEALQ------------------------
G1XP24_ARTOA/334-375-----------LHDNLV--NKLS-DKL-.-G---Y----GK-----D-D-LVDALE------------------------
S6E228_ZYGB2/340-385-----------IDDQLV--TALS-RTM-.-G---Y----DR-----D-E-IYESLQ------------------------
G3B5F5_CANTC/507-556-----------VDEDVL--SALT-HTM-.-G---Y----ER-----D-E-IVGSIN------------------------
A7TDR3_VANPO/325-369-----------INEDLV--DILS-RTM-.-G---Y----EK-----H-E-IYECLQ------------------------
A2QGW4_ASPNC/367-408-----------IHQVAI--SKLE-RSM-.-G---Y----AR-----D-D-IEDALK------------------------
A5DC34_PICGU/311-358-----------VNDDVV--AALS-ATM-.-G---Y----DR-----D-E-ILSVIQ------------------------
I6NE34_ERECY/322-368-----------IDESLV--AILA-KTM-.-S---Y----DR-----D-E-IYEALE------------------------
G8XZL3_PICSO/324-373-----------LDEDVV--SALE-ATM-.-G---Y----ER-----D-E-IVNVIN------------------------
Q5A1R0_CANAL/326-382-----------VDEDVI--RALS-VTM-.-G---Y----DR-----D-E-IVNVIE------------------------
G8BSU9_TETPH/349-401-----------IDDRLV--DALS-KIM-.-G---Y----DK-----N-E-IYNCLR------------------------
V2XGM0_MONRO/313-356-----------IEEDVV--EELA-SRM-Q-G---I----TK-----D-D-VWEALR------------------------
L8G3T2_PSED2/354-395-----------LHDAVT--EKLG-KKM-.-G---Y----GK-----Q-D-VQEALE------------------------
E3REL3_PYRTT/359-400-----------LHENVV--SKLG-KTM-.-G---Y----AK-----H-D-VQDALA------------------------
Q758J2_ASHGO/318-364-----------IDEALV--AVLA-NTM-.-S---Y----DK-----D-E-IYEALE------------------------
B8PHJ5_POSPM/106-149-----------IEEDVV--DELA-TRM-E-G---V----DK-----D-D-VWESLR------------------------
G3AP00_SPAPN/325-374-----------IDEDVI--KALS-MTM-.-G---Y----DR-----D-E-IINVIE------------------------
G8B9P1_CANPC/350-399-----------IDEDVI--RALN-VTM-.-G---Y----DR-----D-E-IINIIT------------------------
V5FGW2_BYSSN/369-410-----------IHRTAV--AKLE-RSM-.-G---Y----AK-----E-D-IEDALK------------------------
M7PGS8_PNEMU/302-343-----------VDDKIV--GKLG-QAM-.-G---Y----NK-----D-H-VYEALA------------------------
C4Y9B9_CLAL4/313-362-----------IDNDVV--DALT-MTM-.-G---Y----DR-----D-E-ILNVIN------------------------
C4R0X9_KOMPG/289-334-----------VDDDVI--HALS-VAM-.-G---Y----DK-----Q-E-ILDAIR------------------------
C5DM37_LACTC/317-362-----------VDDSLV--TMLS-KTM-.-G---Y----DR-----D-E-IYEALE------------------------

PF07223

I1HCE2_BRADI/569-613------------IDDVV--EKVS-TM----G---F----SR-----E-Q.VRATVRRLT---------------------
B9RAX3_RICCO/444-488------------VDDVV--DKVV-GM----G---F----RR-----D-T.VRATVKKLT---------------------
U5FQ46_POPTR/336-380------------VDDVI--DNVA-AM----G---F----HR-----D-L.VRETVIKLM---------------------
C5YVI7_SORBI/466-509------------V.DIA--EKVA-RM----G---Y----SK-----D-Q.VEGLALRMV---------------------
A0A096QE33_MAIZE/467-511------------I.GIA--DKVA-RM----G---Y----PK-----D-QVVDGLALRMV---------------------
I1HGG6_BRADI/483-526------------V.DMA--DKAA-RM----G---Y----LN-----D-Q.VESMAPRMV---------------------
M7ZY27_TRIUA/607-650------------A.DMA--DKAA-RM----G---Y----LN-----D-H.AENMPRRMV---------------------
I1HQA0_BRADI/484-528------------FGNMF--ETGS-VV----G---Y----PQ-----D-R.VGSMTLPVV---------------------
U5FYB8_POPTR/477-521------------YNDLI--EKLV-NM----G---F----RG-----D-H.VVSVIQRME---------------------
K7M2P3_SOYBN/486-530------------YNDLI--EKFV-SM----G---F----RG-----D-H.VANIIQRME---------------------
B9RVZ9_RICCO/483-526------------YSELI--DKLV-SM----G---F----RA-----E-H.IVGVIQRME---------------------
K4CY11_SOLLC/491-535------------YNELI--EKLA-SM----G---Y----RG-----D-H.VVNVIQRLE---------------------
M4D1M6_BRARP/439-483------------YGELI--EKLM-SM----G---F----RG-----D-H.VMAVIQRME---------------------
B9DHK3_ARATH/483-527------------VDDVI--DKVV-SM----G---F----PR-----D-Q.VRGTVRTLT---------------------
M1AY29_SOLTU/488-532------------IDDVV--DKVT-NM----G---F----PR-----D-Q.VRATVRRLT---------------------

PF16577

W5N0C3_LEPOC/377-436EAALYPHLPQDADPRLV--ESLA-QML-SMG---F----TD-----EGGWLTRLLH------------------------
F6VD69_MOUSE/48-109EAALYPHLPPEADPRLI--ESLS-QML-SMG---F----SD-----EGGWLTRLLQ------------------------

PF06972

B9S9X5_RICCO/30-90--------IPETVRKTI--LSIR-EIT-GKQ---H----TD-----E-D-IYSVLK------------------------
F4JQR9_ARATH/15-73--------VPASSRKVI--QDLK-EIV-E..---C----SE-----L-E-IYAMLV------------------------
GIP1_ARATH/14-74--------IPADLLQTI--QNIR-EVT-GKQ---H----SD-----E-D-IFSVFK------------------------
M1C0W5_SOLTU/10-69--------IPSNVRKTI--DDIK-EIA-AGK---H----TD-----E-D-IYAMLK------------------------
GIP1L_ARATH/13-73--------IPYHLRKTL--QKIR-EYT-GKQ---H----SD-----E-D-IFAVYK------------------------
B9GG04_POPTR/13-72--------IPKNVKKTI--QSIR-EIT-GKQ---H----SD-----E-D-IYSVLQ------------------------
M0S185_MUSAM/10-70--------IPAGVRRTI--QNIK-EIA-GN.---H----SD-----E-E-IYAMLK------------------------
M4DWX6_BRARP/6-60--------...SVQKMI--QSLK-EIV-N..---C----SD-----S-E-IYTMLV------------------------
I1HG05_BRADI/32-91--------.PPASRKLV--QGLK-GDP-WPT---A----PR-----P-K-IYATLL------------------------
D7MRX5_ARALL/109-167--------VPVDFKEVV--QNVQ-EIV-K..---C----SE-----E-E-TKKMLV------------------------
D8QZ59_SELML/24-84--------IPASARKVV--QNLK-EVV-GVG---H----GE-----E-E-IFATLK------------------------
K4DFK4_SOLLC/17-73--------...GVREIL--ESIK-EVV-GN.---H----SD-----A-D-IYVTLK------------------------
E1Z2G3_CHLVA/20-73--------....PKKII--DSIK-EAT-G..---A----QE-----E-E-ISAMLA------------------------
D7L2B1_ARALL/16-74--------.DDESKKMI--QSIK-EIV-GN.---H----SD-----A-D-IYTALK------------------------
K7VTF9_MAIZE/24-83--------VPAASRKMV--QSLK-GIL-AD.---R----SE-----G-E-IYATLC------------------------
M0SCQ0_MUSAM/14-73--------VPLRIQKTI--QSIK-EIV-GN.---H----SD-----A-D-IYAVLK------------------------
B9GT31_POPTR/14-74--------IPGASKKVV--QNIK-EIV-NKN---C----TD-----A-E-IYSVLC------------------------
K7LDS8_SOYBN/21-79--------IPVSSRKMV--QSLK-EIV-SN.---F----PN-----H-K-IYATLK------------------------
K3Z3T8_SETIT/15-73--------VPAGSRKLV--QSLK-EIV-N..---R----PE-----A-E-IYAALR------------------------
D7L6N2_ARALL/10-70--------IPASTRKTI--QNIK-ETT-AGN---Y----SE-----D-E-ILAMLH------------------------
U5D0R9_AMBTC/13-72--------IPSSVRKMI--QNIK-EIA-GN.---H----HD-----D-E-IYAMLK------------------------
A9RRL8_PHYPA/13-72--------IPASTKKVV--QDLK-EVV-GN.---.----SE-----E-E-IYAMLK------------------------
D7TD97_VITVI/10-69--------ISSSMREVI--QNIK-EVT-GD.---H----TE-----E-E-IYAMLK------------------------
D7UAL3_VITVI/18-77--------IPKDARKMV--QDIK-EIA-RK.---H----SD-----E-D-VYAMLQ------------------------
K7LA00_SOYBN/25-80--------...AEKEMV--QCVK-EIV-N..---C----TE-----C-E-IYAALE------------------------
I1IIY7_BRADI/8-67--------IPAAVRRTI--QNIK-EIA-GG.---H----TD-----E-E-VYAALR------------------------
U5FVE0_POPTR/27-85--------IPAASRKMV--QSLK-EIV-N..---C----PE-----P-E-IYAMLK------------------------
K7M4A9_SOYBN/15-75--------IPNNVRKII--QDIR-EIT-GKQ---H----TD-----D-E-IYAVLR------------------------
C5Z6C7_SORBI/28-86--------.TAAIQTTI--QSIK-EVV-GG.---H----SD-----A-D-ILDTLR------------------------
D7MRX5_ARALL/30-88--------IPENSREIV--QAMK-EIV-.N.---C----SE-----Q-E-IYDMLV------------------------
B9GTE9_POPTR/10-69--------IPGNVRKTI--QNIK-EIT-GN.---H----SD-----E-E-IYAMLK------------------------
M4EF18_BRARP/15-72--------..DGDRKLI--ESIR-EIV-GN.---H----TD-----A-D-IYAALK------------------------

PF07499

RUVA_FRATT/167-212----------SIFNESV--DALL-AL----G---Y----KQ-----K-D-AEKMARSAM..-------------------
RUVA_ACIAD/155-200----------SPIAEAE--AALQ-SL----G---Y----KP-----I-E-AQKAIAAVK..-------------------
RUVA_PHOPR/161-206----------RAEDEAV--SALI-AL----G---Y----KA-----L-Q-AAKVVSQVV..-------------------
RUVA_CLOAB/156-200----------KKLEEVR--FALN-SL----G---Y----SE-----K-E-TDRAINNV...-------------------
RUVA_MYCPE/158-208----------NPVPDLV--SALK-AL----G---Y----KK-----N-M-IEKAINLLIPQ-------------------
RUVA_MYCPU/144-188----------QNISDAT--ETLK-ML----G---F----KR-----E-Q-IKYALESA...-------------------
RUVA_CLOB8/153-197----------MALSEAL--SALI-AL----G---Y----SE-----K-E-AESVLKKI...-------------------
RUVA_CHLPB/151-198----------SMRDDAV--NALV-TL----G---F----LR-----S-V-AQKAVTESLT.-------------------
RUVA_THIDA/145-189----------GASDDVR--QALL-AL----G---Y----NE-----R-E-TAATVREL...-------------------
RUVA_IDILO/160-205----------DARTDAI--SALQ-SL----G---Y----KE-----N-Q-AEKALQKVY..-------------------
RUVA_DECAR/146-190----------DSKQDIS--NALL-AL----G---Y----NE-----K-E-AASAMKQL...-------------------
RUVA_CHLL7/151-198----------GIREDAT--NALL-TL----G---F----SR-----T-A-AQQAVAGVLE.-------------------
Q6KI20_MYCMO/150-194----------KKITELS--NTLK-TL----G---F----KT-----N-Q-INYAISNI...-------------------
RUVA_CORJK/161-211----------DVREQVL--EALV-GL----G---F----TE-----S-K-AGTTIEAVLSQ-------------------
RUVA_CHLTE/151-198----------QLNEDAL--AALM-TL----G---F----PK-----P-A-AQKAISGILE.-------------------
RUVA_DESAG/151-198----------SVLRDAV--QALG-NL----G---Y----AE-----E-E-AAPVLKNILK.-------------------
RUVA_SALRD/153-201----------EARADAL--EALT-EL----G---L----SK-----A-D-AERSIRQVLRD-------------------
RUVA_CLOTE/152-196----------LHSAEAL--EALM-SL----G---Y----SQ-----K-E-SEKALKNV...-------------------
RUVA_NITOC/154-199----------GTVAEAV--SALV-AL----G---Y----KP-----N-E-ASRAVRRLD..-------------------
RUVA_NITMU/150-194----------TMGSDVL--NALL-SL----G---Y----ND-----R-E-ANWAVSQL...-------------------
RUVA_CAUCR/156-204----------APTGDAV--AALM-GL----G---V----AE-----V-N-ARRVVEAAAAE-------------------
RUVA_STRAW/149-200----------GWREQLH--AALI-GL----G---Y----AT-----R-E-ADEAVAAVAP.-------------------
RUVA_GEOMG/152-198----------EVADDVA--SALV-NL----G---Y----KE-----A-V-VRKVLAEMAI.-------------------
RUVA_CORDI/153-200----------AVQEQVL--EALV-GL----G---F----SE-----K-I-ALPVLSRVLR.-------------------
RUVA_OCEIH/153-200----------EVYSEAM--EALK-AL----G---Y----TD-----K-E-VKQVLPHLKK.-------------------
RUVA_ECOLI/158-203----------DAEQEAV--AALV-AL----G---Y----KP-----Q-E-ASRMVSKIA..-------------------
RUVA_HELPY/138-182----------PARNEVF--LALE-SL----G---F----KS-----A-E-INQVLKTL...-------------------
RUVA_SYNPX/151-201----------PVAPDLI--ATLE-TL----G---F----ET-----H-E-IRDALQRLNGM-------------------
RUVA_SYNY3/159-209----------ALLEDLE--MTLL-AL----G---Y----TQ-----T-E-IQQAIAMVSQ.-------------------
RUVA_HAEIN/159-204----------SSSDEAI--SALI-AL----G---Y----KP-----V-E-AEKMVKRVA..-------------------
RUVA_BIFLO/152-205----------TGTEQVV--EGLI-SL----G---W----RQ-----Q-D-AQQAVAEACAE-------------------
RUVA_PSEHT/160-205----------NAADDAV--SALV-SL----G---Y----KL-----P-Q-AQKAVKSVS..-------------------
RUVA_SYNE7/156-206----------AVQEDVE--MTLL-AL----G---Y----NN-----R-E-ILQALTAIAQ.-------------------
RUVA_PELCD/150-196----------DLREDAL--SALV-NL----G---Y----KE-----N-L-SRKALDGIDT.-------------------
RUVA_BACSK/151-196----------PQLEDAL--EALR-AL----G---Y----VE-----K-E-LKKVEKQLK..-------------------
RUVA_LACAC/147-193----------PALNDAL--LALI-AL----G---Y----TQ-----K-E-VDRITPKLVE.-------------------
RUVA_COREF/155-202----------VVVDQVT--QALT-GL----G---F----TE-----K-Q-ADDAVAAVLS.-------------------
RUVA_CALS8/150-195----------EKLEEIS--LALL-SL----G---Y----EI-----D-E-INQVLSSED..-------------------
RUVA_TROWT/144-191----------DRSAEIV--QALI-GL----G---W----QR-----Q-E-SAAAVESVLE.-------------------
RUVA_BDEBA/148-192----------VAHTQIT--SALL-NL----G---Y----KS-----Q-L-VDQFVSSL...-------------------
RUVA_SULDN/143-186----------LAVAQAS--EALE-SL----G---F----KK-----D-K-ISKALGSC...-------------------
RUVA_CARHZ/148-194----------DLWGDVY--KGLL-SL----G---L----SA-----A-E-AREILGKIDKK-------------------
RUVA_HAEDU/156-201----------DASEEAR--DALL-AL----G---Y----KL-----T-D-AEKMIKKVH..-------------------
RUVA_LEIXX/150-200----------SVSDSVL--VALV-GL----G---W----PE-----K-V-AGEAVAEVIAG-------------------
RUVA_ZYMMO/163-211----------NFMADAV--SALL-NL----G---F----KP-----A-E-AQRVVQLASEE-------------------
RUVA_UREPA/142-190----------NWAKELS--IGLE-NL----G---Y----TK-----K-D-IEYAITKVKIN-------------------
RUVA_ALKMQ/148-193----------KNNNEVV--DALM-AL----G---Y----TK-----H-E-GEQAASAVR..-------------------
RUVA_CLOTH/155-200----------SKMAEAV--SALM-VL----G---Y----SP-----A-E-ANKAVSAVY..-------------------
RUVA_HAHCH/156-201----------SHLEEAE--AALL-AL----G---Y----KP-----Q-E-ASRAINAVN..-------------------
RUVA_MYCLE/149-200----------AVRGSVV--EALV-GL----G---F----AA-----K-Q-AEEATDQVLD.-------------------
RUVA_LACPL/152-201----------GALADAL--AALE-AL----G---Y----SK-----A-D-VKKVTKKLETF-------------------
RUVA_MAGSA/159-207----------GRMEDAV--SALV-NL----G---Y----KR-----L-E-AFQAVGETARE-------------------
RUVA_COXBU/152-197----------QPTQDAI--SALM-AL----G---Y----KP-----Q-E-AKRAIDAIQ..-------------------
RUVA_CLOPE/156-200----------FNINETL--SALM-AL----G---Y----TE-----K-E-AQKALEKV...-------------------
RUVA_SYMTH/155-203----------DAWAEAS--EALI-AL----G---Y----SR-----G-E-AAAALARVRAE-------------------
RUVA_METCA/155-200----------DPADEAV--SALI-AL----G---F----KP-----Q-E-ANTLVARQA..-------------------
RUVA_MOOTA/149-197----------GDNDEAL--AALL-AL----G---Y----SR-----E-E-IGPILARVRQE-------------------
RUVA_THICR/155-199----------NQKASAV--EALI-SL----G---Y----KT-----A-Q-ADKMVQAV...-------------------
RUVA_BACSU/154-200----------TALEEAL--EALR-VL----G---Y----AE-----K-E-IKKVLPHLKE.-------------------
RUVA_LACSS/155-201----------PELSDAL--AALS-AL----G---Y----SA-----R-E-VKAITPKLTD.-------------------
RUVA_COLP3/166-211----------DNKGDAI--NALL-SL----G---Y----KQ-----V-Q-ADKAVKSVY..-------------------
RUVA_RHOS4/174-221----------SHTADAL--SALA-NL----G---Y----QP-----T-D-AAQAVAQAAG.-------------------
RUVA_NEIG1/149-193----------DETEDIV--STLL-AL----G---Y----NE-----R-E-AKAAVKGV...-------------------
RUVA_CHLCH/153-200----------QLRDDAI--TALV-TL----G---F----PR-----A-A-AQKTVTSLLD.-------------------
A6WCH9_KINRD/154-207----------ARREQVV--EALV-GL----G---Y----PL-----K-H-AGDVVDVVVGA-------------------
RUVA_PROAC/150-200----------PWREQVA--EGLV-GL----G---W----ST-----K-D-AEKAVDKVVA.-------------------
RUVA_PELPB/151-198----------LLRDDAV--NALV-TL----G---F----SR-----I-I-VQKAVVAILE.-------------------
RUVA_WOLSU/143-186----------PVFEESR--LALE-SL----G---F----KS-----E-L-IAKALQNI...-------------------
RUVA_GLOVI/155-203----------RVYEEVE--LALL-AL----G---F----AP-----G-E-VVRALDAV...-------------------
RUVA_HELHP/153-196----------NLKYEAS--LALQ-SL----G---F----KR-----N-E-IQKVLEHI...-------------------
RUVA_DEHM1/146-192----------EANSDIL--ATLT-AL----G---Y----SA-----G-E-AAKAIASLED.-------------------
RUVA_GLUOX/152-199----------SVENDAL--LALA-GL----G---F----RR-----A-E-AWPVLSKVLA.-------------------
RUVA_EXIS2/149-194----------AELNEAC--EALT-AL----G---Y----SE-----R-E-VEKVKKALQ..-------------------
RUVA_MYCPN/149-195----------NDYDEMF--DTLK-SL----G---Y----KP-----Q-D-IQNALSKIEI.-------------------
RUVA_RHORT/162-208----------DVLGDAV--SALV-NL----G---Y----GR-----S-E-AVGAASRAA..-------------------
RUVA_STRP1/151-196----------TQLDEAI--EALL-AL----G---Y----KA-----K-E-LKKIRAFFE..-------------------
RUVA_CYAA5/160-209----------.ILEDIE--MTLL-AL----G---Y----TN-----E-E-INKAISTLSQD-------------------
C5AB30_BURGB/148-191----------.HAADIL--NALL-AL----G---Y----SE-----K-E-ALAAIKNV...-------------------
I3TYC8_ENTFC/70-115----------.ALSEAM--EALS-AL----G---Y----SD-----R-E-IKRVEKQLKE.-------------------
K9QJ68_9NOSO/157-206----------.ILEEVQ--MTLF-AL----G---Y----TA-----H-E-VSHALHVVSE.-------------------
RUVA_STAA8/155-197----------..VQEAM--LALE-AL----G---Y----SK-----R-E-LAKVEKTLNK.-------------------
RUVA_BRUA2/157-204----------.PVADAV--SALS-NL----G---Y----SR-----D-Q-AANAVAAALKE-------------------
RUVA_LEGPH/154-197----------..QQEAI--SALE-AL----G---Y----KP-----Q-E-AWKVMNKID..-------------------
RUVA_PSEPK/158-202----------.AEADAV--SALV-SL----G---Y----KP-----Q-E-ASKAIAAIKD.-------------------
RUVA_XANCP/148-191----------DAVSEAT--VALQ-QL----G---Y----KP-----A-E-AARMAREAG..-------------------
RUVA_FUSNN/145-190----------DMLEDLV--LALE-GL----G---Y----NK-----K-E-IDKTLEKIDL.-------------------
RUVA_LISMO/155-199----------.QLEEAV--LALE-AL----G---Y----ST-----R-E-LKKVIPKLAK.-------------------
RUVA_THET8/145-190----------.AAEEAV--MALA-AL----G---F----KE-----A-Q-ARAVVLDLLA.-------------------
RUVA_THEMA/144-186----------...HESL--EALV-SL----G---Y----PE-----K-Q-AREAVKQVY..-------------------

PF16678

E7F0V6_DANRE/453-616-------LMKEDGLKLI--QLIR-EGE-KKG---V----SP-----E-E-VYTSMRVSGNSN....VTPYDWLKTELPHV
H2ZW95_LATCH/495-644-------QMRARGQKLV--QMIR-EGE-KNG---V----SP-----E-D-VYCAVRYSGTE......VPVQWLRTELPHV
M3ZQS2_XIPMA/503-650-------TMREDGLVLI--HQIR-EAE-KRG---V----SP-----E-E-VYAALSMCGGSS....INPCDWLTSELPHL
L7N3X7_XENTR/417-563-------RLREDGAKIV--ALIR-EGE-KYG---V----LP-----E-E-VCSAIRYSGTE......VPQWWLQTELPYV
H3CTG2_TETNG/446-592-------TMKEDGRNLI--HQIR-EAE-TCG---I----SP-----E-E-VYAAI.VCSGNS....IKPCDWLKSELPHL
W5L3N4_ASTMX/453-628-------LMREEGLKLI--QMIR-EGE-MKG---V----SP-----E-E-LYTSLRVSGGSSSSISGTPCDWVITELPHR
H2LH73_ORYLA/407-560-------RMKEEGEKLI--HLIR-DGE-KRG---L----SP-----E-E-VYTSMKVSEESC....NLSSKWLKMELPLL
K7IZK9_NASVI/23-173-------SLTRQGLELV--QVLR-EAE-RRG---F----SA-----D-D-IQVALAQDPA.......NPLDWLRNQWPHL
G3PPR4_GASAC/433-581-------RMKEEGLKLI--QLIR-DGE-KKG---V----SP-----E-E-VYTSRRAAGDSS....ILPCKWLKTELPLL
H2MDV5_ORYLA/481-633-------KMMEDGLALI--QQIR-EAE-KRG---V----SP-----E-E-VYAARFLCGGSN....VNPCDWLTSELPHL
C3XU40_BRAFL/1055-1204-------DMRTEGLQMI--KWFR-EAE-HAG---F----LP-----E-E-VQAALFHCENG......NPVNWLKENWQEL
T1HCE2_RHOPR/136-283-------...TQGLEMV--KLLR-DAE-ENQ---F----TA-----D-D-LAVALTHCEDE......DPILWLQQNWRNM
B4JB90_DROGR/979-1128-------..RDPEIEMH--IILK-ELE-LYK---F----TV-----E-E-LEAALKYCGPDM.....HPIQWLRENWHKL
T1JM07_STRMM/128-278-------KMRTQGFELV--RLLR-EAE-QNN---F----AA-----D-D-LQIAMSHCG.NQ.....NAVQWLQENWKNM
G7P9X8_MACFA/483-627-------KMREEGLQLV--SMIR-EGE-AAG---A----CP-----E-E-IFSALQYSGTE......VPLQWLRSELPYV
E2BUD1_HARSA/1129-1278-------TLTRQGLEVV--ELLR-DAE-RQG---F----TT-----D-D-VQVALAQGAA.......NPLDWLRTQWPHL
I3JHL5_ORENI/463-610-------MMKEDGLALV--HHIR-EAE-KRG---M----SP-----E-E-VYAALCACGGSN....VNPCDWLTSELPHL
W5LG34_ASTMX/53-208-------HMREDGLKLL--HQLK-EGE-KRK---L----YP-----E-E-VCAAFQMSNGS......NCFDWLQSELPHL
A7RQ03_NEMVE/425-572-------EMLIEGRRYV--DLLK-TAE-INN---F----LP-----E-E-LNIAITLSEGME....MGPIEWLKTKWFDL
I1E6J1_AMPQE/32-175-------KIKEDGQFFM--HWLK-ECT-PFG---F----SP-----E-E-VQIALKRSPK.......DPLHYLQNKWLEI
W5JDH8_ANODA/747-897-------SIKEEPSEMT--LLLR-EAE-RYQ---F----TA-----E-E-LQAAMNHCGEK......HPVQWLRDNWNKL
K1RET9_CRAGI/1065-1218-------LMDIEAKELV--GFFK-EAE-KEG---F----DT-----D-E-GELAVEMCVRDQ....LLPLQWLKQIWMKR
H9G897_ANOCA/403-553-------KLREDGQKMI--AMIR-EAE-AVG---V----AP-----E-L-VAAALRYSGAE......RPLAWLNSELPSV
H2TJL2_TAKRU/388-536-------QIKEDGLKLI--QLIR-EGE-KKG---M----SP-----E-E-VYMSIRVTGDRI....NLPFKWLKVEFPLL
I3JGL0_ORENI/429-574-------LIKEEGLKLI--QLIR-HGE-KKG---V----SP-----E-E-VYTSMRVAGDSN....ILPCKWLKTELPLL
G3NA67_GASAC/402-550-------MMRDDGLRLV--QQIR-EAE-KRG---V----SA-----E-E-VYAAIGMCGGSNT...TSPCDWLTSELPHL

PF10440

M4EY20_BRARP/4-60--------NA....HIK--KAIT-AMK-ALG---I----EE-----A-Q-IKPVLKNLLA.LYDKK.....WDLI-----
W5ATU1_WHEAT/4-64--------SKVCKERFD--AAVT-YLG-AIG---I----QR-----E-T-VSPVLTNLLD.LYDHN.....WEFI-----
J3M322_ORYBR/4-63--------.KSNTERAR--RALD-AMK-QLG---F----SK-----K-E-ATPVLKNLLR.LFGNN.....WEPI-----
Q1PFN1_ARATH/10-69--------KNIGLRRED--AARD-RMK-EFG---F----KK-----P-V-INASIKQVLK.VYGEDQ....WFLI-----
F4K7E7_ARATH/4-60--------NL....HIK--KAFM-AMR-AMG---I----ED-----A-R-VKPVLKNLLA.LYEKN.....WELI-----
I1N9U3_SOYBN/4-60--------NP....RVV--AAFM-AMS-NLG---I----HE-----S-K-VKPVLKKLLK.LYDKN.....WALI-----
K3ZX78_SETIT/9-70--------.RKGDRRID--AAID-HFA-PMG---Y----TA-----R-Q-VRTAVNALLK.EYLGAAA...WPFL-----
W5GKU5_WHEAT/6-64--------..IFDEKFE--AAVA-KLD-VIG---I----AR-----K-T-VSPVLTKLLE.LYDYN.....WEYI-----
K3YYH3_SETIT/4-59--------PNALAERFN--DAVR-SMT-RIG---F----QK-----E-T-VVRVLKKLLK.TYDGN.....WEHI-----
I1IBN5_BRADI/131-191--------SKVSLERFE--AAVT-SMH-AIG---I----QS-----E-T-VTPVLENLLK.LYDYN.....WEYI-----
F4J3N8_ARATH/25-82--------...KDEKVL--KALE-RTR-QLD---I----PD-----E-K-TMPVLMKLLE.EAGGN.....WSYI-----
B9SLL2_RICCO/7-68--------PKVGLKRID--AALD-ALR-PMG---F----SP-----D-L-IRKTVQSLLK.AYGGDEG...WPFL-----
K3ZX65_SETIT/6-67--------PKRGERRID--AAID-HLA-EYG---F----PK-----P-R-IRKIINNLLQ.LYGRD.G...WVFL-----
I1IXS9_BRADI/4-65--------RRSRVGRMD--AAID-HFT-PMG---Y----KE-----T-Q-VRSVVNSLLK.VYG.NDG...WPLL-----
J3MVL2_ORYBR/7-68--------PKKGGGRID--AAID-HFT-PMG---Y----AK-----P-D-IRAVVKQLLK.LYG.DDG...WPFL-----
I1I063_BRADI/3-61--------..SNNERFK--KAFE-AMK-PLG---I----SK-----K-Q-MKPILRHLYN.LFDKN.....WEPI-----
M4CLA6_BRARP/8-69--------KKAGLTRAD--AARD-AMR-AFG---F----AE-----R-L-INVCIKELLE.VYGEGG....WFLI-----
I1IKP9_BRADI/4-69--------RRSSAGRMD--AAID-HFT-PMG---Y----NK-----A-Q-VRSVVNTLLK.VYGTEDGKQPWALL-----
SUVR1_ARATH/4-60--------NL....RIK--KACD-AMK-LLG---I----SE-----T-K-TRAFLRKLLK.TYENN.....WDFI-----
D7KPU3_ARALL/7-68--------KRIGLRRQD--AARD-RMK-EFG---F----DK-----R-V-INESIKQVLK.VYGEDQ....WFLI-----
C0PJG3_MAIZE/4-61--------...NKERAK--KALN-AMK-LLG---F----SK-----K-Q-ATPVLKELLN.IFNNN.....WEPI-----
W5BBI8_WHEAT/6-65--------.GNRNVRAR--RAVK-AMK-LLG---I----PR-----E-Q-TAPVLKRLIE.LYDDN.....WQLI-----
K3ZWZ7_SETIT/12-73--------.GRGDRRID--AAID-HFA-AMG---Y----AA-----R-D-IRDAIADLLK.VYGGPSA...WPLL-----
M4FGG9_BRARP/331-388--------...TDERVR--KACE-TTR-ELK---I----PD-----E-K-TLSVLKKLLQ.ENGEN.....WTLI-----
K7LZD4_SOYBN/4-64--------TPSQKERAL--AACR-AMS-SLG---I----DD-----S-K-VKSVLKKLLK.VYDKN.....WELI-----
K4CW89_SOLLC/4-62--------NS..KSRVT--KAFE-AMK-VFG---Y----SE-----T-V-VKPVLRNLLN.LYNKN.....WKLI-----
Q6K9F7_ORYSJ/20-80--------PKISKDRFD--AAIR-AMA-DIG---I----LK-----E-T-AAPVLNNLLN.LFDYN.....WVHI-----
I1H6C5_BRADI/4-61--------PNISPEKFD--LAIR-TMN-GLG---I----SR-----E-T-VSPVLNNLLE.LYDYN.....WEHI-----
J3MVL1_ORYBR/35-95--------TKKGERRID--AAID-HFI-PMG---Y----AT-----S-D-IQTVIKQLLE.VYG.KDG...WRFL-----
F4IG36_ARATH/8-68--------KKAGLMRED--AARD-RMR-GFG---F----HE-----H-V-ISESIKELLE.VYEDQ.....WFLI-----
W1PPN1_AMBTC/10-70--------..SGSRRVD--AAID-ALL-PFG---F----SK-----S-T-ITCTVNKLLK.VYGGDSG...WLFI-----
K7N559_SOYBN/7-69--------PKKGESRMD--AALD-AMK-PYG---F----PN-----R-L-VRTTVNSLLK.VYGGNGG...WFFI-----
C5WT72_SORBI/6-67--------PERGERRID--AATD-HLA-QYG---F----AK-----P-Q-IRNVIHDLLQ.VYGRE.G...WPFL-----
M0X9W3_HORVD/7-68--------.RGGEKRMD--AAID-HFA-IMG---Y----RS-----A-D-VRSVVNRLLRDVYG.KDG...WPFL-----
M4F4K4_BRARP/4-60--------NT....HVK--RAFK-AMN-DLG---I----TD-----A-Q-VKPVLKNLLT.LYDKN.....WELI-----
C5X350_SORBI/8-71--------PRKGDRRID--AAID-HFT-VMG---Y----AA-----R-D-VKAVVTDLLK.VYGGPDA...WPLL-----

PF09145

Q6CVQ6_KLULA/133-176------------LVDEVKDMEIA-RLM-SLG---L----SF-----D-K-AVHYYD------------------------
Q74Z54_ASHGO/119-160------------IADEEQDFELA-KLM-SLG---L----DI-----G-A-ANDYYH------------------------
C5E3M8_LACTC/99-142------------VVDEVKDMEIA-RLM-SLG---L----DW-----D-K-AAEYYE------------------------
G0VH00_NAUCC/125-168------------VVDEVKDMEVA-RLM-SLG---L----SI-----D-E-ANDHYD------------------------
G0W8I1_NAUDC/144-187------------IVDEVKDMEVA-RLM-SLG---L----SI-----D-Q-ANKYYD------------------------
C5DVX5_ZYGRC/116-159------------LVDEVRDMEVA-KLM-SLG---Y----SI-----D-G-ANTSYE------------------------
I2H7Y1_TETBL/216-257------------VVDEVKDMEIA-KLM-SLG---L----SI-----D-K-AHMYYN------------------------
H2AS28_KAZAF/124-167------------VVDEVKDMEIA-QLM-SLG---L----SI-----E-K-ANSYYS------------------------
J8Q0V5_SACAR/133-176------------LVDEVEDMEIA-KLM-SLG---L----SI-----E-R-ATELYK------------------------
Q6FRN9_CANGA/130-172------------VIDEVRDMELA-KLM-SLG---L----NI-----D-K-ASSYYE------------------------
SWA2_YEAST/138-181------------LVDEVKDMEIA-RLM-SLG---L----SI-----E-E-ATEFYE------------------------

PF03943

Q5KB75_CRYNJ/635-681--------------SLI--SQIS-SRT-G-----M----NA-----Q-Y-AGMCLV------------------------
B4L4P1_DROMO/624-672--------------QMV--QAMS-AQS-Q-----M----NL-----D-W-SRKCLE------------------------
G0SET4_CHATD/604-651--------------QLI--AEVS-RRT-G-----M----NV-----E-Y-SQMCLT------------------------
K1XEL3_MARBU/737-782--------------.MA--TQLT-EQT-G-----M----TM-----E-Y-SGMCLE------------------------
G3JJS3_CORMM/652-697--------------.MV--AELC-KQT-G-----M----TP-----Q-Y-SEMCLT------------------------
G7YY76_CLOSI/94-140--------------..L--RELS-VTT-G-----M----NE-----A-Y-AWQCLS------------------------
W5LZ72_LEPOC/466-514--------------EML--NAFS-LQS-G-----M----NL-----E-W-SQKCLQ------------------------
G1SY35_RABIT/513-561--------------ELE--QAFS-SLS-G-----M----KF-----E-W-CRKCLE------------------------
L5MHV8_MYODS/691-739--------------EMV--QIFS-IQS-G-----M----KP-----Q-W-SQMCLQ------------------------
E3L9C5_PUCGT/608-656--------------ELI--KKVM-DLT-N-----L----NL-----N-F-TLDCLT------------------------
G0SVJ1_RHOT2/617-665--------------TLI--LQLQ-QVT-R-----L----TY-----H-F-AHMCLA------------------------
B7P9R3_IXOSC/76-124--------------RLV--LELC-AQT-R-----M----NR-----Q-F-SERCLE------------------------
Q54LU1_DICDI/333-381--------------TLI--NDFA-VYT-K-----L----KP-----E-F-AKECLS------------------------
R9AGN7_WALI9/530-575--------------.IV--CELA-VRT-R-----L----NY-----D-F-SIECLQ------------------------
F6VE78_HORSE/419-466--------------EMV--QAFS-TQS-G-----M----NL-----Q-W-SQKCLH------------------------
F0ZVY7_DICPU/222-270--------------EIT--NEFS-AYT-K-----L----KP-----E-F-ANECLL------------------------
F1KXD7_ASCSU/601-647--------------QMV--EAFS-RES-K-----M----KP-----E-W-SRKCLM------------------------
E9HPR7_DAPPU/577-625--------------QMV--ASFS-EQS-G-----M----NT-----T-W-SLKCLE------------------------
F7AR15_MOUSE/425-473--------------RMV--QAFS-TQS-G-----M----KL-----E-W-SQKCLE------------------------
K0KJ11_WICCF/580-628--------------EFV--MKVI-QDT-K-----L----NL-----Q-F-SLLLSE------------------------
F0XI66_GROCL/595-641--------------ELI--AELS-KVT-N-----M----NP-----Q-Y-SEMCLA------------------------
F2U637_SALR5/599-647--------------AMV--QQLA-ADT-G-----M----NF-----A-F-SEECLA------------------------
K1VEX0_TRIAC/566-611--------------.MV--EQVR-QRT-G-----M----NA-----Q-F-SELCLA------------------------
J9KX88_ACYPI/498-543--------------.MI--KRFS-NET-G-----M----NN-----K-W-SKKCLV------------------------
B6JXN8_SCHJY/563-611--------------ELV--ARVK-AET-G-----L----ND-----V-F-AEMCCQ------------------------
J7S834_KAZNA/560-606--------------ELL--NKLH-LET-K-----L----NA-----E-Y-TYMLAD------------------------
G1SVP1_RABIT/555-601--------------EMV--QALS-IQY-G-----V----NL-----E-W-SQKCLH------------------------
G3UHJ2_LOXAF/526-574--------------EMV--PAFT-AQS-G-----L----NL-----E-W-AQKCLH------------------------
F2SUD8_TRIRC/647-695--------------QLI--LEIS-FKT-K-----M----TL-----Q-F-SEMALS------------------------
X1WQH3_ACYPI/76-122--------------SLV--NSFS-NEF-G-----M----NN-----E-W-SEKCLE------------------------
S8AQ06_PENO1/644-692--------------QLV--AQMS-AKS-G-----M----TL-----Q-F-SEMALS------------------------
G3RNR7_GORGO/565-617--------------EMV--ETVS-TQS-G-----M----KL-----E-Q-SQKCGA------------------------
E9IDJ4_SOLIN/589-637--------------QMT--ITLS-QQT-S-----M----NL-----E-W-SLKCLQ------------------------
D2W3R0_NAEGR/116-164--------------ELV--LYLM-NRT-N-----L----VH-----V-F-AYDCLQ------------------------
I4YK11_WALMC/472-517--------------.II--IELA-KKT-K-----L----NY-----E-F-SIQCLQ------------------------
G7DTW7_MIXOS/628-674--------------AMV--AEFS-RLT-R-----L----KS-----Q-F-AFDCLA------------------------
J9L587_ACYPI/702-748--------------TMI--KSFS-NES-G-----M----NN-----E-W-AEKCLE------------------------
A0A068X6G5_HYMMI/609-657--------------TMV--IEFH-RQT-G-----M----NM-----T-Y-SRQCLQ------------------------
T1KYL1_TETUR/570-618--------------SMV--QQFC-SLT-N-----M----NL-----Q-F-STQCLE------------------------
E9FRA5_DAPPU/889-937--------------QMI--ATFS-EQS-G-----M----DS-----R-W-SFKCLE------------------------
G0VCA2_NAUCC/534-580--------------ELL--NRLH-LQT-K-----L----NA-----E-Y-TFMLAE------------------------
E2BWH2_HARSA/479-525--------------..I--VRFG-QIT-T-----L----NK-----E-W-CEMYLS------------------------
L5KNV8_PTEAL/148-196--------------KMV--QVIS-ALS-E-----M----NF-----Q-L-SQKCLQ------------------------
G8BSF9_TETPH/525-571--------------ELL--NKLH-VDT-K-----L----NS-----E-Y-TYMLAE------------------------
E4WRQ9_OIKDI/606-653--------------.MV--KKFM-DNS-G-----M----VE-----N-Y-SKMCLE------------------------
G8BFF2_CANPC/570-616--------------ELL--VKII-VET-K-----L----NL-----Q-Y-AIMLCE------------------------
Q0CUQ6_ASPTN/629-675--------------QLV--MQMS-ANT-N-----M----TL-----P-Y-SEAALS------------------------
F6VM51_XENTR/515-561--------------..L--RNFS-EST-G-----M----KV-----E-W-ALKCLE------------------------
A8PSC4_MALGO/433-478--------------...--LQLS-AQT-S-----L----SY-----P-F-AVQCLG------------------------
D2VFN8_NAEGR/436-483--------------.II--VQFT-SIT-G-----L----RR-----E-Y-ALPCLE------------------------
E4ZXH0_LEPMJ/340-386--------------EMI--LYVQ-QQT-N-----L----KR-----D-F-AVQCLE------------------------
K5XSW2_AGABU/545-590--------------.LV--LQTC-ART-R-----L----NV-----N-F-ALDCLH------------------------
E9IDT6_SOLIN/499-546--------------.II--TRIQ-QIT-K-----M----NK-----E-W-CLIYLS------------------------
C3ZQJ7_BRAFL/156-204--------------QMI--KMFA-EQS-G-----M----NE-----E-W-SQSCLE------------------------
J9JRI7_ACYPI/747-793--------------TMV--KSFS-KES-G-----M----NI-----E-W-AEKCLE------------------------
R4XCL5_TAPDE/566-613--------------.MI--NQLK-TAT-G-----L----NT-----N-Y-ANMCLS------------------------
G6DRX3_DANPL/557-604--------------.ML--NMLC-QQT-G-----M----NE-----H-W-SVNCLQ------------------------
B0W492_CULQU/610-658--------------QMV--QAMA-TQS-N-----M----NL-----E-W-SRKCLE------------------------
E9HYQ3_DAPPU/1190-1236--------------..V--DCFS-FES-S-----M----NM-----F-W-SLKCLK------------------------
D1ZZZ3_TRICA/492-540--------------QVI--TAMK-LIT-N-----L----TT-----E-W-AKKCLE------------------------
F6ZBK7_CIOIN/560-608--------------DMI--ASFS-RES-G-----M----NV-----G-Y-SRQCLE------------------------
E7KVF3_YEASL/539-585--------------ELL--NKLH-LET-K-----L----NA-----E-Y-TFMLAE------------------------
G0NM87_CAEBE/570-616--------------QMT--AAMC-QFS-G-----M----TP-----A-Y-SEKCLA------------------------
H6C6P8_EXODN/361-409--------------QMG--LQFS-FET-R-----L----KL-----Q-W-VENCLS------------------------
Q6CTV4_KLULA/541-587--------------ELL--QKLH-LET-K-----L----NA-----E-Y-TYMLAE------------------------
Q0UUQ5_PHANO/307-353--------------QMI--LYVQ-QAT-N-----L----TR-----D-Y-AVQCLE------------------------
V5HX14_BYSSN/620-668--------------QMV--LEMS-LKT-K-----M----TL-----Q-Y-SEMALS------------------------
H0WK93_OTOGA/514-561--------------NMV--EAFS-TQF-G-----M----NL-----K-W-SQKYLH------------------------
F8PXV4_SERL3/560-605--------------.LI--MQTC-QRT-G-----L----NV-----K-F-AVDCLQ------------------------
M7NQ07_PNEMU/557-604--------------.ML--NEIS-KKT-G-----L----NQ-----K-F-SLMCLE------------------------
K7JG87_NASVI/502-550--------------QLL--RLLQ-ELT-T-----M----ND-----K-Y-SEKYLI------------------------
G3B3M1_CANTC/552-598--------------EIL--IKVS-LET-N-----L----NL-----Q-Y-GLMLCQ------------------------
L2G897_COLGN/607-653--------------AMI--AELS-KQT-N-----M----TP-----Q-Y-SEMCLS------------------------
F9XC14_ZYMTI/590-636--------------AMV--FELT-KRT-N-----M----TL-----P-M-SKTCLE------------------------
G4LZB4_SCHMA/637-685--------------NMV--IEFS-RRT-G-----M----NI-----P-F-SRQCLE------------------------
I3MCG2_ICTTR/504-551--------------EMV--QAFS-VRS-G-----M----NL-----R-W-SQKFLE------------------------
S8AEB1_DACHA/596-643--------------QMI--AQLM-GQT-G-----L----TQ-----K-Y-AEMCLD------------------------
F4PQ71_DICFS/552-597--------------EII--QQLM-TMT-S-----L----NN-----Q-F-AKDCLV------------------------
K7JZ59_NASVI/501-549--------------NLI--LIFQ-ESS-Q-----M----KH-----E-H-CEKYLK------------------------
F1M355_RAT/502-547--------------QMM--PTFC-SQS-G-----V----NV-----E-R-SQKCLH------------------------
T1JGC8_STRMM/579-627--------------QMV--LMFS-QSS-G-----M----NI-----E-W-STKCLQ------------------------
A7SAV5_NEMVE/648-696--------------QMV--LQFS-NQS-Q-----M----NP-----E-W-SFKCLS------------------------
M7T649_EUTLA/611-657--------------QMV--LELS-KQT-S-----M----TA-----D-Y-SKLCLE------------------------
T1HA90_RHOPR/588-636--------------QMV--TALS-LKS-G-----M----NL-----I-W-SEKCLA------------------------
F6YJ26_MONDO/575-623--------------EML--QTFS-TQS-G-----M----NL-----E-W-SQKCLQ------------------------
H0YDU0_HUMAN/74-122--------------EML--QAFS-TQS-G-----M----NL-----E-W-SQKCLQ------------------------
K2SBU5_MACPH/598-644--------------RLV--LEFS-KHT-G-----M----TL-----E-Y-AKMCLI------------------------
G3SLM1_LOXAF/570-618--------------EMV--QAFS-TQS-R-----M----KF-----E-W-SWKCLE------------------------
G3TVU6_LOXAF/523-571--------------EMV--PAFT-AQS-G-----M----NL-----E-W-PRNCLH------------------------
F4P6P4_BATDJ/682-727--------------.LV--VEFA-KAT-G-----L----NY-----S-Y-SLLCLQ------------------------
B4JSR1_DROGR/504-550--------------..M--TMLS-AET-S-----L----KS-----R-W-CRKFLK------------------------
Q7QK79_ANOGA/610-658--------------QMI--QALS-AQT-N-----M----NA-----E-W-SKRCLE------------------------
MEX67_SCHPO/547-595--------------QIV--LKIK-AET-G-----L----ND-----Y-Y-AHMCCE------------------------
K7J5C6_NASVI/712-760--------------QMT--MTLS-QQT-N-----M----NF-----E-W-SFKCLE------------------------
B8MH42_TALSN/594-642--------------QLV--LQLS-FAT-Q-----L----KL-----E-F-SQRALV------------------------
G3VFP4_SARHA/604-652--------------DML--QSFS-TQS-G-----M----NL-----E-W-SQKCLQ------------------------
R7YJB7_CONA1/601-647--------------QLV--AQLS-AAT-R-----M----NA-----T-Y-SRQCLE------------------------
G2R2G6_THITE/590-637--------------AMV--QELA-GKT-G-----M----TA-----E-Y-SRLCLS------------------------
M2MUW6_BAUCO/606-652--------------QMV--AALM-SQT-G-----M----TL-----Q-Y-AKDCLD------------------------
H2Z6T4_CIOSA/441-489--------------EMV--ASFS-RDS-A-----M----NA-----M-F-SRQCLE------------------------
E9HYQ3_DAPPU/1133-1181--------------RMV--STFS-QEH-G-----M----NT-----T-W-TLKCLE------------------------
A0A088AIA9_APIME/486-534--------------QLL--TFLH-ELT-T-----M----NM-----K-F-CHQYLE------------------------
C4R7R9_KOMPG/549-597--------------ELA--HKVL-MET-K-----L----NP-----E-F-TLMLCE------------------------
MEX67_CANAL/569-615--------------ELL--VKIL-LET-K-----L----NI-----N-Y-GIMLCE------------------------
F6V2B4_MACMU/231-279--------------EMV--QAFS-AQS-G-----M----KL-----E-W-SQKCLQ------------------------
T5AI53_OPHSC/605-651--------------AMI--AELS-KQT-G-----M----VA-----E-Y-CEMCLS------------------------
D6WXF5_TRICA/557-605--------------QMV--TAMA-EQS-T-----M----NL-----E-W-SRRCLE------------------------
M1VWJ6_CLAP2/571-617--------------AMV--AELC-RQT-G-----M----VP-----Q-Y-SELCLS------------------------
F4SB63_MELLP/556-604--------------NLI--NQFR-QVT-K-----L----NE-----R-L-ALDCLL------------------------
A0A0D1CBA5_USTMA/616-661--------------...--LQLA-AQT-G-----L----IY-----P-F-AVQCLQ------------------------
S8ENB3_FOMPI/545-590--------------.LV--MQIC-QRT-G-----L----NV-----E-Y-AVQCLE------------------------
U5GY34_USTV1/553-599--------------..V--LQLQ-SVT-N-----L----TY-----S-F-AYMCLE------------------------
B3LYG5_DROAN/287-333--------------..V--EKLS-QQT-G-----M----NP-----V-F-SRQLLA------------------------
F6PYN9_MONDO/592-640--------------SII--QLFS-TQS-G-----M----NL-----E-W-SKKCLQ------------------------
G3UBE9_LOXAF/559-611--------------QMV--PAFS-TQS-G-----M----YL-----G-W-PQRYLY------------------------
Q8R499_MOUSE/622-670--------------EMV--KSFS-VQS-G-----M----KL-----D-W-SQKCLQ------------------------
D8Q3Y4_SCHCM/566-611--------------.MV--LELC-RRS-G-----L----TV-----S-Y-SVECLV------------------------
B8P4D5_POSPM/146-191--------------.LV--MEVL-TRT-G-----L----NL-----E-Y-AVQCLE------------------------
E3RM33_PYRTT/267-313--------------EMI--AYVQ-HET-N-----L----TR-----D-Y-AVQCLE------------------------
H2W522_CAEJA/573-619--------------QMI--KAFC-EFS-G-----M----IV-----P-Y-SEKCLA------------------------
R8BMH6_TOGMI/564-609--------------.MI--LELS-NRT-N-----M----TL-----E-Y-SKMCLD------------------------
G1T8L7_RABIT/565-613--------------QMV--QSFS-TQS-G-----M----KI-----E-W-SQKCLE------------------------
F7G9M2_CALJA/508-555--------------KMV--KGFS-AQS-G-----M----NF-----Q-C-SQKCLH------------------------
C4Y6C5_CLAL4/572-618--------------EFL--VKIL-VET-K-----L----SM-----Q-Y-ALMLCQ------------------------
H0XJG4_OTOGA/507-555--------------EMV--QAFS-TQS-G-----M----KP-----N-W-SQKCLE------------------------
Q4WJR0_ASPFU/644-692--------------QLV--MQMS-TKT-N-----M----TL-----Q-Y-SEMALS------------------------
G1SPN8_RABIT/540-588--------------EMV--KAFS-TQS-G-----M----NL-----E-W-SQKCLE------------------------
A0A158NK73_ATTCE/495-543--------------QLL--RFLR-ELT-T-----M----NI-----R-Y-CYKYLQ------------------------
G7Y305_CLOSI/630-677--------------.LI--TELK-QRS-G-----M----NE-----A-F-SRQCLE------------------------
K1S373_CRAGI/551-599--------------QMI--QQFA-AQS-G-----M----NH-----Q-W-SIKCLE------------------------
W4YYQ9_STRPU/193-241--------------TML--AEFM-RVS-G-----M----NA-----D-W-SMKCLV------------------------
A0A087ZSK2_APIME/474-522--------------ELL--NKFT-EIT-S-----L----NK-----D-W-CQTYLE------------------------
B5BM32_CAEEL/561-607--------------EMI--KAMC-QFS-G-----M----IP-----P-F-SEKCLA------------------------
H2AN82_KAZAF/495-540--------------.LL--EKLH-SET-K-----L----TA-----E-Y-TYMLAE------------------------
G3TEP3_LOXAF/519-567--------------QMV--QASS-TQS-G-----M----NL-----E-W-PQKCLH------------------------
F4W8B0_ACREC/479-526--------------.LI--TRIR-QVT-T-----M----NK-----E-W-AETYLT------------------------
J0D0B1_AURST/523-568--------------.LV--MELM-ART-R-----L----VT-----Q-A-AGQCLE------------------------
A0A068XP13_HYMMI/367-413--------------..I--NHLS-SMT-G-----M----NQ-----A-Y-SEQCLS------------------------
A9V2I0_MONBE/494-542--------------MMV--MQLS-QMS-G-----M----NQ-----Q-F-STDCLA------------------------
W1QBF4_OGAPD/541-587--------------QLL--CKIM-TET-N-----L----VL-----Q-Y-SLLLCE------------------------
D5GCX3_TUBMM/589-637--------------SMC--EQLM-AQT-R-----L----RS-----D-W-ATMCLS------------------------
I1G080_AMPQE/561-608--------------.VI--QQLA-LET-G-----M----NY-----D-Y-SKKCLA------------------------
G1PB99_MYOLU/566-613--------------EMV--QVFS-TKS-G-----M----SL-----Q-L-SQKCLH------------------------
E9FRA5_DAPPU/832-880--------------QMV--ASFS-QQS-G-----M----DL-----N-W-SLKCLM------------------------
G8YCF0_PICSO/544-590--------------EIL--VKTL-LET-H-----L----NL-----Q-Y-AIMLCE------------------------
G0R6P6_HYPJQ/603-649--------------AMV--AELS-KQT-G-----M----VP-----Q-Y-SEMCLS------------------------
H0WGH6_OTOGA/555-601--------------EMV--QTFP-SQF-G-----M----DL-----K-W-SQNYLQ------------------------
A3M0A0_PICST/566-612--------------ELL--VKIL-VET-K-----L----NM-----Q-Y-SIMLCE------------------------
E9DE69_COCPS/642-690--------------QLV--LEIS-FKT-R-----M----TL-----E-F-SEMALS------------------------
G1SL70_RABIT/598-646--------------KMV--QAFY-MQS-G-----M----KL-----E-W-SQKCLE------------------------
G2Q1H7_MYCTT/597-644--------------QMI--EELS-RQT-G-----M----TA-----E-Y-SRLCLA------------------------
E1ZWJ7_CAMFO/420-468--------------QMT--MTLS-QQT-N-----M----NL-----E-W-SLKCLQ------------------------
F7IC37_CALJA/558-604--------------ETM--HTVS-TQS-G-----M----NL-----E-Q-SQNVLY------------------------
N4TCL5_FUSC1/606-652--------------AMI--TELC-KQT-G-----M----TP-----Q-Y-SEMCLT------------------------
A0A0C4DTE4_MAGP6/609-655--------------QLI--AQLS-QRT-N-----M----VS-----Q-Y-SEMCLD------------------------
F6TNP2_XENTR/570-618--------------DMV--QAFI-QVS-G-----M----NA-----E-W-SQKCLE------------------------
A8WY32_CAEBR/572-617--------------.MT--EAMC-QFS-G-----M----IA-----P-Y-SEKCLA------------------------
A5DKM0_PICGU/529-575--------------ELL--VKVL-LET-K-----L----NL-----Q-Y-GILLCE------------------------
H9GMR1_ANOCA/558-606--------------EML--QNFS-LQS-G-----M----NL-----E-W-SQKCLL------------------------
F1RYG7_PIG/577-625--------------QIV--KAFS-SQS-G-----M----NL-----Q-W-SEKCLQ------------------------
E0VI83_PEDHC/572-620--------------QMV--ETLA-TKT-G-----M----NV-----A-W-SKKCLD------------------------
H3ET57_PRIPA/576-621--------------.MV--AAFS-AES-G-----M----LP-----E-W-SARCLQ------------------------
G3PXQ8_GASAC/582-630--------------EML--TAFS-QKS-G-----M----NL-----E-W-SQKCLQ------------------------
B4MYL2_DROWI/572-620--------------QMA--NALS-ARS-Q-----M----NL-----E-W-SYKCLE------------------------

PF14555

TYDP2_CHICK/34-76-------------KVLC--SEFA.AVT.S..---S....DE.....A-V-ASGFLA------------------------
UBX1_EMENI/7-49-------------DEAV--SQFC.AMT.R..---A....RP.....D-E-AQEYLA------------------------
B9PW09_TOXGV/14-57-------------QSLL--DTFQ.SVT.G..---C...TDR.....A-G-ATEFLR------------------------
E3KWG8_PUCGT/7-49-------------SDVV--NQFV.SIT.G..---S....ST.....D-Q-ARFFVD------------------------
Q6A589_CAEEL/12-55-------------REKL--RQYT.EFT.H..---Q...QDY.....E-V-AIGTLA------------------------
F2Z2K0_HUMAN/6-48-------------QEAL--REFV.AVT.G..---A....EE.....D-R-ARFFLE------------------------
B6QBH5_TALMQ/18-59-------------QEAL--QTYM.NVT.G..---Q....EP.....D-A-AIPLLQ------------------------
O50062_ARATH/120-163-------------QERI--NLFL.AVA.S..---D...LPS.....Q-E-VLSYLE------------------------
F2SWQ8_TRIRC/16-57-------------EDTL--QTYL.AVT.G..---Q....DR.....E-A-AIPLLR------------------------
A6QY73_AJECN/16-57-------------QNAL--QTFI.AIT.G..---G....EE.....S-A-AIQLLQ------------------------
D5G597_TUBMM/14-55-------------QQAL--EQFT.AVT.A..---Q....EI.....K-D-AIPILR------------------------
E5A7G5_LEPMJ/16-58-------------QLAL--QQYT.AVT.D..---Q....EV.....D-K-AIPLLT------------------------
A7F973_SCLS1/16-57-------------QAAL--QQLL.AVT.G..---Q....EV.....D-Q-AVPLLQ------------------------
C4K012_UNCRE/3-45-------------DAAV--AQFT.EIT.G..---S....SP.....E-T-ATQYLQ------------------------
A7SCW2_NEMVE/8-50-------------SRLI--AEFS.DVT.G..---A....DT.....E-R-ARFFLE------------------------
B8MDL3_TALSN/8-50-------------DELL--SQFC.SMT.G..---A....TP.....S-E-ARPFLE------------------------
D6WT40_TRICA/5-47-------------PELI--SQFT.AIT.G..---V....DE.....D-R-AKFYLE------------------------
C3Y288_BRAFL/5-47-------------DELQ--SQFV.AVT.G..---V....DQ.....G-R-AKFFLE------------------------
E2BNT9_HARSA/5-47-------------DELV--SQFA.DVT.G..---V....EA.....E-R-AQFYLE------------------------
B3RL52_TRIAD/6-48-------------TSMI--ANFV.SIA.G..---T....DA.....D-Q-ARFYLE------------------------
C1EHA1_MICCC/2-45-------------DAKI--AQFC.QVT.G..---C...ADP.....A-K-ARFFLE------------------------
B4MIP1_DROWI/5-46-------------ADLI--AQFI.EIT.G..---S....DE.....N-V-ASFYLS------------------------
F2PQY6_TRIEC/8-50-------------KSAI--AQFV.SVT.G..---A....KD.....S-V-ATKCLK------------------------
E3S3Y1_PYRTT/3-45-------------EDSI--LNFC.SIT.S..---C....DP.....D-K-AAQYLR------------------------
C4IZE8_MAIZE/12-55-------------ETLV--SSFI.EITAG..---Q....TL.....E-T-ATQFLQ------------------------
E9FYH5_DAPPU/5-47-------------DELV--ANFR.EVT.G..---I....DE.....Q-R-ARFYLE------------------------
UBX2_SCHPO/6-48-------------ASLV--ANFC.AIT.N..---S....TP.....E-K-AQEYLS------------------------
E6ZQC6_SPORE/5-47-------------PSLI--QQVS.SIT.G..---C....ND.....Y-Q-AETVLE------------------------
F0ZVA6_DICPU/4-46-------------SEAI--STFQ.QIT.N..---A....SE.....P-E-ARFYLE------------------------
A9V0Q4_MONBE/19-62-------------SALV--QRFC.QLVPG..---M....SQ.....E-A-ATFFLE------------------------
D7MAI3_ARALL/7-49-------------ENLI--NSFV.EIT.S..---S....SR.....E-E-ATFFLE------------------------
D8LYL9_BLAHO/2-44-------------DNAI--AGFC.SVT.G..---T....DA.....E-T-ARKYLE------------------------
D7M082_ARALL/6-47-------------QEAI--DTFI.SIT.G..---A....SE.....A-V-ALQKLE------------------------
D5GLD2_TUBMM/110-152-------------RFAI--QQFI.AFT.A..---C....PE.....R-T-AAKFLK------------------------
F2PN33_TRIEC/7-49-------------DEAI--EAFV.SFT.S..---A....SR.....E-R-AIAFLQ------------------------
C1MNP9_MICPC/5-48-------------DEKI--AAFC.AVT.G..---C...ADA.....A-K-AAFHLE------------------------
D7L0K1_ARALL/9-50-------------RDKL--QQFV.AIT.G..---A....SE.....K-N-ALQALK------------------------
Q6C927_YARLI/12-55-------------REKV--ESFV.SIT.D..---WK..GDP.....A-L-AVVLLQ------------------------
E7A1C9_SPORE/3-45-------------DESI--QQFA.SIT.G..---A....ST.....E-R-ARFFLE------------------------
A5DQC6_PICGU/8-52-------------QDLV--TQFV.SIS.G..---AE..DDR.....Q-K-VVSLLT------------------------
C0NTP5_AJECG/10-52-------------DDLI--SQLC.GVT.G..---I....SP.....A-E-AREYLA------------------------
F2PRZ6_TRIEC/6-48-------------DEMI--SHFC.AIT.G..---A....TP.....A-V-AREHLV------------------------
C4QW21_KOMPG/7-51-------------EEKL--AQFQ.EVT.S..---F....EDE..QTD-K-IVRLLE------------------------
C3YKP5_BRAFL/16-59-------------TEKL--LQFQ.DLT.G..---I....ND....LE-K-CRQVLD------------------------
B6HMA7_PENRW/3-45-------------NDVV--AQFT.EIT.G..---S....TP.....E-L-AIQYLQ------------------------
F0XJM7_GROCL/5-47-------------DERI--SEFC.SIT.G..---V....SP.....Q-E-AAHHLA------------------------
E9DBC9_COCPS/9-50-------------DTLI--SHFC.AIT.G..---V....TP.....T-E-AREYLD------------------------
Q6P007_DANRE/9-48-------------KDKV--RQFM.SFT.Q..---A....GE.....K-T-AVYCLT------------------------
A5DDG0_PICGU/6-48-------------STAR--NQLV.SIT.G..---C....TP.....T-T-ATSLLE------------------------
Q6BQ37_DEBHA/11-57-------------KDLI--SQFQ.AIT.G..---LGPEEET.....E-N-IHKLLR------------------------
E3QSL9_COLGM/2-44-------------DEDI--SNFV.AIT.A..---A....SP.....E-A-ARGFLE------------------------
A7RJI9_NEMVE/7-49-------------QAMI--NQFV.MAA.G..---C....AR.....D-Q-ARQLLQ------------------------
D5G5L9_TUBMM/2-44-------------DELI--SQFT.TIT.G..---A....TV.....R-K-AETYLK------------------------
D0NIJ4_PHYIT/8-50-------------QDAL--AAFM.SIT.G..---A....DS.....G-S-ALQFLE------------------------
D7L0V3_ARALL/10-51-------------EKLI--SSFI.EVT.S..---S....SR.....E-V-AISFLE------------------------
E4X2U9_OIKDI/11-53-------------RELV--RQLQ.SFT.Q..---A....NE.....K-T-CIYCLQ------------------------
E9E2G4_METAQ/11-53-------------EKLV--QDFI.AMC.N..---C....SP.....E-Q-ATQYLD------------------------
F0XBP2_GROCL/17-58-------------QESL--DQLV.SIT.N..---Q....TQ.....A-E-AVGLLR------------------------
Q2GWY8_CHAGB/5-47-------------DTLI--SNFC.ELT.S..---S....ST.....E-Q-AAEYLS------------------------
NSF1C_DICDI/5-47-------------SEAI--ATFQ.SIT.G..---A....SK.....E-E-STFYLE------------------------
A0A0D2VIE5_CAPO3/21-64-------------DTLL--QQFR.IILPD..---A....DE.....E-S-CRFFLE------------------------
E9IBR1_SOLIN/3-44-------------RELV--EKFI.EVT.G..---E....SE.....A-T-AQQYLA------------------------
E0VQG6_PEDHC/6-48-------------DELV--SQFV.DIT.G..---V....DN.....N-Q-ARGYLE------------------------
B6AAH9_CRYMR/9-51-------------DSLI--ATFC.EIT.G..---C....NA.....T-K-SSEILE------------------------
E4WR21_OIKDI/22-65-------------DILM--NRFC.ELIQG..---A....NQ.....D-S-AQFYLE------------------------
Q7Q9P4_ANOGA/5-46-------------NEQV--KQFA.QIT.G..---A....TE.....E-R-AKFFVD------------------------
E3MCA3_CAERE/6-47-------------QAAV--AQMK.EIT.N..---C....NE.....D-T-AMDYLF------------------------
A7SUB3_NEMVE/6-48-------------SHLI--DEFT.NVT.G..---A....TR.....Q-I-ATSLLE------------------------
C7Z6D4_NECH7/2-44-------------DDNI--STFI.AIT.G..---A....NA.....D-V-ARSFLE------------------------
C5DHE4_LACTC/3-46-------------QEDI--DTFT.AIT.S..---A....DN....SE-L-ASQFLE------------------------
F2UT65_SALR5/23-66-------------GTLI--DQFK.KVV.R..---I...DDD.....S-L-ASFFLE------------------------
C6HFQ4_AJECH/8-50-------------EDAI--ENFI.SFT.N..---A....SR.....E-K-AIAFLE------------------------
E3NDY1_CAERE/12-55-------------KEKV--QQFM.EIT.N..---T...KCA.....E-T-AHQLLS------------------------
C4YC44_CLAL4/27-70-------------DDQI--ATFL.AFT.G..---S...EDA.....A-T-AKQYLE------------------------
A9ULP0_XENTR/14-57-------------TEKL--LQFQ.DLT.G..---I....ES....MD-Q-CRQTLQ------------------------
Q6BK03_DEBHA/2-43-------------DELV--STFL.AVT.G..---I...EDE.....S-T-AKQYLE------------------------
B2B6H8_PODAN/7-49-------------DTLI--SNFC.DLT.G..---A....SA.....D-Q-ATEYLT------------------------
DCN1_CAEEL/9-48-------------KTKL--RQFV.QWT.Q..---V....TE.....A-V-SLNFLA------------------------
Q5A0W1_CANAL/9-56-------------KEKV--DEFK.SIT.G..---S....STDSENDD-K-IIEFLT------------------------
A5E803_LODEL/7-54-------------SEAI--EQFI.AIT.G..---I....ESNGDVEE-K-VLRLLN------------------------
F1R890_DANRE/27-70-------------DVLI--SEFQ.RLL.G..---FQ..LNP.....A-G-CAFFLD------------------------
A7S9M6_NEMVE/13-56-------------MEVL--VQFQ.DIT.G..---I....DD....VE-K-CRAVLE------------------------
A1C843_ASPCL/9-51-------------KQLI--NQFV.NFT.D..---A....KD.....T-V-AVKFLK------------------------
C4JUU5_UNCRE/9-49-------------KQLI--AQFV.SFA.S..---V....KD.....S-V-AAKFLK------------------------
E1ZSZ0_CHLVA/5-47-------------SEAV--SEFM.AFT.G..---E....DE.....A-T-ARAMLE------------------------
B6IJS1_CAEBR/11-54-------------QRKL--NQFM.EIT.D..---S....ED....LD-S-AYQLLV------------------------
Q6C2H5_YARLI/3-45-------------DELI--SNFI.AIT.T..---A....TT.....E-K-AERYLQ------------------------
A3GEZ6_PICST/9-55-------------QELV--DQFK.AIA.G..---L....EDSE.NDN-K-VFQLLT------------------------
C1GJS9_PARBD/9-51-------------DVLI--SQLS.GIT.G..---I....SP.....A-Q-AREFLV------------------------
C3ZEN2_BRAFL/13-55-------------DALI--EQFR.AIT.D..---T....TE.....D-V-ARHMLE------------------------
A5DFQ1_PICGU/6-48-------------EQLI--DQFI.NVT.G..---S....SR.....N-L-AEQYLS------------------------
B7FQE3_PHATC/7-49-------------DELV--SHFM.AVT.G..---I...ADA.....D-K-ATSYLE------------------------
D6WAX0_TRICA/35-79-------------DELV--QQLQ.KLL.G..---SN..LNY.....S-T-AAFFLD------------------------
A9SVK1_PHYPA/5-47-------------DELV--EEFC.GVT.T..---S....TP.....E-H-AKFFLE------------------------
F0XQR2_GROCL/3-45-------------DELA--ANFM.AVT.G..---A....DE.....N-I-ARQLLD------------------------
Q29L14_DROPS/9-51-------------DELV--KQVV.EIT.A..---C....NA.....D-E-AKHYLG------------------------
C5DY54_ZYGRC/2-44-------------ENLV--ATFK.SLA.Q..---C....SD.....R-T-ARDYLN------------------------
E9EC80_METAQ/2-44-------------DESI--SSFV.AIT.G..---A....TA.....D-V-ARGFLQ------------------------
Q6FRZ1_CANGA/18-63-------------EEKL--NNFQ.GIT.N..---F....PED..DLP-L-VIKLLQ------------------------
B4J9X4_DROGR/8-51-------------EETL--ASFQ.IIT.G..---I....DD....VG-E-AFSHLE------------------------
C4JLG5_UNCRE/10-52-------------DDAI--NEFV.AIT.K..---T....TR.....D-H-ATSLLQ------------------------
Q6CMX2_KLULA/4-47-------------DEDI--STFQ.GVC.G..---T...DND.....E-L-SRHFLE------------------------
F1L242_ASCSU/9-51-------------AEII--CSFK.EVC.A..---V....SD.....E-T-AMDFLH------------------------
A1CAL2_ASPCL/7-49-------------EEAI--ANFV.SFT.S..---T....SR.....E-H-ALAFLK------------------------
E9FTF8_DAPPU/39-80-------------RQQI--EQFC.AVT.G..---S....TE.....D-V-ARTLIE------------------------
D8QT57_SELML/9-51-------------RDKV--HQFM.SIA.G..---A....TE.....K-A-SLTALK------------------------
C5M4D9_CANTT/8-50-------------QQII--AEFV.SIT.N..---S....ST.....Y-L-AEQYLS------------------------
A7EE19_SCLS1/8-50-------------RSML--NEFM.QIT.G..---V....SE.....R-T-GTRLLK------------------------
A0A0D2U416_CAPO3/11-53-------------KDAV--GRFM.SLA.L..---V....SE.....A-I-AIQFLE------------------------
DCN1_MAGO7/8-48-------------KTLS--AQFV.HMT.A..---T....ND.....K-V-AQKFLK------------------------
A0E6F9_PARTE/6-49-------------EKDI--LDFM.TLT.G..---C...QDE.....Q-K-AMQYLQ------------------------
Q17C41_AEDAE/24-66-------------EENV--KSLR.EIT.G..---L....KP.....E-Q-AANLLT------------------------
D7M5K9_ARALL/6-48-------------RDAI--QSYM.SIT.G..---A....SE.....S-L-AIQRLE------------------------
D2VD49_NAEGR/3-46-------------DDLL--MSFM.SIT.D..---E...NNV.....E-T-AQHYLE------------------------
Q75D11_ASHGO/3-45-------------DEQI--QQFM.MLT.N..---S....SA.....E-V-ARKYLG------------------------
Q7PNN2_ANOGA/6-48-------------DEIL--ADFQ.SIT.A..---I....DD....VA-E-AIFHLE------------------------
E7QB86_YEASZ/6-47-------------DETI--QQFM.ALT.N..---V....SH.....N-I-AVQYLS------------------------
D8PW55_SCHCM/8-51-------------AEAI--AQLT.EVT.GGS---C....TD.....E-A-ARDMLE------------------------
D7MH49_ARALL/10-53-------------LQLI--SSFL.DITVG..---Q....SV.....E-I-ALQFLK------------------------
A0BUB5_PARTE/7-50-------------EENI--NNFM.AIT.G..---C...QDY.....Q-K-AQSYIQ------------------------
TYDP2_DANRE/9-51-------------TRLC--DQFA.FVS.G..---S....DS.....A-V-AQCYLA------------------------
Q7Q3P6_ANOGA/11-54-------------TEKV--LQFQ.DIT.G..---L....DD....MN-V-CRDILI------------------------
C7YV31_NECH7/5-47-------------ESQI--VDFV.GLT.G..---G....ST.....E-E-AKQYLE------------------------
E3QXM3_COLGM/11-53-------------NNIL--RDFK.NLT.G..---M....PE.....A-R-CTEYLD------------------------
D0N3L0_PHYIT/18-60-------------DELV--DQFA.HLL.Q..---L....DV.....Q-T-ASFFLE------------------------
E4ZZB0_LEPMJ/10-52-------------KAAI--TQFI.NFT.Q..---L....DR.....N-T-AIRALK------------------------
C3ZC83_BRAFL/24-66-------------RQLQ--LEFS.EIT.G..---S....TL.....D-R-ARFYLL------------------------
B7QCT9_IXOSC/12-55-------------TEKL--LQFQ.DLT.R..---I....ED....LD-R-CREILN------------------------
E5SHZ1_TRISP/10-52-------------EQMI--SLFM.EIC.A..---V....EP.....N-V-ARNYLE------------------------
C5MDM6_CANTT/9-55-------------RDKF--EEFK.SIT.G..---I....DNDS.QDE-K-IVQLLT------------------------
C3Z1N9_BRAFL/24-67-------------EVLV--AELQ.KLV.N..---YQ..LNP.....S-A-CAFFLD------------------------
B8LDH2_THAPS/193-236-------------GAQL--SQFL.AFA.G.P---S....DP.....T-I-ARQYLE------------------------
A0A0K0JUN0_BRUMA/10-52-------------MNSI--NSFK.EIC.A..---V....DD.....K-L-AKDFLV------------------------
E9DC17_COCPS/7-49-------------EDAI--SEFV.TIT.N..---A....TR.....D-Q-AISLLQ------------------------
B6QEE1_TALMQ/7-49-------------EDDI--GNFI.SFT.S..---L....SR.....E-K-AVLFLK------------------------
Q0UAL0_PHANO/9-51-------------DAQI--AQLA.SLT.G..---L....DP.....A-T-AERYLN------------------------
B0E453_LACBS/7-48-------------DENI--SQFC.AVT.G..---A....SA.....R-D-ARKFLE------------------------
E1Z398_CHLVA/4-46-------------EDAL--STFV.TLT.G..---A....NG.....Q-V-AGHLLD------------------------
A7RJX7_NEMVE/9-52-------------EMIL--ANFQ.SIT.G..---I....EN....LD-E-CITLLD------------------------
A9V0L8_MONBE/109-151-------------SEKL--SLFC.GAT.G..---A....SP.....A-E-ATAYLQ------------------------
D3B7A4_POLPA/4-47-------------DEKI--MLFF.QLT.D..---S...SDP.....A-E-AIQILE------------------------
C9SRT0_VERA1/10-52-------------AQAL--QELH.QLT.G..---Y....SE.....E-R-CIGLLE------------------------
B8PGV5_POSPM/11-53-------------REAV--SQLQ.ALMNG..---A....DA.....D-V-AVDVLE------------------------
D2VZD0_NAEGR/18-61-------------TQQI--TAFN.SVTYN..---T....DN.....T-I-AIKYLN------------------------
B6HJ43_PENRW/9-51-------------KHQI--AEFV.NCT.R..---T....KE.....S-V-ATKFLK------------------------
A7SCH1_NEMVE/18-60-------------SAPV--KDFR.DLT.G..---A....DE.....E-T-AMNFLK------------------------
B6K2Q5_SCHJY/74-116-------------DEAF--QAYT.SII.G..---S....SD.....E-N-AKQLWN------------------------
C1MTG3_MICPC/18-59-------------DADV--EAFV.AVT.G..---A....DD.....A-R-ARRALL------------------------
A9RJT6_PHYPA/3-46-------------QQKL--AYFQ.EIT.G..---V...KDS.....S-L-SHQILD------------------------
D8QMR0_SELML/12-55-------------DEKL--AHFQ.SLT.G..---M....ED....MA-V-CTRILE------------------------
E6ZTU8_SPORE/8-49-------------EAIL--RQFR.QLT.N..---A....TP.....Q-D-AHRILK------------------------
C5DW92_ZYGRC/18-63-------------EEKL--NHFQ.AIT.T..---F...PDDD...LP-S-VIKLLE------------------------
Q6FXT3_CANGA/5-47-------------DKVI--QQFM.TLT.D..---R....SI.....D-V-AREYLE------------------------
Q2HEZ6_CHAGB/4-46-------------EEDI--ESFV.GIT.G..---A....NR.....T-A-AERVLE------------------------
A7TJ90_VANPO/18-62-------------EDKL--NQFQ.MIS.S..---F....PED..ELP-Q-IIKLLR------------------------
E1ZBM6_CHLVA/5-47-------------DQEL--ARFM.EAT.H..---A....SF.....D-Q-AQFFLE------------------------
TYDP2_CAEBR/34-76-------------EAKM--REFA.EIT.A..---T....DE.....I-M-AQSILQ------------------------
B9GTU7_POPTR/27-68-------------.ALV--DAFC.EIT.S..---S....SK.....Q-E-ALFFLE------------------------
B9HVN3_POPTR/12-52-------------.SMV--SSFL.EIAVG..---Q....TA.....E-T-ARQFLQ------------------------
B9Q2T2_TOXGV/5-47-------------EETV--QQFM.AAT.G..---V...SDR.....E-T-ATRYVE------------------------
E4WS89_OIKDI/3-45-------------DQAV--SEFM.SIT.G..---C...SDT.....A-R-AKFFLD------------------------
A0A0D2VIH6_CAPO3/2-43-------------DDLV--ASFL.AIAPN..---A....TL.....E-E-AEMALQ------------------------
F4IUT4_ARATH/103-142-------------.ESI--ARFCYAVA.G..---V....SV.....E-E-ARAYLE------------------------
G4U8S2_NEUT9/5-44-------------.ESI--ANFA.SIT.G..---A....ND.....T-A-ARRMLE------------------------
G4VIN2_SCHMA/21-62-------------DELI--NQLK.AVV.G..---ND..LSD.....E-S-CRFFLE------------------------
G7Y2V9_CLOSI/55-93-------------.ERV--RNFH.EIT.Q..---C....SE.....K-V-AIHCLQ------------------------
H3CAQ1_TETNG/5-46-------------EQSV--REFV.AVT.G..---V....DE.....E-R-ARFFLE------------------------
TYDP2_XENTR/26-64-------------.EQC--SAFA.SIA.G..---C....DE.....A-V-AQCFLA------------------------
Q59WE0_CANAL/2-43-------------DESI--PTFL.AVT.G..---L...EDE.....S-V-AKQFLE------------------------
Q7K4I5_DROME/8-48-------------DALV--EQVR.EVT.A..---C....SM.....D-E-AKYYLS------------------------
Q9FWC4_ORYSJ/6-47-------------DDKV--SYFQ.AVT.G..---I...SDH.....D-L-CTEILA------------------------
U1NTV9_ASCSU/12-50-------------..AL--KSFA.ELT.G..---T....DE.....A-C-AHFFLQ------------------------
W1Q7K7_OGAPD/9-53-------------QNKL--QSFK.EFT.S..---Y....NESD.EQE-K-VLRLLT------------------------

PF11547

E3LUR5_CAERE/181-232-----RVPATNVPEELI--NNVQ-QVLQG-----K----SR-----D-V-IIRELQ------------------------
J0M342_LOALO/159-209-----.VPLSAIPEDLI--AQAQ-VVLQG-----K----SR-----E-I-IVRELQ------------------------
Q7PY72_ANOGA/189-240-----SVPAPFVPEELV--AQAQ-VVLQG-----K----SR-----N-L-IIRELQ------------------------
K7EIB6_ORNAN/174-225-----VIPASVIPEELI--SQAQ-VVLQG-----K----SR-----S-V-IIRELQ------------------------
B3S209_TRIAD/157-208-----VLPVNLVPDDLI--EQVQ-GVLQD-----K----SR-----Q-V-IIRELQ------------------------
A0A068XTN0_ECHMU/136-185-----.ISPADVPENLI--EQCQ-MVLQG-----K----SR-----Q-L-IIRELQ------------------------
F7AHP3_CIOIN/184-235-----AILSAQVPEDLI--NQVQ-NVLQG-----K----SR-----N-V-IIRELQ------------------------
G7YDQ8_CLOSI/164-214-----QIPASEVPESLI--EECQ-TVLEG-----K----SR-----Q-V-IIRELQ------------------------
U6H7P7_HYMMI/159-208-----.IAASEIPEEFI--EQCQ-MVLQG-----K----SR-----Q-A-IVRELQ------------------------
I1G1T2_AMPQE/146-197-----VVPASEIPEELI--EEAL-SVLQG-----K----SR-----E-V-VVRELQ------------------------

PF02845

Q4WY44_ASPFU/59-100--------------------------------------------------------------------------------
VPS9_YEAST/409-450--------------------------------------------------------------------------------
Q75DK5_ASHGO/3-44--------------------------------------------------------------------------------
TOLIP_DANRE/232-273--------------------------------------------------------------------------------
ASCC2_DICDI/564-605--------------------------------------------------------------------------------
DEF1_DEBHA/28-69--------------------------------------------------------------------------------
A5DPP2_PICGU/21-62--------------------------------------------------------------------------------
A3GGA0_PICST/22-63--------------------------------------------------------------------------------
Q0UHZ6_PHANO/76-117--------------------------------------------------------------------------------
A3GFZ4_PICST/86-127--------------------------------------------------------------------------------
A5DQI0_PICGU/124-165--------------------------------------------------------------------------------
TAB3_HUMAN/9-50--------------------------------------------------------------------------------
Q0U670_PHANO/46-87--------------------------------------------------------------------------------
Q6BNF2_DEBHA/604-645--------------------------------------------------------------------------------
Q299A9_DROPS/168-209--------------------------------------------------------------------------------
Q29HR0_DROPS/452-492--------------------------------------------------------------------------------
A5DKD2_PICGU/326-367--------------------------------------------------------------------------------
Q2H1C9_CHAGB/67-108--------------------------------------------------------------------------------
Q6CCF1_YARLI/36-77--------------------------------------------------------------------------------
A6QRJ9_AJECN/60-101--------------------------------------------------------------------------------
A2QDL6_ASPNC/61-102--------------------------------------------------------------------------------
Q0UJ69_PHANO/56-97--------------------------------------------------------------------------------
A7EMB9_SCLS1/61-102--------------------------------------------------------------------------------
YGVA_SCHPO/78-119--------------------------------------------------------------------------------
Q5K6W5_CRYNJ/9-50--------------------------------------------------------------------------------
Q55BS4_DICDI/38-79--------------------------------------------------------------------------------
DEF1_CANAL/24-65--------------------------------------------------------------------------------
DEF1_LODEL/31-72--------------------------------------------------------------------------------
Q6CAS3_YARLI/132-173--------------------------------------------------------------------------------
A7UXH9_NEUCR/73-114--------------------------------------------------------------------------------
Q2GVS7_CHAGB/75-116--------------------------------------------------------------------------------
CUE5_SCHPO/18-59--------------------------------------------------------------------------------
CUE5_YEAST/98-139--------------------------------------------------------------------------------
Q75C34_ASHGO/99-140--------------------------------------------------------------------------------
Q6CJT9_KLULA/91-132--------------------------------------------------------------------------------
A7TLU9_VANPO/108-149--------------------------------------------------------------------------------
Q5A2E6_CANAL/123-164--------------------------------------------------------------------------------
A5DWM8_LODEL/145-186--------------------------------------------------------------------------------
Q6BQ94_DEBHA/157-198--------------------------------------------------------------------------------
A4HRE2_LEIIN/565-606--------------------------------------------------------------------------------
A4H345_LEIBR/550-591--------------------------------------------------------------------------------
A2VCY9_XENTR/9-50--------------------------------------------------------------------------------
TAB2_DANRE/9-50--------------------------------------------------------------------------------
A7SCG6_NEMVE/14-55--------------------------------------------------------------------------------
CUE3_SCHPO/272-313--------------------------------------------------------------------------------
A0A0D1ED14_USTMA/88-129--------------------------------------------------------------------------------
Q5KNC6_CRYNJ/50-91--------------------------------------------------------------------------------
A6RDW9_AJECN/50-91--------------------------------------------------------------------------------
A1C6F4_ASPCL/48-89--------------------------------------------------------------------------------
A7TT41_VANPO/62-102--------------------------------------------------------------------------------
CUE1_ASHGO/66-106--------------------------------------------------------------------------------
CUE1_CANGA/71-111--------------------------------------------------------------------------------
Q6FP56_CANGA/67-107--------------------------------------------------------------------------------
A3LVB3_PICST/67-107--------------------------------------------------------------------------------
A5E2L2_LODEL/84-124--------------------------------------------------------------------------------
CUE1_DEBHA/71-111--------------------------------------------------------------------------------
CUE1_CANAL/73-113--------------------------------------------------------------------------------
Q6C131_YARLI/77-117--------------------------------------------------------------------------------
A0A0D1E3W1_USTMA/47-87--------------------------------------------------------------------------------
Q5KCQ0_CRYNJ/38-78--------------------------------------------------------------------------------
CUE4_SCHPO/49-89--------------------------------------------------------------------------------
Q69PX0_ORYSJ/530-570--------------------------------------------------------------------------------
A7SP29_NEMVE/363-403--------------------------------------------------------------------------------
A0NBH3_ANOGA/443-483--------------------------------------------------------------------------------
HRDL1_CAEEL/433-473--------------------------------------------------------------------------------
AUP1_RAT/297-337--------------------------------------------------------------------------------
AUP1_DANRE/305-345--------------------------------------------------------------------------------
A7SVC7_NEMVE/299-339--------------------------------------------------------------------------------
AUP1_CAEEL/306-346--------------------------------------------------------------------------------
Q5KMK2_CRYNJ/337-378--------------------------------------------------------------------------------
Q2UU48_ASPOR/479-520--------------------------------------------------------------------------------
A7EMQ6_SCLS1/756-797--------------------------------------------------------------------------------
Q6FRP6_CANGA/412-453--------------------------------------------------------------------------------
A7TR29_VANPO/415-456--------------------------------------------------------------------------------
Q6CRC1_KLULA/395-436--------------------------------------------------------------------------------
Q75BB6_ASHGO/370-411--------------------------------------------------------------------------------
CUE2_YEAST/56-97--------------------------------------------------------------------------------
A0DAV7_PARTE/22-65--------------------------------------------------------------------------------
Q86A70_DICDI/5-46--------------------------------------------------------------------------------
A2FNQ7_TRIVA/4-45--------------------------------------------------------------------------------
Q8SZU6_DROME/8-49--------------------------------------------------------------------------------
Q16JC1_AEDAE/9-50--------------------------------------------------------------------------------
CUED1_HUMAN/47-88--------------------------------------------------------------------------------
A7S4P0_NEMVE/32-73--------------------------------------------------------------------------------
YR75_CAEEL/21-62--------------------------------------------------------------------------------
A2EJZ8_TRIVA/9-49--------------------------------------------------------------------------------
Q2UM38_ASPOR/129-170--------------------------------------------------------------------------------
TOLIP_CHICK/230-271--------------------------------------------------------------------------------
A4RVM3_OSTLU/5-46--------------------------------------------------------------------------------
A3LVI3_PICST/205-246--------------------------------------------------------------------------------
A2EPF6_TRIVA/5-46--------------------------------------------------------------------------------
Q6CVA0_KLULA/1-42--------------------------------------------------------------------------------
Q6FJ08_CANGA/4-45--------------------------------------------------------------------------------
A2DJ73_TRIVA/268-309--------------------------------------------------------------------------------
Q6CVA0_KLULA/50-91--------------------------------------------------------------------------------
A7SKY0_NEMVE/412-453--------------------------------------------------------------------------------
Q0CKT2_ASPTN/332-373--------------------------------------------------------------------------------
Q7S3G0_NEUCR/343-384--------------------------------------------------------------------------------
Q16FQ3_AEDAE/441-481--------------------------------------------------------------------------------
A7TEC3_VANPO/313-354--------------------------------------------------------------------------------
CUE3_YEAST/317-358--------------------------------------------------------------------------------
Q754U5_ASHGO/313-354--------------------------------------------------------------------------------
Q6CKH8_KLULA/314-355--------------------------------------------------------------------------------
Q54MZ0_DICDI/3-44--------------------------------------------------------------------------------
A5DWX4_LODEL/377-418--------------------------------------------------------------------------------
A2CEX4_DANRE/479-518--------------------------------------------------------------------------------
AUP1_XENTR/288-327--------------------------------------------------------------------------------
E7LT08_YEASV/86-124--------------------------------------------------------------------------------
E7LYK2_YEASV/64-103--------------------------------------------------------------------------------
E7QH78_YEASZ/9-49--------------------------------------------------------------------------------
E7QIN9_YEASZ/67-105--------------------------------------------------------------------------------
F1QPQ8_DANRE/61-102--------------------------------------------------------------------------------
F1REE7_DANRE/37-77--------------------------------------------------------------------------------
F6T5I7_XENTR/457-497--------------------------------------------------------------------------------
F8W3V1_DANRE/12-51--------------------------------------------------------------------------------
H3DD27_TETNG/468-507--------------------------------------------------------------------------------
I1NXY6_ORYGL/54-94--------------------------------------------------------------------------------
K7EV76_PONAB/340-379--------------------------------------------------------------------------------
Q0WL28_ARATH/310-351--------------------------------------------------------------------------------
Q4WTH8_ASPFU/65-105--------------------------------------------------------------------------------
Q7RWL8_NEUCR/143-181--------------------------------------------------------------------------------
R4GNG2_HUMAN/114-153--------------------------------------------------------------------------------

PF00627

I1LWN1_SOYBN/167-203--------------------------------------------------------------------------------
OSK3_ORYSJ/291-327--------------------------------------------------------------------------------
KIN11_ARATH/294-330--------------------------------------------------------------------------------
MARK1_RAT/331-367--------------------------------------------------------------------------------
MARK2_HUMAN/324-360--------------------------------------------------------------------------------
MARK3_HUMAN/327-363--------------------------------------------------------------------------------
A0D390_PARTE/179-215--------------------------------------------------------------------------------
Q9VBQ3_DROME/422-458--------------------------------------------------------------------------------
LATS1_HUMAN/101-138--------------------------------------------------------------------------------
PTH2_CAEEL/129-166--------------------------------------------------------------------------------
Q9VXR3_DROME/1468-1503--------------------------------------------------------------------------------
Q9VZU7_DROME/696-732--------------------------------------------------------------------------------
RHP23_SCHPO/146-182--------------------------------------------------------------------------------
RAD23_YEAST/147-183--------------------------------------------------------------------------------
Q9V3W9_DROME/158-194--------------------------------------------------------------------------------
RD23A_MOUSE/162-198--------------------------------------------------------------------------------
Q23451_CAEEL/128-164--------------------------------------------------------------------------------
RAD23_ORYSJ/157-196--------------------------------------------------------------------------------
Q9STA6_SOLLC/154-193--------------------------------------------------------------------------------
RD23A_ARATH/145-184--------------------------------------------------------------------------------
RAD23_DICDI/162-198--------------------------------------------------------------------------------
Q9VCD5_DROME/110-146--------------------------------------------------------------------------------
UBP5_HUMAN/723-759--------------------------------------------------------------------------------
UBP13_HUMAN/728-764--------------------------------------------------------------------------------
UCP12_SCHPO/277-312--------------------------------------------------------------------------------
Q9VBQ3_DROME/475-511--------------------------------------------------------------------------------
UBP14_YEAST/586-623--------------------------------------------------------------------------------
Q9SDB9_ORYSJ/250-286--------------------------------------------------------------------------------
UBP5_HUMAN/655-692--------------------------------------------------------------------------------
UBP13_HUMAN/653-690--------------------------------------------------------------------------------
Q9VZU7_DROME/629-666--------------------------------------------------------------------------------
P91502_CAEEL/595-631--------------------------------------------------------------------------------
UBPA_DICDI/629-666--------------------------------------------------------------------------------
UBS3A_DROME/20-57--------------------------------------------------------------------------------
Q9VSC5_DROME/1-36--------------------------------------------------------------------------------
UBPA_DICDI/701-737--------------------------------------------------------------------------------
NUB1_MOUSE/374-410--------------------------------------------------------------------------------
Q9VBQ3_DROME/352-388--------------------------------------------------------------------------------
Q9VRF3_DROME/353-391--------------------------------------------------------------------------------
UBP14_SCHPO/640-676--------------------------------------------------------------------------------
UCP7_SCHPO/183-218--------------------------------------------------------------------------------
Q43780_SOLLC/155-191--------------------------------------------------------------------------------
UBC27_ARATH/153-189--------------------------------------------------------------------------------
GTS1_YEAST/194-231--------------------------------------------------------------------------------
DSK2_SCHPO/313-350--------------------------------------------------------------------------------
DSK2B_ARATH/508-545--------------------------------------------------------------------------------
UBQL1_HUMAN/546-583--------------------------------------------------------------------------------
P90879_CAEEL/263-300--------------------------------------------------------------------------------
RHP23_SCHPO/321-357--------------------------------------------------------------------------------
RAD23_YEAST/356-392--------------------------------------------------------------------------------
RD23A_HUMAN/319-355--------------------------------------------------------------------------------
Q23451_CAEEL/278-316--------------------------------------------------------------------------------
RAD23_DICDI/298-335--------------------------------------------------------------------------------
Q9STA6_SOLLC/344-380--------------------------------------------------------------------------------
Q9VCD5_DROME/245-281--------------------------------------------------------------------------------
RD23A_ARATH/323-359--------------------------------------------------------------------------------
Q9VXF9_DROME/409-445--------------------------------------------------------------------------------
NUB1_MOUSE/489-525--------------------------------------------------------------------------------
CBL_MOUSE/863-899--------------------------------------------------------------------------------
GAWKY_DROME/549-585--------------------------------------------------------------------------------
NUB1_MOUSE/430-466--------------------------------------------------------------------------------
RHBD3_HUMAN/324-359--------------------------------------------------------------------------------
EDE1_YEAST/1341-1377--------------------------------------------------------------------------------
UBE2K_MOUSE/161-197--------------------------------------------------------------------------------

PF09288

Q6C353_YARLI/158-210--------------------------------------------------------------------------------
Q6CSQ8_KLULA/173-227--------------------------------------------------------------------------------
UBC1_YEAST/161-215--------------------------------------------------------------------------------
Q6FVM7_CANGA/159-213--------------------------------------------------------------------------------
A0A0D1D151_USTMA/174-227--------------------------------------------------------------------------------
Q759V3_ASHGO/157-211--------------------------------------------------------------------------------

PF03474

B4K652_DROMO/130-166--------------------------------------------------------------------------------
G3UKZ4_LOXAF/136-172--------------------------------------------------------------------------------
T1KDU7_TETUR/274-308--------------------------------------------------------------------------------
C3YCF3_BRAFL/233-268--------------------------------------------------------------------------------
A8X4G6_CAEBR/147-183--------------------------------------------------------------------------------
Q0V986_XENTR/274-310--------------------------------------------------------------------------------
I3N5R0_ICTTR/319-355--------------------------------------------------------------------------------
H2RIW9_TAKRU/200-236--------------------------------------------------------------------------------
W5KUC2_ASTMX/234-270--------------------------------------------------------------------------------
G1KXF8_ANOCA/239-275--------------------------------------------------------------------------------
F6YPT9_HORSE/128-164--------------------------------------------------------------------------------
B7P132_IXOSC/113-149--------------------------------------------------------------------------------
D6WS24_TRICA/256-292--------------------------------------------------------------------------------
Q178S9_AEDAE/156-192--------------------------------------------------------------------------------
B7PCX2_IXOSC/435-470--------------------------------------------------------------------------------
K1RAP5_CRAGI/198-234--------------------------------------------------------------------------------
H3AVL7_LATCH/180-216--------------------------------------------------------------------------------
DMRTA_MOUSE/314-350--------------------------------------------------------------------------------
Q18248_CAEEL/144-180--------------------------------------------------------------------------------
C3YCF4_BRAFL/285-320--------------------------------------------------------------------------------
J9JUU4_ACYPI/243-279--------------------------------------------------------------------------------
W5KZ34_ASTMX/208-244--------------------------------------------------------------------------------
V8NZ77_OPHHA/110-146--------------------------------------------------------------------------------
F6SHF2_CIOIN/285-320--------------------------------------------------------------------------------
E0VFK2_PEDHC/93-129--------------------------------------------------------------------------------
B3S3S8_TRIAD/89-124--------------------------------------------------------------------------------
W4XD00_STRPU/320-356--------------------------------------------------------------------------------
W5N4B2_LEPOC/277-313--------------------------------------------------------------------------------
A7SV97_NEMVE/49-83--------------------------------------------------------------------------------
G6DMI7_DANPL/197-233--------------------------------------------------------------------------------
H3AN28_LATCH/286-322--------------------------------------------------------------------------------
W5JJ55_ANODA/54-89--------------------------------------------------------------------------------
G3R135_GORGO/329-365--------------------------------------------------------------------------------
T1J9X3_STRMM/252-288--------------------------------------------------------------------------------
E9G633_DAPPU/363-399--------------------------------------------------------------------------------
B3MTG8_DROAN/378-414--------------------------------------------------------------------------------

PF08587

U9USK8_RHIID/258-299--------------------------------------------------------------------------------
I2H4T8_TETBL/344-389--------------------------------------------------------------------------------
B6K4E5_SCHJY/289-331--------------------------------------------------------------------------------
M3D916_SPHMS/360-401--------------------------------------------------------------------------------
SNF1_CANGA/322-367--------------------------------------------------------------------------------
E7KM91_YEASL/249-294--------------------------------------------------------------------------------
K0KNS0_WICCF/293-334--------------------------------------------------------------------------------
S7ZEF0_PENO1/367-408--------------------------------------------------------------------------------
C5MH31_CANTT/329-386--------------------------------------------------------------------------------
F0XT12_GROCL/367-408--------------------------------------------------------------------------------
M3J3A3_CANMX/335-387--------------------------------------------------------------------------------
W1QLV1_OGAPD/298-341--------------------------------------------------------------------------------
D8PL66_SCHCM/313-356--------------------------------------------------------------------------------
A7TNZ1_VANPO/325-371--------------------------------------------------------------------------------
U4KV91_PYROM/363-404--------------------------------------------------------------------------------
Q6CAK0_YARLI/302-345--------------------------------------------------------------------------------
A5E2E8_LODEL/348-397--------------------------------------------------------------------------------
Q6BPA5_DEBHA/329-378--------------------------------------------------------------------------------
D4B296_ARTBC/353-394--------------------------------------------------------------------------------
G8BR28_TETPH/317-364--------------------------------------------------------------------------------
B8MA84_TALSN/374-415--------------------------------------------------------------------------------
J7S3J7_KAZNA/333-378--------------------------------------------------------------------------------
F2Z677_KLULA/321-366--------------------------------------------------------------------------------
G0RE22_HYPJQ/314-355--------------------------------------------------------------------------------
G1XP24_ARTOA/334-375--------------------------------------------------------------------------------
S6E228_ZYGB2/340-385--------------------------------------------------------------------------------
G3B5F5_CANTC/507-556--------------------------------------------------------------------------------
A7TDR3_VANPO/325-369--------------------------------------------------------------------------------
A2QGW4_ASPNC/367-408--------------------------------------------------------------------------------
A5DC34_PICGU/311-358--------------------------------------------------------------------------------
I6NE34_ERECY/322-368--------------------------------------------------------------------------------
G8XZL3_PICSO/324-373--------------------------------------------------------------------------------
Q5A1R0_CANAL/326-382--------------------------------------------------------------------------------
G8BSU9_TETPH/349-401--------------------------------------------------------------------------------
V2XGM0_MONRO/313-356--------------------------------------------------------------------------------
L8G3T2_PSED2/354-395--------------------------------------------------------------------------------
E3REL3_PYRTT/359-400--------------------------------------------------------------------------------
Q758J2_ASHGO/318-364--------------------------------------------------------------------------------
B8PHJ5_POSPM/106-149--------------------------------------------------------------------------------
G3AP00_SPAPN/325-374--------------------------------------------------------------------------------
G8B9P1_CANPC/350-399--------------------------------------------------------------------------------
V5FGW2_BYSSN/369-410--------------------------------------------------------------------------------
M7PGS8_PNEMU/302-343--------------------------------------------------------------------------------
C4Y9B9_CLAL4/313-362--------------------------------------------------------------------------------
C4R0X9_KOMPG/289-334--------------------------------------------------------------------------------
C5DM37_LACTC/317-362--------------------------------------------------------------------------------

PF07223

I1HCE2_BRADI/569-613--------------------------------------------------------------------------------
B9RAX3_RICCO/444-488--------------------------------------------------------------------------------
U5FQ46_POPTR/336-380--------------------------------------------------------------------------------
C5YVI7_SORBI/466-509--------------------------------------------------------------------------------
A0A096QE33_MAIZE/467-511--------------------------------------------------------------------------------
I1HGG6_BRADI/483-526--------------------------------------------------------------------------------
M7ZY27_TRIUA/607-650--------------------------------------------------------------------------------
I1HQA0_BRADI/484-528--------------------------------------------------------------------------------
U5FYB8_POPTR/477-521--------------------------------------------------------------------------------
K7M2P3_SOYBN/486-530--------------------------------------------------------------------------------
B9RVZ9_RICCO/483-526--------------------------------------------------------------------------------
K4CY11_SOLLC/491-535--------------------------------------------------------------------------------
M4D1M6_BRARP/439-483--------------------------------------------------------------------------------
B9DHK3_ARATH/483-527--------------------------------------------------------------------------------
M1AY29_SOLTU/488-532--------------------------------------------------------------------------------

PF16577

W5N0C3_LEPOC/377-436--------------------------------------------------------------------------------
F6VD69_MOUSE/48-109--------------------------------------------------------------------------------

PF06972

B9S9X5_RICCO/30-90--------------------------------------------------------------------------------
F4JQR9_ARATH/15-73--------------------------------------------------------------------------------
GIP1_ARATH/14-74--------------------------------------------------------------------------------
M1C0W5_SOLTU/10-69--------------------------------------------------------------------------------
GIP1L_ARATH/13-73--------------------------------------------------------------------------------
B9GG04_POPTR/13-72--------------------------------------------------------------------------------
M0S185_MUSAM/10-70--------------------------------------------------------------------------------
M4DWX6_BRARP/6-60--------------------------------------------------------------------------------
I1HG05_BRADI/32-91--------------------------------------------------------------------------------
D7MRX5_ARALL/109-167--------------------------------------------------------------------------------
D8QZ59_SELML/24-84--------------------------------------------------------------------------------
K4DFK4_SOLLC/17-73--------------------------------------------------------------------------------
E1Z2G3_CHLVA/20-73--------------------------------------------------------------------------------
D7L2B1_ARALL/16-74--------------------------------------------------------------------------------
K7VTF9_MAIZE/24-83--------------------------------------------------------------------------------
M0SCQ0_MUSAM/14-73--------------------------------------------------------------------------------
B9GT31_POPTR/14-74--------------------------------------------------------------------------------
K7LDS8_SOYBN/21-79--------------------------------------------------------------------------------
K3Z3T8_SETIT/15-73--------------------------------------------------------------------------------
D7L6N2_ARALL/10-70--------------------------------------------------------------------------------
U5D0R9_AMBTC/13-72--------------------------------------------------------------------------------
A9RRL8_PHYPA/13-72--------------------------------------------------------------------------------
D7TD97_VITVI/10-69--------------------------------------------------------------------------------
D7UAL3_VITVI/18-77--------------------------------------------------------------------------------
K7LA00_SOYBN/25-80--------------------------------------------------------------------------------
I1IIY7_BRADI/8-67--------------------------------------------------------------------------------
U5FVE0_POPTR/27-85--------------------------------------------------------------------------------
K7M4A9_SOYBN/15-75--------------------------------------------------------------------------------
C5Z6C7_SORBI/28-86--------------------------------------------------------------------------------
D7MRX5_ARALL/30-88--------------------------------------------------------------------------------
B9GTE9_POPTR/10-69--------------------------------------------------------------------------------
M4EF18_BRARP/15-72--------------------------------------------------------------------------------

PF07499

RUVA_FRATT/167-212--------------------------------------------------------------------------------
RUVA_ACIAD/155-200--------------------------------------------------------------------------------
RUVA_PHOPR/161-206--------------------------------------------------------------------------------
RUVA_CLOAB/156-200--------------------------------------------------------------------------------
RUVA_MYCPE/158-208--------------------------------------------------------------------------------
RUVA_MYCPU/144-188--------------------------------------------------------------------------------
RUVA_CLOB8/153-197--------------------------------------------------------------------------------
RUVA_CHLPB/151-198--------------------------------------------------------------------------------
RUVA_THIDA/145-189--------------------------------------------------------------------------------
RUVA_IDILO/160-205--------------------------------------------------------------------------------
RUVA_DECAR/146-190--------------------------------------------------------------------------------
RUVA_CHLL7/151-198--------------------------------------------------------------------------------
Q6KI20_MYCMO/150-194--------------------------------------------------------------------------------
RUVA_CORJK/161-211--------------------------------------------------------------------------------
RUVA_CHLTE/151-198--------------------------------------------------------------------------------
RUVA_DESAG/151-198--------------------------------------------------------------------------------
RUVA_SALRD/153-201--------------------------------------------------------------------------------
RUVA_CLOTE/152-196--------------------------------------------------------------------------------
RUVA_NITOC/154-199--------------------------------------------------------------------------------
RUVA_NITMU/150-194--------------------------------------------------------------------------------
RUVA_CAUCR/156-204--------------------------------------------------------------------------------
RUVA_STRAW/149-200--------------------------------------------------------------------------------
RUVA_GEOMG/152-198--------------------------------------------------------------------------------
RUVA_CORDI/153-200--------------------------------------------------------------------------------
RUVA_OCEIH/153-200--------------------------------------------------------------------------------
RUVA_ECOLI/158-203--------------------------------------------------------------------------------
RUVA_HELPY/138-182--------------------------------------------------------------------------------
RUVA_SYNPX/151-201--------------------------------------------------------------------------------
RUVA_SYNY3/159-209--------------------------------------------------------------------------------
RUVA_HAEIN/159-204--------------------------------------------------------------------------------
RUVA_BIFLO/152-205--------------------------------------------------------------------------------
RUVA_PSEHT/160-205--------------------------------------------------------------------------------
RUVA_SYNE7/156-206--------------------------------------------------------------------------------
RUVA_PELCD/150-196--------------------------------------------------------------------------------
RUVA_BACSK/151-196--------------------------------------------------------------------------------
RUVA_LACAC/147-193--------------------------------------------------------------------------------
RUVA_COREF/155-202--------------------------------------------------------------------------------
RUVA_CALS8/150-195--------------------------------------------------------------------------------
RUVA_TROWT/144-191--------------------------------------------------------------------------------
RUVA_BDEBA/148-192--------------------------------------------------------------------------------
RUVA_SULDN/143-186--------------------------------------------------------------------------------
RUVA_CARHZ/148-194--------------------------------------------------------------------------------
RUVA_HAEDU/156-201--------------------------------------------------------------------------------
RUVA_LEIXX/150-200--------------------------------------------------------------------------------
RUVA_ZYMMO/163-211--------------------------------------------------------------------------------
RUVA_UREPA/142-190--------------------------------------------------------------------------------
RUVA_ALKMQ/148-193--------------------------------------------------------------------------------
RUVA_CLOTH/155-200--------------------------------------------------------------------------------
RUVA_HAHCH/156-201--------------------------------------------------------------------------------
RUVA_MYCLE/149-200--------------------------------------------------------------------------------
RUVA_LACPL/152-201--------------------------------------------------------------------------------
RUVA_MAGSA/159-207--------------------------------------------------------------------------------
RUVA_COXBU/152-197--------------------------------------------------------------------------------
RUVA_CLOPE/156-200--------------------------------------------------------------------------------
RUVA_SYMTH/155-203--------------------------------------------------------------------------------
RUVA_METCA/155-200--------------------------------------------------------------------------------
RUVA_MOOTA/149-197--------------------------------------------------------------------------------
RUVA_THICR/155-199--------------------------------------------------------------------------------
RUVA_BACSU/154-200--------------------------------------------------------------------------------
RUVA_LACSS/155-201--------------------------------------------------------------------------------
RUVA_COLP3/166-211--------------------------------------------------------------------------------
RUVA_RHOS4/174-221--------------------------------------------------------------------------------
RUVA_NEIG1/149-193--------------------------------------------------------------------------------
RUVA_CHLCH/153-200--------------------------------------------------------------------------------
A6WCH9_KINRD/154-207--------------------------------------------------------------------------------
RUVA_PROAC/150-200--------------------------------------------------------------------------------
RUVA_PELPB/151-198--------------------------------------------------------------------------------
RUVA_WOLSU/143-186--------------------------------------------------------------------------------
RUVA_GLOVI/155-203--------------------------------------------------------------------------------
RUVA_HELHP/153-196--------------------------------------------------------------------------------
RUVA_DEHM1/146-192--------------------------------------------------------------------------------
RUVA_GLUOX/152-199--------------------------------------------------------------------------------
RUVA_EXIS2/149-194--------------------------------------------------------------------------------
RUVA_MYCPN/149-195--------------------------------------------------------------------------------
RUVA_RHORT/162-208--------------------------------------------------------------------------------
RUVA_STRP1/151-196--------------------------------------------------------------------------------
RUVA_CYAA5/160-209--------------------------------------------------------------------------------
C5AB30_BURGB/148-191--------------------------------------------------------------------------------
I3TYC8_ENTFC/70-115--------------------------------------------------------------------------------
K9QJ68_9NOSO/157-206--------------------------------------------------------------------------------
RUVA_STAA8/155-197--------------------------------------------------------------------------------
RUVA_BRUA2/157-204--------------------------------------------------------------------------------
RUVA_LEGPH/154-197--------------------------------------------------------------------------------
RUVA_PSEPK/158-202--------------------------------------------------------------------------------
RUVA_XANCP/148-191--------------------------------------------------------------------------------
RUVA_FUSNN/145-190--------------------------------------------------------------------------------
RUVA_LISMO/155-199--------------------------------------------------------------------------------
RUVA_THET8/145-190--------------------------------------------------------------------------------
RUVA_THEMA/144-186--------------------------------------------------------------------------------

PF16678

E7F0V6_DANRE/453-616LDEICVMAASCQQEPNGSGGNN........GHDGLKGNPVPLSRAEAKRAWLAAGGDNEKAVRQALRDRRVKVKELGSL.
H2ZW95_LATCH/495-644LETIADLATQKGAAMVE...................NTVGVVRLEEARLAWRACEGNIEDAVQECVTMRRRKFQELKVM.
M3ZQS2_XIPMA/503-650LDEICAMAASVQ........................PGGVKLSRAEAKLAWLAAGGNKDKAVRQLLRDRQVKMRELHSL.
L7N3X7_XENTR/417-563LERLLDAASQKAG.......................DTIGALTVEEARDAWVSSGGDMDAAVILCVTERRRKVDALSGL.
H3CTG2_TETNG/446-592LDEICAMAASVH........................REGVKLSRAEARVAWLAAGGDTERAVRQLLRDRRRKMKELHAL.
W5L3N4_ASTMX/453-628LDEICAMAASFQHTPKPLHSTLFNCAGEDGGLEAQKSGAVQLSRAEAKQAWLTAGGDAEKAARQALRNRRAKVKELASL.
H2LH73_ORYLA/407-560LDQIRMLPCETPPGGKP..................PTPLVQLSRAEAKQAWLTAGGDTEKAAKQALRDRLAKVEELQVL.
K7IZK9_NASVI/23-173IETVQILTSTRGKDLGE..................GNDVGTLSAAEAKEVLRLAKGDIWIAVASAIQMRQRKCQSIMAK.
G3PPR4_GASAC/433-581LDQIREAGKEAQS.......................ANGVQLSRAEAKQAWLRAGGDKERAARQALRDRLTKVQELCAL.
H2MDV5_ORYLA/481-633LDEVCAMAASVQLSSQA...................GGTGARSVAEAKLAWLAAGGDTERAARQMLRDRKVKMKELHSL.
C3XU40_BRAFL/1055-1204VASVAAQATEEGKKLKT...................NIVGVITTQEAAEALRKQEGEIPKSIKECIDCRRKKFIYVMEY.
T1HCE2_RHOPR/136-283IDTVVTLATNYGHERKE...................NTVGTISASEARDALRLHDGNVWAAVTECVDQRQRKYAELLSR.
B4JB90_DROGR/979-1128VQTVQSLSTKYGQERAE...................NTIGTISQNEAREALRSSGGNVWQAVADCIQQRQQKYRKLAAK.
T1JM07_STRMM/128-278IDTIVTLVTNYGRDKKE...................NDVGVISTTEAKESLRRHKGNIWAAVTDSVETRQRKFKDLQSR.
G7P9X8_MACFA/483-627LEMVAELAGQQD........................PGLGAFSCQEARKAWLDRHGNLDEAVEECVRTRRRKVQELQSL.
E2BUD1_HARSA/1129-1278VETVQVLVAAQGKELKE...................NTVGVLSPAEAKEALRSVKGDVWNAVATAIRRRQRKCEQIMAK.
I3JHL5_ORENI/463-610LDEICAMAASVQ........................RDSMKLSRAEAKLAWLKTGGDTDKAVRELLRDRKEKMKELHSL.
W5LG34_ASTMX/53-208LDEICALASSVQPESETEP..............SGREDQVLLSRTEAKQAWVSSGGNTQKAVANILRNRAEKLRLLRTL.
A7RQ03_NEMVE/425-572IHTVMLRVTEKSKC......................ADIGNISPEEARQALIEHTGDVEPAVEYCVTQRENKLTKVMDS.
I1E6J1_AMPQE/32-175IKNAIVGVKFEKCNK.....................GSYGIPSRNEIRLVLIECQGDITAAKKLCVKNRKKKINELFKKI
W5JDH8_ANODA/747-897IETVQTLATKYGHEKRE...................NTIGTISIAEARDALRLHKGNIWRAITECIEQRQRKYREIASK.
K1RET9_CRAGI/1065-1218VKSVMAEVAKAGADMNE...................NEVGELSEAEAKNSLKETKGDVEEAVKICTAKRCKLYQEICKV.
H9G897_ANOCA/403-553LEDVAELATQRGEQEPG...................GGLGALTRQEVQTAWVESQGDVDEAVSRCLSARRSKIRELKAL.
H2TJL2_TAKRU/388-536LDQIRTLVATSES.......................DSVVNLSRAEAKQAWLVEGSDVERATRQAQRERLAKVKELSDL.
I3JGL0_ORENI/429-574LDQIRMLVAT..........................SSLQSFSEAEAKQAWLTAGGDTERAARQALRDRLAKVKELRAL.
G3NA67_GASAC/402-550LDEICAMAASVQ........................GDGAKLSRAEAKLAWLSAGGDTNKAVTQLLRDRQVKMKELHSL.

PF10440

M4EY20_BRARP/4-60--------------------------------------------------------------------------------
W5ATU1_WHEAT/4-64--------------------------------------------------------------------------------
J3M322_ORYBR/4-63--------------------------------------------------------------------------------
Q1PFN1_ARATH/10-69--------------------------------------------------------------------------------
F4K7E7_ARATH/4-60--------------------------------------------------------------------------------
I1N9U3_SOYBN/4-60--------------------------------------------------------------------------------
K3ZX78_SETIT/9-70--------------------------------------------------------------------------------
W5GKU5_WHEAT/6-64--------------------------------------------------------------------------------
K3YYH3_SETIT/4-59--------------------------------------------------------------------------------
I1IBN5_BRADI/131-191--------------------------------------------------------------------------------
F4J3N8_ARATH/25-82--------------------------------------------------------------------------------
B9SLL2_RICCO/7-68--------------------------------------------------------------------------------
K3ZX65_SETIT/6-67--------------------------------------------------------------------------------
I1IXS9_BRADI/4-65--------------------------------------------------------------------------------
J3MVL2_ORYBR/7-68--------------------------------------------------------------------------------
I1I063_BRADI/3-61--------------------------------------------------------------------------------
M4CLA6_BRARP/8-69--------------------------------------------------------------------------------
I1IKP9_BRADI/4-69--------------------------------------------------------------------------------
SUVR1_ARATH/4-60--------------------------------------------------------------------------------
D7KPU3_ARALL/7-68--------------------------------------------------------------------------------
C0PJG3_MAIZE/4-61--------------------------------------------------------------------------------
W5BBI8_WHEAT/6-65--------------------------------------------------------------------------------
K3ZWZ7_SETIT/12-73--------------------------------------------------------------------------------
M4FGG9_BRARP/331-388--------------------------------------------------------------------------------
K7LZD4_SOYBN/4-64--------------------------------------------------------------------------------
K4CW89_SOLLC/4-62--------------------------------------------------------------------------------
Q6K9F7_ORYSJ/20-80--------------------------------------------------------------------------------
I1H6C5_BRADI/4-61--------------------------------------------------------------------------------
J3MVL1_ORYBR/35-95--------------------------------------------------------------------------------
F4IG36_ARATH/8-68--------------------------------------------------------------------------------
W1PPN1_AMBTC/10-70--------------------------------------------------------------------------------
K7N559_SOYBN/7-69--------------------------------------------------------------------------------
C5WT72_SORBI/6-67--------------------------------------------------------------------------------
M0X9W3_HORVD/7-68--------------------------------------------------------------------------------
M4F4K4_BRARP/4-60--------------------------------------------------------------------------------
C5X350_SORBI/8-71--------------------------------------------------------------------------------

PF09145

Q6CVQ6_KLULA/133-176--------------------------------------------------------------------------------
Q74Z54_ASHGO/119-160--------------------------------------------------------------------------------
C5E3M8_LACTC/99-142--------------------------------------------------------------------------------
G0VH00_NAUCC/125-168--------------------------------------------------------------------------------
G0W8I1_NAUDC/144-187--------------------------------------------------------------------------------
C5DVX5_ZYGRC/116-159--------------------------------------------------------------------------------
I2H7Y1_TETBL/216-257--------------------------------------------------------------------------------
H2AS28_KAZAF/124-167--------------------------------------------------------------------------------
J8Q0V5_SACAR/133-176--------------------------------------------------------------------------------
Q6FRN9_CANGA/130-172--------------------------------------------------------------------------------
SWA2_YEAST/138-181--------------------------------------------------------------------------------

PF03943

Q5KB75_CRYNJ/635-681--------------------------------------------------------------------------------
B4L4P1_DROMO/624-672--------------------------------------------------------------------------------
G0SET4_CHATD/604-651--------------------------------------------------------------------------------
K1XEL3_MARBU/737-782--------------------------------------------------------------------------------
G3JJS3_CORMM/652-697--------------------------------------------------------------------------------
G7YY76_CLOSI/94-140--------------------------------------------------------------------------------
W5LZ72_LEPOC/466-514--------------------------------------------------------------------------------
G1SY35_RABIT/513-561--------------------------------------------------------------------------------
L5MHV8_MYODS/691-739--------------------------------------------------------------------------------
E3L9C5_PUCGT/608-656--------------------------------------------------------------------------------
G0SVJ1_RHOT2/617-665--------------------------------------------------------------------------------
B7P9R3_IXOSC/76-124--------------------------------------------------------------------------------
Q54LU1_DICDI/333-381--------------------------------------------------------------------------------
R9AGN7_WALI9/530-575--------------------------------------------------------------------------------
F6VE78_HORSE/419-466--------------------------------------------------------------------------------
F0ZVY7_DICPU/222-270--------------------------------------------------------------------------------
F1KXD7_ASCSU/601-647--------------------------------------------------------------------------------
E9HPR7_DAPPU/577-625--------------------------------------------------------------------------------
F7AR15_MOUSE/425-473--------------------------------------------------------------------------------
K0KJ11_WICCF/580-628--------------------------------------------------------------------------------
F0XI66_GROCL/595-641--------------------------------------------------------------------------------
F2U637_SALR5/599-647--------------------------------------------------------------------------------
K1VEX0_TRIAC/566-611--------------------------------------------------------------------------------
J9KX88_ACYPI/498-543--------------------------------------------------------------------------------
B6JXN8_SCHJY/563-611--------------------------------------------------------------------------------
J7S834_KAZNA/560-606--------------------------------------------------------------------------------
G1SVP1_RABIT/555-601--------------------------------------------------------------------------------
G3UHJ2_LOXAF/526-574--------------------------------------------------------------------------------
F2SUD8_TRIRC/647-695--------------------------------------------------------------------------------
X1WQH3_ACYPI/76-122--------------------------------------------------------------------------------
S8AQ06_PENO1/644-692--------------------------------------------------------------------------------
G3RNR7_GORGO/565-617--------------------------------------------------------------------------------
E9IDJ4_SOLIN/589-637--------------------------------------------------------------------------------
D2W3R0_NAEGR/116-164--------------------------------------------------------------------------------
I4YK11_WALMC/472-517--------------------------------------------------------------------------------
G7DTW7_MIXOS/628-674--------------------------------------------------------------------------------
J9L587_ACYPI/702-748--------------------------------------------------------------------------------
A0A068X6G5_HYMMI/609-657--------------------------------------------------------------------------------
T1KYL1_TETUR/570-618--------------------------------------------------------------------------------
E9FRA5_DAPPU/889-937--------------------------------------------------------------------------------
G0VCA2_NAUCC/534-580--------------------------------------------------------------------------------
E2BWH2_HARSA/479-525--------------------------------------------------------------------------------
L5KNV8_PTEAL/148-196--------------------------------------------------------------------------------
G8BSF9_TETPH/525-571--------------------------------------------------------------------------------
E4WRQ9_OIKDI/606-653--------------------------------------------------------------------------------
G8BFF2_CANPC/570-616--------------------------------------------------------------------------------
Q0CUQ6_ASPTN/629-675--------------------------------------------------------------------------------
F6VM51_XENTR/515-561--------------------------------------------------------------------------------
A8PSC4_MALGO/433-478--------------------------------------------------------------------------------
D2VFN8_NAEGR/436-483--------------------------------------------------------------------------------
E4ZXH0_LEPMJ/340-386--------------------------------------------------------------------------------
K5XSW2_AGABU/545-590--------------------------------------------------------------------------------
E9IDT6_SOLIN/499-546--------------------------------------------------------------------------------
C3ZQJ7_BRAFL/156-204--------------------------------------------------------------------------------
J9JRI7_ACYPI/747-793--------------------------------------------------------------------------------
R4XCL5_TAPDE/566-613--------------------------------------------------------------------------------
G6DRX3_DANPL/557-604--------------------------------------------------------------------------------
B0W492_CULQU/610-658--------------------------------------------------------------------------------
E9HYQ3_DAPPU/1190-1236--------------------------------------------------------------------------------
D1ZZZ3_TRICA/492-540--------------------------------------------------------------------------------
F6ZBK7_CIOIN/560-608--------------------------------------------------------------------------------
E7KVF3_YEASL/539-585--------------------------------------------------------------------------------
G0NM87_CAEBE/570-616--------------------------------------------------------------------------------
H6C6P8_EXODN/361-409--------------------------------------------------------------------------------
Q6CTV4_KLULA/541-587--------------------------------------------------------------------------------
Q0UUQ5_PHANO/307-353--------------------------------------------------------------------------------
V5HX14_BYSSN/620-668--------------------------------------------------------------------------------
H0WK93_OTOGA/514-561--------------------------------------------------------------------------------
F8PXV4_SERL3/560-605--------------------------------------------------------------------------------
M7NQ07_PNEMU/557-604--------------------------------------------------------------------------------
K7JG87_NASVI/502-550--------------------------------------------------------------------------------
G3B3M1_CANTC/552-598--------------------------------------------------------------------------------
L2G897_COLGN/607-653--------------------------------------------------------------------------------
F9XC14_ZYMTI/590-636--------------------------------------------------------------------------------
G4LZB4_SCHMA/637-685--------------------------------------------------------------------------------
I3MCG2_ICTTR/504-551--------------------------------------------------------------------------------
S8AEB1_DACHA/596-643--------------------------------------------------------------------------------
F4PQ71_DICFS/552-597--------------------------------------------------------------------------------
K7JZ59_NASVI/501-549--------------------------------------------------------------------------------
F1M355_RAT/502-547--------------------------------------------------------------------------------
T1JGC8_STRMM/579-627--------------------------------------------------------------------------------
A7SAV5_NEMVE/648-696--------------------------------------------------------------------------------
M7T649_EUTLA/611-657--------------------------------------------------------------------------------
T1HA90_RHOPR/588-636--------------------------------------------------------------------------------
F6YJ26_MONDO/575-623--------------------------------------------------------------------------------
H0YDU0_HUMAN/74-122--------------------------------------------------------------------------------
K2SBU5_MACPH/598-644--------------------------------------------------------------------------------
G3SLM1_LOXAF/570-618--------------------------------------------------------------------------------
G3TVU6_LOXAF/523-571--------------------------------------------------------------------------------
F4P6P4_BATDJ/682-727--------------------------------------------------------------------------------
B4JSR1_DROGR/504-550--------------------------------------------------------------------------------
Q7QK79_ANOGA/610-658--------------------------------------------------------------------------------
MEX67_SCHPO/547-595--------------------------------------------------------------------------------
K7J5C6_NASVI/712-760--------------------------------------------------------------------------------
B8MH42_TALSN/594-642--------------------------------------------------------------------------------
G3VFP4_SARHA/604-652--------------------------------------------------------------------------------
R7YJB7_CONA1/601-647--------------------------------------------------------------------------------
G2R2G6_THITE/590-637--------------------------------------------------------------------------------
M2MUW6_BAUCO/606-652--------------------------------------------------------------------------------
H2Z6T4_CIOSA/441-489--------------------------------------------------------------------------------
E9HYQ3_DAPPU/1133-1181--------------------------------------------------------------------------------
A0A088AIA9_APIME/486-534--------------------------------------------------------------------------------
C4R7R9_KOMPG/549-597--------------------------------------------------------------------------------
MEX67_CANAL/569-615--------------------------------------------------------------------------------
F6V2B4_MACMU/231-279--------------------------------------------------------------------------------
T5AI53_OPHSC/605-651--------------------------------------------------------------------------------
D6WXF5_TRICA/557-605--------------------------------------------------------------------------------
M1VWJ6_CLAP2/571-617--------------------------------------------------------------------------------
F4SB63_MELLP/556-604--------------------------------------------------------------------------------
A0A0D1CBA5_USTMA/616-661--------------------------------------------------------------------------------
S8ENB3_FOMPI/545-590--------------------------------------------------------------------------------
U5GY34_USTV1/553-599--------------------------------------------------------------------------------
B3LYG5_DROAN/287-333--------------------------------------------------------------------------------
F6PYN9_MONDO/592-640--------------------------------------------------------------------------------
G3UBE9_LOXAF/559-611--------------------------------------------------------------------------------
Q8R499_MOUSE/622-670--------------------------------------------------------------------------------
D8Q3Y4_SCHCM/566-611--------------------------------------------------------------------------------
B8P4D5_POSPM/146-191--------------------------------------------------------------------------------
E3RM33_PYRTT/267-313--------------------------------------------------------------------------------
H2W522_CAEJA/573-619--------------------------------------------------------------------------------
R8BMH6_TOGMI/564-609--------------------------------------------------------------------------------
G1T8L7_RABIT/565-613--------------------------------------------------------------------------------
F7G9M2_CALJA/508-555--------------------------------------------------------------------------------
C4Y6C5_CLAL4/572-618--------------------------------------------------------------------------------
H0XJG4_OTOGA/507-555--------------------------------------------------------------------------------
Q4WJR0_ASPFU/644-692--------------------------------------------------------------------------------
G1SPN8_RABIT/540-588--------------------------------------------------------------------------------
A0A158NK73_ATTCE/495-543--------------------------------------------------------------------------------
G7Y305_CLOSI/630-677--------------------------------------------------------------------------------
K1S373_CRAGI/551-599--------------------------------------------------------------------------------
W4YYQ9_STRPU/193-241--------------------------------------------------------------------------------
A0A087ZSK2_APIME/474-522--------------------------------------------------------------------------------
B5BM32_CAEEL/561-607--------------------------------------------------------------------------------
H2AN82_KAZAF/495-540--------------------------------------------------------------------------------
G3TEP3_LOXAF/519-567--------------------------------------------------------------------------------
F4W8B0_ACREC/479-526--------------------------------------------------------------------------------
J0D0B1_AURST/523-568--------------------------------------------------------------------------------
A0A068XP13_HYMMI/367-413--------------------------------------------------------------------------------
A9V2I0_MONBE/494-542--------------------------------------------------------------------------------
W1QBF4_OGAPD/541-587--------------------------------------------------------------------------------
D5GCX3_TUBMM/589-637--------------------------------------------------------------------------------
I1G080_AMPQE/561-608--------------------------------------------------------------------------------
G1PB99_MYOLU/566-613--------------------------------------------------------------------------------
E9FRA5_DAPPU/832-880--------------------------------------------------------------------------------
G8YCF0_PICSO/544-590--------------------------------------------------------------------------------
G0R6P6_HYPJQ/603-649--------------------------------------------------------------------------------
H0WGH6_OTOGA/555-601--------------------------------------------------------------------------------
A3M0A0_PICST/566-612--------------------------------------------------------------------------------
E9DE69_COCPS/642-690--------------------------------------------------------------------------------
G1SL70_RABIT/598-646--------------------------------------------------------------------------------
G2Q1H7_MYCTT/597-644--------------------------------------------------------------------------------
E1ZWJ7_CAMFO/420-468--------------------------------------------------------------------------------
F7IC37_CALJA/558-604--------------------------------------------------------------------------------
N4TCL5_FUSC1/606-652--------------------------------------------------------------------------------
A0A0C4DTE4_MAGP6/609-655--------------------------------------------------------------------------------
F6TNP2_XENTR/570-618--------------------------------------------------------------------------------
A8WY32_CAEBR/572-617--------------------------------------------------------------------------------
A5DKM0_PICGU/529-575--------------------------------------------------------------------------------
H9GMR1_ANOCA/558-606--------------------------------------------------------------------------------
F1RYG7_PIG/577-625--------------------------------------------------------------------------------
E0VI83_PEDHC/572-620--------------------------------------------------------------------------------
H3ET57_PRIPA/576-621--------------------------------------------------------------------------------
G3PXQ8_GASAC/582-630--------------------------------------------------------------------------------
B4MYL2_DROWI/572-620--------------------------------------------------------------------------------

PF14555

TYDP2_CHICK/34-76--------------------------------------------------------------------------------
UBX1_EMENI/7-49--------------------------------------------------------------------------------
B9PW09_TOXGV/14-57--------------------------------------------------------------------------------
E3KWG8_PUCGT/7-49--------------------------------------------------------------------------------
Q6A589_CAEEL/12-55--------------------------------------------------------------------------------
F2Z2K0_HUMAN/6-48--------------------------------------------------------------------------------
B6QBH5_TALMQ/18-59--------------------------------------------------------------------------------
O50062_ARATH/120-163--------------------------------------------------------------------------------
F2SWQ8_TRIRC/16-57--------------------------------------------------------------------------------
A6QY73_AJECN/16-57--------------------------------------------------------------------------------
D5G597_TUBMM/14-55--------------------------------------------------------------------------------
E5A7G5_LEPMJ/16-58--------------------------------------------------------------------------------
A7F973_SCLS1/16-57--------------------------------------------------------------------------------
C4K012_UNCRE/3-45--------------------------------------------------------------------------------
A7SCW2_NEMVE/8-50--------------------------------------------------------------------------------
B8MDL3_TALSN/8-50--------------------------------------------------------------------------------
D6WT40_TRICA/5-47--------------------------------------------------------------------------------
C3Y288_BRAFL/5-47--------------------------------------------------------------------------------
E2BNT9_HARSA/5-47--------------------------------------------------------------------------------
B3RL52_TRIAD/6-48--------------------------------------------------------------------------------
C1EHA1_MICCC/2-45--------------------------------------------------------------------------------
B4MIP1_DROWI/5-46--------------------------------------------------------------------------------
F2PQY6_TRIEC/8-50--------------------------------------------------------------------------------
E3S3Y1_PYRTT/3-45--------------------------------------------------------------------------------
C4IZE8_MAIZE/12-55--------------------------------------------------------------------------------
E9FYH5_DAPPU/5-47--------------------------------------------------------------------------------
UBX2_SCHPO/6-48--------------------------------------------------------------------------------
E6ZQC6_SPORE/5-47--------------------------------------------------------------------------------
F0ZVA6_DICPU/4-46--------------------------------------------------------------------------------
A9V0Q4_MONBE/19-62--------------------------------------------------------------------------------
D7MAI3_ARALL/7-49--------------------------------------------------------------------------------
D8LYL9_BLAHO/2-44--------------------------------------------------------------------------------
D7M082_ARALL/6-47--------------------------------------------------------------------------------
D5GLD2_TUBMM/110-152--------------------------------------------------------------------------------
F2PN33_TRIEC/7-49--------------------------------------------------------------------------------
C1MNP9_MICPC/5-48--------------------------------------------------------------------------------
D7L0K1_ARALL/9-50--------------------------------------------------------------------------------
Q6C927_YARLI/12-55--------------------------------------------------------------------------------
E7A1C9_SPORE/3-45--------------------------------------------------------------------------------
A5DQC6_PICGU/8-52--------------------------------------------------------------------------------
C0NTP5_AJECG/10-52--------------------------------------------------------------------------------
F2PRZ6_TRIEC/6-48--------------------------------------------------------------------------------
C4QW21_KOMPG/7-51--------------------------------------------------------------------------------
C3YKP5_BRAFL/16-59--------------------------------------------------------------------------------
B6HMA7_PENRW/3-45--------------------------------------------------------------------------------
F0XJM7_GROCL/5-47--------------------------------------------------------------------------------
E9DBC9_COCPS/9-50--------------------------------------------------------------------------------
Q6P007_DANRE/9-48--------------------------------------------------------------------------------
A5DDG0_PICGU/6-48--------------------------------------------------------------------------------
Q6BQ37_DEBHA/11-57--------------------------------------------------------------------------------
E3QSL9_COLGM/2-44--------------------------------------------------------------------------------
A7RJI9_NEMVE/7-49--------------------------------------------------------------------------------
D5G5L9_TUBMM/2-44--------------------------------------------------------------------------------
D0NIJ4_PHYIT/8-50--------------------------------------------------------------------------------
D7L0V3_ARALL/10-51--------------------------------------------------------------------------------
E4X2U9_OIKDI/11-53--------------------------------------------------------------------------------
E9E2G4_METAQ/11-53--------------------------------------------------------------------------------
F0XBP2_GROCL/17-58--------------------------------------------------------------------------------
Q2GWY8_CHAGB/5-47--------------------------------------------------------------------------------
NSF1C_DICDI/5-47--------------------------------------------------------------------------------
A0A0D2VIE5_CAPO3/21-64--------------------------------------------------------------------------------
E9IBR1_SOLIN/3-44--------------------------------------------------------------------------------
E0VQG6_PEDHC/6-48--------------------------------------------------------------------------------
B6AAH9_CRYMR/9-51--------------------------------------------------------------------------------
E4WR21_OIKDI/22-65--------------------------------------------------------------------------------
Q7Q9P4_ANOGA/5-46--------------------------------------------------------------------------------
E3MCA3_CAERE/6-47--------------------------------------------------------------------------------
A7SUB3_NEMVE/6-48--------------------------------------------------------------------------------
C7Z6D4_NECH7/2-44--------------------------------------------------------------------------------
C5DHE4_LACTC/3-46--------------------------------------------------------------------------------
F2UT65_SALR5/23-66--------------------------------------------------------------------------------
C6HFQ4_AJECH/8-50--------------------------------------------------------------------------------
E3NDY1_CAERE/12-55--------------------------------------------------------------------------------
C4YC44_CLAL4/27-70--------------------------------------------------------------------------------
A9ULP0_XENTR/14-57--------------------------------------------------------------------------------
Q6BK03_DEBHA/2-43--------------------------------------------------------------------------------
B2B6H8_PODAN/7-49--------------------------------------------------------------------------------
DCN1_CAEEL/9-48--------------------------------------------------------------------------------
Q5A0W1_CANAL/9-56--------------------------------------------------------------------------------
A5E803_LODEL/7-54--------------------------------------------------------------------------------
F1R890_DANRE/27-70--------------------------------------------------------------------------------
A7S9M6_NEMVE/13-56--------------------------------------------------------------------------------
A1C843_ASPCL/9-51--------------------------------------------------------------------------------
C4JUU5_UNCRE/9-49--------------------------------------------------------------------------------
E1ZSZ0_CHLVA/5-47--------------------------------------------------------------------------------
B6IJS1_CAEBR/11-54--------------------------------------------------------------------------------
Q6C2H5_YARLI/3-45--------------------------------------------------------------------------------
A3GEZ6_PICST/9-55--------------------------------------------------------------------------------
C1GJS9_PARBD/9-51--------------------------------------------------------------------------------
C3ZEN2_BRAFL/13-55--------------------------------------------------------------------------------
A5DFQ1_PICGU/6-48--------------------------------------------------------------------------------
B7FQE3_PHATC/7-49--------------------------------------------------------------------------------
D6WAX0_TRICA/35-79--------------------------------------------------------------------------------
A9SVK1_PHYPA/5-47--------------------------------------------------------------------------------
F0XQR2_GROCL/3-45--------------------------------------------------------------------------------
Q29L14_DROPS/9-51--------------------------------------------------------------------------------
C5DY54_ZYGRC/2-44--------------------------------------------------------------------------------
E9EC80_METAQ/2-44--------------------------------------------------------------------------------
Q6FRZ1_CANGA/18-63--------------------------------------------------------------------------------
B4J9X4_DROGR/8-51--------------------------------------------------------------------------------
C4JLG5_UNCRE/10-52--------------------------------------------------------------------------------
Q6CMX2_KLULA/4-47--------------------------------------------------------------------------------
F1L242_ASCSU/9-51--------------------------------------------------------------------------------
A1CAL2_ASPCL/7-49--------------------------------------------------------------------------------
E9FTF8_DAPPU/39-80--------------------------------------------------------------------------------
D8QT57_SELML/9-51--------------------------------------------------------------------------------
C5M4D9_CANTT/8-50--------------------------------------------------------------------------------
A7EE19_SCLS1/8-50--------------------------------------------------------------------------------
A0A0D2U416_CAPO3/11-53--------------------------------------------------------------------------------
DCN1_MAGO7/8-48--------------------------------------------------------------------------------
A0E6F9_PARTE/6-49--------------------------------------------------------------------------------
Q17C41_AEDAE/24-66--------------------------------------------------------------------------------
D7M5K9_ARALL/6-48--------------------------------------------------------------------------------
D2VD49_NAEGR/3-46--------------------------------------------------------------------------------
Q75D11_ASHGO/3-45--------------------------------------------------------------------------------
Q7PNN2_ANOGA/6-48--------------------------------------------------------------------------------
E7QB86_YEASZ/6-47--------------------------------------------------------------------------------
D8PW55_SCHCM/8-51--------------------------------------------------------------------------------
D7MH49_ARALL/10-53--------------------------------------------------------------------------------
A0BUB5_PARTE/7-50--------------------------------------------------------------------------------
TYDP2_DANRE/9-51--------------------------------------------------------------------------------
Q7Q3P6_ANOGA/11-54--------------------------------------------------------------------------------
C7YV31_NECH7/5-47--------------------------------------------------------------------------------
E3QXM3_COLGM/11-53--------------------------------------------------------------------------------
D0N3L0_PHYIT/18-60--------------------------------------------------------------------------------
E4ZZB0_LEPMJ/10-52--------------------------------------------------------------------------------
C3ZC83_BRAFL/24-66--------------------------------------------------------------------------------
B7QCT9_IXOSC/12-55--------------------------------------------------------------------------------
E5SHZ1_TRISP/10-52--------------------------------------------------------------------------------
C5MDM6_CANTT/9-55--------------------------------------------------------------------------------
C3Z1N9_BRAFL/24-67--------------------------------------------------------------------------------
B8LDH2_THAPS/193-236--------------------------------------------------------------------------------
A0A0K0JUN0_BRUMA/10-52--------------------------------------------------------------------------------
E9DC17_COCPS/7-49--------------------------------------------------------------------------------
B6QEE1_TALMQ/7-49--------------------------------------------------------------------------------
Q0UAL0_PHANO/9-51--------------------------------------------------------------------------------
B0E453_LACBS/7-48--------------------------------------------------------------------------------
E1Z398_CHLVA/4-46--------------------------------------------------------------------------------
A7RJX7_NEMVE/9-52--------------------------------------------------------------------------------
A9V0L8_MONBE/109-151--------------------------------------------------------------------------------
D3B7A4_POLPA/4-47--------------------------------------------------------------------------------
C9SRT0_VERA1/10-52--------------------------------------------------------------------------------
B8PGV5_POSPM/11-53--------------------------------------------------------------------------------
D2VZD0_NAEGR/18-61--------------------------------------------------------------------------------
B6HJ43_PENRW/9-51--------------------------------------------------------------------------------
A7SCH1_NEMVE/18-60--------------------------------------------------------------------------------
B6K2Q5_SCHJY/74-116--------------------------------------------------------------------------------
C1MTG3_MICPC/18-59--------------------------------------------------------------------------------
A9RJT6_PHYPA/3-46--------------------------------------------------------------------------------
D8QMR0_SELML/12-55--------------------------------------------------------------------------------
E6ZTU8_SPORE/8-49--------------------------------------------------------------------------------
C5DW92_ZYGRC/18-63--------------------------------------------------------------------------------
Q6FXT3_CANGA/5-47--------------------------------------------------------------------------------
Q2HEZ6_CHAGB/4-46--------------------------------------------------------------------------------
A7TJ90_VANPO/18-62--------------------------------------------------------------------------------
E1ZBM6_CHLVA/5-47--------------------------------------------------------------------------------
TYDP2_CAEBR/34-76--------------------------------------------------------------------------------
B9GTU7_POPTR/27-68--------------------------------------------------------------------------------
B9HVN3_POPTR/12-52--------------------------------------------------------------------------------
B9Q2T2_TOXGV/5-47--------------------------------------------------------------------------------
E4WS89_OIKDI/3-45--------------------------------------------------------------------------------
A0A0D2VIH6_CAPO3/2-43--------------------------------------------------------------------------------
F4IUT4_ARATH/103-142--------------------------------------------------------------------------------
G4U8S2_NEUT9/5-44--------------------------------------------------------------------------------
G4VIN2_SCHMA/21-62--------------------------------------------------------------------------------
G7Y2V9_CLOSI/55-93--------------------------------------------------------------------------------
H3CAQ1_TETNG/5-46--------------------------------------------------------------------------------
TYDP2_XENTR/26-64--------------------------------------------------------------------------------
Q59WE0_CANAL/2-43--------------------------------------------------------------------------------
Q7K4I5_DROME/8-48--------------------------------------------------------------------------------
Q9FWC4_ORYSJ/6-47--------------------------------------------------------------------------------
U1NTV9_ASCSU/12-50--------------------------------------------------------------------------------
W1Q7K7_OGAPD/9-53--------------------------------------------------------------------------------

PF11547

E3LUR5_CAERE/181-232--------------------------------------------------------------------------------
J0M342_LOALO/159-209--------------------------------------------------------------------------------
Q7PY72_ANOGA/189-240--------------------------------------------------------------------------------
K7EIB6_ORNAN/174-225--------------------------------------------------------------------------------
B3S209_TRIAD/157-208--------------------------------------------------------------------------------
A0A068XTN0_ECHMU/136-185--------------------------------------------------------------------------------
F7AHP3_CIOIN/184-235--------------------------------------------------------------------------------
G7YDQ8_CLOSI/164-214--------------------------------------------------------------------------------
U6H7P7_HYMMI/159-208--------------------------------------------------------------------------------
I1G1T2_AMPQE/146-197--------------------------------------------------------------------------------

PF02845

Q4WY44_ASPFU/59-100---------DA-DG------V----------------LED-AVERITEG-N---------------
VPS9_YEAST/409-450---------AK-KS------R----------------IGP-CVDALLSL-S---------------
Q75DK5_ASHGO/3-44---------NA-NG------D----------------VDT-ACAMLVER-E---------------
TOLIP_DANRE/232-273---------AQ-QG------N----------------KDA-AINSLLQM-A---------------
ASCC2_DICDI/564-605---------YY-NQ------D----------------VEQ-VINALCDD-S---------------
DEF1_DEBHA/28-69---------EH-NN------I----------------LEV-VIDLIVNN-K---------------
A5DPP2_PICGU/21-62---------EH-NN------L----------------VEV-VIDLIVNN-K---------------
A3GGA0_PICST/22-63---------EN-NN------D----------------VEV-VIDLIING-K---------------
Q0UHZ6_PHANO/76-117---------AS-GG------K----------------VEP-AFNALLSM-S---------------
A3GFZ4_PICST/86-127---------AS-QG------N----------------VDP-AFNALLYL-S---------------
A5DQI0_PICGU/124-165---------AS-EG------K----------------LDP-AFNALLYI-S---------------
TAB3_HUMAN/9-50---------QN-NN------N----------------LEA-CCRALSQE-S---------------
Q0U670_PHANO/46-87---------RN-GG------N----------------ASA-TTERVLGG-R---------------
Q6BNF2_DEBHA/604-645---------RN-DE------N----------------IAL-ASAVILQG-D---------------
Q299A9_DROPS/168-209---------IS-KG------D----------------IDS-ATQILLHR-Q---------------
Q29HR0_DROPS/452-492---------RY-E.------N----------------SEQ-AIAAILDD-N---------------
A5DKD2_PICGU/326-367---------DN-DQ------N----------------VER-ATNILLES-P---------------
Q2H1C9_CHAGB/67-108---------ET-DG------D----------------ENL-AVTRIAEG-T---------------
Q6CCF1_YARLI/36-77---------DT-DG------D----------------LEN-AIIRIADG-H---------------
A6QRJ9_AJECN/60-101---------DA-DG------D----------------LEI-AIERITEG-N---------------
A2QDL6_ASPNC/61-102---------DA-NG------D----------------LEE-AIDRISEG-N---------------
Q0UJ69_PHANO/56-97---------DS-DG------D----------------LER-TIEKISEG-S---------------
A7EMB9_SCLS1/61-102---------ET-DG------D----------------LES-TVERISEG-T---------------
YGVA_SCHPO/78-119---------EA-DR------D----------------LEL-TILHITEG-H---------------
Q5K6W5_CRYNJ/9-50---------DV-KG------N----------------LEE-AAVMITEG-R---------------
Q55BS4_DICDI/38-79---------QT-NF------N----------------VET-TILYIVEG-L---------------
DEF1_CANAL/24-65---------EN-DN------S----------------LEI-VIDLIVNN-K---------------
DEF1_LODEL/31-72---------EK-RN------S----------------LEV-VIDLIVNN-K---------------
Q6CAS3_YARLI/132-173---------AS-GG------E----------------VEP-AFTALLSM-S---------------
A7UXH9_NEUCR/73-114---------AS-RG------Q----------------IEP-AFNALLEM-T---------------
Q2GVS7_CHAGB/75-116---------AS-GG------R----------------IES-AFNALLEM-T---------------
CUE5_SCHPO/18-59---------AS-GY------K----------------LEP-AFNALLGL-S---------------
CUE5_YEAST/98-139---------AS-QG------V----------------LSP-AFNALLFL-S---------------
Q75C34_ASHGO/99-140---------AS-QG------I----------------LDP-AFSALLFL-S---------------
Q6CJT9_KLULA/91-132---------AS-QG------Q----------------LDP-AFNALLFI-S---------------
A7TLU9_VANPO/108-149---------AS-QG------S----------------IDP-SFNALLYL-S---------------
Q5A2E6_CANAL/123-164---------AS-QG------N----------------PDP-AFNALLYI-S---------------
A5DWM8_LODEL/145-186---------AS-QG------N----------------PEP-AFSALLYL-S---------------
Q6BQ94_DEBHA/157-198---------AS-QG------N----------------PDP-AFNALLYI-S---------------
A4HRE2_LEIIN/565-606---------QH-HG------A----------------FAD-AYNVLFCA-Q---------------
A4H345_LEIBR/550-591---------QH-HG------A----------------FEE-AYSVLLCA-Q---------------
A2VCY9_XENTR/9-50---------QN-NN------N----------------LDA-CCAVLSQE-S---------------
TAB2_DANRE/9-50---------QN-KS------D----------------LAA-CCEYLTKV-S---------------
A7SCG6_NEMVE/14-55---------QH-AG------N----------------LEK-CIVILSQE-S---------------
CUE3_SCHPO/272-313---------AS-LG------N----------------IDA-ACESVITS-S---------------
A0A0D1ED14_USTMA/88-129---------SR-GG------N----------------QEA-AINALLQM-S---------------
Q5KNC6_CRYNJ/50-91---------TC-GG------S----------------TDR-AIEQLLAM-S---------------
A6RDW9_AJECN/50-91---------RN-GG------N----------------MAA-TTERVLSG-R---------------
A1C6F4_ASPCL/48-89---------RN-RG------N----------------AAA-TTERILSG-R---------------
A7TT41_VANPO/62-102---------TQ-TG------S----------------VEE-TVEKFLRG-E---------------
CUE1_ASHGO/66-106---------ER-SG------S----------------VEA-TVERYLRG-E---------------
CUE1_CANGA/71-111---------ES-TG------S----------------VEQ-TMERYFNG-E---------------
Q6FP56_CANGA/67-107---------EK-TG------S----------------VEL-TVERLLKG-E---------------
A3LVB3_PICST/67-107---------SN-TG------S----------------VEL-TINRYMEL-G---------------
A5E2L2_LODEL/84-124---------EA-TG------S----------------VEV-TIDKYMET-G---------------
CUE1_DEBHA/71-111---------ER-SG------S----------------VEV-TMERYMET-G---------------
CUE1_CANAL/73-113---------ET-TG------N----------------VEA-TVNRFMEL-G---------------
Q6C131_YARLI/77-117---------EK-TG------N----------------IEA-TVERYLSE-G---------------
A0A0D1E3W1_USTMA/47-87---------QR-SG------S----------------VEE-TCERILNE-G---------------
Q5KCQ0_CRYNJ/38-78---------SR-TR------S----------------AQA-TSEEILER-G---------------
CUE4_SCHPO/49-89---------QK-TK------N----------------VDA-TIENALRG-Q---------------
Q69PX0_ORYSJ/530-570---------MR-TN------N----------------INA-TVNNLLLM-Q---------------
A7SP29_NEMVE/363-403---------RQ-TH------S----------------IEL-TTDNFLEG-R---------------
A0NBH3_ANOGA/443-483---------QI-SR------S----------------IEV-TIDNILEG-R---------------
HRDL1_CAEEL/433-473---------RQ-SG------S----------------AQS-TIENILEG-R---------------
AUP1_RAT/297-337---------AR-TG------C----------------VDL-TITNLLEG-A---------------
AUP1_DANRE/305-345---------LQ-TN------C----------------VDT-TITNLLER-T---------------
A7SVC7_NEMVE/299-339---------SK-SR------C----------------VDT-TISNILEG-R---------------
AUP1_CAEEL/306-346---------KT-RS------Q----------------T.T-TVNNLKAG-K---------------
Q5KMK2_CRYNJ/337-378---------RN-DY------N----------------TAQ-AVEALLQQ-S---------------
Q2UU48_ASPOR/479-520---------MK-EG------R----------------VGL-AVDACLAL-S---------------
A7EMQ6_SCLS1/756-797---------QK-EG------R----------------VGL-AVDACLAL-S---------------
Q6FRP6_CANGA/412-453---------AK-KH------R----------------IGP-CVDVLLTL-S---------------
A7TR29_VANPO/415-456---------AK-KY------R----------------LGV-CVDVLLSF-T---------------
Q6CRC1_KLULA/395-436---------AS-KY------R----------------VGV-CVDSLLEM-A---------------
Q75BB6_ASHGO/370-411---------AT-RY------R----------------MGA-CVDSLLSI-S---------------
CUE2_YEAST/56-97---------IN-EK------S----------------VES-TISDLLNY-E---------------
A0DAV7_PARTE/22-65---------SE-KA------N----------------IEN-TVSKLLEL-Q---------------
Q86A70_DICDI/5-46---------QN-KG------H----------------MEK-TIDALLEM-N---------------
A2FNQ7_TRIVA/4-45---------SK-NG------D----------------LQN-TINALLKM-K---------------
Q8SZU6_DROME/8-49---------AN-LG------A----------------VDQ-TIDALLAM-S---------------
Q16JC1_AEDAE/9-50---------AN-QG------A----------------VDA-TIDQLLAM-S---------------
CUED1_HUMAN/47-88---------AN-SG------A----------------VDA-TIDQLLQM-N---------------
A7S4P0_NEMVE/32-73---------AN-NG------L----------------VDA-TIDQLLTM-G---------------
YR75_CAEEL/21-62---------KY-DG------D----------------VSA-TINELLYD-N---------------
A2EJZ8_TRIVA/9-49---------AE-CG------S----------------FER-TMDRLLQG-D---------------
Q2UM38_ASPOR/129-170---------KS-NG------D----------------VDR-SMDVLLNL-T---------------
TOLIP_CHICK/230-271---------AQ-RG------N----------------KNA-AINSLLQM-T---------------
A4RVM3_OSTLU/5-46---------AR-DG------H----------------MES-AVEKLLAM-S---------------
A3LVI3_PICST/205-246---------LS-NG------D----------------IEV-AIHKLLEG-V---------------
A2EPF6_TRIVA/5-46---------DQ-NN------Y----------------VPN-AINILLEL-K---------------
Q6CVA0_KLULA/1-42---------SS-NN------D----------------INL-ACSILLSE-V---------------
Q6FJ08_CANGA/4-45---------DS-NN------D----------------VNL-ACSMVISG-T---------------
A2DJ73_TRIVA/268-309---------QS-HN------D----------------VNG-AVVTLSSM-N---------------
Q6CVA0_KLULA/50-91---------TT-NG------D----------------VDE-AIQDLLCV-N---------------
A7SKY0_NEMVE/412-453---------HF-NY------S----------------IEQ-VVNSILEN-T---------------
Q0CKT2_ASPTN/332-373---------FY-ND------N----------------PET-VVAHLLDG-S---------------
Q7S3G0_NEUCR/343-384---------HY-SS------D----------------TEQ-VVACLLED-S---------------
Q16FQ3_AEDAE/441-481---------RY-E.------D----------------VEQ-AIAAVLEG-N---------------
A7TEC3_VANPO/313-354---------RY-DN------N----------------VEL-LTNILFEN-P---------------
CUE3_YEAST/317-358---------AY-DN------N----------------IEL-VTNKIFED-P---------------
Q754U5_ASHGO/313-354---------TH-EN------N----------------VEL-VINDLFED-P---------------
Q6CKH8_KLULA/314-355---------RY-DN------N----------------TEV-IINNLFEN-P---------------
Q54MZ0_DICDI/3-44---------TC-NN------N----------------IEQ-TINYLVEN-I---------------
A5DWX4_LODEL/377-418---------QY-NN------D----------------SEL-VTDILLEN-P---------------
A2CEX4_DANRE/479-518---------EY-GY------N----------------SEL-VINNILED-.---------------
AUP1_XENTR/288-327---------GH-TG------C----------------IDT-TITNFLEG-R---------------
E7LT08_YEASV/86-124---------AS-QG------V----------------LEP-AFNSLLYY-S---------------
E7LYK2_YEASV/64-103---------RN-TG------S----------------IEH-TMENIFAG-.---------------
E7QH78_YEASZ/9-49---------EN-NN------D----------------LDL-TIGLLLKE-.---------------
E7QIN9_YEASZ/67-105---------EN-TG------S----------------VEE-TVERYLRG-.---------------
F1QPQ8_DANRE/61-102---------EV-DF------K----------------VDN-AMDSLLEM-S---------------
F1REE7_DANRE/37-77---------AN-HG------A----------------VDS-TIDQLLQM-S---------------
F6T5I7_XENTR/457-497---------EY-EH------N----------------PER-VINNLLED-N---------------
F8W3V1_DANRE/12-51---------QN-NN------N----------------ADL-CYHLLAQE-S---------------
H3DD27_TETNG/468-507---------EY-DY------N----------------SET-VINNILED-.---------------
I1NXY6_ORYGL/54-94---------AS-GD------D----------------IDS-AIKSLNEL-.---------------
K7EV76_PONAB/340-379---------YY-HY------D----------------PEQ-VINNILEE-.---------------
Q0WL28_ARATH/310-351---------AY-NQ------N----------------PEE-VIQRILEG-T---------------
Q4WTH8_ASPFU/65-105---------AS-NW------D----------------IER-AFHALLGM-.---------------
Q7RWL8_NEUCR/143-181---------QS-GG------D----------------LDR-AFDDLLTR-.---------------
R4GNG2_HUMAN/114-153---------QL-TR------S----------------VEI-TTDNILEG-R---------------

PF00627

I1LWN1_SOYBN/167-203---------NR-IQ-..---N----------------EGT-VTYYL--------------------
OSK3_ORYSJ/291-327---------NR-LQ-..---N----------------EAT-VAYYL--------------------
KIN11_ARATH/294-330---------NR-TQ-..---N----------------DAT-VTYYL--------------------
MARK1_RAT/331-367---------SQ-KY-..---D----------------EVM-ATYIL--------------------
MARK2_HUMAN/324-360---------GQ-RY-..---N----------------EVM-ATYLL--------------------
MARK3_HUMAN/327-363---------KM-KY-..---D----------------EIT-ATYLL--------------------
A0D390_PARTE/179-215---------QT-NN-..---N----------------FDK-ALDIV--------------------
Q9VBQ3_DROME/422-458---------RT-KN-..---N----------------LDR-SLDLL--------------------
LATS1_HUMAN/101-138---------KT-NN-.R---S----------------IEA-AIEFI--------------------
PTH2_CAEEL/129-166---------RT-NS-.A---G----------------VEQ-AVAWI--------------------
Q9VXR3_DROME/1468-1503---------RT-NA-..---S----------------LEE-ATDYL--------------------
Q9VZU7_DROME/696-732---------AT-DG-..---N----------------VER-ATDWI--------------------
RHP23_SCHPO/146-182---------AA-FN-..---N----------------PDR-AVEYL--------------------
RAD23_YEAST/147-183---------AA-FN-..---N----------------PDR-AVEYL--------------------
Q9V3W9_DROME/158-194---------AS-YN-..---N----------------PER-AVEYL--------------------
RD23A_MOUSE/162-198---------AS-YN-..---N----------------PHR-AVEYL--------------------
Q23451_CAEEL/128-164---------AA-FW-..---N----------------PDR-AVEFL--------------------
RAD23_ORYSJ/157-196---------AA-FN-..---N----------------PER-AVEYL--------------------
Q9STA6_SOLLC/154-193---------AA-YN-..---N----------------PER-AVDYL--------------------
RD23A_ARATH/145-184---------AA-YN-..---N----------------PER-AVDYL--------------------
RAD23_DICDI/162-198---------LT-FN-..---N----------------AER-AIEYL--------------------
Q9VCD5_DROME/110-146---------AS-FN-..---H----------------PER-AIEYL--------------------
UBP5_HUMAN/723-759---------AT-NN-..---S----------------LER-AVDWI--------------------
UBP13_HUMAN/728-764---------AT-NN-..---N----------------LER-ALDWI--------------------
UCP12_SCHPO/277-312---------YC-V.-..---S----------------LED-ALEWL--------------------
Q9VBQ3_DROME/475-511---------TT-GN-..---S----------------FHK-SLKFL--------------------
UBP14_YEAST/586-623---------NT-GN-.Q---D----------------AES-AMNWL--------------------
Q9SDB9_ORYSJ/250-286---------RA-RN-..---D----------------INT-ATNIL--------------------
UBP5_HUMAN/655-692---------YT-GN-.S---G----------------AEA-AMNWV--------------------
UBP13_HUMAN/653-690---------FT-GN-.M---G----------------AEV-AFNWI--------------------
Q9VZU7_DROME/629-666---------HT-KN-.S---G----------------LEA-ASNWL--------------------
P91502_CAEEL/595-631---------YS-NG-..---N----------------VEI-ASNWL--------------------
UBPA_DICDI/629-666---------AT-GG-.K---D----------------AEL-AMNWI--------------------
UBS3A_DROME/20-57---------ST-GN-.R---G----------------VQI-ASDWL--------------------
Q9VSC5_DROME/1-36---------VT-SN-.K---G----------------VEP-AMEWL--------------------
UBPA_DICDI/701-737---------NT-KG-..---N----------------LER-AADWL--------------------
NUB1_MOUSE/374-410---------AC-DG-..---N----------------VDH-AATHI--------------------
Q9VBQ3_DROME/352-388---------SC-AG-..---Q----------------VDR-AIQYI--------------------
Q9VRF3_DROME/353-391---------SC-KG-GT---A----------------VEQ-AVQFI--------------------
UBP14_SCHPO/640-676---------ES-NN-..---N----------------IER-AVDWI--------------------
UCP7_SCHPO/183-218---------NS-G.-..---S----------------LED-AIEYI--------------------
Q43780_SOLLC/155-191---------AN-GW-..---D----------------ENM-ALEKL--------------------
UBC27_ARATH/153-189---------SS-GG-..---D----------------ENL-ALEKL--------------------
GTS1_YEAST/194-231---------SA-HG-..---N----------------INR-AIDYL--------------------
DSK2_SCHPO/313-350---------RS-GG-..---N----------------VQG-AIESL--------------------
DSK2B_ARATH/508-545---------AT-NG-..---N----------------VNA-AVERL--------------------
UBQL1_HUMAN/546-583---------AT-GG-..---D----------------INA-AIERL--------------------
P90879_CAEEL/263-300---------QA-NG-..---D----------------VQA-AMEFL--------------------
RHP23_SCHPO/321-357---------AC-DK-..---N----------------EEL-AANYL--------------------
RAD23_YEAST/356-392---------AC-DK-..---N----------------EEA-AANIL--------------------
RD23A_HUMAN/319-355---------AC-EK-..---N----------------ENL-AANFL--------------------
Q23451_CAEEL/278-316---------AC-DK-..---N----------------EEA-AINFI--------------------
RAD23_DICDI/298-335---------AC-DK-..---N----------------EEL-TASYL--------------------
Q9STA6_SOLLC/344-380---------AC-NK-..---N----------------EEL-AANYL--------------------
Q9VCD5_DROME/245-281---------AC-DK-..---D----------------EQL-AAEVL--------------------
RD23A_ARATH/323-359---------SC-DR-..---N----------------EEL-AANYL--------------------
Q9VXF9_DROME/409-445---------LC-GG-..---N----------------KQA-ARSVL--------------------
NUB1_MOUSE/489-525---------VF-GG-..---N----------------VQL-AAQTL--------------------
CBL_MOUSE/863-899---------IA-HN-..---N----------------IEM-AKNIL--------------------
GAWKY_DROME/549-585---------IA-NM-..---N----------------IEE-AADML--------------------
NUB1_MOUSE/430-466---------QA-RG-..---N----------------LDD-ALKVL--------------------
RHBD3_HUMAN/324-359---------AT-G.-..---R----------------VEG-AVSLL--------------------
EDE1_YEAST/1341-1377---------KC-NW-..---D----------------LEA-ATNFL--------------------
UBE2K_MOUSE/161-197---------SK-SW-..---D----------------VET-ATELL--------------------

PF09288

Q6C353_YARLI/158-210-----K..PQS-QE------D----------------EQR-VVEELLN------------------
Q6CSQ8_KLULA/173-227-----SMSMED-NE------T----------------ANK-ILEELLK------------------
UBC1_YEAST/161-215-----SLDPND-NN------T----------------ANR-IIEELLK------------------
Q6FVM7_CANGA/159-213-----SLDPND-NA------T----------------VNK-IIEELLK------------------
A0A0D1D151_USTMA/174-227-----GAN.VR-NI------T----------------DDT-VLNELLK------------------
Q759V3_ASHGO/157-211-----TMDKGD-NE------K----------------ANI-ILEELLK------------------

PF03474

B4K652_DROMO/130-166---------RC-DL------D----------------LIR-AIENV--------------------
G3UKZ4_LOXAF/136-172---------GC-GG------D----------------LVS-AVEVL--------------------
T1KDU7_TETUR/274-308---------GC-NG------D----------------VIK-AIEQF--------------------
C3YCF3_BRAFL/233-268---------GC-GG------D----------------LDR-ALEKV--------------------
A8X4G6_CAEBR/147-183---------AY-NG------N----------------VLQ-AIEHF--------------------
Q0V986_XENTR/274-310---------YC-KG------D----------------VVQ-AIEFV--------------------
I3N5R0_ICTTR/319-355---------FC-KG------D----------------VVQ-AIEQI--------------------
H2RIW9_TAKRU/200-236---------TC-RG------D----------------VVR-SIELL--------------------
W5KUC2_ASTMX/234-270---------MC-SG------D----------------IVK-AIEAL--------------------
G1KXF8_ANOCA/239-275---------FC-RG------D----------------IAQ-AIEQI--------------------
F6YPT9_HORSE/128-164---------GY-GG------D----------------VVQ-AIEQV--------------------
B7P132_IXOSC/113-149---------RC-QG------D----------------VLL-AIDEV--------------------
D6WS24_TRICA/256-292---------RC-KG------D----------------VVQ-AMEMM--------------------
Q178S9_AEDAE/156-192---------RY-RG------D----------------VVQ-AMEAM--------------------
B7PCX2_IXOSC/435-470---------SC-DG------D----------------LIR-AIEQL--------------------
K1RAP5_CRAGI/198-234---------GC-NG------D----------------VVQ-TIEQV--------------------
H3AVL7_LATCH/180-216---------GC-GG------D----------------VVQ-AIEQI--------------------
DMRTA_MOUSE/314-350---------FC-KG------D----------------VVQ-AIEQI--------------------
Q18248_CAEEL/144-180---------AC-HG------N----------------VLQ-AIEHF--------------------
C3YCF4_BRAFL/285-320---------GC-NG------D----------------LVS-AIEVL--------------------
J9JUU4_ACYPI/243-279---------RC-NG------D----------------VLH-AIELM--------------------
W5KZ34_ASTMX/208-244---------GC-GG------D----------------LVG-AIEIL--------------------
V8NZ77_OPHHA/110-146---------LC-RG------D----------------IVQ-AIEQI--------------------
F6SHF2_CIOIN/285-320---------LC-NG------D----------------VVK-AIEK.--------------------
E0VFK2_PEDHC/93-129---------RC-KG------D----------------VLQ-ALEIM--------------------
B3S3S8_TRIAD/89-124---------AC-NG------D----------------LVQ-AIEQI--------------------
W4XD00_STRPU/320-356---------GC-DG------D----------------VVQ-AIEQL--------------------
W5N4B2_LEPOC/277-313---------TC-KG------D----------------IVK-AIELV--------------------
A7SV97_NEMVE/49-83---------GC-SG------D----------------IVQ-TIECV--------------------
G6DMI7_DANPL/197-233---------RC-KG------D----------------VVA-AMEMM--------------------
H3AN28_LATCH/286-322---------DC-KG------D----------------VVQ-AIDQV--------------------
W5JJ55_ANODA/54-89---------RC-DS------D----------------LLK-AIEQ.--------------------
G3R135_GORGO/329-365---------FC-KG------D----------------VVQ-AIEQV--------------------
T1J9X3_STRMM/252-288---------TC-QG------D----------------VVQ-AIEHV--------------------
E9G633_DAPPU/363-399---------RC-DG------D----------------VLR-AIEQL--------------------
B3MTG8_DROAN/378-414---------RF-RG------D----------------VLQ-AMECM--------------------

PF08587

U9USK8_RHIID/258-299---------EP-EN------N................QIK-VAYQLVVD-N---------------
I2H4T8_TETBL/344-389---------SG-ED------N............LPLNEIR-DAYLLIRE-N---------------
B6K4E5_SCHJY/289-331---------DV-NE------N...............NKIK-EAYNILHE-N---------------
M3D916_SPHMS/360-401---------KD-EP------S................AIK-DAYLIVRE-N---------------
SNF1_CANGA/322-367---------SS-ED------T............PAYNEIR-NAYILIKD-N---------------
E7KM91_YEASL/249-294---------SS-ED------T............PAFNEIR-DAYMLIKE-N---------------
K0KNS0_WICCF/293-334---------KN-LQ------N................EIM-DGYMLIKE-N---------------
S7ZEF0_PENO1/367-408---------HP-EP------S................AIK-DAFSIVVE-N---------------
C5MH31_CANTT/329-386---------KA-NR------EAAAGGATPNNQSKSTNEVL-DAYLLMKE-N---------------
F0XT12_GROCL/367-408---------AN-VP------S................AIK-DAYMIVRD-N---------------
M3J3A3_CANMX/335-387---------RA-NK------Q.....PAGSNSTQANNEIL-DAYLLMKE-N---------------
W1QLV1_OGAPD/298-341---------IG-RT------P.............ETEEIL-DSYQLMKS-N---------------
D8PL66_SCHCM/313-356---------RD-DG------I.............QGNAVK-VAYLLLR.-.---------------
A7TNZ1_VANPO/325-371---------SK-ST------D...........NPSHNEIK-EAYLLIKE-N---------------
U4KV91_PYROM/363-404---------KN-EP------S................AIK-DAYMIVRE-N---------------
Q6CAK0_YARLI/302-345---------AP-KS------D..............GTEIR-DAYDLMKE-N---------------
A5E2E8_LODEL/348-397---------KS-NE------H........RHPQEQSNEIL-DAYLLMKE-N---------------
Q6BPA5_DEBHA/329-378---------KC-NQ------H........NAPQQQSNEII-DAYLLMRE-N---------------
D4B296_ARTBC/353-394---------KP-EP------S................AIK-DAFFIVVE-N---------------
G8BR28_TETPH/317-364---------SG-DV------D..........TNPSHHEIK-EAYLLIKE-N---------------
B8MA84_TALSN/374-415---------KA-EP------S................AVK-DAFFIIAE-N---------------
J7S3J7_KAZNA/333-378---------SN-ED------N............SNLNEIR-DAYMLMKE-N---------------
F2Z677_KLULA/321-366---------SD-ED------H............PSLNEIR-DAYQLIKE-N---------------
G0RE22_HYPJQ/314-355---------SD-EP------S................AIK-DAYMIVRE-N---------------
G1XP24_ARTOA/334-375---------RP-EP------S................AIK-DAYDILKH-N---------------
S6E228_ZYGB2/340-385---------SS-NR------T............PVLNEIR-EAYMLIKE-N---------------
G3B5F5_CANTC/507-556---------RY-NN------A........PTPQQKSNEIV-DAYLLMRD-N---------------
A7TDR3_VANPO/325-369---------ST-ED------N............PVSNEIR-DAYMLIKE-.---------------
A2QGW4_ASPNC/367-408---------NP-EP------S................AIK-DAFFIIME-N---------------
A5DC34_PICGU/311-358---------RA-NE------S..........GTQPSSEIL-DAYLLMKE-N---------------
I6NE34_ERECY/322-368---------NA-ND------S...........DPSIAEIR-DAYMLIKE-N---------------
G8XZL3_PICSO/324-373---------HS-NE------Q........SSPQQQSNEVL-DAYMLMKD-N---------------
Q5A1R0_CANAL/326-382---------KA-NK------QVAAGNSS.SQQSKSSNEIL-DAYLLMKE-N---------------
G8BSU9_TETPH/349-401---------TE-IA------E.....DSNSPNSSMVSEIK-NAYTLLKE-N---------------
V2XGM0_MONRO/313-356---------RE-DG------V.............NGNAVK-VAYMLLR.-.---------------
L8G3T2_PSED2/354-395---------AD-EP------S................AIK-DAYLIVRE-N---------------
E3REL3_PYRTT/359-400---------RD-EP------S................AIK-DAYLIVRE-N---------------
Q758J2_ASHGO/318-364---------DP-NQ------T...........DPTVLEIR-DAYLLLKE-N---------------
B8PHJ5_POSPM/106-149---------RD-DG------P.............QGNAVK-VAYMLLR.-.---------------
G3AP00_SPAPN/325-374---------RC-NK------S........NAPQQQSNEIL-DAYLLMKE-N---------------
G8B9P1_CANPC/350-399---------KC-NK------H........SSPQSQKNEIL-DAYLLMKE-N---------------
V5FGW2_BYSSN/369-410---------RP-EP------S................AVK-DAFFIIAE-N---------------
M7PGS8_PNEMU/302-343---------RS-DC------N................EIK-DAYRLVAE-N---------------
C4Y9B9_CLAL4/313-362---------AC-NK------Q........QYPQQQSNEIL-DAYLLMKE-N---------------
C4R0X9_KOMPG/289-334---------TG-RK------P............DETNEVF-DAYELMKE-N---------------
C5DM37_LACTC/317-362---------SE-ED------N............PALKEIR-DAYLLIKE-N---------------

PF07223

I1HCE2_BRADI/569-613---------EN-GQ-NV---D----------------LNV-VLDKLMND-S---------------
B9RAX3_RICCO/444-488---------EN-GQ-SV---D----------------LNV-VLDKLMNN-G---------------
U5FQ46_POPTR/336-380---------EN-GQ-SV---D----------------LNA-VLDKLMNS-G---------------
C5YVI7_SORBI/466-509---------AA-GQ-PA---E----------------YNH-LHDRLSSV-S---------------
A0A096QE33_MAIZE/467-511---------DA-GQ-PA---E----------------CNT-LHDRLSSV-T---------------
I1HGG6_BRADI/483-526---------TA-GQ-PV---E----------------FNT-FHDGLSSC-G---------------
M7ZY27_TRIUA/607-650---------AA-GQ-PV---E----------------YNT-FHDGLSSV-G---------------
I1HQA0_BRADI/484-528---------SA-AR-PA---D----------------SGV-IADKLNAG-S---------------
U5FYB8_POPTR/477-521---------EG-GE-PV---D----------------FNS-VLDRLKVH-S---------------
K7M2P3_SOYBN/486-530---------ET-QL-PI---D----------------FNS-VHDRLDVH-N---------------
B9RVZ9_RICCO/483-526---------ES-GQ-PL---D----------------FNA-VLDRLS.N-S---------------
K4CY11_SOLLC/491-535---------ES-GQ-TV---D----------------FNT-VLDRLNGH-S---------------
M4D1M6_BRARP/439-483---------ES-GQ-AI---D----------------FNA-LLDRLSVQ-S---------------
B9DHK3_ARATH/483-527---------EN-GQ-AV---D----------------LNV-VLDKLMNG-D---------------
M1AY29_SOLTU/488-532---------ES-GQ-TV---D----------------LNT-VLDKLMND-G---------------

PF16577

W5N0C3_LEPOC/377-436---------TK-NF------D----------------IGA-AMDAIHFS-K..PSA----------
F6VD69_MOUSE/48-109---------TK-NY------D----------------IGA-ALDTIQYS-KHPPPL----------

PF06972

B9S9X5_RICCO/30-90---------DC-SM------D----------------PNE-TAQKLLYI.DTFHEV.KSKRDRRKE
F4JQR9_ARATH/15-73---------EC-DM------N----------------PDE-AVNRLLSQ.DTFHEV.KSKREKKKE
GIP1_ARATH/14-74---------EC-FS------D----------------PHE-TTQKLLYL.DTFHEV.RSKRERKKE
M1C0W5_SOLTU/10-69---------EC-NM------D----------------PND-TAQKLLYL.DTFHEV.KKKRDRKK.
GIP1L_ARATH/13-73---------DS-FN------D----------------PHE-TAQKLLFL.DTFHEV.RSKREKKKE
B9GG04_POPTR/13-72---------DC-AM------D----------------LDD-TAQKLLYL.DTFHEV.KRKHDRRK.
M0S185_MUSAM/10-70---------DC-GM------D----------------PNE-TAQKLLLQ.GILSPLPSSKRDKRKE
M4DWX6_BRARP/6-60---------EC-HM------D----------------PNE-TVIRLISQ.DAFQEV.KSKRNKNK.
I1HG05_BRADI/32-91---------DC-GM------D----------------PDV-AVERLISQ.DPFHEV.RRKRNNKKE
D7MRX5_ARALL/109-167---------EC-NM------D----------------ADK-AVNRLLSQ.DSVQQV.KSNQDEKKE
D8QZ59_SELML/24-84---------EC-NM------D----------------PNE-TAQRLMSQ.DTFHEV.KRKRDKKKE
K4DFK4_SOLLC/17-73---------ET-NM------D----------------PNE-TAQKLLNQ.DPFHKV.KRKGDRRKE
E1Z2G3_CHLVA/20-73---------EC-NY------D----------------VNE-ATSRLID..NPFQQV.KSRVEKRKE
D7L2B1_ARALL/16-74---------EA-NM------D----------------ADE-AVQKLIHQ.DPFHEV.KRKRDRKKE
K7VTF9_MAIZE/24-83---------DC-GM------D----------------PDI-AVERLISQ.DTFHEV.RRKRDKKKE
M0SCQ0_MUSAM/14-73---------ET-NM------D----------------PNE-TAQKLLNQ.DPFHEV.KRKRDRKKE
B9GT31_POPTR/14-74---------DF-NM------D----------------ADA-AVQNLLNQ.DPFHQV.KSKRERRKE
K7LDS8_SOYBN/21-79---------DC-NM------D----------------PNK-AVSRLLSQ.DPFHEV.KSKREKKK.
K3Z3T8_SETIT/15-73---------EC-GM------D----------------PDE-AVSRLLSQ.DTFQEV.KSKRDKKKE
D7L6N2_ARALL/10-70---------EC-NM------D----------------PDE-TAQRLLLQ.DPFHEV.KKKRDKRKE
U5D0R9_AMBTC/13-72---------EC-NM------D----------------PNE-TTQKLLLQ.DTFHEV.RRKRDKRKE
A9RRL8_PHYPA/13-72---------EC-NM------D----------------PNE-AAQRLLNQGDPFHEV.KRKRDKKKE
D7TD97_VITVI/10-69---------DC-AM------D----------------PNE-TVQKLLMQ.DPFHEV.RRKRDKRKE
D7UAL3_VITVI/18-77---------EC-AM------D----------------PNE-AVQRLLYL.DTFHEV.KKKRDRKKE
K7LA00_SOYBN/25-80---------EC-DM------D----------------VNR-AVEMLLSQ.DTFHEV.KSKRERRRE
I1IIY7_BRADI/8-67---------EC-DM------D----------------PNE-TVQKLLFQ.DTFHEV.KRKREKKKE
U5FVE0_POPTR/27-85---------EC-NM------D----------------PNE-AVNRLLSQ.DPFHEV.KSKREKKKE
K7M4A9_SOYBN/15-75---------EC-SM------D----------------PNE-TAQKLLYL.DTFHEV.RRRRDRKKE
C5Z6C7_SORBI/28-86---------ES-NM------D----------------PNE-TAQKLLNQ.DPFHEV.KRKRDKKKE
D7MRX5_ARALL/30-88---------EC-NM------N----------------ADE-AMNRLLSQ.DSFQEV.KSKRNKKKE
B9GTE9_POPTR/10-69---------EC-SM------D----------------PNE-TAQKLLYQ.DPFHEV.KRKRDRKKE
M4EF18_BRARP/15-72---------EA-DM------N----------------ADE-AVQKLIHQ.DPFHVV.KRRRDRKKE

PF07499

RUVA_FRATT/167-212-----...GDA-TT-..---.---------------.VAE.VIRKALQGSI---------------
RUVA_ACIAD/155-200-----...ADY-TE-..---.---------------.AAD.LIRAALKSMM---------------
RUVA_PHOPR/161-206-----...KPE-MS-..---.---------------.SEN.IIREALRSMV---------------
RUVA_CLOAB/156-200-----...DKS-EG-..---.---------------.IEN.IIKSCLRFLM---------------
RUVA_MYCPE/158-208-----.LSNVS-ED-..---.---------------QISD.LISQAIKIIS---------------
RUVA_MYCPU/144-188-----...NLQ-DD-..---.---------------.VET.LVENAIKKIS---------------
RUVA_CLOB8/153-197-----...DKN-DS-..---.---------------.VEN.IIKNALKALM---------------
RUVA_CHLPB/151-198-----..SLRN-PQ-..---.---------------.VED.LVRDALLTIR---------------
RUVA_THIDA/145-189-----...PAG-LA-..---.---------------.VGE.AIRQALRALS---------------
RUVA_IDILO/160-205-----...SAE-HN-..---.---------------.SET.LIRLALKQLS---------------
RUVA_DECAR/146-190-----...PAD-VS-..---.---------------.TSD.GIRAALKLLS---------------
RUVA_CHLL7/151-198-----..ANPG-GS-..---.---------------.VED.VVKSALLAMH---------------
Q6KI20_MYCMO/150-194-----...NDK-ND-..---.---------------.IEE.MLEESIQLIA---------------
RUVA_CORJK/161-211-----.WSAPQ-AP-..---.---------------.DASGLLRASLAAIK---------------
RUVA_CHLTE/151-198-----..TSPG-LS-..---.---------------.VEE.VVRAALIAIH---------------
RUVA_DESAG/151-198-----..QDPD-LD-..---.---------------.VSE.ALRAALKALA---------------
RUVA_SALRD/153-201-----..NAGI-QS-..---.---------------.ADE.LVRRALKADQ---------------
RUVA_CLOTE/152-196-----...DKE-NS-..---.---------------.LED.IIKACLKYLM---------------
RUVA_NITOC/154-199-----...TEA-LT-..---.---------------.TEE.IIRQALQRML---------------
RUVA_NITMU/150-194-----...SVD-LS-..---.---------------.VSD.GIRQALKFLS---------------
RUVA_CAUCR/156-204-----..LGEE-AT-..---.---------------.VQA.LIKAGLKELG---------------
RUVA_STRAW/149-200-----..QAEA-AG-GT---P---------------QVGQ.LLKAALQTLN---------------
RUVA_GEOMG/152-198-----...ESG-AS-..---.---------------.TEA.VLRQALKILM---------------
RUVA_CORDI/153-200-----..DSPE-LS-..---.---------------.KSQ.ALRAALSELG---------------
RUVA_OCEIH/153-200-----..DNDA-LS-..---.---------------.VDE.AIRKALALLA---------------
RUVA_ECOLI/158-203-----...RPD-AS-..---.---------------.SET.LIREALRAAL---------------
RUVA_HELPY/138-182-----...KPN-LS-..---.---------------.IEA.AIKEALQQLR---------------
RUVA_SYNPX/151-201-----..GGPQ-DG-D.---.---------------DDDA.WLRACIKLMS---------------
RUVA_SYNY3/159-209-----...VPD-VA-QS---E---------------DPEV.WIRQAIGWLS---------------
RUVA_HAEIN/159-204-----...KPE-LT-..---.---------------.SEQ.VIREALKVAL---------------
RUVA_BIFLO/152-205-----.NDIPT-PL-AT---D---------------DVPR.VLRLALALMD---------------
RUVA_PSEHT/160-205-----...KPD-MS-..---.---------------.TEV.LIKESLKSML---------------
RUVA_SYNE7/156-206-----...ENL-VQ-SG---Q---------------PAED.WIREAIAWLS---------------
RUVA_PELCD/150-196-----...APD-AP-..---.---------------.LED.ILKQALKLLM---------------
RUVA_BACSK/151-196-----...AET-LE-..---.---------------.TDE.YIRRALALML---------------
RUVA_LACAC/147-193-----...IEA-DT-..---.---------------.ADQ.YIKKGLALLL---------------
RUVA_COREF/155-202-----..ADPG-LD-..---.---------------.TSA.ALRAALAKLG---------------
RUVA_CALS8/150-195-----...FSE-LS-..---.---------------.LED.GIKLALKKLS---------------
RUVA_TROWT/144-191-----..KDQS-LT-..---.---------------.MPE.ILRNALRYLA---------------
RUVA_BDEBA/148-192-----...PAD-IA-..---.---------------.VED.GIRKGFQTLS---------------
RUVA_SULDN/143-186-----....SA-VD-..---.---------------.TAI.LVKEALKLLQ---------------
RUVA_CARHZ/148-194-----.SVKTP-EE-..---.---------------.....GIALALRFLN---------------
RUVA_HAEDU/156-201-----...KSG-AT-..---.---------------.SEQ.LIRDALKASL---------------
RUVA_LEIXX/150-200-----.TAESE-RD-..---.---------------SVQT.LLRLTLARLG---------------
RUVA_ZYMMO/163-211-----..LGDQ-AT-..---.---------------.LDS.LVRLALRLSS---------------
RUVA_UREPA/142-190-----..SQQD-ID-..---.---------------.ISE.IISSAIKEIS---------------
RUVA_ALKMQ/148-193-----...DTS-LS-..---.---------------.TEE.MIRKALNWLA---------------
RUVA_CLOTH/155-200-----...RED-MD-..---.---------------.IET.IIKNALKGLA---------------
RUVA_HAHCH/156-201-----...KDG-MG-..---.---------------.RDE.LIRLALKGMV---------------
RUVA_MYCLE/149-200-----..GELG-KD-GA---V---------------ATSS.ALRAALSLLG---------------
RUVA_LACPL/152-201-----.SQTQG-AD-..---.---------------.TNT.LLSEGLRLLM---------------
RUVA_MAGSA/159-207-----..LGDE-AD-..---.---------------.SSA.LIRAALKHLG---------------
RUVA_COXBU/152-197-----...KPD-LS-..---.---------------.AET.LIRLALKQMV---------------
RUVA_CLOPE/156-200-----...DKT-LS-..---.---------------.IEN.MIKESLKLLM---------------
RUVA_SYMTH/155-203-----..AGEA-PS-..---.---------------.VET.LVRLALKQLY---------------
RUVA_METCA/155-200-----...AEG-RS-..---.---------------.AED.LIRAALQSAV---------------
RUVA_MOOTA/149-197-----..LGNA-AP-..---.---------------.TTA.VLQAVLKTFG---------------
RUVA_THICR/155-199-----...ESG-LS-..---.---------------.LEE.TIKKALQSVK---------------
RUVA_BACSU/154-200-----...EIG-LT-..---.---------------.TDQ.YVKKALQKLL---------------
RUVA_LACSS/155-201-----...FAA-QT-..---.---------------.TDQ.YLREGLRLLM---------------
RUVA_COLP3/166-211-----...NRG-MS-..---.---------------.SEN.IIRDALKSMI---------------
RUVA_RHOS4/174-221-----..ESPD-AD-..---.---------------.TAA.LIRAALKLLA---------------
RUVA_NEIG1/149-193-----...PKG-TD-..---.---------------.VGE.GVRLALKNLL---------------
RUVA_CHLCH/153-200-----..ENSN-CT-..---.---------------.VEE.VVKSALLLIH---------------
A6WCH9_KINRD/154-207-----.TPDAG-AA-DD---L---------------DVAA.TLRAALRHLS---------------
RUVA_PROAC/150-200-----...LKE-AD-PA---M---------------SIGN.LMRAALRSLA---------------
RUVA_PELPB/151-198-----..QNPG-LT-..---.---------------.VEE.VIKAALVSIH---------------
RUVA_WOLSU/143-186-----....QA-TT-..---.---------------.TQE.IIKEALKKLQ---------------
RUVA_GLOVI/155-203-----...APA-MA-GE---E---------------QTEA.WLRAAIAWLS---------------
RUVA_HELHP/153-196-----....EA-LS-..---.---------------.VSE.IVKEALKRLA---------------
RUVA_DEHM1/146-192-----...ITG-MP-..---.---------------.LEE.RIKLALNYFN---------------
RUVA_GLUOX/152-199-----..ENEN-AT-..---.---------------.LDL.AIRLSLKDLA---------------
RUVA_EXIS2/149-194-----...GEV-LS-..---.---------------.TDQ.YVKRALQLLL---------------
RUVA_MYCPN/149-195-----...KPN-FD-..---.---------------.VSE.VIAEVIKLMS---------------
RUVA_RHORT/162-208-----...GLG-AT-..---.---------------.TVQGVIGLALRDLG---------------
RUVA_STRP1/151-196-----...GTS-ET-..---.---------------.AEQ.YIKSALKLLM---------------
RUVA_CYAA5/160-209-----NLMLKN-TN-..---.---------------.TEE.WIKEAIAWLS---------------
C5AB30_BURGB/148-191-----...PAG-TG-..---.---------------.VSE.GIKLSLKALS---------------
I3TYC8_ENTFC/70-115-----...VDN-QT-..---.---------------.TDE.YLRQALKLMM---------------
K9QJ68_9NOSO/157-206-----...DIG-LP-KD---A---------------YVED.WIKQAIAHLS---------------
RUVA_STAA8/155-197-----...NKY-DS-..---.---------------.VDE.AVKAGLQL..---------------
RUVA_BRUA2/157-204-----..TGEG-AD-..---.---------------.SAK.LIRLGLKELS---------------
RUVA_LEGPH/154-197-----...NGN-KS-..---.---------------.CEQ.LIREALQILS---------------
RUVA_PSEPK/158-202-----...KAG-LS-..---.---------------.SEE.LIRRSLKGM.---------------
RUVA_XANCP/148-191-----...AEG-DE-..---.---------------.VAT.VIRKALQA..---------------
RUVA_FUSNN/145-190-----...NKF-SS-..---.---------------.LED.AIKGILKNM.---------------
RUVA_LISMO/155-199-----...EAD-LT-..---.---------------.SDA.YIKLALQLM.---------------
RUVA_THET8/145-190-----..QNPK-AR-..---.---------------.AQD.LIKEALKRL.---------------
RUVA_THEMA/144-186-----...REG-MK-..---.---------------.TSE.LIKEALKFLS---------------

PF16678

E7F0V6_DANRE/453-616..GF.NDATRC-EE-AL---R----------------QSGGDVRGALVLLQRPLLEPFHQRMWSEE
H2ZW95_LATCH/495-644..GF.SDREEV-LQ-SL---Y----------------INGGDVSKALTDLQRKLLEPFHQHIWEE.
M3ZQS2_XIPMA/503-650..GF.QDMSQC-EE-AL---R----------------QSGGDIKGALSLLQRPLMEPFHQRIWLDQ
L7N3X7_XENTR/417-563..GF.PERHKV-VA-AL---Y----------------ESAGDVGRALSILQRPLLEPFLIRMWEEP
H3CTG2_TETNG/446-592..GF.RDVSQC-EE-AL---R----------------LSGGEVKGALSLLQRPLLEPFHQRIWTEQ
W5L3N4_ASTMX/453-628..GF.NDSAAV-EE-AL---R----------------QSGGDVKGALVLLQRPLLEAFHKRMWSDE
H2LH73_ORYLA/407-560..GF.RDDARC-HE-AL---R----------------QSGGELRGALALLQRPLLEAFHMRIWSDK
K7IZK9_NASVI/23-173..GN.FTLHSV-IT-AL---D----------------NNAGNEDASLLELQKDQLKPFLMRIWGPP
G3PPR4_GASAC/433-581..GF.SNAARC-HE-GL---R----------------QSGGEVRGALALLQRPLLEPFHKHIWSDK
H2MDV5_ORYLA/481-633..GF.RDVAQC-EE-AL---R----------------QSGGQVKGALSLLQRPLLESFHQRIWTDQ
C3XU40_BRAFL/1055-1204..QE.FEQDQV-LT-AL---Q----------------ENCGDTEKAILAIQRELLQPFEEHIWKV.
T1HCE2_RHOPR/136-283..GN.FSREDI-VT-ML---T----------------SHHGNVEAAYTELNKSQLKPFLMRIWGPP
B4JB90_DROGR/979-1128..GN.FLSEDI-VN-AL---T----------------AHQGNVEQALVELNRTQLKPFLMRIWGSP
T1JM07_STRMM/128-278..NN.FNREEI-IA-SL---T----------------ANHGNVEAAYLELMKNAMKPFHMQIWGPP
G7P9X8_MACFA/483-627..GF.GPEEGS-LQ-AL---F----------------QHGGDVSRALTELQRQRLEPFHQRLWDS.
E2BUD1_HARSA/1129-1278..GS.FALADV-VK-AL---D----------------NNAGVEDATLLELQRNQLKPFLMRIWGPP
I3JHL5_ORENI/463-610..GF.QDVAQC-EE-AL---R----------------QSGGEMQGALSLLQRPLLEAFHQRIWTAQ
W5LG34_ASTMX/53-208..GF.VDRLAC-EK-AL---F----------------MSGGDLDGALSHLQRPLLEHFHQNIWKKQ
A7RQ03_NEMVE/425-572..GI.YVRTDC-IK-EL---D----------------KSNGDVDRAIRSLELLTLAPFRQRILE..
I1E6J1_AMPQE/32-175DGRFQVSWDDA-VQ-AL---S----------------ETELDVDQAYYTVQRYGLQEL........
W5JDH8_ANODA/747-897..GN.FTREDI-VT-SL---T----------------AHHGNLELALVELSKTQLKPFLMRIWGPP
K1RET9_CRAGI/1065-1218..DNSFPREEI-LQ-AM---L----------------SSKGELEEALDHLNSDSLQQFTDHLWERE
H9G897_ANOCA/403-553..GF.GERGPV-LQ-AL---Y----------------QNNGDLWQALVQLQRQLLEPFHQRLWEDE
H2TJL2_TAKRU/388-536..GF.CDEAQC-HE-VL---R----------------QSGGEVRGALVLLQRPLLEGFHKRIWSDK
I3JGL0_ORENI/429-574..GF.SDEARC-HE-VL---W----------------QSGGEVRGALVLLQRPLLEPFHKRIWSEK
G3NA67_GASAC/402-550..GF.REASRC-EE-AL---R----------------LSGGEVKGALSLLQRPLLEPFHQRIWTDQ

PF10440

M4EY20_BRARP/4-60---------AE.DN-----------------------YRA-LADAIFEAQDT--------------
W5ATU1_WHEAT/4-64---------EA.DH-----------------------FRV-LTDAIFDEPDP--------------
J3M322_ORYBR/4-63---------ED.EC-----------------------YRA-LADAILDRHQE--------------
Q1PFN1_ARATH/10-69---------ED.AN-----------------------YEV-..SLIFPLKSK--------------
F4K7E7_ARATH/4-60---------AE.DN-----------------------YRV-LADAIFDSHED--------------
I1N9U3_SOYBN/4-60---------EE.ES-----------------------YRA-LADAIFEEEEN--------------
K3ZX78_SETIT/9-70---------ED.SS-----------------------YLV-VQEKLLEMEDE--------------
W5GKU5_WHEAT/6-64---------EA.DD-----------------------FRV-LTDAIFDEPDP--------------
K3YYH3_SETIT/4-59---------EA.DN-----------------------YNA-LADVIA.....--------------
I1IBN5_BRADI/131-191---------EA.DN-----------------------FRV-LTDAIFDDPDP--------------
F4J3N8_ARATH/25-82---------KL.DN-----------------------YTA-LVDAIYSVEDE--------------
B9SLL2_RICCO/7-68---------EE.NS-----------------------YRL-VIESILEELE.--------------
K3ZX65_SETIT/6-67---------EE.GS-----------------------YKI-VLDTLLEEQEQ--------------
I1IXS9_BRADI/4-65---------EG.DC-----------------------YEV-VQQELFKQEEE--------------
J3MVL2_ORYBR/7-68---------EE.GA-----------------------YRV-VQEALFEKQER--------------
I1I063_BRADI/3-61---------EE.EN-----------------------YRI-LADAILDAQNE--------------
M4CLA6_BRARP/8-69---------EE.CS-----------------------YSV-LLHKCLEKSDE--------------
I1IKP9_BRADI/4-69---------ED.NC-----------------------YQV-VQDVLFEKQEE--------------
SUVR1_ARATH/4-60---------EE.DA-----------------------YKV-LLDAIFDEADA--------------
D7KPU3_ARALL/7-68---------ED.AN-----------------------YDA-LLNICLEKKEE--------------
C0PJG3_MAIZE/4-61---------ED.EC-----------------------YRA-LADAILDRQDN--------------
W5BBI8_WHEAT/6-65---------EA.ES-----------------------YRA-LADAIFDEQAN--------------
K3ZWZ7_SETIT/12-73---------EE.GS-----------------------YQV-VQDKLFEKEDE--------------
M4FGG9_BRARP/331-388---------KL.DN-----------------------YTA-LIDAIYSLDDE--------------
K7LZD4_SOYBN/4-64---------EA.EN-----------------------YRV-LADAIFEDDDN--------------
K4CW89_SOLLC/4-62---------ED.EN-----------------------YSV-LLESIIDSEES--------------
Q6K9F7_ORYSJ/20-80---------EA.DN-----------------------YLA-LADAIFCDSDP--------------
I1H6C5_BRADI/4-61---------EA.DN-----------------------FLV-LAEAIFDG...--------------
J3MVL1_ORYBR/35-95---------EE.DS-----------------------YRV-VQEALFEKQE.--------------
F4IG36_ARATH/8-68---------ED.DS-----------------------YGP-LLAICLEKQEE--------------
W1PPN1_AMBTC/10-70---------EE.AS-----------------------YRL-LIDTILEDQEK--------------
K7N559_SOYBN/7-69---------EE.SA-----------------------YSL-LIETLLEKQAN--------------
C5WT72_SORBI/6-67---------EE.GS-----------------------YSL-VRNRLLEEQAQ--------------
M0X9W3_HORVD/7-68---------ED.SC-----------------------YHV-VQEALFEMQEE--------------
M4F4K4_BRARP/4-60---------AE.DN-----------------------YRA-LADAIFDSQES--------------
C5X350_SORBI/8-71---------EEGGS-----------------------YQV-VQERLFEIEEK--------------

PF09145

Q6CVQ6_KLULA/133-176---------KG-IM-----------------------YEE-LIESQKKRK----------------
Q74Z54_ASHGO/119-160---------RG-GR-----------------------YEQ-LRMRRAE..----------------
C5E3M8_LACTC/99-142---------RG-IL-----------------------YEQ-VVDRQKRRT----------------
G0VH00_NAUCC/125-168---------KG-IL-----------------------YEN-LLAKMKQNQ----------------
G0W8I1_NAUDC/144-187---------KG-IL-----------------------YED-IIRKQREKK----------------
C5DVX5_ZYGRC/116-159---------QG-ML-----------------------YDD-VIEERKKKK----------------
I2H7Y1_TETBL/216-257---------KG-YL-----------------------SDD-VLRKMQA..----------------
H2AS28_KAZAF/124-167---------KG-IS-----------------------YDT-LLKKLERRR----------------
J8Q0V5_SACAR/133-176---------DD-VT-----------------------YES-YLEALKSKH----------------
Q6FRN9_CANGA/130-172---------RG-IT-----------------------FED-VLRKRKQK.----------------
SWA2_YEAST/138-181---------ND-VT-----------------------YER-YLEILKSKQ----------------

PF03943

Q5KB75_CRYNJ/635-681------------QN.GW...D----------------PEA-AIKNFEEIK......SSIPAEAF--
B4L4P1_DROMO/624-672------------ET.NW...D----------------FNH-AAFVFEKLFKE....NKIPPEAF--
G0SET4_CHATD/604-651------------GAANW...N----------------LEL-ALQSFEQQK......ANVPPEAF--
K1XEL3_MARBU/737-782------------NA.GW...N----------------LET-AYNMFMANK......ANLPQEAW--
G3JJS3_CORMM/652-697------------QV.DF...V----------------FDR-ALAIFNDKK......AQLPPEAF--
G7YY76_CLOSI/94-140------------EC.GF...N----------------LHA-ALEAFRNVMEA....NLLPPEAF--
W5LZ72_LEPOC/466-514------------DN.EW...D----------------FSR-AAHIFTQLKAQ....DKIPPAAF--
G1SY35_RABIT/513-561------------EN.GW...N----------------YTR-AAQVFLILQMQ....GKIPKEAF--
L5MHV8_MYODS/691-739------------DN.EW...N----------------YIK-AAQVFTTLKAQ....GKIPEEAF--
E3L9C5_PUCGT/608-656------------QN.HW...N----------------FEA-SIKNFHEILQR....GGLPPDAF--
G0SVJ1_RHOT2/617-665------------QN.GW...D----------------PHQ-ALSQFQALQAQ....GSIPPEAF--
B7P9R3_IXOSC/76-124------------QN.SW...D----------------LQK-AFAVFTELNVR....GGIPPEAF--
Q54LU1_DICDI/333-381------------LS.GW...D----------------KSK-ALETFQNLKAN....NQIPADYF--
R9AGN7_WALI9/530-575------------SN.NW...N----------------LEQ-ALNNFEAVK......GSIPEAGF--
F6VE78_HORSE/419-466------------DS.HW...D----------------YTK-AAQVLALLKAQ....CKIPEEA.--
F0ZVY7_DICPU/222-270------------MA.GW...D----------------QMM-AFFSFSNLNDN....NQIPQDYF--
F1KXD7_ASCSU/601-647------------DQ.NW...N----------------YEV-AGQAFLAVR......DKIPPEAF--
E9HPR7_DAPPU/577-625------------EN.GW...V----------------FDR-AAFVFTELKAA....NQIPPEAF--
F7AR15_MOUSE/425-473------------DN.KW...D----------------YAR-AAEVFTMLQTK....CKIPKEFF--
K0KJ11_WICCF/580-628------------QS.SW...N----------------YEI-AINGFKESHQQ....GQIPPEAF--
F0XI66_GROCL/595-641------------EA.GW...N----------------FSA-AIAKFNESQ......PNLGPEVF--
F2U637_SALR5/599-647------------GN.NW...I----------------YDA-AVANFRELQAS....NSLPPEAF--
K1VEX0_TRIAC/566-611------------QN.GW...D----------------VER-AVVNFQEIR......ATIPPEAF--
J9KX88_ACYPI/498-543------------DN.NW...D----------------FAK-ATLCYSKLK......PNIPSIAY--
B6JXN8_SCHJY/563-611------------QN.NW...D----------------YNR-AIAAFTELKQR....GVIPPEAF--
J7S834_KAZNA/560-606------------QS.GW...D----------------YQL-ASTTFQQSI......PNLPQNAF--
G1SVP1_RABIT/555-601------------DN.NW...D----------------YAR-AAQFLTLPKVK....GKMPGE..--
G3UHJ2_LOXAF/526-574------------SN.NW...N----------------YTR-ASQIFALSTPV....LKIPEDTF--
F2SUD8_TRIRC/647-695------------GN.SW...D----------------MNL-ALKNFEELKAQ....GNLPPTAF--
X1WQH3_ACYPI/76-122------------EN.GW...N----------------YTK-AASCFSDLK......ASIPPMAF--
S8AQ06_PENO1/644-692------------GN.GW...N----------------FDA-AWRNFEELKAS....GTLPASAF--
G3RNR7_GORGO/565-617------------SKNEWPHKN----------------YTK-ADQVFTMLQTK....SKISVEAF--
E9IDJ4_SOLIN/589-637------------VA.QW...N----------------YDN-ALSTFQEFYKH....GQLSLEVF--
D2W3R0_NAEGR/116-164------------QY.QW...N----------------INS-ALQRVFELASM....NRLPSHAF--
I4YK11_WALMC/472-517------------SN.NW...S----------------LDM-ALQNFEAVK......TSIPQEAF--
G7DTW7_MIXOS/628-674------------LN.EW...D----------------PTR-SMTNFEQLR......PTIPAEAF--
J9L587_ACYPI/702-748------------EN.GW...D----------------YVK-AASCFLDMR......SNIPTVAF--
A0A068X6G5_HYMMI/609-657------------EF.GW...Q----------------FEA-ALNGFRTMNAS....GSIPQIAF--
T1KYL1_TETUR/570-618------------EN.AY...D----------------LQK-SFEVFEQLNKQ....GAIPAAAF--
E9FRA5_DAPPU/889-937------------DC.GW...D----------------YDR-AAYVFTELKGT....FKIPLAAF--
G0VCA2_NAUCC/534-580------------QS.GW...N----------------YDV-ALKAFQSSV......TNLPREAF--
E2BWH2_HARSA/479-525------------EA.KW...D----------------MRQ-ALSNFMKDYKS....LSVPENAF--
L5KNV8_PTEAL/148-196------------DN.EW...N----------------YAR-AGQVFTMLKTK....GTIPEEAF--
G8BSF9_TETPH/525-571------------QS.GW...N----------------YDV-AFKGFQSSM......GQIPREAY--
E4WRQ9_OIKDI/606-653------------QN.DW...N----------------FNR-AAEKFMELKSA....GQLPADAW--
G8BFF2_CANPC/570-616------------QS.QW...D----------------YNQ-SMVNFKNSA......SSLPRDAF--
Q0CUQ6_ASPTN/629-675------------GN.GW...N----------------IEA-ALKNFEELK......GQIPADAF--
F6VM51_XENTR/515-561------------DN.NW...N----------------VEQ-AQDVFSLLKEK....GTIPQDAF--
A8PSC4_MALGO/433-478------------EN.DW...N----------------MTR-ALSVFTSLQAA....GTIPPEAF--
D2VFN8_NAEGR/436-483------------YS.NW...N----------------ISN-AINTFNTEKMN....GNIPLYCF--
E4ZXH0_LEPMJ/340-386------------AG.GW...N----------------IDQ-AGVLFAQSQ......PSLPAEAY--
K5XSW2_AGABU/545-590------------GN.AW...D----------------LER-AITNFEQVK......DKLPKDAY--
E9IDT6_SOLIN/499-546------------EA.QW...D----------------MRK-AIYDFMKDLKE....SSIPEQAF--
C3ZQJ7_BRAFL/156-204------------QN.GW...E----------------YNK-SAQVFTELKAQ....NKIPPEAF--
J9JRI7_ACYPI/747-793------------EN.YW...D----------------YAK-AVSCFSGLK......ANIPPIAF--
R4XCL5_TAPDE/566-613------------QL.QW...D----------------YQA-ALKVTQDLKSK....NGLPAEAF--
G6DRX3_DANPL/557-604------------ET.GW...D----------------YQR-ALFIFNQLQSE....GKIPPDAF--
B0W492_CULQU/610-658------------ET.NW...D----------------YER-AAFAFSELHKQ....NRIPPEAF--
E9HYQ3_DAPPU/1190-1236------------EN.DW...D----------------YDR-AAFNFAKFKAS....NEIPPEAF--
D1ZZZ3_TRICA/492-540------------EC.HY...D----------------FKS-ALALFVDLYKV....DKIPADGF--
F6ZBK7_CIOIN/560-608------------EN.GW...N----------------YEK-AGQTFLELNGK....GAIPAEAF--
E7KVF3_YEASL/539-585------------QS.NW...N----------------YEV-AIKGFQSSM......NGIPREAF--
G0NM87_CAEBE/570-616------------DC.GW...N----------------YDF-ACTKFTEIR......AAIPAEAF--
H6C6P8_EXODN/361-409------------AN.NW...D----------------YPT-AMANFMQLKEQ....GQIPADAF--
Q6CTV4_KLULA/541-587------------QS.LW...N----------------YDN-AIQGFRNSA......NNLPREAF--
Q0UUQ5_PHANO/307-353------------AG.NW...D----------------LQQ-ASDLFTQSR......ATLPPSAF--
V5HX14_BYSSN/620-668------------GN.SW...N----------------MEA-ALKNFEELKTQ....GKLPPDAF--
H0WK93_OTOGA/514-561------------DS.KW...D----------------YTR-ATEILALPNVA...KGKIPEE..--
F8PXV4_SERL3/560-605------------NN.AW...D----------------LDR-AIANFEQVK......GALSREAF--
M7NQ07_PNEMU/557-604------------QN.QW...N----------------MEQ-AMNNFNILKEK....GVIPLEAF--
K7JG87_NASVI/502-550------------EA.SW...D----------------IRQ-AIKTFMQQYLS....NRVPTEAF--
G3B3M1_CANTC/552-598------------QS.NW...D----------------YQQ-CIINFKNSV......GSLPRDAY--
L2G897_COLGN/607-653------------DV.AW...D----------------FTR-ALAVFNEKK......AQLPAEAF--
F9XC14_ZYMTI/590-636------------QT.GW...D----------------FDT-ALAAFENVK......GTLTAEAF--
G4LZB4_SCHMA/637-685------------EY.EW...D----------------TNA-ALTAFETMNSA....GKIPPEAF--
I3MCG2_ICTTR/504-551------------EN.HW...D----------------YIR-ATQVLTMPKVK....GMVPEET.--
S8AEB1_DACHA/596-643------------QT.GW...D----------------LSK-ALQAFNEVRAS....GTLPPDA.--
F4PQ71_DICFS/552-597------------NS.GW...D----------------LNI-AFTTFQMFKSQ....GKIPD...--
K7JZ59_NASVI/501-549------------EV.EW...N----------------LKK-AIMNFLNHYKN....GQLPKDAF--
F1M355_RAT/502-547------------DD.QW...N----------------YNK-AIQSFALLKVK....DTVPE...--
T1JGC8_STRMM/579-627------------EN.DW...D----------------FHK-SANVFQEYNTK....GQIPPAAF--
A7SAV5_NEMVE/648-696------------EN.GW...N----------------YEK-SAEIFTSLQAA....GSIPPDAF--
M7T649_EUTLA/611-657------------GV.NW...N----------------FEQ-ALIAFTEKR......AQLPPEAF--
T1HA90_RHOPR/588-636------------ET.NW...N----------------FDQ-ALNSFLQLQKT....GSIPAEAF--
F6YJ26_MONDO/575-623------------DN.DW...D----------------FAR-AAHVFTQLKAG....SKIPEVAF--
H0YDU0_HUMAN/74-122------------DN.NW...D----------------YTR-SAQAFTHLKAK....GEIPEVAF--
K2SBU5_MACPH/598-644------------QS.NW...D----------------PPT-AVATFESAK......ATLPAEAF--
G3SLM1_LOXAF/570-618------------DN.EW...D----------------YVR-AGQVFSILKAE....GRIPEEAF--
G3TVU6_LOXAF/523-571------------DN.NW...D----------------YTG-ASEIFAPSSPV....IKVPEGAF--
F4P6P4_BATDJ/682-727------------QT.GW...S----------------AEA-AGQAFLTAK......NMIPPEAF--
B4JSR1_DROGR/504-550------------DT.NW...D----------------YQQ-ALLAFQTLLRR....RQIHENAF--
Q7QK79_ANOGA/610-658------------ET.NW...D----------------YPR-AEFAFAELHKQ....NRIPPEAF--
MEX67_SCHPO/547-595------------QN.NW...D----------------YNS-ALASFLELKSR....NVIPAEAF--
K7J5C6_NASVI/712-760------------EV.QW...H----------------FEN-ARAAFQEAYSL....GKIPATAF--
B8MH42_TALSN/594-642------------QH.NW...S----------------IEG-ALRAFEESKAQ....NQIPAEAF--
G3VFP4_SARHA/604-652------------DN.NW...D----------------FIQ-AAQIFTQLKEQ....GKIPAIAF--
R7YJB7_CONA1/601-647------------ES.GW...N----------------LER-AVVAFESAR......ASLPADAF--
G2R2G6_THITE/590-637------------GAANW...D----------------FNL-ALASFHEKK......AQLPPEAF--
M2MUW6_BAUCO/606-652------------QS.GW...N----------------AQV-AVVNFEKAK......AILPPTAF--
H2Z6T4_CIOSA/441-489------------EN.DW...N----------------YEK-AGTVFMELKAK....GAIPPEAF--
E9HYQ3_DAPPU/1133-1181------------ET.EW...D----------------LLR-ATFSFTKFKAE....SKIPPEAF--
A0A088AIA9_APIME/486-534------------DA.NW...D----------------IRS-AIATFMNMYTV....NNVPPEAF--
C4R7R9_KOMPG/549-597------------QS.HW...N----------------YEA-AIQAFRSSHQQ....GQIPPHAF--
MEX67_CANAL/569-615------------QS.NW...D----------------YQQ-ASVNFKNSA......ASLPSDAF--
F6V2B4_MACMU/231-279------------DN.EW...N----------------YTR-AGQVFTMLQTE....GKIPAEAF--
T5AI53_OPHSC/605-651------------QV.EW...Q----------------FDK-AIAIFHEKR......AELPAEAF--
D6WXF5_TRICA/557-605------------ET.QW...D----------------FTR-ALSAFADAQKQ....GLIPPEAF--
M1VWJ6_CLAP2/571-617------------QV.GW...D----------------FDK-ALLVFGEKK......SLLPPEAF--
F4SB63_MELLP/556-604------------HN.GW...N----------------PTL-AMENFQTINAS....GALPPDAF--
A0A0D1CBA5_USTMA/616-661------------EN.GW...D----------------YNL-ALANFQTLKAS....NAIPPQAF--
S8ENB3_FOMPI/545-590------------GN.AW...D----------------VER-AVANFEQVK......STLSREAF--
U5GY34_USTV1/553-599------------QN.AW...V----------------PET-ALANFQQLHAS....GAIPAEAF--
B3LYG5_DROAN/287-333------------QN.EG...D----------------YSQ-ALWVFERLYDA....GQIPPKAF--
F6PYN9_MONDO/592-640------------DN.NW...D----------------FPR-AAQIFTQLKVE....GKIPAVAF--
G3UBE9_LOXAF/559-611------------SN.NW...D----------------YTR-ASKIFVLSTVRSGNLGQIPEDTF--
Q8R499_MOUSE/622-670------------DN.EW...D----------------YTK-AGEAFTALQNE....GKIPKEFF--
D8Q3Y4_SCHCM/566-611------------GN.SW...D----------------LDR-AWANFEAVK......TTLPPDAF--
B8P4D5_POSPM/146-191------------SN.AW...D----------------VGR-AIANFEQVK......GTLPRDAF--
E3RM33_PYRTT/267-313------------AG.QW...N----------------LEQ-AGALFTQSR......DSLPAEAF--
H2W522_CAEJA/573-619------------DF.GW...N----------------FEV-ACQKFPEVK......HCVPVEAF--
R8BMH6_TOGMI/564-609------------TA.GW...D----------------FDR-AVAVFEEKR......AVLGPEAF--
G1T8L7_RABIT/565-613------------EN.EW...N----------------YTR-AAQAFINLQTQ....GTIPKEAF--
F7G9M2_CALJA/508-555------------NN.QQ...D----------------YSR-AVPVLAPPKVK....SKIPEKA.--
C4Y6C5_CLAL4/572-618------------QS.NW...D----------------YQQ-CIVNFKNSA......SSLPPDAF--
H0XJG4_OTOGA/507-555------------DN.EW...N----------------YSK-AGEIFTALQSQ....GKIPEEAF--
Q4WJR0_ASPFU/644-692------------GN.GW...N----------------MDA-ALKNFEELKAQ....GTLPPEAF--
G1SPN8_RABIT/540-588------------DN.EW...N----------------YAT-AAQIFTMLQRQ....GRIPEEAF--
A0A158NK73_ATTCE/495-543------------DA.EW...N----------------IKN-AIITFMKNYSV....NDVPSEAF--
G7Y305_CLOSI/630-677------------EY.QW...N----------------FEA-AFAAFEMLRNA....GKLPPEAF--
K1S373_CRAGI/551-599------------QN.GW...N----------------YEK-SGEIFLELQKQ....NKIPPEAF--
W4YYQ9_STRPU/193-241------------EN.NW...N----------------YEN-SGKVFTSLKSE....GKIPPEAF--
A0A087ZSK2_APIME/474-522------------EA.KW...N----------------IRK-AISNFMKDYKS....SAIPAEAF--
B5BM32_CAEEL/561-607------------DC.AW...N----------------FDF-ACQKFNEIK......SSVPAEAF--
H2AN82_KAZAF/495-540------------QS.KW...E----------------YNM-AVATFQNNA......NNLPPNAF--
G3TEP3_LOXAF/519-567------------DN.NW...D----------------YTR-ASQMFTLSTPV....LKIPEDTF--
F4W8B0_ACREC/479-526------------AA.QW...D----------------MRK-TIFDFMKDFKN....SSIPDHAF--
J0D0B1_AURST/523-568------------GN.GW...D----------------LGK-ALANFEAVK......NDLPREAF--
A0A068XP13_HYMMI/367-413------------EC.DW...D----------------LQI-ALEAFKRLREA....GTLSEDAF--
A9V2I0_MONBE/494-542------------NN.GW...N----------------YDA-AVANFQQLQAG....GQIPPQAF--
W1QBF4_OGAPD/541-587------------QS.NW...D----------------YGT-ALMNFQNSR......SQIPREAF--
D5GCX3_TUBMM/589-637------------ET.GW...N----------------IES-AWKAFLEAKAN....GAIPPDAY--
I1G080_AMPQE/561-608------------EN.GW...N----------------YEK-AISTFRVLQGQ....GNIPLEAF--
G1PB99_MYOLU/566-613------------DN.HW...D----------------YTR-AVQVLALCKAK....YKLSEEA.--
E9FRA5_DAPPU/832-880------------DN.GW...V----------------YDS-AAYRFNLLKRT....FKIPQEAF--
G8YCF0_PICSO/544-590------------QS.NW...D----------------YNQ-CTINFKNSA......ASLPRDAY--
G0R6P6_HYPJQ/603-649------------QV.EW...D----------------FAR-ALVIFNEKK......AELPPEAF--
H0WGH6_OTOGA/555-601------------DN.EW...N----------------SIM-ADQVFAELQTG....GKFPKK..--
A3M0A0_PICST/566-612------------QS.NW...D----------------YQQ-CTINFKNSA......ATLPREAF--
E9DE69_COCPS/642-690------------GN.NW...N----------------MEA-ALKNFEELKAQ....GKLPANAF--
G1SL70_RABIT/598-646------------DN.GW...N----------------YIR-AKNIFITLLTQ....SKIPQEAF--
G2Q1H7_MYCTT/597-644------------GVADW...N----------------FEL-ALRSFQEKR......AELPPEAF--
E1ZWJ7_CAMFO/420-468------------ET.QW...N----------------YDN-ALSAFQEFFKR....GQIPSEAF--
F7IC37_CALJA/558-604------------HN.LK...N----------------YTK-ADQVFTMIQAK....SKIPVE..--
N4TCL5_FUSC1/606-652------------QV.NW...E----------------FDQ-ALVIFNEKK......SQLPAEAF--
A0A0C4DTE4_MAGP6/609-655------------QV.GW...N----------------LEA-ALAKFQETR......PNLGPEAF--
F6TNP2_XENTR/570-618------------DN.GW...D----------------FDQ-AGQIFMKLNAE....GKIPDVAF--
A8WY32_CAEBR/572-617------------DC.NW...N----------------FDF-ACAKFTEIK......ASIPIEAF--
A5DKM0_PICGU/529-575------------QS.SW...D----------------YQQ-ATVNFKNSV......GSLPREAF--
H9GMR1_ANOCA/558-606------------DN.DW...D----------------YTK-AAHAYTQLKAE....QKIPEVAF--
F1RYG7_PIG/577-625------------DN.EW...N----------------YTR-AGQVFSILKTE....GKIPEEAF--
E0VI83_PEDHC/572-620------------ET.NW...D----------------FDR-AIWTFTQLQSK....GSIPPEAF--
H3ET57_PRIPA/576-621------------DS.AW...N----------------YQL-AGQNFLASK......DRIPKEAF--
G3PXQ8_GASAC/582-630------------DN.EW...D----------------FNR-AAQVFTQLKTD....GKIPDVAF--
B4MYL2_DROWI/572-620------------DN.NW...D----------------FSH-ATLVFDELFKL....QQIPLEAF--

PF14555

TYDP2_CHICK/34-76------------GS-GW---H----------------LER-ALDAYFEAPMN----E---------
UBX1_EMENI/7-49------------TN-GW---D----------------LEA-AVTEFFAEQDE----T---------
B9PW09_TOXGV/14-57------------KH-SF---D----------------LSR-ALDTYFAMPQR----E---------
E3KWG8_PUCGT/7-49------------SA-GG---N----------------LDT-ALSTYFETVGT----T---------
Q6A589_CAEEL/12-55------------SL-NW---N----------------LEQ-AIEAHLMQEDK----N---------
F2Z2K0_HUMAN/6-48------------SA-GW---D----------------LQI-ALASFYEDGGD----E---------
B6QBH5_TALMQ/18-59------------RS-QW---N----------------VQI-AISKFFD.GEG----P---------
O50062_ARATH/120-163------------RF-NW---D----------------VER-AGAQYYEDRDQ----Q---------
F2SWQ8_TRIRC/16-57------------RS-EW---N----------------VQI-AITRFFD.GEA----P---------
A6QY73_AJECN/16-57------------RS-EW---N----------------TQI-AVTKFFD.GDG----P---------
D5G597_TUBMM/14-55------------RS-QW---N----------------VEI-AITKFFD.GET----S---------
E5A7G5_LEPMJ/16-58------------RS-QW---N----------------VQI-AIARFFDGEPA----E---------
A7F973_SCLS1/16-57------------RS-QW---S----------------VEI-AIAKFFD.GED----D---------
C4K012_UNCRE/3-45------------LS-DY---N----------------LET-AMQLYFENGGA----E---------
A7SCW2_NEMVE/8-50------------SS-GW---Q----------------LHI-ALSSFFEDGDL----P---------
B8MDL3_TALSN/8-50------------TH-QW---D----------------LDA-AVTEFFADQEE----E---------
D6WT40_TRICA/5-47------------SS-AW---K----------------LDV-AISRYYENDGG----E---------
C3Y288_BRAFL/5-47------------SA-QW---D----------------LQV-AIAHFYDTAGD----D---------
E2BNT9_HARSA/5-47------------SS-AW---H----------------LEV-ALASFYENDET----P---------
B3RL52_TRIAD/6-48------------AS-NW---N----------------LKL-ALARYYDRGDD----S---------
C1EHA1_MICCC/2-45------------SS-NG---E----------------IDA-AISAFFEHGDQ----D---------
B4MIP1_DROWI/5-46------------SC-DW---D----------------IEQ-ALGNYWSTQ.V----D---------
F2PQY6_TRIEC/8-50------------AN-GW---K----------------VDQ-AIDDYFQNGQS----G---------
E3S3Y1_PYRTT/3-45------------LT-DG---N----------------FEQ-AIQLFFDAPGL----D---------
C4IZE8_MAIZE/12-55------------MT-SW---H----------------LEE-ALQLFYIDGEA----A---------
E9FYH5_DAPPU/5-47------------SS-GW---Q----------------LET-ALASFFENDGA----M---------
UBX2_SCHPO/6-48------------VA-DG---D----------------LST-AITLFFESGGV----T---------
E6ZQC6_SPORE/5-47------------RS-NW---D----------------VER-AMNSYFDDPPP----E---------
F0ZVA6_DICPU/4-46------------SH-NW---D----------------LEE-ATQTYLSTNDV----S---------
A9V0Q4_MONBE/19-62------------AN-SW---N----------------LEA-AVVSFFDQGGA----N---------
D7MAI3_ARALL/7-49------------SH-RW---N----------------LDA-AVSTFLDNDAA----A---------
D8LYL9_BLAHO/2-44------------IS-EG---N----------------IDQ-AISLYFDNANI----F---------
D7M082_ARALL/6-47------------EH-RG---D----------------LNQ-AVNAYFGEGD.----R---------
D5GLD2_TUBMM/110-152------------SH-SW---N----------------VEI-AVDSYFTSNNS----S---------
F2PN33_TRIEC/7-49------------HN-NG---D----------------SHR-AINAYFENPND----P---------
C1MNP9_MICPC/5-48------------SC-GG---D----------------VDA-AVGAFYEAGDE----P---------
D7L0K1_ARALL/9-50------------AS-DW---H----------------LEA-AFDVFYSQP.Q----P---------
Q6C927_YARLI/12-55------------SS-QW---N----------------LEL-ALSRHFD.GAT----G---------
E7A1C9_SPORE/3-45------------AA-GG---D----------------LQT-AMSSFYESEPA----Q---------
A5DQC6_PICGU/8-52------------VN-NW---D----------------LNN-ALSSYFDHGFD----V---------
C0NTP5_AJECG/10-52------------TN-NW---D----------------IHD-ALADYYPEQDD----N---------
F2PRZ6_TRIEC/6-48------------AN-NW---D----------------LDM-AIAEVYPEEEG----P---------
C4QW21_KOMPG/7-51------------HT-SW---N----------------LDL-AISRFFD.GNI----D---------
C3YKP5_BRAFL/16-59------------RH-GW---N----------------MEA-AVHDTFNENEG----Q---------
B6HMA7_PENRW/3-45------------IT-EF---Q----------------IEQ-AMQLYFESGGA----P---------
F0XJM7_GROCL/5-47------------AA-DW---D----------------NNV-AVAAFFQRLEA----E---------
E9DBC9_COCPS/9-50------------NA-HW---N----------------LDR-SIAEFYPE.EQ----E---------
Q6P007_DANRE/9-48------------QN-DW---K----------------LEV-ATDNYFQN...----P---------
A5DDG0_PICGU/6-48------------KH-NW---K----------------LEE-AVNAYLENGSS----R---------
Q6BQ37_DEBHA/11-57------------VN-DW---N----------------LNN-SISTYFDSKFA----S---------
E3QSL9_COLGM/2-44------------MA-NN---N----------------LEQ-AIQLFFESPDI----Q---------
A7RJI9_NEMVE/7-49------------AA-HW---Q----------------FET-ALSLFFQEAAI----P---------
D5G5L9_TUBMM/2-44------------VS-DG---D----------------LEQ-AIQLYFDTGGA----D---------
D0NIJ4_PHYIT/8-50------------LS-NW---K----------------LDE-AVNLYMESGGQ----S---------
D7L0V3_ARALL/10-51------------TH-QW---N----------------LNA-AVSTFTK.NEV----A---------
E4X2U9_OIKDI/11-53------------KH-NW---R----------------LEL-AVDQYFSNPAA----Y---------
E9E2G4_METAQ/11-53------------AN-QW---D----------------LLA-ACNSFFQDDDE----A---------
F0XBP2_GROCL/17-58------------RS-NW---S----------------VPV-AIAKFFD.GEQ----E---------
Q2GWY8_CHAGB/5-47------------AS-KW---D----------------IDS-AVTSYYTDMEE----S---------
NSF1C_DICDI/5-47------------SH-DW---D----------------LEK-AAQTFTTLQEE----E---------
A0A0D2VIE5_CAPO3/21-64------------AN-NW---S----------------LQS-AVASYFDSAGS----G---------
E9IBR1_SOLIN/3-44------------LA-DG---N----------------VEM-AISLMFE.GGR----P---------
E0VQG6_PEDHC/6-48------------AA-AW---Q----------------LQA-ALISFYDKESD----E---------
B6AAH9_CRYMR/9-51------------ST-NW---N----------------LEN-ALILYYEENNN----E---------
E4WR21_OIKDI/22-65------------SF-NW---N----------------LQA-AVNAWFEYGGV----V---------
Q7Q9P4_ANOGA/5-46------------AA-NG---E----------------LQV-ALSNFYE.GEN----E---------
E3MCA3_CAERE/6-47------------RT-NF---D----------------VEI-AVRHFFE.GTI----P---------
A7SUB3_NEMVE/6-48------------AS-NG---N----------------LEM-AIEMHFDSCGD----Q---------
C7Z6D4_NECH7/2-44------------MT-AG---N----------------FER-AIELFYENPDL----A---------
C5DHE4_LACTC/3-46------------MA-GG---N----------------MEV-AISLFYEHGGN----A---------
F2UT65_SALR5/23-66------------AN-NW---N----------------LQG-AVWSYFDQQGS----G---------
C6HFQ4_AJECH/8-50------------AN-NR---D----------------SNR-AINAYFENPDS----V---------
E3NDY1_CAERE/12-55------------DS-NW---R----------------LDS-AIETFFIVSSI----D---------
C4YC44_CLAL4/27-70------------LS-GN---N----------------LEY-AVQLFLEAGAN----N---------
A9ULP0_XENTR/14-57------------QH-NW---N----------------IEA-AVQDRLNEQEG----V---------
Q6BK03_DEBHA/2-43------------IT-NN---D----------------LEY-AVTLYMESN..----P---------
B2B6H8_PODAN/7-49------------AT-NW---D----------------VNT-AAAAFYGDLDE----N---------
DCN1_CAEEL/9-48------------KA-NW---N----------------IEY-AMTLYFDN...----P---------
Q5A0W1_CANAL/9-56------------VH-DF---D----------------LNN-AISTYFDSGFD----S---------
A5E803_LODEL/7-54------------VH-DN---N----------------LNN-AISTYFDTGFE----S---------
F1R890_DANRE/27-70------------MT-NW---N----------------LQA-AIGAYYD.FES----P---------
A7S9M6_NEMVE/13-56------------RH-EW---N----------------IET-AVQDTFNEAEG----G---------
A1C843_ASPCL/9-51------------AH-RW---N----------------AEE-AIDAYFQSPQG----S---------
C4JUU5_UNCRE/9-49------------GN-GW---D----------------VAR-AVDDYFQHN..----P---------
E1ZSZ0_CHLVA/5-47------------AT-GG---N----------------VEQ-AVNLYFAAEPA----G---------
B6IJS1_CAEBR/11-54------------RN-RW---D----------------VEE-AIGTFFSVGFS----S---------
Q6C2H5_YARLI/3-45------------VC-DN---D----------------LER-AVTLYLENDGA----D---------
A3GEZ6_PICST/9-55------------IN-DF---N----------------LNN-AISFYFDSGFE----S---------
C1GJS9_PARBD/9-51------------TS-NW---D----------------LET-ALEEFYRDQDD----N---------
C3ZEN2_BRAFL/13-55------------AC-GG---N----------------LEM-AITMHLEGGAG----A---------
A5DFQ1_PICGU/6-48------------RN-KN---D----------------IMN-AIEDYYASNDK----S---------
B7FQE3_PHATC/7-49------------MS-GG---D----------------LET-AVGLYMEH.EQ----T---------
D6WAX0_TRICA/35-79------------MN-NW---N----------------LQA-AVCSYLDIESS----T---------
A9SVK1_PHYPA/5-47------------ST-EW---L----------------LEP-ALQLYFESDHG----E---------
F0XQR2_GROCL/3-45------------MA-NG---D----------------LPQ-AVLLYYETDEE----E---------
Q29L14_DROPS/9-51------------AC-EN---D----------------VAA-AVALFFEQGAA----S---------
C5DY54_ZYGRC/2-44------------TH-NW---D----------------VNQ-ALNDYYDSEHD----Q---------
E9EC80_METAQ/2-44------------IA-NG---D----------------FER-AIGLFYENPEL----A---------
Q6FRZ1_CANGA/18-63------------NH-GW---N----------------LEA-ALSRYFDDEWK----E---------
B4J9X4_DROGR/8-51------------AS-NW---D----------------LVE-AISRVMPHEDA----P---------
C4JLG5_UNCRE/10-52------------AN-NL---D----------------ANQ-ALNAFFESNSG----Q---------
Q6CMX2_KLULA/4-47------------MA-GG---N----------------LET-AISLFFEHGGE----R---------
F1L242_ASCSU/9-51------------RN-DW---N----------------LEA-AVQHFFQTGGQ----L---------
A1CAL2_ASPCL/7-49------------AN-DL---N----------------SNK-AINAYFEDPTP----P---------
E9FTF8_DAPPU/39-80------------AC-RG---N----------------LER-AVDMHME.GLS----E---------
D8QT57_SELML/9-51------------AS-DW---N----------------LEG-AFEYFYTNQPV----S---------
C5M4D9_CANTT/8-50------------RN-NG---D----------------LVE-AVEDFYANNEP----T---------
A7EE19_SCLS1/8-50------------GT-SW---R----------------LEP-ACDSFFQANNN----A---------
A0A0D2U416_CAPO3/11-53------------RA-SW---K----------------LEP-ALDAFYNSPEA----R---------
DCN1_MAGO7/8-48------------NA-NW---K----------------LDI-AADAYFNSN..----P---------
A0E6F9_PARTE/6-49------------MG-DN---K----------------LEN-AIQLYLDLEGQ----P---------
Q17C41_AEDAE/24-66------------AY-NG---N----------------LEG-AINAFFENPEG----V---------
D7M5K9_ARALL/6-48------------EH-GN---N----------------LPE-AINSHFRDVER----S---------
D2VD49_NAEGR/3-46------------AA-GF---D----------------LET-AVELFFSNQPA----S---------
Q75D11_ASHGO/3-45------------EH-ED---D----------------LED-ALNGFYANQQR----P---------
Q7PNN2_ANOGA/6-48------------AS-NW---N----------------LIN-AIQRVLP.QDP----T---------
E7QB86_YEASZ/6-47------------EF-.G---D----------------LNE-ALNSYYASQTD----D---------
D8PW55_SCHCM/8-51------------SV-DW---D----------------VQR-AAELIFD.GAA----P---------
D7MH49_ARALL/10-53------------AT-NW---H----------------LED-AINLFLIARRN----P---------
A0BUB5_PARTE/7-50------------MA-QD---K----------------LDN-AIQLYFDFEGV----Q---------
TYDP2_DANRE/9-51------------EN-EW---D----------------MER-ALNSFFEAHMD----S---------
Q7Q3P6_ANOGA/11-54------------RH-QW---D----------------LEI-AFQEHLNIREG----R---------
C7YV31_NECH7/5-47------------AH-NW---D----------------IAE-ASNAWFRDAED----D---------
E3QXM3_COLGM/11-53------------SA-NW---D----------------IGL-AAQAYYADHDS----E---------
D0N3L0_PHYIT/18-60------------SC-NW---N----------------VET-AANNYLATMEA----S---------
E4ZZB0_LEPMJ/10-52------------SN-GW---D----------------AQA-AVNAHYGGGGG----A---------
C3ZC83_BRAFL/24-66------------KN-GW---R----------------LQD-SINDYYDPSEE----E---------
B7QCT9_IXOSC/12-55------------RH-NW---D----------------LEV-AVQDTLNIQEG----S---------
E5SHZ1_TRISP/10-52------------NS-AW---D----------------LTL-AVHTFMNDRED----G---------
C5MDM6_CANTT/9-55------------IH-DF---N----------------LNN-AISVYFDTGFD----S---------
C3Z1N9_BRAFL/24-67------------MN-NW---N----------------LQA-AVGAFYD.LET----P---------
B8LDH2_THAPS/193-236------------MS-GG---N----------------LEM-AVSLFLEHGGG----G---------
A0A0K0JUN0_BRUMA/10-52------------YN-HW---N----------------LES-AVQHFFHTGGR----L---------
E9DC17_COCPS/7-49------------AH-NL---D----------------ANR-AANAFYESVCG----S---------
B6QEE1_TALMQ/7-49------------AN-SL---N----------------LEK-AINAYFENPDG----V---------
Q0UAL0_PHANO/9-51------------AS-NG---D----------------LTL-AASLYFDEHQE----Q---------
B0E453_LACBS/7-48------------AH-K.---R----------------VDV-AIDAYYNDPNA----F---------
E1Z398_CHLVA/4-46------------SF-GG---D----------------LDS-AINFYLESGGV----G---------
A7RJX7_NEMVE/9-52------------HH-NW---D----------------LTA-CVNSVLADQTD----S---------
A9V0L8_MONBE/109-151------------RA-SG---D----------------AQT-AIILYLAEHDE----T---------
D3B7A4_POLPA/4-47------------QN-NW---D----------------LDA-SVNHYLLLHDN----Q---------
C9SRT0_VERA1/10-52------------AA-DW---D----------------FGQ-AAQAFYLDQDR----E---------
B8PGV5_POSPM/11-53------------SV-DW---D----------------VQR-AANMILDTG.V----P---------
D2VZD0_NAEGR/18-61------------QS-NG---D----------------VSK-AIENYFDEQEQ----Q---------
B6HJ43_PENRW/9-51------------AC-GW---S----------------LPP-ALDAFFAAASG----T---------
A7SCH1_NEMVE/18-60------------EN-FM---D----------------IEQ-AASAYYESAAK----D---------
B6K2Q5_SCHJY/74-116------------LA-KG---N----------------LEV-AVNMYFDKTTS----S---------
C1MTG3_MICPC/18-59------------AC-GG---E----------------LQR-AVDRHFA.VVA----P---------
A9RJT6_PHYPA/3-46------------AY-GW---D----------------LDS-AIQAMVDKTTN----V---------
D8QMR0_SELML/12-55------------RH-GW---D----------------LDS-AVTAAVSDDSH----S---------
E6ZTU8_SPORE/8-49------------AH-GY---R----------------IEP-ATDAFFND.EQ----A---------
C5DW92_ZYGRC/18-63------------RD-GW---G----------------LEL-ALSHYFDGNWK----E---------
Q6FXT3_CANGA/5-47------------QY-DN---D----------------LGG-ALNAYYASQME----S---------
Q2HEZ6_CHAGB/4-46------------LC-GS---E----------------LEQ-AIQLWFTDEDL----Q---------
A7TJ90_VANPO/18-62------------NH-GW---S----------------LEP-ALGRYFD.GTW----K---------
E1ZBM6_CHLVA/5-47------------AS-GG---N----------------YER-ALSMFHEQSAG----G---------
TYDP2_CAEBR/34-76------------DV-GW---D----------------LKR-ALDVFFGSDAF----K---------
B9GTU7_POPTR/27-68------------SH-QW---D----------------LDS-AVSTFLDNDSA----P---------
B9HVN3_POPTR/12-52------------AT-SW---K----------------LED-AIQLFYVGNE.----.---------
B9Q2T2_TOXGV/5-47------------MA-AG---D----------------CNA-AALLFFDHQEE----.---------
E4WS89_OIKDI/3-45------------AA-HG---D----------------VSA-AIANFFDAGGN----.---------
A0A0D2VIH6_CAPO3/2-43------------MT-GG---D----------------LNA-AVSMFLDEGT.----.---------
F4IUT4_ARATH/103-142------------RS-NW---N----------------INL-AVDSFLVER..----.---------
G4U8S2_NEUT9/5-44------------LC-GG---D----------------LEQ-AIQLWFADEE.----.---------
G4VIN2_SCHMA/21-62------------LA-DW---N----------------LQR-AIGAYFDFS..----.---------
G7Y2V9_CLOSI/55-93------------TN-NW---K----------------MEQ-AVDYFYRQN..----.---------
H3CAQ1_TETNG/5-46------------SA-GW---S----------------LHL-ALGSFFEDEGD----.---------
TYDP2_XENTR/26-64------------EN-DW---D----------------MER-AINSFFEPG..----.---------
Q59WE0_CANAL/2-43------------VA-GG---D----------------LEL-AVTLYMESGQ.----.---------
Q7K4I5_DROME/8-48------------AC-AN---D----------------VSA-AVALFFEQ.AA----.---------
Q9FWC4_ORYSJ/6-47------------AH-NW---D----------------LQL-AVSSITANPS.----.---------
U1NTV9_ASCSU/12-50------------DV-DW---Q----------------LQA-ALDRFFECNS.----.---------
W1Q7K7_OGAPD/9-53------------VC-NW---D----------------LEI-AVARYFDNDF.----.---------

PF11547

E3LUR5_CAERE/181-232------------RT-GL---N----------------VNE-AVNNLLSRDDG----D---------
J0M342_LOALO/159-209------------RT-NL---N----------------VNE-AVNNLLSRDDE----E---------
Q7PY72_ANOGA/189-240------------RT-NL---D----------------VNL-AVNNLLSRDDE----G---------
K7EIB6_ORNAN/174-225------------RT-NL---D----------------VNL-AVNNLLSRDDE----D---------
B3S209_TRIAD/157-208------------RS-NL---D----------------VNV-AVNNLLSRDDD----D---------
A0A068XTN0_ECHMU/136-185------------RT-NL---D----------------VNM-AVNNMLSREDE----.---------
F7AHP3_CIOIN/184-235------------RT-SL---D----------------VNL-AVNNLLSRDDE----D---------
G7YDQ8_CLOSI/164-214------------NT-NL---D----------------VNM-AVNNLLSRDDE----.---------
U6H7P7_HYMMI/159-208------------RT-NL---D----------------VNA-AVNNLLSREDE----.---------
I1G1T2_AMPQE/146-197------------RT-NL---D----------------VNT-AVNNLLSRDDD----D---------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window