Sequence alignment for CL0217

PF00434

VP7_ROTHT/1-326MYGIEYTTVLFYLISFVLVSYILKTIIKIMDYIIYRITFVIVVLSVLSN...AQNYGINLPITGSMDTAYANSTQDNNFL
VP7_ROTEL/1-326MYGIEYTTILTFFVSFIILDYTIKTLTRAMDFIIYRFLLVVVILSPLLT...AQNYGINLPITGSMDTAYANSTQEENFL
VP7_ROTA1/1-329MYSTECTILLIEIIFYFLAAIILYDMLHKMANSPLLCIAVLTVTLAVTSKCYAQNYGINVPITGSMDVAVPNKTDDQIGL
VP7_ROTBJ/1-326MYGIEYTTILIFLVSIILINYILKSITRIMDYIIYRFLFVVVLMAIVTS...AQNYGVNLPITGSMDTAYANSTQNEPFL
VP7_ROTE2/1-326MYGIECTTILTFLISLILLNYILQLLTRIMDFIIYRFLFIIVFLSPFLK...AQNYGINLPISGSMDTAYVNSTQENIFL
VP7_ROTCC/1-329MYSTKCTNFFLEIIFYVIFCTLFLLVLEKMSKLLSWIVIVCLFVFAISSKCSAQNYGINVPITGSMDVVLANSTQDQIGL
VP7_ROTHA/1-326MYGIEYTTILTILISIILLNYILKTITNTMDYIIFRFLLLIALISPFVR...TQNYGMYLPITGSLDAVYTNSTSGEPFL
VP7_ROTHL/1-326MYGIEYTTILTILISIVLLNYILKSITSMMDFIIYRFLLVFVIVLPFIK...AQNYGINLPITGSMDTAYVNSTQQESFM

PF05868

VP7_ROTGI/2-246------TTMLLLLVVAALANGQLTIL---------------------------------------------------PHE
P87518_9REOV/1-247------MPLPLLLVFAACAKAQLVIT---------------------------------------------------PIS
VP7_ROTGA/1-249------MASLLLLVLAAAVTAQLNIV---------------------------------------------------PST

PF00434

VP7_ROTHT/1-326FSTLCLYYPSEAPTQISDTEWKDTLSQLFLTKGWPTGSVYF---NEYSNVLEFSIDPKLYCDYNVVLIRFVSGEELDISE
VP7_ROTEL/1-326VSTLCLYYPNEVVSELNDDSWKNTLSQLFLTKGWPTGSVYF---NEYSDIASFSINPQLYCDYNIVVVKYSTELQLDISE
VP7_ROTA1/1-329SSTLCIYYPKEAATQMNDAEWKSTVTQLLLAKGWPTTSVYL---NEYADLQSFSNDPQLNCDYNIILAKYDQNETLDMSE
VP7_ROTBJ/1-326TSTLCLYYPIEASNEIADTEWRNTLSQLFLTKGWPTGSVYF---KEYADIAAFSVEPQLYCDYNIVLMKYDSTLELDMSE
VP7_ROTE2/1-326TSTLCLYYPTEAATQIDDSSWKDTISQLFLTKGWPAGSVYL---KEYTDITSFSIDPQLYCDYNVVLMKYDEALQLDMSE
VP7_ROTCC/1-329TSTLCIYYPKAADTEIADPEWKATVTQLLLTKGWPTTSVYL---NEYQDLVTFSNDPKLYCDYNIVLAHYTNDVALDISE
VP7_ROTHA/1-326TSTLCLYYPAEAKNEISDDEWENTLSQLFLTKGWPIGSVYF---KDYNDINTFSVNPQLYCDYNVVLMRYDNTSELDASE
VP7_ROTHL/1-326TSTLCLYYPNSVTTEITDPDWTHTLSQLFLTKGWPTNSVYF---KSYADIASFSVNPQLYCDYNIVLVQYQNSLALDVSE

PF05868

VP7_ROTGI/2-246ESQICFLQPDNPGFD..--.FDGNFTNIFRDYASVKISSFTYKAQDADIVEILNVDRDRSCT---ILAIYIADSTLD---
P87518_9REOV/1-247NPEICVLHASDW..NVN--SFGDNFTNIFETYNSVTLSFYQYDSTNYEVIDIISKRDYSLCH---ILAIDVVKPEMD---
VP7_ROTGA/1-249HPEVCVLYADDHQADAN--KFNGNFTQIFHSYNSITLSFMSYSSSSYDVIDIISKYDLSSCN---ILAIDVFNASMD---

PF00434

VP7_ROTHT/1-326LADLILNEWLCNPMDITLYYYQQTGEANKWISMGSSCTVKVCPLNTQTLGIGCQTTNTATFETVADSEKLAIIDVVDSVN
VP7_ROTEL/1-326LANLILNEWLCNPMDITLYYYQQTDETNKWISTGTSCTVKVCPLNTQTLGIGCLTTDTETFEEVATLEKLVITDVVDGVN
VP7_ROTA1/1-329LAELLLYEWLCNPMDVTLYYYQQTSESNKWIAMGSDCTIKVCPLNTQTLGIGCKTTDVSTFEELTTTEKLAIIDVVDGVN
VP7_ROTBJ/1-326LADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTIKVCPLNTQTLGIGCSTTNPDTFETVATAEKLVITDVVDGVN
VP7_ROTE2/1-326LADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTIKVCPLNTQTLGIGCLTTNVATFEEVATSEKLVIKDVVDGVD
VP7_ROTCC/1-329LAEFLLYEWLCNPMDVTLYYYQQTSEPNKWIAMGTNCTIKVCPLNTQTLGIGCQTTNTDTFEILTMSEKLAIIDVVDGVN
VP7_ROTHA/1-326LADLILNEWLCNPMDISLYYYQQSSESNKWISMGTDCTVKVCPLNTQTLGIGCKTTDVNTFEIVASSEKLVITDVVNGVN
VP7_ROTHL/1-326LADLILNEWLCNPMDVTLYYYQQTDEANKWISMGDSCTVKVCPLNMQTLGIGCTTTDVATFEEVANAEKLVITDVVDGVN

PF05868

VP7_ROTGI/2-246FNTFLQSENECVKYAASKKHYIKLPRDREYFALAKN--LSFCPLNDDLIGIYCDTQLETTYFSVARSSNYDVTDIPEFTE
P87518_9REOV/1-247FITFLQSNNECTKYAGQKIHYQKLSTNEEWFVYSKN--LSLSPLSDSLIGLYCDTEINGTYFPLSENEKYDVTDLPEFTE
VP7_ROTGA/1-249FNVFLQSTNNCSKYNANKVHHVKLPRGEEWFSYSKN--LKFCPLSDSLIGMYCDTQLSDTYFEISTGGTYEVTDIPEFTQ

PF00434

VP7_ROTHT/1-326HKLNITSTTCTIRNCNKLGPRENVAIIQVGGSNILDITADPTTSPQTERMMRVNWKKWWQVFYTVVDYINQIVQVMSKRS
VP7_ROTEL/1-326HKINLTTATCTIRNCKKLGPRENVAIIQVGRSSTIDITADPTTMPQTERMMRINWKKWWQVFYTIVDYVNQIIQVMSKRS
VP7_ROTA1/1-329HKANYTISTCTIKNCIRLDPRENVAIIQVGGPEIIDISEDPMVVPHVQRATRINWKKWWQIFYTVVDYINTIIQAMSKRS
VP7_ROTBJ/1-326HKLDVTTATCTIRNCKKLGPRENVAVIQVGGANILDITADPTTAPQTERMMRVNWKKWWQVFYTVVDYVNQIIQAMSRRS
VP7_ROTE2/1-326HKVECTTTTCTIRNCKKLGPRENVAIIQVGGSDILDITADPTTAPQIARMMRINWKKWWQVFYTVVDYINQIVQVMSKRS
VP7_ROTCC/1-329HKVDYTVATCKINNCIRLNPRENVAIIQVGGPEVLDISENPMVIPKVSRMTRMNWKKWWQVFYTIVDYINTIITTMSKRS
VP7_ROTHA/1-326HNINISINTCTIRNCNKLGPRENVAIIQVGGPNALDITADPTTVPQVQRIMRINWKKWWQVFYTVVDYINQVIQVMSKRS
VP7_ROTHL/1-326HKINITLNTCTIQNCKKLGPRENVAIIQVGGSDIIDITADPTTIPQTERIMRINWKKWWQVFYTVVDYINQIVQVMSKRS

PF05868

VP7_ROTGI/2-246LGYVFHSND-HFYICERKSEGNWI--------DYQLFYQNDAPLGTVSQ--RVNWGNVWSNVKTVAQMVYKILDIFFG.K
P87518_9REOV/1-247MGYVFYSND-DFYICKRINDHKWV--------NYHLFYREYSASGTVSR--AISWDNVWTGFKTFAQVVYKILDIFFNNR
VP7_ROTGA/1-249MGYTFHSSE-EFYLCHRISSEAWL--------NYHLFYRDYDVSGVISK--QVNWGNVWSGFKTFAQVLYKILDLFFNSK

PF00434

VP7_ROTHT/1-326RSLDSSSFYYRV
VP7_ROTEL/1-326RSLDAAEFYYRV
VP7_ROTA1/1-329RSLNTSAYYFRV
VP7_ROTBJ/1-326RSLNSAAFYYRV
VP7_ROTE2/1-326RSLDSAAFYYRI
VP7_ROTCC/1-329RSLDVSSYYYRV
VP7_ROTHA/1-326RSLDAAAFYYRI
VP7_ROTHL/1-326RSLNSAAFYYRI

PF05868

VP7_ROTGI/2-246RNIEPRA-----
P87518_9REOV/1-247RNFEPRA-----
VP7_ROTGA/1-249RNVEPRA-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window