Sequence alignment for CL0217

PF00434

VP7_ROTSH/1-323MYGIEYTTVLTF.LISIILLNYILKSLTRIMDFIIYRFLFIIVILS...PFLRAQNYGINLPITGSMDTAYANSTQEETF
VP7_ROTHC/3-323C.....TTLYTVCAILFILFIYIL..LFRKMFHLITDTLIVILILSNCVEWSQGQMFTDDIYYNGNVET.IINST..DPF

PF05868

VP7_ROTGI/2-246T------------------------------------TMLLLLVVAALA--------------NGQLTI--------LPH
P87518_9REOV/1-247M------------------------------------PLPLLLVFAACA--------------KAQLVI--------TPI
VP7_ROTGA/1-249M------------------------------------ASLLLLVLAAAV--------------TAQLNI--------VPS

PF00434

VP7_ROTSH/1-323LTSTLCLYYPT.........EAATEINDNSWKDTLSQLFLTKGWPTGSVYFKEYTNIASFSVDPQLYCDYNVVLMKYDAT
VP7_ROTHC/3-323NVESLCIYFPNAVVGSQGPGKSDGHLNDGNYAQTIATLFETKGFPKGSIILKTYTQTSDFINSVEMTCSYNIVIIPDSPN

PF05868

VP7_ROTGI/2-246EESQICFLQPD-----------NPGFD...FDGNFTNIFRD--YASVKISSFTYKAQDADIVEILNVDRDRSCTILAIYI
P87518_9REOV/1-247SNPEICVLHAS-----------DW..NVNSFGDNFTNIFET--YNSVTLSFYQYDSTNYEVIDIISKRDYSLCHILAIDV
VP7_ROTGA/1-249THPEVCVLYAD-----------DHQADANKFNGNFTQIFHS--YNSITLSFMSYSSSSYDVIDIISKYDLSSCNILAIDV

PF00434

VP7_ROTSH/1-323LQLDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTIKVCPLNTQTLGIGCLTTDATTFEEVATAEKLVIT
VP7_ROTHC/3-323DSESIEQIAEWILNVWRCDDMNLEIYTYEQIGINNLWAAFGSDCDISVCPLDTTSNGIGCSPASTETYEVVSNDTQLALI

PF05868

VP7_ROTGI/2-246ADSTL-DFNTFLQSENECVKYAASKKHYIKLPRDREYFALAKN--LSFCPLNDDLIGIYCDTQLETTYFSVARSSNYDVT
P87518_9REOV/1-247VKPEM-DFITFLQSNNECTKYAGQKIHYQKLSTNEEWFVYSKN--LSLSPLSDSLIGLYCDTEINGTYFPLSENEKYDVT
VP7_ROTGA/1-249FNASM-DFNVFLQSTNNCSKYNANKVHHVKLPRGEEWFSYSKN--LKFCPLSDSLIGMYCDTQLSDTYFEISTGGTYEVT

PF00434

VP7_ROTSH/1-323DVVDGVNHKLDVTTATCTIRNCKKLGPRENVAVIQVGGSDILDITA-DPTTAPQTERMMRINWKKWWQVFYTVVDYVDQI
VP7_ROTHC/3-323NVVDNVRHRIQMNTAQCKLKNCIKGEARLNTALIRISTSSSFDNSL-SPLNNGQTTRSFKINAKKWWTIFYTIIDYINTI

PF05868

VP7_ROTGI/2-246DIPEFTELGYVFHSND-HFYICE-----------RKSEGNWIDYQLFYQNDAPLGTVSQRVNWGNVWSNVKTVAQMVYKI
P87518_9REOV/1-247DLPEFTEMGYVFYSND-DFYICK-----------RINDHKWVNYHLFYREYSASGTVSRAISWDNVWTGFKTFAQVVYKI
VP7_ROTGA/1-249DIPEFTQMGYTFHSSE-EFYLCH-----------RISSEAWLNYHLFYRDYDVSGVISKQVNWGNVWSGFKTFAQVLYKI

PF00434

VP7_ROTSH/1-323IQVMSKRSRSLNSAAFY
VP7_ROTHC/3-323VQAMTPRHR.....AIY

PF05868

VP7_ROTGI/2-246LDIFFG.KRNIEPRA--
P87518_9REOV/1-247LDIFFNNRRNFEPRA--
VP7_ROTGA/1-249LDLFFNSKRNVEPRA--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window