Sequence alignment for CL0220

PF13405

F5HLN4_ANOGA/622-651--------------------------------------------------------------------------M-Y-V.
B9PZD1_TOXGO/10-39--------------------------------------------------------------------------K-C-R.
Q7QH58_ANOGA/21-50--------------------------------------------------------------------------E-M-R.
B9PML0_TOXGO/103-132--------------------------------------------------------------------------E-L-K.
C4Q5J4_SCHMA/2655-2684--------------------------------------------------------------------------R-V-I.
B9PRI1_TOXGO/15-44--------------------------------------------------------------------------E-L-K.
Q001X5_TOXGO/73-102--------------------------------------------------------------------------D-L-K.
Q95UJ7_TOXGO/149-178--------------------------------------------------------------------------D-L-V.
CAN8_HUMAN/536-564--------------------------------------------------------------------------Q-F-R.
A9V4Q3_MONBE/290-319--------------------------------------------------------------------------K-L-S.
A9V4Q3_MONBE/492-521--------------------------------------------------------------------------Q-I-L.
A0BQH1_PARTE/99-128--------------------------------------------------------------------------D-I-K.
A0BQH1_PARTE/172-202--------------------------------------------------------------------------T-I-R.
B3DGM2_DANRE/12-41--------------------------------------------------------------------------E-F-K.
B3DGM2_DANRE/85-114--------------------------------------------------------------------------E-I-L.
B4G986_DROPE/40-69--------------------------------------------------------------------------D-I-K.
B4G986_DROPE/113-142--------------------------------------------------------------------------D-M-L.
EFCB6_PONAB/24-53--------------------------------------------------------------------------T-V-M.
EFCB6_PONAB/255-284--------------------------------------------------------------------------S-L-K.
EFCB6_PONAB/699-728--------------------------------------------------------------------------D-L-S.
EFCB6_PONAB/816-845--------------------------------------------------------------------------D-I-S.
B4GVA6_DROPE/51-80--------------------------------------------------------------------------R-L-G.
B4GVA6_DROPE/139-169--------------------------------------------------------------------------R-D-R.
B4GVA6_DROPE/217-247--------------------------------------------------------------------------R-E-R.
C5KAW4_PERM5/19-48--------------------------------------------------------------------------A-F-K.
C5KAW4_PERM5/93-122--------------------------------------------------------------------------V-L-M.
A0E4G3_PARTE/299-328--------------------------------------------------------------------------K-I-Q.
B4K4U2_DROMO/29-58--------------------------------------------------------------------------D-L-T.
B4K4U2_DROMO/102-131--------------------------------------------------------------------------E-V-I.
A0BG74_PARTE/108-137--------------------------------------------------------------------------E-I-E.
B5Y3F8_PHATC/258-286--------------------------------------------------------------------------F-L-R.
Q7Y0H2_CHLRE/18-47--------------------------------------------------------------------------E-L-E.
C5Z5N8_SORBI/67-96--------------------------------------------------------------------------R-I-R.
C5Z5N8_SORBI/134-163--------------------------------------------------------------------------E-L-Y.
A7SG62_NEMVE/12-41--------------------------------------------------------------------------Q-L-R.
A7SG62_NEMVE/87-116--------------------------------------------------------------------------D-F-V.
Q240R2_TETTS/29-58--------------------------------------------------------------------------T-L-I.
B5DYP3_DROPS/28-57--------------------------------------------------------------------------D-C-T.
A7RGK2_NEMVE/11-40--------------------------------------------------------------------------E-Y-R.
A7RGK2_NEMVE/86-115--------------------------------------------------------------------------E-F-V.
Q4DGX2_TRYCC/326-357--------------------------------------------------------------------------E-I-H.
A9V7J3_MONBE/330-359--------------------------------------------------------------------------A-L-K.
A9V7J3_MONBE/402-431--------------------------------------------------------------------------R-L-W.
Q4Y2X6_PLACH/19-48--------------------------------------------------------------------------E-I-Y.
B3LYL3_DROAN/28-57--------------------------------------------------------------------------D-L-E.
A0E0C2_PARTE/300-329--------------------------------------------------------------------------D-I-G.
C3YDW3_BRAFL/85-114--------------------------------------------------------------------------E-I-L.
Q0IEY6_AEDAE/74-103--------------------------------------------------------------------------R-L-G.
Q0IEY6_AEDAE/240-270--------------------------------------------------------------------------H-E-R.
A9VBL4_MONBE/184-215--------------------------------------------------------------------------L-V-D.
A0E3X2_PARTE/219-248--------------------------------------------------------------------------S-L-K.
MYL6B_HUMAN/145-174--------------------------------------------------------------------------D-Y-L.
Q7QCU7_ANOGA/79-109--------------------------------------------------------------------------E-L-T.
Q7QCU7_ANOGA/211-241--------------------------------------------------------------------------L-V-D.
D0NI99_PHYIT/995-1024--------------------------------------------------------------------------L-L-T.
D0NZK1_PHYIT/776-806--------------------------------------------------------------------------V-L-L.
C1FGB5_MICSR/2004-2033--------------------------------------------------------------------------E-L-T.
C1FGB5_MICSR/2077-2106--------------------------------------------------------------------------A-L-D.
C1FGB5_MICSR/2208-2238--------------------------------------------------------------------------D-V-R.
D3AYI6_POLPA/6-35--------------------------------------------------------------------------Q-I-A.
D3AYI6_POLPA/79-108--------------------------------------------------------------------------E-M-L.
A2ERW3_TRIVA/9-39--------------------------------------------------------------------------A-I-E.
A2ERW3_TRIVA/82-111--------------------------------------------------------------------------Q-Y-K.
A7RV39_NEMVE/88-117--------------------------------------------------------------------------Y-F-M.
A2DT12_TRIVA/7-37--------------------------------------------------------------------------E-F-S.
A2DT12_TRIVA/80-109--------------------------------------------------------------------------L-T-K.
A4UNW1_CHICK/97-126--------------------------------------------------------------------------T-I-L.
A2DIY5_TRIVA/14-43--------------------------------------------------------------------------L-Y-K.
A2DIY5_TRIVA/85-114--------------------------------------------------------------------------E-L-T.
A8N2E2_COPC7/129-158--------------------------------------------------------------------------E-L-I.
A0CCH5_PARTE/297-326--------------------------------------------------------------------------D-F-L.
A0BPZ4_PARTE/198-233--------------------------------------------------------------------------V-A-R.
Q01GA6_OSTTA/40-69--------------------------------------------------------------------------I-L-R.
Q01GA6_OSTTA/181-223--------------------------------------------------------------------------Y-L-H.
B6K7R4_SCHJY/10-39--------------------------------------------------------------------------E-M-N.
B6K7R4_SCHJY/79-108--------------------------------------------------------------------------E-F-I.
C3YGP7_BRAFL/22-51--------------------------------------------------------------------------K-I-T.
Q240Z1_TETTS/371-400--------------------------------------------------------------------------S-L-K.
Q240Z1_TETTS/445-474--------------------------------------------------------------------------K-I-W.
C3ZWG8_BRAFL/29-59--------------------------------------------------------------------------R-V-S.
Q7T2F7_DANRE/113-143--------------------------------------------------------------------------K-L-L.
B4LIU4_DROVI/12-41--------------------------------------------------------------------------E-L-K.
B4LIU4_DROVI/85-114--------------------------------------------------------------------------N-L-R.
A0C7B9_PARTE/44-73--------------------------------------------------------------------------R-V-R.
A0C7B9_PARTE/522-551--------------------------------------------------------------------------R-I-A.
D0NQW3_PHYIT/447-476--------------------------------------------------------------------------D-A-L.
B4KPB2_DROMO/13-42--------------------------------------------------------------------------E-L-R.
A7SK46_NEMVE/37-66--------------------------------------------------------------------------L-F-K.
A7SK46_NEMVE/105-134--------------------------------------------------------------------------I-I-L.
A7S7W7_NEMVE/508-546--------------------------------------------------------------------------T-L-N.
A7S7W7_NEMVE/583-612--------------------------------------------------------------------------K-W-M.
A9SC48_PHYPA/64-94--------------------------------------------------------------------------A-L-Y.
A9SC48_PHYPA/138-175--------------------------------------------------------------------------K-I-Q.
Q4N995_THEPA/859-892--------------------------------------------------------------------------S-L-K.
B8PFW7_POSPM/47-76--------------------------------------------------------------------------Q-F-R.
B8CDF2_THAPS/17-48--------------------------------------------------------------------------S-Y-A.
A2EWU3_TRIVA/26-55--------------------------------------------------------------------------E-L-R.
A2EWU3_TRIVA/99-128--------------------------------------------------------------------------D-L-K.
Q4PFY7_USTMA/49-78--------------------------------------------------------------------------E-Y-K.
B9S960_RICCO/440-471--------------------------------------------------------------------------K-I-R.
D0N3P0_PHYIT/23-52--------------------------------------------------------------------------R-I-R.
D0N3P0_PHYIT/102-131--------------------------------------------------------------------------T-L-L.
D0NIV0_PHYIT/360-387--------------------------------------------------------------------------M-A-A.
C4R6X4_PICPG/24-55--------------------------------------------------------------------------R-Y-K.
B7PVC0_IXOSC/891-929--------------------------------------------------------------------------K-F-R.
A2F2K1_TRIVA/16-45--------------------------------------------------------------------------S-F-K.
A2F2K1_TRIVA/87-116--------------------------------------------------------------------------E-L-I.
B3MTC1_DROAN/109-140--------------------------------------------------------------------------L-Y-R.
B3DFQ1_DANRE/118-147--------------------------------------------------------------------------R-W-Q.
Q4DBB8_TRYCC/35-64--------------------------------------------------------------------------Q-L-R.
Q4DBB8_TRYCC/108-137--------------------------------------------------------------------------E-A-I.
B6AAA3_CRYMR/149-179--------------------------------------------------------------------------E-I-Q.
B6KGE8_TOXGO/126-155--------------------------------------------------------------------------S-T-R.
B6KGE8_TOXGO/199-230--------------------------------------------------------------------------K-V-V.
B8CB62_THAPS/13-42--------------------------------------------------------------------------E-F-A.
Q6CKI4_KLULA/78-107--------------------------------------------------------------------------D-F-I.
C5DMF9_LACTC/14-45--------------------------------------------------------------------------R-F-K.
A8J3S1_CHLRE/300-329--------------------------------------------------------------------------R-L-I.
A5DJ68_PICGU/64-95--------------------------------------------------------------------------Y-C-H.
A0CPY1_PARTE/103-143--------------------------------------------------------------------------K-A-N.
A8XS91_CAEBR/6-35--------------------------------------------------------------------------D-C-R.
A2DQT8_TRIVA/13-42--------------------------------------------------------------------------N-Y-K.
A2DQT8_TRIVA/83-112--------------------------------------------------------------------------E-L-V.
A0DCA4_PARTE/23-52--------------------------------------------------------------------------K-C-Y.
Q5KN37_CRYNJ/88-117--------------------------------------------------------------------------E-F-I.
A0BDG8_PARTE/301-330--------------------------------------------------------------------------D-L-E.
Q66HU4_DANRE/630-659--------------------------------------------------------------------------Q-W-Q.
C5LCN0_PERM5/396-425--------------------------------------------------------------------------D-M-R.
A9UUF1_MONBE/6-34--------------------------------------------------------------------------R-L-L.
C1EI49_MICSR/48-79--------------------------------------------------------------------------F-L-A.
B7PJB2_IXOSC/18-48--------------------------------------------------------------------------F-L-M.
B3M2P5_DROAN/85-114--------------------------------------------------------------------------E-L-K.
A8BSJ2_GIAIC/8-37--------------------------------------------------------------------------R-C-R.
A8J2K6_CHLRE/48-77--------------------------------------------------------------------------L-L-K.
A8XSA6_CAEBR/77-106--------------------------------------------------------------------------E-F-Q.
CBPF_DICDI/13-45--------------------------------------------------------------------------E-V-Q.
C8JQR9_CAEEL/144-173--------------------------------------------------------------------------K-L-A.
Q6FSJ6_CANGA/19-48--------------------------------------------------------------------------K-L-K.
A0BKS7_PARTE/17-46--------------------------------------------------------------------------A-A-K.
Q4DSH4_TRYCC/48-77--------------------------------------------------------------------------E-A-V.
Q4Y7U7_PLACH/93-122--------------------------------------------------------------------------K-I-K.
A9U253_PHYPA/229-258--------------------------------------------------------------------------T-L-K.
B0WB65_CULQU/256-285--------------------------------------------------------------------------R-K-A.
A4I3F5_LEIIN/12-41--------------------------------------------------------------------------F-F-R.
A4I3F5_LEIIN/85-114--------------------------------------------------------------------------E-V-R.
A0BU82_PARTE/29-57--------------------------------------------------------------------------E-L-H.
Q755U9_ASHGO/14-45--------------------------------------------------------------------------R-H-E.
A8I1S7_CHLRE/186-215--------------------------------------------------------------------------R-M-R.
A4HZA9_LEIIN/84-113--------------------------------------------------------------------------E-L-Y.
A0D306_PARTE/59-88--------------------------------------------------------------------------E-V-D.
Q4Q2P9_LEIMA/35-64--------------------------------------------------------------------------S-F-S.
A0E3G8_PARTE/176-205--------------------------------------------------------------------------N-F-Q.
A9V0G9_MONBE/68-97--------------------------------------------------------------------------A-I-A.
A7AQR4_BABBO/777-815--------------------------------------------------------------------------A-L-F.
A7AQR4_BABBO/875-908--------------------------------------------------------------------------S-L-R.
A4HBM1_LEIBR/11-40--------------------------------------------------------------------------R-A-S.
A0CNQ7_PARTE/356-385--------------------------------------------------------------------------S-L-R.
A0CNQ7_PARTE/435-464--------------------------------------------------------------------------R-I-W.
B3L806_PLAKH/94-123--------------------------------------------------------------------------K-I-R.
C3Y3X5_BRAFL/109-138--------------------------------------------------------------------------E-F-K.
C3Y3X5_BRAFL/178-207--------------------------------------------------------------------------V-L-L.
C5E2K8_LACTC/5-34--------------------------------------------------------------------------T-Q-K.
D0NMF2_PHYIT/62-91--------------------------------------------------------------------------F-F-R.
B9RGV3_RICCO/45-74--------------------------------------------------------------------------R-I-R.
A0DZF8_PARTE/406-435--------------------------------------------------------------------------S-L-V.
D0NPC8_PHYIT/30-59--------------------------------------------------------------------------L-L-R.
D3B753_POLPA/41-70--------------------------------------------------------------------------K-Y-K.
A7RJ54_NEMVE/73-101--------------------------------------------------------------------------E-I-R.
C3ZK54_BRAFL/145-176--------------------------------------------------------------------------R-D-L.
Q23CU0_TETTS/69-99--------------------------------------------------------------------------I-Y-K.
EFCB7_HUMAN/106-135--------------------------------------------------------------------------E-L-L.
Q4P615_USTMA/58-87--------------------------------------------------------------------------G-F-K.
A0BMA1_PARTE/125-154--------------------------------------------------------------------------E-I-K.
A7RI54_NEMVE/73-102--------------------------------------------------------------------------Q-W-K.
Q7RNY5_PLAYO/47-76--------------------------------------------------------------------------N-L-Q.
A8QGG8_BRUMA/91-120--------------------------------------------------------------------------E-M-H.
A0NGM4_ANOGA/720-749--------------------------------------------------------------------------K-W-K.
A0CQY7_PARTE/181-210--------------------------------------------------------------------------N-F-Q.
A2FZQ0_TRIVA/11-40--------------------------------------------------------------------------K-Y-K.
A2FZQ0_TRIVA/82-111--------------------------------------------------------------------------Q-L-I.
PLSI_BOVIN/15-46--------------------------------------------------------------------------E-L-Q.
A0BVC0_PARTE/355-384--------------------------------------------------------------------------K-L-Q.
A0BVC0_PARTE/444-473--------------------------------------------------------------------------K-L-W.
A8J258_CHLRE/12-41--------------------------------------------------------------------------A-V-L.
A8J258_CHLRE/85-114--------------------------------------------------------------------------E-H-R.
A0BLQ1_PARTE/56-85--------------------------------------------------------------------------K-Y-R.
A0BLQ1_PARTE/129-158--------------------------------------------------------------------------Q-L-V.
D3B3V9_POLPA/20-49--------------------------------------------------------------------------K-L-R.
C6WP87_ACTMD/55-86--------------------------------------------------------------------------W-W-E.
B0CEP3_ACAM1/69-106--------------------------------------------------------------------------P-L-E.
B4JQZ6_DROGR/12-41--------------------------------------------------------------------------K-M-R.
B4JQZ6_DROGR/95-124--------------------------------------------------------------------------Q-F-K.
B3RJS5_TRIAD/515-551--------------------------------------------------------------------------A-F-H.
B3RJS5_TRIAD/588-617--------------------------------------------------------------------------S-W-K.
B4LWK2_DROVI/652-680--------------------------------------------------------------------------E-F-R.
B4LWK2_DROVI/720-749--------------------------------------------------------------------------E-V-I.
Q236L3_TETTS/181-210--------------------------------------------------------------------------N-F-Q.
A9UU69_MONBE/7-36--------------------------------------------------------------------------D-I-K.
A9UU69_MONBE/73-102--------------------------------------------------------------------------E-T-M.
B3SAM3_TRIAD/385-414--------------------------------------------------------------------------R-L-I.
D0N7S9_PHYIT/33-62--------------------------------------------------------------------------L-M-R.
B4J628_DROGR/30-59--------------------------------------------------------------------------S-L-R.
C5DUR9_ZYGRC/19-48--------------------------------------------------------------------------R-L-K.
B8CFT6_THAPS/84-113--------------------------------------------------------------------------E-I-A.
C3YER0_BRAFL/167-196--------------------------------------------------------------------------S-F-R.
A8X3X6_CAEBR/106-135--------------------------------------------------------------------------Y-F-A.
A0BXL7_PARTE/42-71--------------------------------------------------------------------------N-L-H.
A0BXL7_PARTE/114-145--------------------------------------------------------------------------V-V-A.
A0DNH6_PARTE/2304-2334--------------------------------------------------------------------------D-L-F.
A8XVF9_CAEBR/36-65--------------------------------------------------------------------------R-L-F.
A0D1H3_PARTE/66-95--------------------------------------------------------------------------S-L-W.
A0D1H3_PARTE/181-210--------------------------------------------------------------------------Q-L-E.
B7PU66_IXOSC/252-281--------------------------------------------------------------------------Y-L-R.
A9UV27_MONBE/2126-2155--------------------------------------------------------------------------Q-I-F.
B4L3F1_DROMO/11-40--------------------------------------------------------------------------E-I-C.
B3RIN1_TRIAD/205-233--------------------------------------------------------------------------P-L-..
A5WWC4_DANRE/533-569--------------------------------------------------------------------------H-F-K.
A5WWC4_DANRE/606-635--------------------------------------------------------------------------K-Y-L.
A0D218_PARTE/76-105--------------------------------------------------------------------------Q-L-E.
C5LZ40_PERM5/40-69--------------------------------------------------------------------------K-Y-S.
Q011E6_OSTTA/74-105--------------------------------------------------------------------------R-F-R.
Q384M5_TRYB2/12-41--------------------------------------------------------------------------Y-L-K.
C1E207_MICSR/45-75--------------------------------------------------------------------------R-L-M.
Q6FMX6_CANGA/187-217--------------------------------------------------------------------------I-A-I.
A7AP31_BABBO/33-62--------------------------------------------------------------------------E-V-E.
A2ETB6_TRIVA/14-43--------------------------------------------------------------------------E-L-Q.
Q6C7R0_YARLI/24-53--------------------------------------------------------------------------S-Y-A.
Q6C7R0_YARLI/130-160--------------------------------------------------------------------------R-V-R.
A7EII8_SCLS1/126-155--------------------------------------------------------------------------E-W-K.
B7Q3R8_IXOSC/111-140--------------------------------------------------------------------------E-I-V.
Q8SS75_ENCCU/23-52--------------------------------------------------------------------------E-L-R.
Q8SS75_ENCCU/92-121--------------------------------------------------------------------------S-I-F.
Q7RGT1_PLAYO/1340-1369--------------------------------------------------------------------------Y-I-N.
D0MWK2_PHYIT/425-454--------------------------------------------------------------------------V-I-R.
A0DI75_PARTE/65-94--------------------------------------------------------------------------E-T-E.
Q00XI4_OSTTA/186-215--------------------------------------------------------------------------R-L-K.
Q2R1L7_ORYSJ/123-154--------------------------------------------------------------------------E-V-K.
C5LG68_PERM5/14-43--------------------------------------------------------------------------E-A-K.
A2DMA5_TRIVA/14-43--------------------------------------------------------------------------S-L-Q.
C4QYA1_PICPG/220-250--------------------------------------------------------------------------I-M-M.
C4QYA1_PICPG/287-316--------------------------------------------------------------------------Y-W-E.
A7SIU0_NEMVE/415-444--------------------------------------------------------------------------R-V-V.
A2EU49_TRIVA/304-333--------------------------------------------------------------------------N-I-W.
A8HPL4_CHLRE/259-288--------------------------------------------------------------------------E-I-A.
CPNS2_HUMAN/153-182--------------------------------------------------------------------------K-W-Q.
Q4E300_TRYCC/191-222--------------------------------------------------------------------------P-V-K.
D0MRM4_PHYIT/32-61--------------------------------------------------------------------------Q-M-K.
Q6DG81_DANRE/12-43--------------------------------------------------------------------------E-L-R.
B4I7K3_DROSE/14-43--------------------------------------------------------------------------K-I-S.
C5DUA6_ZYGRC/18-49--------------------------------------------------------------------------R-Y-E.
A0CDJ6_PARTE/157-186--------------------------------------------------------------------------S-V-Q.
A0CRT3_PARTE/42-71--------------------------------------------------------------------------Q-I-M.
A0CRT3_PARTE/115-144--------------------------------------------------------------------------V-I-I.
C5KE42_PERM5/17-46--------------------------------------------------------------------------A-I-E.
A7RPN5_NEMVE/525-553--------------------------------------------------------------------------E-F-K.
A7RPN5_NEMVE/596-627--------------------------------------------------------------------------D-I-L.
C5KKB0_PERM5/33-64--------------------------------------------------------------------------Q-I-R.
A7RMQ1_NEMVE/11-40--------------------------------------------------------------------------E-L-K.
A7RMQ1_NEMVE/82-111--------------------------------------------------------------------------E-F-I.
Q5CZ29_CRYPI/514-545--------------------------------------------------------------------------N-L-R.
Q2A943_DANRE/33-62--------------------------------------------------------------------------Q-W-K.
A7S688_NEMVE/8-37--------------------------------------------------------------------------L-L-K.
A7S688_NEMVE/84-113--------------------------------------------------------------------------S-V-I.
D0NHY4_PHYIT/209-239--------------------------------------------------------------------------R-L-E.
Q4U8S4_THEAN/16-45--------------------------------------------------------------------------L-I-R.
C1FIV9_MICSR/85-114--------------------------------------------------------------------------T-M-L.
EFC13_HUMAN/456-485--------------------------------------------------------------------------T-L-E.
Q4SJD6_TETNG/29-56--------------------------------------------------------------------------V-L-H.
E8RNE1_ASTEC/46-76--------------------------------------------------------------------------E-I-K.
A0DCS1_PARTE/72-101--------------------------------------------------------------------------E-L-R.
Q9EMH8_AMEPV/24-53--------------------------------------------------------------------------N-I-R.
A0CH88_PARTE/390-419--------------------------------------------------------------------------S-L-Y.
A0CH88_PARTE/696-725--------------------------------------------------------------------------N-I-Q.
C4R1V0_PICPG/25-54--------------------------------------------------------------------------K-L-Q.
Q01A96_OSTTA/1800-1831--------------------------------------------------------------------------A-L-R.
Q01A96_OSTTA/2035-2064--------------------------------------------------------------------------R-L-L.
A7SHW4_NEMVE/108-138--------------------------------------------------------------------------K-V-K.
D0MWI5_PHYIT/661-691--------------------------------------------------------------------------H-V-G.
C3YCK9_BRAFL/241-275--------------------------------------------------------------------------M-L-M.
B3MPK2_DROAN/57-86--------------------------------------------------------------------------E-L-H.
A9RFM6_PHYPA/328-362--------------------------------------------------------------------------V-L-K.
Q01AN9_OSTTA/334-364--------------------------------------------------------------------------S-L-A.
Q4Z5E3_PLABA/655-693--------------------------------------------------------------------------A-L-F.
D2VTY7_NAEGR/97-134--------------------------------------------------------------------------L-L-R.
Q6BFU2_PARTE/195-224--------------------------------------------------------------------------L-A-E.
Q5ZLW0_CHICK/14-43--------------------------------------------------------------------------E-L-R.
B5Y4Q9_PHATC/8-42--------------------------------------------------------------------------D-L-R.
B5Y4Q9_PHATC/86-115--------------------------------------------------------------------------E-I-Q.
B7QKE4_IXOSC/612-641--------------------------------------------------------------------------Q-Y-I.
Q0V5Q9_PHANO/214-243--------------------------------------------------------------------------S-M-R.
Q4DIV1_TRYCC/166-195--------------------------------------------------------------------------A-I-Y.
Q7Q4L8_ANOGA/103-139--------------------------------------------------------------------------K-A-E.
A8XE93_CAEBR/628-657--------------------------------------------------------------------------K-A-K.
A7RJ83_NEMVE/514-548--------------------------------------------------------------------------E-F-W.
A7RJ83_NEMVE/585-614--------------------------------------------------------------------------K-W-K.
A4HWJ1_LEIIN/25-54--------------------------------------------------------------------------E-W-S.
A2EBQ1_TRIVA/14-43--------------------------------------------------------------------------T-L-H.
A2EBQ1_TRIVA/84-113--------------------------------------------------------------------------E-L-I.
Q4D662_TRYCC/188-217--------------------------------------------------------------------------Q-I-V.
Q4D662_TRYCC/269-298--------------------------------------------------------------------------E-A-L.
A0EFA3_PARTE/319-348--------------------------------------------------------------------------G-L-A.
A9RGD0_PHYPA/476-506--------------------------------------------------------------------------L-D-D.
Q8SRF8_ENCCU/100-129--------------------------------------------------------------------------R-I-R.
B8BV66_THAPS/328-359--------------------------------------------------------------------------G-L-R.
A7SIU1_NEMVE/364-393--------------------------------------------------------------------------R-A-V.
D0NLH6_PHYIT/779-808--------------------------------------------------------------------------E-I-K.
C1MVN8_MICPC/105-141--------------------------------------------------------------------------K-I-R.
B5DN90_DROPS/53-82--------------------------------------------------------------------------R-L-G.
A0BWN9_PARTE/584-613--------------------------------------------------------------------------N-I-Y.
A0DZH6_PARTE/32-61--------------------------------------------------------------------------E-L-Y.
Q5CTT5_CRYPI/66-93--------------------------------------------------------------------------I-L-R.
A0C693_PARTE/354-383--------------------------------------------------------------------------K-L-S.
A7SZ62_NEMVE/480-509--------------------------------------------------------------------------R-L-V.
C1MZG1_MICPC/117-146--------------------------------------------------------------------------E-I-R.
Q4DZ37_TRYCC/328-358--------------------------------------------------------------------------V-L-E.
B3RKL5_TRIAD/438-467--------------------------------------------------------------------------R-I-I.
A2Q7S2_ASPNC/15-46--------------------------------------------------------------------------E-L-K.
C1E2H7_MICSR/61-97--------------------------------------------------------------------------G-L-A.
A9SRE6_PHYPA/269-299--------------------------------------------------------------------------Y-L-Q.
C1FI51_MICSR/18-54--------------------------------------------------------------------------K-I-K.
B8MY97_ASPFN/34-63--------------------------------------------------------------------------H-R-G.
B3S580_TRIAD/58-91--------------------------------------------------------------------------M-V-M.
C5KSZ3_PERM5/370-399--------------------------------------------------------------------------A-L-K.
D0N582_PHYIT/1409-1438--------------------------------------------------------------------------Q-L-A.
B7G8H4_PHATC/377-408--------------------------------------------------------------------------N-L-I.
A0E9E9_PARTE/44-75--------------------------------------------------------------------------I-V-T.
A7RMQ2_NEMVE/10-39--------------------------------------------------------------------------E-F-R.
A7RMQ2_NEMVE/82-111--------------------------------------------------------------------------D-F-L.
B6AAT1_CRYMR/92-121--------------------------------------------------------------------------E-L-I.
Q1DGU0_AEDAE/85-114--------------------------------------------------------------------------M-L-G.
C4VC48_NOSCE/64-95--------------------------------------------------------------------------F-V-F.
B4M210_DROVI/76-106--------------------------------------------------------------------------K-M-R.
D0N398_PHYIT/276-305--------------------------------------------------------------------------Y-L-S.
Q4PE44_USTMA/739-769--------------------------------------------------------------------------E-L-R.
EFCB9_HUMAN/28-56--------------------------------------------------------------------------A-L-A.
A4HY14_LEIIN/110-138--------------------------------------------------------------------------Y-Y-D.
A0BNY1_PARTE/42-71--------------------------------------------------------------------------M-M-K.
A9RBC3_PHYPA/187-216--------------------------------------------------------------------------Q-I-C.
A8P593_BRUMA/121-151--------------------------------------------------------------------------K-L-K.
CEX1_CAEEL/29-68--------------------------------------------------------------------------K-W-E.
A7SPN7_NEMVE/582-611--------------------------------------------------------------------------Y-Y-K.
A4FU16_HUMAN/38-67--------------------------------------------------------------------------H-W-K.
C3YAW3_BRAFL/215-244--------------------------------------------------------------------------R-L-L.
D2V6N0_NAEGR/12-41--------------------------------------------------------------------------Q-F-K.
D2V6N0_NAEGR/215-245--------------------------------------------------------------------------N-M-D.
Q5CUC1_CRYPI/325-356--------------------------------------------------------------------------K-I-H.
D2VL69_NAEGR/86-115--------------------------------------------------------------------------Q-L-L.
B8BVX2_THAPS/190-219--------------------------------------------------------------------------A-I-I.
A2FS38_TRIVA/86-115--------------------------------------------------------------------------E-I-D.
A9V750_MONBE/19-48--------------------------------------------------------------------------Q-I-A.
C5LX97_PERM5/270-303--------------------------------------------------------------------------R-I-V.
A2FHL4_TRIVA/83-112--------------------------------------------------------------------------Q-Y-K.
A9FD96_SORC5/187-216--------------------------------------------------------------------------F-A-W.
Q6BG59_PARTE/363-394--------------------------------------------------------------------------E-I-Y.
A0DQE8_PARTE/49-78--------------------------------------------------------------------------V-I-K.
A2DGG1_TRIVA/1002-1031--------------------------------------------------------------------------E-F-R.
A8IAC5_CHLRE/27-56--------------------------------------------------------------------------M-I-E.
C3YFC2_BRAFL/86-117--------------------------------------------------------------------------R-I-S.
A9VC94_MONBE/198-229--------------------------------------------------------------------------F-A-A.
C5KSU3_PERM5/80-110--------------------------------------------------------------------------P-I-A.
C5L8H3_PERM5/62-92--------------------------------------------------------------------------T-C-R.
Q01DB0_OSTTA/332-361--------------------------------------------------------------------------Q-L-R.
Q4UF53_THEAN/443-471--------------------------------------------------------------------------E-V-Y.
A8XPA0_CAEBR/61-90--------------------------------------------------------------------------E-V-F.
A2FQM2_TRIVA/14-43--------------------------------------------------------------------------E-V-R.
A7RTI1_NEMVE/216-246--------------------------------------------------------------------------D-M-F.
C5LI98_PERM5/493-523--------------------------------------------------------------------------Q-M-R.
B6AJS6_CRYMR/55-84--------------------------------------------------------------------------R-F-G.
A0D0W9_PARTE/274-302--------------------------------------------------------------------------N-L-N.
A2E466_TRIVA/79-108--------------------------------------------------------------------------E-L-V.
C1N3J2_MICPC/18-47--------------------------------------------------------------------------M-L-H.
D2VIE2_NAEGR/8-38--------------------------------------------------------------------------D-I-E.
Q7QIB4_ANOGA/279-317--------------------------------------------------------------------------K-L-E.
Q8T5H8_ANOGA/12-41--------------------------------------------------------------------------K-A-Q.
D0N994_PHYIT/33-63--------------------------------------------------------------------------L-L-R.
C1MU07_MICPC/540-583--------------------------------------------------------------------------E-M-R.
B0XJB8_CULQU/36-75--------------------------------------------------------------------------Q-F-M.
A8J3A0_CHLRE/99-128--------------------------------------------------------------------------T-L-L.
D0MVE6_PHYIT/210-253--------------------------------------------------------------------------L-M-I.
Q5CPW8_CRYPI/89-118--------------------------------------------------------------------------D-A-V.
Q6NYK0_DANRE/29-57--------------------------------------------------------------------------K-L-H.
D4AID5_ARTBC/715-746--------------------------------------------------------------------------F-L-K.
O97201_LEIMA/270-300--------------------------------------------------------------------------Q-L-V.
B3M0N0_DROAN/117-151--------------------------------------------------------------------------K-L-Q.
A9UXC0_MONBE/17-46--------------------------------------------------------------------------L-L-R.
A2F622_TRIVA/94-129--------------------------------------------------------------------------F-I-Q.
CAN11_RAT/548-584--------------------------------------------------------------------------N-S-V.
B4QEJ5_DROSI/103-132--------------------------------------------------------------------------K-I-L.
A8JI98_CHLRE/149-179--------------------------------------------------------------------------A-A-M.
D3ZRP1_RAT/120-151--------------------------------------------------------------------------G-L-G.
B4MVV8_DROWI/30-59--------------------------------------------------------------------------R-I-R.
C4IYW7_MAIZE/57-84--------------------------------------------------------------------------K-C-K.
A2FJN7_TRIVA/18-47--------------------------------------------------------------------------E-A-K.
B6AIK9_CRYMR/17-46--------------------------------------------------------------------------A-V-R.
A9UQV7_MONBE/115-144--------------------------------------------------------------------------R-A-E.
A9SXN2_PHYPA/278-307--------------------------------------------------------------------------E-V-D.
Q4YSX9_PLABA/63-94--------------------------------------------------------------------------K-A-K.
B9R7E2_RICCO/18-47--------------------------------------------------------------------------E-F-K.
A0E9R2_PARTE/21-50--------------------------------------------------------------------------K-I-L.
Q5KK44_CRYNJ/681-710--------------------------------------------------------------------------H-L-R.
D0N6S6_PHYIT/203-232--------------------------------------------------------------------------N-A-R.
Q4Q156_LEIMA/33-65--------------------------------------------------------------------------R-I-Q.
A7RPN6_NEMVE/2-31--------------------------------------------------------------------------E-F-E.
A4H5I7_LEIBR/177-206--------------------------------------------------------------------------K-L-R.
C1ECT5_MICSR/271-300--------------------------------------------------------------------------T-P-R.
A9V6X3_MONBE/1141-1170--------------------------------------------------------------------------E-M-E.
C3ZP66_BRAFL/54-83--------------------------------------------------------------------------S-S-K.
C0H4A2_PLAF7/13-41--------------------------------------------------------------------------E-I-E.
A9VBY6_MONBE/239-268--------------------------------------------------------------------------W-L-R.
D2UXJ1_NAEGR/416-444--------------------------------------------------------------------------Y-F-N.
B4MM19_DROWI/36-65--------------------------------------------------------------------------T-I-K.
Q4DRI4_TRYCC/49-79--------------------------------------------------------------------------R-R-I.
B3S1G2_TRIAD/152-183--------------------------------------------------------------------------K-I-E.
CIB4_MOUSE/101-132--------------------------------------------------------------------------K-I-E.
C1EBS6_MICSR/387-416--------------------------------------------------------------------------E-L-R.
B4N916_DROWI/114-145--------------------------------------------------------------------------K-M-Q.
Q8IE29_PLAF7/251-282--------------------------------------------------------------------------K-A-L.
CAN8_MOUSE/536-572--------------------------------------------------------------------------H-F-W.
A0BF71_PARTE/385-419--------------------------------------------------------------------------Q-I-Q.
B0WSM1_CULQU/659-688--------------------------------------------------------------------------Q-W-Q.
Q32KM4_BOVIN/68-99--------------------------------------------------------------------------L-M-N.
D2V5I4_NAEGR/35-64--------------------------------------------------------------------------Q-A-Q.
CAN11_MOUSE/547-583--------------------------------------------------------------------------D-S-L.
A7RK77_NEMVE/68-97--------------------------------------------------------------------------T-T-R.
A0C4R5_PARTE/23-53--------------------------------------------------------------------------D-L-K.
Q4QBQ5_LEIMA/330-359--------------------------------------------------------------------------R-F-V.
B4LJI0_DROVI/124-155--------------------------------------------------------------------------R-M-Q.
C3YQL6_BRAFL/328-359--------------------------------------------------------------------------K-F-L.
A0C1C8_PARTE/336-372--------------------------------------------------------------------------Q-I-E.
D0NH53_PHYIT/26-55--------------------------------------------------------------------------D-L-R.
RFIP3_DANRE/710-739--------------------------------------------------------------------------A-L-R.
A0DZK5_PARTE/70-97--------------------------------------------------------------------------Q-I-Y.
EFCB3_BOVIN/51-80--------------------------------------------------------------------------A-F-Q.
C1EDZ9_MICSR/29-59--------------------------------------------------------------------------S-T-Q.
C1N631_MICPC/47-78--------------------------------------------------------------------------F-L-E.
C1MXG3_MICPC/631-660--------------------------------------------------------------------------Q-V-G.
Q6DFZ8_DANRE/606-635--------------------------------------------------------------------------L-F-V.
C5LJH8_PERM5/404-433--------------------------------------------------------------------------E-V-V.
B9RD69_RICCO/210-239--------------------------------------------------------------------------E-L-V.
Q4DDH8_TRYCC/10-40--------------------------------------------------------------------------D-I-L.
A0CSU8_PARTE/30-61--------------------------------------------------------------------------S-L-K.
C5KYQ1_PERM5/23-54--------------------------------------------------------------------------H-L-H.
A2CE70_DANRE/30-58--------------------------------------------------------------------------R-L-Y.
C5L8Y2_PERM5/254-290--------------------------------------------------------------------------A-L-K.
A7SHJ6_NEMVE/330-359--------------------------------------------------------------------------G-I-V.
A0C9U0_PARTE/401-432--------------------------------------------------------------------------N-I-R.
A9RZV6_PHYPA/322-351--------------------------------------------------------------------------Q-M-K.
A0CIN3_PARTE/412-441--------------------------------------------------------------------------M-A-R.
A7RLF8_NEMVE/106-135--------------------------------------------------------------------------M-M-N.
C3ZDD3_BRAFL/389-419--------------------------------------------------------------------------E-H-Y.
A8X343_CAEBR/192-230--------------------------------------------------------------------------K-L-D.
C5L7A7_PERM5/27-55--------------------------------------------------------------------------E-Y-E.
B3RJJ4_TRIAD/113-142--------------------------------------------------------------------------A-A-E.
A7T7P5_NEMVE/35-64--------------------------------------------------------------------------E-L-L.
A8IMX5_CHLRE/147-180--------------------------------------------------------------------------L-M-E.
Q8STQ3_ENCCU/76-105--------------------------------------------------------------------------E-L-Q.
Q6FSU4_CANGA/603-632--------------------------------------------------------------------------F-L-K.
D0NT24_PHYIT/227-256--------------------------------------------------------------------------R-M-R.
Q5ZJB5_CHICK/68-103--------------------------------------------------------------------------E-L-Q.
Q4CS95_TRYCC/33-65--------------------------------------------------------------------------K-L-Q.
Q00WG8_OSTTA/33-61--------------------------------------------------------------------------A-L-Y.
RASEF_XENTR/9-38--------------------------------------------------------------------------R-L-R.
Q6TXM2_STRPU/582-611--------------------------------------------------------------------------S-L-T.
D2VGQ0_NAEGR/231-261--------------------------------------------------------------------------Y-L-K.
D0MVJ8_PHYIT/2641-2670--------------------------------------------------------------------------D-V-G.
A9V7D4_MONBE/231-262--------------------------------------------------------------------------L-A-T.
C5LFC0_PERM5/84-113--------------------------------------------------------------------------R-L-I.
Q01DN6_OSTTA/94-123--------------------------------------------------------------------------A-L-R.
B7G332_PHATC/130-165--------------------------------------------------------------------------L-M-R.
B3S581_TRIAD/59-96--------------------------------------------------------------------------M-N-F.
Q4XYU2_PLACH/524-554--------------------------------------------------------------------------S-L-Y.
B0CNF8_LACBS/51-83--------------------------------------------------------------------------D-I-G.
A0E1J3_PARTE/38-73--------------------------------------------------------------------------V-A-R.
D3BGC9_POLPA/56-86--------------------------------------------------------------------------A-L-R.
C1N8S9_MICPC/55-85--------------------------------------------------------------------------G-I-G.
B3RSL0_TRIAD/112-148--------------------------------------------------------------------------K-A-A.
C1MSB0_MICPC/627-658--------------------------------------------------------------------------A-A-R.
C3YY99_BRAFL/15-44--------------------------------------------------------------------------L-F-K.
B8C8A3_THAPS/287-317--------------------------------------------------------------------------L-L-R.
D7AV60_NOCDD/14-45--------------------------------------------------------------------------E-A-R.
Q94LH2_ORYSJ/29-58--------------------------------------------------------------------------E-F-K.
A8Q891_MALGO/17-46--------------------------------------------------------------------------Q-L-Q.
C5LPQ5_PERM5/9-38--------------------------------------------------------------------------L-I-E.
A8IJ90_CHLRE/3-32--------------------------------------------------------------------------E-F-R.
B7G8B5_PHATC/86-115--------------------------------------------------------------------------N-M-Q.
A4I9Q9_LEIIN/181-211--------------------------------------------------------------------------A-V-G.
C5LIS6_PERM5/226-255--------------------------------------------------------------------------E-L-Q.
C6KTA8_PLAF7/77-106--------------------------------------------------------------------------G-L-L.
A0CSB1_PARTE/153-182--------------------------------------------------------------------------N-V-K.
B9PLU7_TOXGO/4-33--------------------------------------------------------------------------N-L-E.
Q4DPM5_TRYCC/184-213--------------------------------------------------------------------------R-I-R.
B8LD33_THAPS/828-857--------------------------------------------------------------------------I-F-I.
C1MUU0_MICPC/12-42--------------------------------------------------------------------------Q-M-K.
C3YUG8_BRAFL/425-454--------------------------------------------------------------------------M-H-R.
Q4U8G1_THEAN/76-105--------------------------------------------------------------------------N-L-T.
A7SXZ3_NEMVE/9-37--------------------------------------------------------------------------I-F-L.
Q8IJ97_PLAF7/12-41--------------------------------------------------------------------------L-F-E.
A0BF28_PARTE/345-376--------------------------------------------------------------------------A-M-M.
Q4E2K6_TRYCC/617-646--------------------------------------------------------------------------R-F-H.
Q4E1U1_TRYCC/7-40--------------------------------------------------------------------------A-L-M.
A0C5R3_PARTE/309-338--------------------------------------------------------------------------S-I-S.
A0ED28_PARTE/72-103--------------------------------------------------------------------------E-I-R.
D2VR29_NAEGR/607-636--------------------------------------------------------------------------K-F-V.
B8BSH1_THAPS/111-142--------------------------------------------------------------------------L-L-T.
Q5KAJ1_CRYNJ/665-697--------------------------------------------------------------------------L-I-D.
C3YDH3_BRAFL/26-58--------------------------------------------------------------------------E-L-E.
B3S2Z7_TRIAD/64-96--------------------------------------------------------------------------E-K-L.
Q5CKJ4_CRYHO/151-180--------------------------------------------------------------------------Y-M-V.
A2DPY5_TRIVA/83-112--------------------------------------------------------------------------E-L-I.
C5KLK8_PERM5/99-128--------------------------------------------------------------------------R-L-R.
A0D7T4_PARTE/77-106--------------------------------------------------------------------------E-L-T.
A0DSQ2_PARTE/47-76--------------------------------------------------------------------------D-L-N.
C1FHF3_MICSR/35-68--------------------------------------------------------------------------Q-A-K.
A0BCE1_PARTE/120-149--------------------------------------------------------------------------L-L-E.
B7FPG8_PHATC/98-128--------------------------------------------------------------------------R-A-E.
C3XQZ6_BRAFL/437-468--------------------------------------------------------------------------R-L-I.
Q22DM3_TETTS/41-68--------------------------------------------------------------------------R-L-R.
C7YTC4_NECH7/525-554--------------------------------------------------------------------------F-W-R.
D3BH77_POLPA/977-1008--------------------------------------------------------------------------Q-Y-Q.
B7PAY1_IXOSC/102-130--------------------------------------------------------------------------V-I-V.
A8WRH5_CAEBR/109-138--------------------------------------------------------------------------Y-A-E.
C5KU24_PERM5/19-48--------------------------------------------------------------------------D-E-R.
CAN11_HUMAN/571-609--------------------------------------------------------------------------D-F-L.
D0MUI2_PHYIT/445-475--------------------------------------------------------------------------T-I-K.
A0BTT3_PARTE/62-91--------------------------------------------------------------------------E-L-K.
A0DVD9_PARTE/23-52--------------------------------------------------------------------------D-I-N.
C3ZDD2_BRAFL/477-508--------------------------------------------------------------------------H-H-F.
B8BTK8_THAPS/174-205--------------------------------------------------------------------------R-E-Y.
B8CFD8_THAPS/313-348--------------------------------------------------------------------------D-L-R.
A2AB62_MOUSE/109-138--------------------------------------------------------------------------A-F-Q.
C3Y3L2_BRAFL/18-48--------------------------------------------------------------------------M-A-Q.
A0EAZ9_PARTE/45-80--------------------------------------------------------------------------V-A-R.
C5LYE4_PERM5/81-110--------------------------------------------------------------------------S-L-R.
D3BHC5_POLPA/246-276--------------------------------------------------------------------------T-L-R.
CDPKP_ARATH/437-466--------------------------------------------------------------------------E-L-R.
B9R7D2_RICCO/19-48--------------------------------------------------------------------------Q-M-K.
B3RQP5_TRIAD/251-279--------------------------------------------------------------------------R-F-L.
C3YEV6_BRAFL/628-656--------------------------------------------------------------------------R-Y-T.
A1CBB6_ASPCL/49-87--------------------------------------------------------------------------S-F-DP
C3Z5Z5_BRAFL/533-562--------------------------------------------------------------------------D-I-Q.
D0NH29_PHYIT/57-87--------------------------------------------------------------------------R-M-N.
B7XIJ8_ENTBH/72-101--------------------------------------------------------------------------N-I-D.
A0DMG4_PARTE/351-381--------------------------------------------------------------------------Y-L-K.
C3YV00_BRAFL/85-114--------------------------------------------------------------------------L-A-G.
B7FUB0_PHATC/1084-1115--------------------------------------------------------------------------L-L-S.
C3ZH49_BRAFL/1174-1204--------------------------------------------------------------------------K-F-L.
A7RK79_NEMVE/188-218--------------------------------------------------------------------------T-T-E.
B3S1A6_TRIAD/67-96--------------------------------------------------------------------------E-L-..
Q29IA0_DROPS/39-68--------------------------------------------------------------------------N-L-R.
A4S9A6_OSTLU/2128-2162--------------------------------------------------------------------------P-.-M.
A0CCU0_PARTE/82-111--------------------------------------------------------------------------N-F-E.
B7Q350_IXOSC/1399-1442--------------------------------------------------------------------------D-F-DP
C1MT69_MICPC/45-75--------------------------------------------------------------------------S-F-R.
A9URG6_MONBE/582-611--------------------------------------------------------------------------R-A-C.
B7PQS4_IXOSC/34-61--------------------------------------------------------------------------K-A-L.
A0BSR5_PARTE/180-209--------------------------------------------------------------------------L-L-Y.
A0BM15_PARTE/63-92--------------------------------------------------------------------------E-L-K.
Q29GA6_DROPS/127-159--------------------------------------------------------------------------K-M-R.
Q4E142_TRYCC/257-286--------------------------------------------------------------------------A-D-H.
B3L1G0_PLAKH/13-41--------------------------------------------------------------------------E-I-E.
B8C031_THAPS/320-349--------------------------------------------------------------------------L-L-K.
A8XF67_CAEBR/57-86--------------------------------------------------------------------------K-F-..
Q38C77_TRYB2/16-45--------------------------------------------------------------------------D-L-Q.
Q4U910_THEAN/477-506--------------------------------------------------------------------------E-L-K.
B7PG89_IXOSC/60-90--------------------------------------------------------------------------W-W-N.
B8NHB5_ASPFN/61-89--------------------------------------------------------------------------D-F-L.
C3ZYS2_BRAFL/1605-1634--------------------------------------------------------------------------K-S-R.
A9VCA0_MONBE/80-109--------------------------------------------------------------------------D-V-L.
A7SIS2_NEMVE/98-139--------------------------------------------------------------------------G-I-F.
B0DIL9_LACBS/626-655--------------------------------------------------------------------------F-I-D.
C7G032_DICDI/508-537--------------------------------------------------------------------------L-L-D.
D2A071_TRICA/143-179--------------------------------------------------------------------------E-L-E.
A0EAP2_PARTE/324-354--------------------------------------------------------------------------S-M-M.
A8P2X2_COPC7/487-516--------------------------------------------------------------------------F-W-R.
A0DU71_PARTE/549-578--------------------------------------------------------------------------L-A-K.
Q8LKK4_CHLRE/572-601--------------------------------------------------------------------------A-V-R.
Q54E45_DICDI/138-166--------------------------------------------------------------------------Q-L-E.
A0ECX0_PARTE/269-298--------------------------------------------------------------------------D-L-Q.
Q4DLY4_TRYCC/95-128--------------------------------------------------------------------------V-I-R.
B7Q8D4_IXOSC/82-118--------------------------------------------------------------------------T-V-F.
D0N3C9_PHYIT/174-204--------------------------------------------------------------------------E-I-R.
C5KYD8_PERM5/173-202--------------------------------------------------------------------------K-I-R.
A9V4G2_MONBE/147-180--------------------------------------------------------------------------W-I-K.
A9UU76_MONBE/93-122--------------------------------------------------------------------------T-L-Y.
CGRE1_MOUSE/75-112--------------------------------------------------------------------------V-L-L.
D0NLT0_PHYIT/68-97--------------------------------------------------------------------------L-S-G.
A5KCC4_PLAVS/562-593--------------------------------------------------------------------------F-L-K.
Q54EU2_DICDI/187-217--------------------------------------------------------------------------V-L-R.
A8WXW8_CAEBR/591-622--------------------------------------------------------------------------Q-I-A.
Q5Z905_ORYSJ/274-303--------------------------------------------------------------------------E-L-L.
Q4P545_USTMA/20-49--------------------------------------------------------------------------G-L-I.
A2EYC2_TRIVA/29-61--------------------------------------------------------------------------K-L-K.
A0DQ90_PARTE/27-67--------------------------------------------------------------------------R-I-H.
B4NGA9_DROWI/115-153--------------------------------------------------------------------------K-S-E.
D0NB87_PHYIT/1035-1065--------------------------------------------------------------------------R-L-R.
B6K3A4_SCHJY/20-48--------------------------------------------------------------------------T-L-T.
C4Y9V5_CLAL4/13-44--------------------------------------------------------------------------Q-V-R.
Q2H4R6_CHAGB/754-784--------------------------------------------------------------------------F-L-Q.
A7SHV8_NEMVE/147-177--------------------------------------------------------------------------G-I-V.
A4I027_LEIIN/173-200--------------------------------------------------------------------------K-I-M.
B3MG51_DROAN/125-154--------------------------------------------------------------------------K-M-E.
EFCB8_MOUSE/115-143--------------------------------------------------------------------------D-L-Q.
A5K8W6_PLAVS/148-177--------------------------------------------------------------------------E-L-I.
A8P5P9_BRUMA/6-33--------------------------------------------------------------------------E-L-K.
B8LWL3_TALSN/221-250--------------------------------------------------------------------------E-I-L.
C3YK83_BRAFL/11-40--------------------------------------------------------------------------E-M-K.
C4LT56_ENTHI/7-35--------------------------------------------------------------------------.-I-D.
C4LUQ9_ENTHI/16-43--------------------------------------------------------------------------E-L-K.
F1R647_DANRE/83-111--------------------------------------------------------------------------.-M-E.
F7GNT1_CALJA/685-713--------------------------------------------------------------------------E-F-R.
G3HZP5_CRIGR/33-62--------------------------------------------------------------------------E-F-K.
H0ZMF4_TAEGU/54-83--------------------------------------------------------------------------D-F-K.
H2VC11_TAKRU/55-86--------------------------------------------------------------------------E-F-R.
H3CP38_TETNG/179-208--------------------------------------------------------------------------.-M-K.
I1LLG5_SOYBN/78-108--------------------------------------------------------------------------D-L-E.
M9MSK2_DROME/7-36--------------------------------------------------------------------------Y-L-R.
Q236J2_TETTS/59-87--------------------------------------------------------------------------E-I-E.
Q38AA2_TRYB2/25-54--------------------------------------------------------------------------D-I-K.
Q38EV6_TRYB2/74-103--------------------------------------------------------------------------D-L-R.
CML9_ORYSJ/91-119--------------------------------------------------------------------------.-L-A.
Q8LHQ5_ORYSJ/28-57--------------------------------------------------------------------------R-F-K.

PF00036

S10AC_RABIT/53-81--------------------------------------------------------------------------T-V-D-
UCP8_SCHPO/337-365--------------------------------------------------------------------------E-L-A-
RPTN_MOUSE/53-81--------------------------------------------------------------------------T-V-E-
2AB2E_ARATH/385-413--------------------------------------------------------------------------S-L-E-
RBOHE_ARATH/272-300--------------------------------------------------------------------------R-L-Q-
CALM4_ARATH/48-76--------------------------------------------------------------------------E-L-Q-
CALM4_ARATH/85-113--------------------------------------------------------------------------E-L-K-
CALM4_ARATH/121-149--------------------------------------------------------------------------E-V-E-
YLJ5_CAEEL/51-79--------------------------------------------------------------------------K-V-F-
YLJ5_CAEEL/87-115--------------------------------------------------------------------------V-V-Q-
DGK3_CAEEL/174-202--------------------------------------------------------------------------K-L-D-
DGK3_CAEEL/219-247--------------------------------------------------------------------------V-I-R-
Q21408_CAEEL/2329-2357--------------------------------------------------------------------------E-F-Q-
END3_EMENI/46-74--------------------------------------------------------------------------Q-L-E-
EP15R_MOUSE/276-304--------------------------------------------------------------------------R-F-D-
Q94288_CAEEL/100-128--------------------------------------------------------------------------E-F-K-
Q94288_CAEEL/136-164--------------------------------------------------------------------------Q-M-M-
Q94288_CAEEL/172-200--------------------------------------------------------------------------M-I-R-
CAN9_MOUSE/595-623--------------------------------------------------------------------------H-W-M-
CABP1_HUMAN/343-370--------------------------------------------------------------------------D-I-E-
O16343_CAEEL/114-142--------------------------------------------------------------------------K-L-R-
O16343_CAEEL/155-183--------------------------------------------------------------------------I-A-D-
PLSL_HUMAN/13-41--------------------------------------------------------------------------E-L-R-
PLSL_HUMAN/53-81--------------------------------------------------------------------------I-T-E-
DGKG_HUMAN/179-207--------------------------------------------------------------------------K-L-E-
DGKG_HUMAN/224-252--------------------------------------------------------------------------I-L-K-
RYR2_HUMAN/4027-4055--------------------------------------------------------------------------T-S-S-
GPDM_HUMAN/627-655--------------------------------------------------------------------------R-Y-K-
GPDM_HUMAN/663-691--------------------------------------------------------------------------T-L-H-
DGKA_HUMAN/114-142--------------------------------------------------------------------------K-L-E-
DGKA_HUMAN/159-187--------------------------------------------------------------------------I-L-Q-
Q93640_CAEEL/121-149--------------------------------------------------------------------------K-L-K-
Q93640_CAEEL/162-190--------------------------------------------------------------------------I-I-E-
ITSN2_MOUSE/58-86--------------------------------------------------------------------------V-L-A-
ITSN2_MOUSE/282-310--------------------------------------------------------------------------Q-L-A-
CALML_DICDI/10-38--------------------------------------------------------------------------L-Y-K-
CALML_DICDI/46-73--------------------------------------------------------------------------E-L-K-
CALML_DICDI/82-110--------------------------------------------------------------------------D-I-K-
CAM2_SCHPO/10-38--------------------------------------------------------------------------E-M-K-
CAM2_SCHPO/79-107--------------------------------------------------------------------------E-Y-I-
CAN9_HUMAN/565-593--------------------------------------------------------------------------S-C-K-
CAN9_HUMAN/595-623--------------------------------------------------------------------------Q-W-I-
PPE1_HUMAN/570-598--------------------------------------------------------------------------D-L-E-
PPE1_HUMAN/610-638--------------------------------------------------------------------------Q-V-N-
PPE2_HUMAN/572-600--------------------------------------------------------------------------D-L-L-
PPE2_HUMAN/656-684--------------------------------------------------------------------------N-L-E-
O16158_DROME/11-39--------------------------------------------------------------------------L-L-F-
O16158_DROME/62-90--------------------------------------------------------------------------I-W-T-
O16158_DROME/104-132--------------------------------------------------------------------------Y-M-N-
O18058_CAEEL/24-52--------------------------------------------------------------------------E-F-A-
O18058_CAEEL/60-88--------------------------------------------------------------------------E-L-L-
O18058_CAEEL/96-124--------------------------------------------------------------------------L-I-R-
O18058_CAEEL/132-160--------------------------------------------------------------------------E-V-D-
SCMC1_RABIT/23-51--------------------------------------------------------------------------R-Y-E-
SCMC1_RABIT/59-87--------------------------------------------------------------------------A-E-E-
SCMC1_RABIT/90-118--------------------------------------------------------------------------K-M-K-
CML5_ARATH/65-93--------------------------------------------------------------------------E-L-K-
CML5_ARATH/101-129--------------------------------------------------------------------------D-L-T-
CML5_ARATH/143-171--------------------------------------------------------------------------D-M-K-
CML5_ARATH/181-209--------------------------------------------------------------------------G-C-K-
Y1515_ARATH/10-38--------------------------------------------------------------------------K-V-K-
CML19_ARATH/27-55--------------------------------------------------------------------------E-I-R-
CML19_ARATH/63-91--------------------------------------------------------------------------Q-I-N-
CML19_ARATH/100-128--------------------------------------------------------------------------E-L-S-
CML19_ARATH/136-164--------------------------------------------------------------------------D-I-E-
CML8_ARATH/49-77--------------------------------------------------------------------------E-L-H-
PPE2_MOUSE/576-604--------------------------------------------------------------------------D-L-L-
PPE2_MOUSE/700-728--------------------------------------------------------------------------G-I-C-
ONCO_CAVPO/43-71--------------------------------------------------------------------------Q-V-K-
ONCO_CAVPO/82-109--------------------------------------------------------------------------E-T-K-
CALU_RAT/72-100--------------------------------------------------------------------------K-L-G-
CALU_RAT/108-136--------------------------------------------------------------------------N-V-E-
CHP2_HUMAN/115-143--------------------------------------------------------------------------K-L-H-
CHP2_HUMAN/156-184--------------------------------------------------------------------------I-A-D-
CALU_HUMAN/72-100--------------------------------------------------------------------------R-L-G-
CALU_HUMAN/192-220--------------------------------------------------------------------------V-V-Q-
O45313_CAEEL/236-262--------------------------------------------------------------------------R-A-T-
GEM1_SCHPO/188-216--------------------------------------------------------------------------A-L-S-
GEM1_SCHPO/308-336--------------------------------------------------------------------------F-L-V-
FIMB_SCHPO/55-83--------------------------------------------------------------------------E-V-R-
CALM_KLULA/12-40--------------------------------------------------------------------------E-F-K-
CALM_KLULA/48-76--------------------------------------------------------------------------E-V-A-
CALM_KLULA/85-113--------------------------------------------------------------------------E-L-L-
CALM_KLULA/121-147--------------------------------------------------------------------------E-V-D-
O61604_DROME/18-46--------------------------------------------------------------------------E-I-K-
O64866_ARATH/24-52--------------------------------------------------------------------------S-V-D-
O64866_ARATH/73-101--------------------------------------------------------------------------L-Y-D-
CDC31_SCHPO/38-66--------------------------------------------------------------------------D-I-N-
CDC31_SCHPO/74-102--------------------------------------------------------------------------E-V-L-
CDC31_SCHPO/147-175--------------------------------------------------------------------------E-L-E-
CMC1_HUMAN/90-118--------------------------------------------------------------------------M-F-I-
CMC1_HUMAN/161-189--------------------------------------------------------------------------H-A-R-
CIB2_HUMAN/107-135--------------------------------------------------------------------------K-A-N-
CIB2_HUMAN/148-176--------------------------------------------------------------------------V-C-D-
SEGN_HUMAN/16-44--------------------------------------------------------------------------G-F-W-
SEGN_HUMAN/109-137--------------------------------------------------------------------------E-F-M-
SEGN_HUMAN/201-229--------------------------------------------------------------------------D-F-E-
SEGN_HUMAN/245-273--------------------------------------------------------------------------F-R-E-
O76670_CAEEL/18-46--------------------------------------------------------------------------A-Q-N-
O76670_CAEEL/50-78--------------------------------------------------------------------------D-G-Q-
O76670_CAEEL/117-145--------------------------------------------------------------------------I-I-D-
O76670_CAEEL/158-186--------------------------------------------------------------------------Q-A-L-
O76670_CAEEL/195-223--------------------------------------------------------------------------D-V-Q-
RBOHA_ARATH/225-253--------------------------------------------------------------------------R-L-R-
CNBL4_ARATH/75-103--------------------------------------------------------------------------F-A-D-
CNBL4_ARATH/112-140--------------------------------------------------------------------------K-V-K-
CNBL4_ARATH/156-184--------------------------------------------------------------------------M-V-D-
CNBL1_ARATH/71-99--------------------------------------------------------------------------F-A-N-
CNBL1_ARATH/108-136--------------------------------------------------------------------------K-I-D-
YC22_ARATH/388-416--------------------------------------------------------------------------E-T-K-
CML20_ARATH/100-128--------------------------------------------------------------------------E-L-T-
CML20_ARATH/136-164--------------------------------------------------------------------------E-I-R-
CABP1_RAT/157-185--------------------------------------------------------------------------E-L-R-
CABP1_RAT/234-262--------------------------------------------------------------------------E-L-R-
O93409_DANRE/30-58--------------------------------------------------------------------------E-Y-K-
RCN1_TAKRU/74-102--------------------------------------------------------------------------R-L-S-
RCN1_TAKRU/110-138--------------------------------------------------------------------------N-V-V-
RCN1_TAKRU/198-226--------------------------------------------------------------------------V-V-L-
YFFE_SCHPO/13-41--------------------------------------------------------------------------E-A-E-
FKBP9_HUMAN/492-520--------------------------------------------------------------------------V-S-P-
FKBP9_HUMAN/537-563--------------------------------------------------------------------------I-V-K-
GUC1C_HUMAN/56-84--------------------------------------------------------------------------H-I-D-
GUC1C_HUMAN/92-120--------------------------------------------------------------------------K-L-K-
GUC1C_HUMAN/134-162--------------------------------------------------------------------------F-I-N-
O96676_DROME/127-155--------------------------------------------------------------------------K-M-R-
O96676_DROME/249-277--------------------------------------------------------------------------D-A-A-
TNNC2_PIG/94-122--------------------------------------------------------------------------E-L-A-
TNNC2_CHICK/98-126--------------------------------------------------------------------------E-L-A-
CALMS_CHICK/121-149--------------------------------------------------------------------------E-V-D-
CALM_DICDI/87-115--------------------------------------------------------------------------E-I-R-
CALM_DICDI/123-151--------------------------------------------------------------------------E-V-D-
MLE1_CHICK/52-80--------------------------------------------------------------------------D-F-K-
MLE1_CHICK/129-157--------------------------------------------------------------------------D-F-V-
MYL6_CHICK/11-39--------------------------------------------------------------------------E-F-K-
MLRS_CHICK/28-56--------------------------------------------------------------------------E-F-K-
MLRA_CHICK/133-161--------------------------------------------------------------------------E-I-D-
MLRB_CHICK/97-125--------------------------------------------------------------------------T-I-L-
MLRM_CHICK/138-166--------------------------------------------------------------------------E-V-D-
PRVB_LATCH/42-70--------------------------------------------------------------------------E-L-E-
PRVA_LATCH/44-72--------------------------------------------------------------------------T-L-K-
PRVA_LATCH/83-111--------------------------------------------------------------------------E-T-K-
S100G_BOVIN/49-77--------------------------------------------------------------------------T-L-D-
S100B_BOVIN/53-81--------------------------------------------------------------------------V-V-D-
S10A1_BOVIN/54-82--------------------------------------------------------------------------A-V-D-
SPE1A_STRPU/14-42--------------------------------------------------------------------------E-F-K-
SPE1A_STRPU/50-78--------------------------------------------------------------------------Q-I-D-
SPE1A_STRPU/88-116--------------------------------------------------------------------------H-Y-T-
SPE2A_STRPU/14-42--------------------------------------------------------------------------L-F-K-
SPE2A_STRPU/50-78--------------------------------------------------------------------------K-I-D-
SPE2A_STRPU/122-150--------------------------------------------------------------------------E-I-D-
SPE2C_STRPU/50-76--------------------------------------------------------------------------K-I-D-
SPE2C_STRPU/85-113--------------------------------------------------------------------------Q-Y-F-
SPE2C_STRPU/122-150--------------------------------------------------------------------------E-I-D-
CALB1_CHICK/16-44--------------------------------------------------------------------------Q-F-F-
CALB1_CHICK/103-131--------------------------------------------------------------------------D-F-M-
CALB1_BOVIN/15-43--------------------------------------------------------------------------Q-F-F-
CALB1_BOVIN/102-130--------------------------------------------------------------------------E-F-M-
CALB1_BOVIN/146-174--------------------------------------------------------------------------Y-T-D-
CALB1_BOVIN/190-218--------------------------------------------------------------------------E-F-N-
CALL_CAEEL/25-53--------------------------------------------------------------------------E-F-R-
CALL_CAEEL/61-89--------------------------------------------------------------------------E-I-L-
CALL_CAEEL/97-125--------------------------------------------------------------------------M-I-R-
CALL_CAEEL/133-161--------------------------------------------------------------------------E-V-D-
ACTNA_DICDI/733-761--------------------------------------------------------------------------E-F-K-
ACTNA_DICDI/769-797--------------------------------------------------------------------------Q-L-N-
S10A8_HUMAN/50-78--------------------------------------------------------------------------G-A-D-
CALM_SCHPO/13-41--------------------------------------------------------------------------E-F-R-
CALM_SCHPO/86-114--------------------------------------------------------------------------E-V-R-
CALM_SCHPO/122-150--------------------------------------------------------------------------E-V-A-
CDC31_YEAST/24-52--------------------------------------------------------------------------E-I-Y-
CDC31_YEAST/97-125--------------------------------------------------------------------------E-I-K-
CDC31_YEAST/133-161--------------------------------------------------------------------------E-L-R-
SPTA1_MOUSE/2271-2299--------------------------------------------------------------------------E-F-S-
SPTA1_MOUSE/2314-2342--------------------------------------------------------------------------K-F-E-
MLE_DICDI/7-35--------------------------------------------------------------------------Q-I-Q-
MLE_DICDI/79-107--------------------------------------------------------------------------E-M-L-
S10A2_BOVIN/54-82--------------------------------------------------------------------------G-L-K-
CAYP1_CANFA/25-53--------------------------------------------------------------------------G-L-A-
CAYP1_CANFA/61-89--------------------------------------------------------------------------E-A-E-
CAYP1_CANFA/97-125--------------------------------------------------------------------------V-I-A-
PLCD1_BOVIN/144-172--------------------------------------------------------------------------W-I-H-
MLRV_HUMAN/98-126--------------------------------------------------------------------------T-I-L-
ACTN1_HUMAN/750-778--------------------------------------------------------------------------E-F-R-
ACTN1_HUMAN/791-819--------------------------------------------------------------------------E-F-A-
PDCD6_MOUSE/27-55--------------------------------------------------------------------------F-L-W-
PDCD6_MOUSE/94-122--------------------------------------------------------------------------D-W-Q-
CPNS1_BOVIN/138-166--------------------------------------------------------------------------T-C-R-
CPNS1_BOVIN/168-196--------------------------------------------------------------------------K-W-Q-
MRLCA_RAT/33-61--------------------------------------------------------------------------E-F-K-
MRLCA_RAT/102-130--------------------------------------------------------------------------V-I-R-
MLR_DICDI/24-52--------------------------------------------------------------------------E-L-K-
MLR_DICDI/60-88--------------------------------------------------------------------------Q-L-D-
MLR_DICDI/97-125--------------------------------------------------------------------------I-L-M-
SPE2D_STRPU/112-140--------------------------------------------------------------------------K-I-K-
SPTN1_RAT/2327-2355--------------------------------------------------------------------------E-F-S-
SPTN1_RAT/2370-2398--------------------------------------------------------------------------E-F-E-
ACTN_DROME/782-810--------------------------------------------------------------------------E-F-R-
ACTN_DROME/823-851--------------------------------------------------------------------------D-F-Q-
MLR_DROME/79-107--------------------------------------------------------------------------E-F-K-
PLSI_CHICK/15-43--------------------------------------------------------------------------E-L-R-
PLSI_CHICK/55-83--------------------------------------------------------------------------I-I-E-
MLR1_CAEEL/28-56--------------------------------------------------------------------------E-F-K-
PRVT_CHICK/82-109--------------------------------------------------------------------------E-T-K-
CAN3_HUMAN/696-724--------------------------------------------------------------------------S-C-R-
FILA_HUMAN/53-81--------------------------------------------------------------------------M-V-D-
RECO_BOVIN/65-93--------------------------------------------------------------------------Y-A-Q-
RECO_BOVIN/101-129--------------------------------------------------------------------------K-L-E-
TRHY_SHEEP/53-81--------------------------------------------------------------------------T-V-D-
S10AB_CHICK/58-86--------------------------------------------------------------------------V-V-D-
CML24_ARATH/17-45--------------------------------------------------------------------------D-I-K-
CML24_ARATH/53-81--------------------------------------------------------------------------E-T-V-
CML24_ARATH/94-122--------------------------------------------------------------------------D-L-K-
CML24_ARATH/130-158--------------------------------------------------------------------------D-C-K-
CML12_ARATH/12-40--------------------------------------------------------------------------E-Y-R-
CML12_ARATH/48-76--------------------------------------------------------------------------D-L-Q-
CML12_ARATH/191-219--------------------------------------------------------------------------E-F-R-
CML12_ARATH/227-255--------------------------------------------------------------------------E-L-Q-
CANB_YEAST/25-53--------------------------------------------------------------------------R-L-R-
CANB_YEAST/57-85--------------------------------------------------------------------------L-A-G-
CANB_YEAST/94-122--------------------------------------------------------------------------K-L-R-
CANB_YEAST/135-163--------------------------------------------------------------------------I-V-D-
S10AA_CHICK/51-79--------------------------------------------------------------------------A-L-D-
S10A8_MOUSE/50-78--------------------------------------------------------------------------N-I-E-
CALL3_HUMAN/48-76--------------------------------------------------------------------------E-L-R-
CALL3_HUMAN/121-149--------------------------------------------------------------------------E-V-D-
M126_CHICK/63-91--------------------------------------------------------------------------S-I-D-
CANB2_RAT/22-50--------------------------------------------------------------------------R-L-G-
CANB2_RAT/132-160--------------------------------------------------------------------------L-V-D-
CDPK_SOYBN/339-367--------------------------------------------------------------------------G-L-K-
CDPK_SOYBN/375-403--------------------------------------------------------------------------E-I-K-
CDPK_SOYBN/411-439--------------------------------------------------------------------------N-L-V-
CDPK_SOYBN/445-473--------------------------------------------------------------------------H-I-D-
GRAN_HUMAN/93-121--------------------------------------------------------------------------T-C-R-
GRAN_HUMAN/123-151--------------------------------------------------------------------------A-W-K-
S10A9_BOVIN/58-86--------------------------------------------------------------------------A-I-N-
CML10_ARATH/12-40--------------------------------------------------------------------------E-F-R-
CML10_ARATH/48-76--------------------------------------------------------------------------E-L-Q-
CML10_ARATH/82-110--------------------------------------------------------------------------D-L-K-
CML10_ARATH/118-146--------------------------------------------------------------------------E-I-D-
CML35_ARATH/70-98--------------------------------------------------------------------------E-L-V-
CML35_ARATH/145-173--------------------------------------------------------------------------E-L-R-
CML35_ARATH/182-210--------------------------------------------------------------------------E-C-M-
YNE5_CAEEL/81-109--------------------------------------------------------------------------E-M-R-
YNE5_CAEEL/117-145--------------------------------------------------------------------------D-F-D-
S10A7_HUMAN/54-82--------------------------------------------------------------------------Y-L-A-
S10A9_MOUSE/59-87--------------------------------------------------------------------------L-I-N-
PLC1_YEAST/273-301--------------------------------------------------------------------------Q-L-L-
PAN1_YEAST/603-631--------------------------------------------------------------------------L-F-Y-
PAN1_YEAST/637-665--------------------------------------------------------------------------D-L-E-
S10A5_HUMAN/51-79--------------------------------------------------------------------------S-I-D-
EDE1_YEAST/51-79--------------------------------------------------------------------------L-L-S-
EDE1_YEAST/171-199--------------------------------------------------------------------------T-L-G-
CBPP_DICDI/403-431--------------------------------------------------------------------------A-A-S-
CBPP_DICDI/439-467--------------------------------------------------------------------------Q-T-K-
S10A4_BOVIN/54-82--------------------------------------------------------------------------A-F-Q-
ACTN2_HUMAN/757-785--------------------------------------------------------------------------E-F-R-
ACTN2_HUMAN/793-821--------------------------------------------------------------------------E-F-A-
NCS1_CAEEL/64-92--------------------------------------------------------------------------F-A-S-
NCS1_CAEEL/100-128--------------------------------------------------------------------------K-L-H-
NCS1_CAEEL/148-176--------------------------------------------------------------------------R-V-D-
NCS2_CAEEL/66-94--------------------------------------------------------------------------F-C-E-
NCS2_CAEEL/102-130--------------------------------------------------------------------------K-L-E-
NCS2_CAEEL/149-177--------------------------------------------------------------------------R-A-K-
FREQ_DROME/100-128--------------------------------------------------------------------------K-L-Q-
FREQ_DROME/147-175--------------------------------------------------------------------------R-V-D-
TRHY_RABIT/53-81--------------------------------------------------------------------------T-V-D-
GEM1_YEAST/205-233--------------------------------------------------------------------------A-L-K-
GEM1_YEAST/334-362--------------------------------------------------------------------------F-L-V-
RDGC_DROME/445-473--------------------------------------------------------------------------E-L-E-
RDGC_DROME/530-558--------------------------------------------------------------------------S-L-V-
RDGC_DROME/570-598--------------------------------------------------------------------------E-M-L-
PLC1_SCHPO/334-362--------------------------------------------------------------------------F-L-E-
CAB32_DROME/39-67--------------------------------------------------------------------------Q-F-M-
CAB32_DROME/89-117--------------------------------------------------------------------------L-K-S-
CAB32_DROME/135-163--------------------------------------------------------------------------E-F-M-
CAB32_DROME/228-256--------------------------------------------------------------------------D-I-E-
MYL5_FELCA/34-62--------------------------------------------------------------------------E-F-K-
MYL5_FELCA/104-132--------------------------------------------------------------------------T-I-L-
CBPA_DICDI/8-36--------------------------------------------------------------------------D-V-E-
CBPA_DICDI/44-72--------------------------------------------------------------------------A-A-S-
CBPA_DICDI/84-112--------------------------------------------------------------------------I-C-N-
CBPA_DICDI/122-150--------------------------------------------------------------------------I-V-E-
EPS15_HUMAN/52-80--------------------------------------------------------------------------I-L-G-
EPS15_HUMAN/164-192--------------------------------------------------------------------------I-L-G-
EPS15_HUMAN/227-255--------------------------------------------------------------------------K-Y-D-
PRVU_CHICK/43-71--------------------------------------------------------------------------Q-L-K-
GUC1A_BOVIN/55-83--------------------------------------------------------------------------Y-V-E-
GUC1A_BOVIN/91-119--------------------------------------------------------------------------K-L-R-
GUC1A_BOVIN/135-163--------------------------------------------------------------------------F-T-D-
TNNC1_DROME/12-40--------------------------------------------------------------------------L-L-R-
TNNC1_DROME/48-76--------------------------------------------------------------------------T-L-A-
TNNC2_DROME/51-79--------------------------------------------------------------------------I-L-D-
TNNC2_DROME/91-119--------------------------------------------------------------------------E-L-R-
CANB1_DROME/22-50--------------------------------------------------------------------------R-L-G-
CANB1_DROME/54-82--------------------------------------------------------------------------L-V-Q-
CANB1_DROME/91-119--------------------------------------------------------------------------K-L-R-
CANB1_DROME/132-160--------------------------------------------------------------------------I-V-D-
E631_DROME/39-67--------------------------------------------------------------------------D-L-R-
E631_DROME/131-159--------------------------------------------------------------------------D-L-I-
E631_DROME/167-193--------------------------------------------------------------------------Q-L-E-
CDPK2_MAIZE/370-398--------------------------------------------------------------------------G-L-K-
CDPK2_MAIZE/406-434--------------------------------------------------------------------------E-V-K-
CDPK2_MAIZE/442-470--------------------------------------------------------------------------H-L-F-
CDPK2_MAIZE/477-505--------------------------------------------------------------------------T-I-R-
CALL_DROME/11-39--------------------------------------------------------------------------E-F-K-
CALL_DROME/47-75--------------------------------------------------------------------------E-L-Q-
CALL_DROME/84-112--------------------------------------------------------------------------E-M-R-
CALL_DROME/120-148--------------------------------------------------------------------------E-I-D-
DGKB_RAT/152-180--------------------------------------------------------------------------K-L-E-
DGKB_RAT/197-225--------------------------------------------------------------------------I-L-H-
CCH1_YEAST/1791-1819--------------------------------------------------------------------------K-Y-I-
S10A8_RAT/50-78--------------------------------------------------------------------------N-T-E-
GUC1B_BOVIN/60-88--------------------------------------------------------------------------Y-V-E-
GUC1B_BOVIN/96-124--------------------------------------------------------------------------K-L-K-
GUC1B_BOVIN/149-177--------------------------------------------------------------------------V-V-D-
PRVA_CAVPO/38-66--------------------------------------------------------------------------E-V-K-
ONCO_MOUSE/43-71--------------------------------------------------------------------------Q-L-K-
MLC1_YEAST/85-113--------------------------------------------------------------------------D-F-V-
GYP2_YEAST/642-670--------------------------------------------------------------------------A-I-N-
CDPK1_ORYSJ/413-440--------------------------------------------------------------------------E-I-N-
CDPK1_ORYSJ/448-476--------------------------------------------------------------------------H-L-M-
CDPK1_ORYSJ/482-510--------------------------------------------------------------------------F-L-E-
CDPKB_ORYSJ/384-412--------------------------------------------------------------------------G-L-R-
CDPKB_ORYSJ/490-518--------------------------------------------------------------------------L-L-E-
MLC2_DROME/11-39--------------------------------------------------------------------------E-F-Q-
MLC2_DROME/84-112--------------------------------------------------------------------------D-F-I-
CBP2_DICDI/17-45--------------------------------------------------------------------------D-L-E-
CBP2_DICDI/92-120--------------------------------------------------------------------------D-V-E-
CBP2_DICDI/128-156--------------------------------------------------------------------------I-T-D-
CAF1_DICDI/10-38--------------------------------------------------------------------------E-V-Q-
CAF1_DICDI/133-161--------------------------------------------------------------------------S-A-N-
FIMB_DICDI/11-39--------------------------------------------------------------------------E-F-K-
FIMB_DICDI/47-75--------------------------------------------------------------------------E-V-R-
CALM_EMENI/121-149--------------------------------------------------------------------------E-V-D-
NCS1_RAT/148-176--------------------------------------------------------------------------R-V-D-
VISL1_RAT/150-178--------------------------------------------------------------------------R-V-D-
CANB1_RAT/132-160--------------------------------------------------------------------------I-V-D-
TAL_SYNY3/356-384--------------------------------------------------------------------------G-T-D-
S10AC_BOVIN/53-81--------------------------------------------------------------------------T-I-D-
PRVA_FELCA/43-71--------------------------------------------------------------------------D-I-K-
PRVA_FELCA/82-110--------------------------------------------------------------------------E-T-K-
S10AC_PIG/53-81--------------------------------------------------------------------------T-I-D-
S10AC_HUMAN/53-81--------------------------------------------------------------------------V-I-D-
NUCB2_MOUSE/245-273--------------------------------------------------------------------------D-P-K-
NUCB2_MOUSE/297-325--------------------------------------------------------------------------M-R-E-
HPCA_RAT/64-92--------------------------------------------------------------------------F-A-E-
HPCA_RAT/100-128--------------------------------------------------------------------------K-L-M-
HPCA_RAT/148-176--------------------------------------------------------------------------R-T-E-
CANB_NEUCR/25-53--------------------------------------------------------------------------R-L-R-
CANB_NEUCR/57-85--------------------------------------------------------------------------L-A-T-
CANB_NEUCR/135-163--------------------------------------------------------------------------I-V-D-
GPDM_CAEEL/628-656--------------------------------------------------------------------------R-A-K-
GPDM_CAEEL/664-692--------------------------------------------------------------------------V-L-H-
P90802_CAEEL/57-85--------------------------------------------------------------------------E-Y-R-
P90802_CAEEL/93-121--------------------------------------------------------------------------E-L-D-
P90802_CAEEL/167-195--------------------------------------------------------------------------I-I-D-
P91423_CAEEL/51-79--------------------------------------------------------------------------F-L-I-
A60DA_DROME/691-719--------------------------------------------------------------------------V-V-G-
A60DA_DROME/774-802--------------------------------------------------------------------------H-I-E-
CDPKE_ARATH/359-387--------------------------------------------------------------------------C-I-K-
CDPKE_ARATH/395-423--------------------------------------------------------------------------D-I-Q-
CDPKE_ARATH/431-459--------------------------------------------------------------------------H-L-K-
CDPKE_ARATH/467-495--------------------------------------------------------------------------V-V-E-
S100G_MOUSE/49-77--------------------------------------------------------------------------T-L-D-
MLRA_HUMAN/36-64--------------------------------------------------------------------------E-F-K-
MLRA_HUMAN/106-134--------------------------------------------------------------------------A-I-L-
NCS1_YEAST/64-92--------------------------------------------------------------------------F-A-N-
NCS1_YEAST/100-128--------------------------------------------------------------------------K-L-S-
NCS1_YEAST/148-176--------------------------------------------------------------------------R-V-K-
MLC2_YEAST/19-47--------------------------------------------------------------------------K-L-K-
CDPK1_ARATH/455-483--------------------------------------------------------------------------G-L-K-
CDPK1_ARATH/491-519--------------------------------------------------------------------------E-I-L-
CDPK1_ARATH/527-555--------------------------------------------------------------------------H-L-F-
CDPK1_ARATH/561-589--------------------------------------------------------------------------R-I-E-
TRHY_HUMAN/53-81--------------------------------------------------------------------------T-V-D-
ACTN3_HUMAN/764-792--------------------------------------------------------------------------E-F-R-
CAST_SOLTU/40-68--------------------------------------------------------------------------R-L-R-
CAST_SOLTU/129-157--------------------------------------------------------------------------D-L-K-
CAST_SOLTU/167-195--------------------------------------------------------------------------R-V-E-
MLR4_SCHPO/78-106--------------------------------------------------------------------------E-F-V-
MLRH_CAEEL/102-130--------------------------------------------------------------------------V-I-R-
NCS1_SCHPO/64-92--------------------------------------------------------------------------F-A-E-
NCS1_SCHPO/100-128--------------------------------------------------------------------------K-L-I-
NCS1_SCHPO/148-176--------------------------------------------------------------------------R-V-N-
Q09980_CAEEL/8-36--------------------------------------------------------------------------E-I-R-
Q09980_CAEEL/44-72--------------------------------------------------------------------------K-I-E-
Q09980_CAEEL/81-109--------------------------------------------------------------------------E-L-R-
Q09980_CAEEL/117-145--------------------------------------------------------------------------E-A-K-
CANA_DROME/703-731--------------------------------------------------------------------------V-C-R-
CANA_DROME/733-761--------------------------------------------------------------------------K-W-K-
YT67_CAEEL/52-80--------------------------------------------------------------------------E-Y-R-
YT67_CAEEL/88-116--------------------------------------------------------------------------E-I-D-
YT67_CAEEL/127-155--------------------------------------------------------------------------L-I-R-
YT67_CAEEL/162-190--------------------------------------------------------------------------L-A-E-
PKD2_HUMAN/754-782--------------------------------------------------------------------------E-I-E-
CAYP1_HUMAN/25-53--------------------------------------------------------------------------G-L-A-
PLSI_HUMAN/55-83--------------------------------------------------------------------------I-V-E-
RCN1_HUMAN/83-111--------------------------------------------------------------------------R-L-G-
Q18136_CAEEL/22-50--------------------------------------------------------------------------D-L-K-
Q18136_CAEEL/58-86--------------------------------------------------------------------------E-L-D-
Q18136_CAEEL/91-119--------------------------------------------------------------------------S-L-K-
Q18874_CAEEL/420-448--------------------------------------------------------------------------V-V-S-
Q18887_CAEEL/66-94--------------------------------------------------------------------------S-I-K-
Q18887_CAEEL/193-221--------------------------------------------------------------------------I-V-N-
Q18887_CAEEL/276-304--------------------------------------------------------------------------E-V-N-
CMC3_CAEEL/74-102--------------------------------------------------------------------------K-I-R-
CMC3_CAEEL/140-168--------------------------------------------------------------------------R-L-A-
Q19770_CAEEL/423-451--------------------------------------------------------------------------M-V-D-
Q19770_CAEEL/452-480--------------------------------------------------------------------------P-F-I-
CDPKI_ARATH/457-485--------------------------------------------------------------------------R-S-R-
CDPKI_ARATH/487-515--------------------------------------------------------------------------S-I-E-
CDPKJ_ARATH/440-468--------------------------------------------------------------------------E-V-K-
CDPKJ_ARATH/476-504--------------------------------------------------------------------------N-L-F-
CDPKJ_ARATH/511-539--------------------------------------------------------------------------M-I-K-
Q20358_CAEEL/23-51--------------------------------------------------------------------------Q-L-S-
Q20358_CAEEL/59-87--------------------------------------------------------------------------E-L-D-
Q20358_CAEEL/96-124--------------------------------------------------------------------------E-L-E-
CMC2_CAEEL/77-105--------------------------------------------------------------------------Q-I-R-
CMC2_CAEEL/144-172--------------------------------------------------------------------------K-L-A-
Q21201_CAEEL/82-110--------------------------------------------------------------------------D-F-I-
RASEF_CAEEL/37-65--------------------------------------------------------------------------D-L-R-
Q26572_SCHMA/11-39--------------------------------------------------------------------------D-V-H-
Q26572_SCHMA/84-112--------------------------------------------------------------------------T-F-I-
CATR1_PARTE/41-69--------------------------------------------------------------------------E-I-K-
CATR1_PARTE/77-105--------------------------------------------------------------------------T-I-Y-
CATR1_PARTE/114-142--------------------------------------------------------------------------D-I-Q-
CATR1_PARTE/150-178--------------------------------------------------------------------------E-L-Q-
S10A7_BOVIN/54-82--------------------------------------------------------------------------Y-L-S-
CDPK9_ARATH/468-496--------------------------------------------------------------------------N-L-Y-
CDPK9_ARATH/503-531--------------------------------------------------------------------------T-I-K-
CDPK4_ARATH/436-464--------------------------------------------------------------------------P-L-D-
CDPK5_ARATH/508-536--------------------------------------------------------------------------F-L-E-
CDPK6_ARATH/462-490--------------------------------------------------------------------------H-L-V-
CDPK7_ARATH/364-392--------------------------------------------------------------------------G-I-K-
CDPK7_ARATH/400-428--------------------------------------------------------------------------D-L-Q-
CDPK7_ARATH/436-464--------------------------------------------------------------------------H-L-H-
CDPK7_ARATH/473-501--------------------------------------------------------------------------V-I-A-
Q39890_SOYBN/121-149--------------------------------------------------------------------------E-V-E-
CDPKC_ARATH/363-391--------------------------------------------------------------------------E-I-Q-
CDPKC_ARATH/399-427--------------------------------------------------------------------------N-L-V-
CDPK8_ARATH/362-390--------------------------------------------------------------------------G-I-K-
CDPK3_ARATH/383-411--------------------------------------------------------------------------G-L-K-
CDPK3_ARATH/419-447--------------------------------------------------------------------------E-I-R-
CDPK3_ARATH/455-483--------------------------------------------------------------------------H-L-Y-
CDPK3_ARATH/490-518--------------------------------------------------------------------------S-I-K-
CML21_ARATH/58-86--------------------------------------------------------------------------N-C-K-
CML21_ARATH/149-177--------------------------------------------------------------------------T-L-V-
CBPC_DICDI/10-38--------------------------------------------------------------------------E-V-Q-
CBPC_DICDI/93-121--------------------------------------------------------------------------D-V-E-
CBPC_DICDI/128-156--------------------------------------------------------------------------D-R-D-
CBPB_DICDI/42-70--------------------------------------------------------------------------K-Y-K-
CBPB_DICDI/78-106--------------------------------------------------------------------------E-L-K-
CAB45_MOUSE/101-129--------------------------------------------------------------------------K-L-M-
CAB45_MOUSE/236-264--------------------------------------------------------------------------M-V-K-
CAB45_MOUSE/317-345--------------------------------------------------------------------------E-A-K-
RCN2_RAT/104-132--------------------------------------------------------------------------E-A-K-
PLCD4_RAT/174-202--------------------------------------------------------------------------Y-A-F-
TBCD9_HUMAN/890-918--------------------------------------------------------------------------L-A-S-
CAN8_RAT/579-607--------------------------------------------------------------------------T-C-R-
CAN8_RAT/609-637--------------------------------------------------------------------------T-Y-L-
CNBLA_ARATH/117-145--------------------------------------------------------------------------F-L-D-
CNBLA_ARATH/154-182--------------------------------------------------------------------------K-T-D-
CNBLA_ARATH/198-226--------------------------------------------------------------------------I-I-D-
CNBL5_ARATH/70-98--------------------------------------------------------------------------S-A-E-
CNBL5_ARATH/107-135--------------------------------------------------------------------------K-A-I-
CNBL5_ARATH/151-179--------------------------------------------------------------------------I-V-S-
GRP2_HUMAN/430-458--------------------------------------------------------------------------M-V-E-
RCN2_MOUSE/68-96--------------------------------------------------------------------------R-L-Q-
RCN2_MOUSE/193-221--------------------------------------------------------------------------V-I-Q-
RCN2_MOUSE/234-262--------------------------------------------------------------------------E-K-D-
GRP3_HUMAN/424-452--------------------------------------------------------------------------L-V-E-
GRP3_HUMAN/453-481--------------------------------------------------------------------------P-F-L-
CNBL2_ARATH/86-114--------------------------------------------------------------------------F-A-D-
CNBL2_ARATH/123-151--------------------------------------------------------------------------K-I-H-
CDPKD_ARATH/359-387--------------------------------------------------------------------------D-I-K-
CDPKD_ARATH/395-423--------------------------------------------------------------------------E-V-Q-
CDPKD_ARATH/467-495--------------------------------------------------------------------------V-A-N-
CAN3_CHICK/685-713--------------------------------------------------------------------------S-S-R-
CAN3_CHICK/715-743--------------------------------------------------------------------------S-W-Q-
CAN2_CHICK/576-604--------------------------------------------------------------------------T-C-K-
CAN2_CHICK/606-634--------------------------------------------------------------------------K-Y-Q-
Q94180_CAEEL/132-160--------------------------------------------------------------------------A-L-I-
MIRO_CAEEL/192-220--------------------------------------------------------------------------A-L-I-
MIRO_CAEEL/312-340--------------------------------------------------------------------------F-V-S-
CML13_ARATH/13-41--------------------------------------------------------------------------S-M-K-
TPC1_ARATH/326-354--------------------------------------------------------------------------M-L-E-
TPC1_ARATH/367-395--------------------------------------------------------------------------E-F-G-
S10A6_CHICK/52-80--------------------------------------------------------------------------E-I-A-
CHP1_HUMAN/114-142--------------------------------------------------------------------------K-L-H-
CHP1_HUMAN/155-183--------------------------------------------------------------------------I-A-D-
CIB1_HUMAN/107-135--------------------------------------------------------------------------K-S-H-
CIB1_HUMAN/152-180--------------------------------------------------------------------------L-I-D-
MICU1_HUMAN/412-440--------------------------------------------------------------------------V-C-D-
CNBL6_ARATH/161-189--------------------------------------------------------------------------I-I-D-
CML43_ARATH/111-139--------------------------------------------------------------------------D-L-E-
RBOHD_ARATH/257-285--------------------------------------------------------------------------K-L-Q-
CDPKN_ARATH/373-401--------------------------------------------------------------------------G-L-K-
CDPKN_ARATH/445-473--------------------------------------------------------------------------H-V-H-
CDPKN_ARATH/480-508--------------------------------------------------------------------------S-I-K-
CDPKA_ARATH/368-396--------------------------------------------------------------------------V-I-K-
CDPKA_ARATH/404-432--------------------------------------------------------------------------E-I-K-
CDPKA_ARATH/440-468--------------------------------------------------------------------------L-F-K-
CDPKA_ARATH/476-504--------------------------------------------------------------------------V-L-S-
CDPK3_PLAF7/422-450--------------------------------------------------------------------------K-L-K-
CDPK3_PLAF7/457-485--------------------------------------------------------------------------N-F-D-
GRP1_RAT/474-502--------------------------------------------------------------------------M-V-D-
RBOHB_ARATH/175-203--------------------------------------------------------------------------R-L-Q-
CANB_DROME/800-828--------------------------------------------------------------------------A-V-R-
KIC_ARATH/78-106--------------------------------------------------------------------------D-A-Q-
CML1_ARATH/50-78--------------------------------------------------------------------------E-M-R-
CML1_ARATH/86-114--------------------------------------------------------------------------D-V-P-
CML1_ARATH/121-149--------------------------------------------------------------------------D-I-R-
CML1_ARATH/157-185--------------------------------------------------------------------------D-C-N-
CML48_ARATH/56-84--------------------------------------------------------------------------E-I-V-
CML48_ARATH/125-153--------------------------------------------------------------------------Q-W-R-
CML6_ARATH/5-33--------------------------------------------------------------------------E-L-N-
CML6_ARATH/41-69--------------------------------------------------------------------------E-L-T-
CML6_ARATH/81-109--------------------------------------------------------------------------D-M-K-
CML6_ARATH/119-147--------------------------------------------------------------------------E-C-R-
CDPKM_ARATH/350-378--------------------------------------------------------------------------G-L-K-
CDPKM_ARATH/422-450--------------------------------------------------------------------------H-L-Y-
CDPKM_ARATH/457-485--------------------------------------------------------------------------N-A-K-
CDPKK_ARATH/439-467--------------------------------------------------------------------------G-L-K-
CDPKK_ARATH/511-539--------------------------------------------------------------------------H-L-F-
CDPKK_ARATH/545-573--------------------------------------------------------------------------H-L-D-
A0DAT1_PARTE/456-482--------------------------------------------------------------------------.-W-T-
A2DKH3_TRIVA/802-830--------------------------------------------------------------------------E-F-K-
A2DXW5_TRIVA/52-79--------------------------------------------------------------------------E-L-Q-
A5KBU9_PLAVS/422-448--------------------------------------------------------------------------E-V-D-
A7X9M1_PHYPA/417-443--------------------------------------------------------------------------.-L-K-
A8HNF8_CHLRE/23-50--------------------------------------------------------------------------.-C-R-
A8JC40_CHLRE/65-92--------------------------------------------------------------------------E-I-K-
B2RYZ0_XENTR/43-70--------------------------------------------------------------------------D-V-K-
B4HBA9_DROPE/62-88--------------------------------------------------------------------------.-W-D-
B4J6G6_DROGR/50-76--------------------------------------------------------------------------.-V-K-
C3YK83_BRAFL/11-38--------------------------------------------------------------------------E-M-K-
C3YYW0_BRAFL/109-136--------------------------------------------------------------------------E-I-L-
C3ZY23_BRAFL/55-82--------------------------------------------------------------------------E-L-Q-
C5MCF3_CANTT/85-112--------------------------------------------------------------------------D-V-D-
C5WY52_SORBI/565-591--------------------------------------------------------------------------.-L-E-
C5Y427_SORBI/388-414--------------------------------------------------------------------------.-L-K-
D2UYG7_NAEGR/127-154--------------------------------------------------------------------------E-V-D-
D2V5Z7_NAEGR/140-166--------------------------------------------------------------------------.-V-D-
D2VXQ7_NAEGR/141-168--------------------------------------------------------------------------E-L-R-
E1F4Z7_GIAIA/144-171--------------------------------------------------------------------------E-L-L-
E1F7L1_GIAIA/130-157--------------------------------------------------------------------------E-I-Q-
E1G510_LOALO/10-37--------------------------------------------------------------------------E-C-R-
F6RDI4_XENTR/92-118--------------------------------------------------------------------------.-L-K-
F6WJV7_XENTR/97-124--------------------------------------------------------------------------E-L-S-
F6X6F2_XENTR/50-78--------------------------------------------------------------------------D-F-K-
F7H9X0_CALJA/57-83--------------------------------------------------------------------------.-I-Q-
G4LZ30_SCHMA/475-502--------------------------------------------------------------------------E-I-D-
G4VAG2_SCHMA/1454-1481--------------------------------------------------------------------------.-I-N-
G4VR58_SCHMA/7-33--------------------------------------------------------------------------.-W-T-
I1KY83_SOYBN/402-429--------------------------------------------------------------------------.-L-K-
I1MDY1_SOYBN/29-57--------------------------------------------------------------------------E-I-K-
K3Y7C9_SETIT/399-425--------------------------------------------------------------------------.-L-K-
M0SNQ3_MUSAM/466-492--------------------------------------------------------------------------.-I-N-
M4CA48_BRARP/11-37--------------------------------------------------------------------------.-.-D-
M4E4B8_BRARP/7-33--------------------------------------------------------------------------.-.-E-
Q4CS04_TRYCC/28-55--------------------------------------------------------------------------E-L-T-
Q4CSZ0_TRYCC/139-167--------------------------------------------------------------------------E-L-R-
Q4DUP6_TRYCC/100-126--------------------------------------------------------------------------.-F-M-
Q4TTW6_SCHMA/12-39--------------------------------------------------------------------------E-F-I-
GNPTA_MOUSE/989-1015--------------------------------------------------------------------------.-I-S-
Q6YYX3_ORYSJ/9-36--------------------------------------------------------------------------.-M-E-
Q7R9F4_PLAYO/85-113--------------------------------------------------------------------------E-L-I-
CDPK2_PLAF7/375-401--------------------------------------------------------------------------.-L-R-
CML1_ORYSJ/48-75--------------------------------------------------------------------------E-L-Q-
CDPKD_ARATH/432-458--------------------------------------------------------------------------.-L-R-
W5KKR2_ASTMX/43-70--------------------------------------------------------------------------D-I-K-
W5MGE4_LEPOC/20-48--------------------------------------------------------------------------E-F-K-

PF13202

Q3HNM6_TOXGO/470-493--------------------------------------------------------------------------L-A.A-
C4P7X0_CHLVA/167-192--------------------------------------------------------------------------I-V.D-
MICU1_XENTR/220-244--------------------------------------------------------------------------F-E.I-
O26668_METTH/8-31--------------------------------------------------------------------------I-E.D-
D3E367_METRM/266-289--------------------------------------------------------------------------I-N.D-
C3ZQ19_BRAFL/1361-1385--------------------------------------------------------------------------F-D.K-
C6T2C2_SOYBN/33-57--------------------------------------------------------------------------L-K.R-
A9T068_PHYPA/10-35--------------------------------------------------------------------------I-V.Q-
A9SKK3_PHYPA/38-62--------------------------------------------------------------------------L-V.D-
B5YG07_THEYD/135-158--------------------------------------------------------------------------T-D.S-
A9SIM5_PHYPA/377-401--------------------------------------------------------------------------L-R.D-
A9T5H9_PHYPA/22-46--------------------------------------------------------------------------L-S.D-
A9T5H9_PHYPA/107-131--------------------------------------------------------------------------L-A.T-
C4P7Y4_SORBI/152-177--------------------------------------------------------------------------I-V.D-
B9RDE4_RICCO/35-59--------------------------------------------------------------------------F-K.Q-
A0BVC5_PARTE/382-405--------------------------------------------------------------------------M-V.A-
C1N2Y6_MICPC/9-33--------------------------------------------------------------------------L-R.D-
B6TKT3_MAIZE/153-178--------------------------------------------------------------------------I-V.D-
A0DDA5_PARTE/353-376--------------------------------------------------------------------------M-D.E-
Q4UIH6_THEAN/479-503--------------------------------------------------------------------------F-N.Q-
B7QHF1_IXOSC/149-174--------------------------------------------------------------------------L-A.D-
C5L6B3_PERM5/255-280--------------------------------------------------------------------------L-GRD-
CML38_ARATH/44-69--------------------------------------------------------------------------L-E.A-
A0DVR4_PARTE/154-178--------------------------------------------------------------------------V-Q.V-
D2VRB9_NAEGR/331-355--------------------------------------------------------------------------L-K.A-
B6KJ69_TOXGO/232-256--------------------------------------------------------------------------L-E.K-
D2VB88_NAEGR/225-250--------------------------------------------------------------------------L-QIA-
D2VA25_NAEGR/11-35--------------------------------------------------------------------------L-R.P-
C5XIH5_SORBI/22-46--------------------------------------------------------------------------L-G.S-
B4HTW1_DROSE/40-64--------------------------------------------------------------------------L-R.T-
A4ZKI6_POPTR/152-177--------------------------------------------------------------------------I-V.D-
A0C5A2_PARTE/441-468--------------------------------------------------------------------------L-N.K-
C3ZF66_BRAFL/98-123--------------------------------------------------------------------------I-V.N-
C5WMF0_SORBI/24-48--------------------------------------------------------------------------L-RPA-
A0DA67_PARTE/343-367--------------------------------------------------------------------------M-K.A-
CANB_KLULA/26-50--------------------------------------------------------------------------L-K.K-
Q5CE65_CRYHO/113-137--------------------------------------------------------------------------L-E.K-
A4HVS3_LEIIN/72-97--------------------------------------------------------------------------L-M.E-
CNBL2_ARATH/167-192--------------------------------------------------------------------------I-I.D-
B0XGS0_CULQU/246-272--------------------------------------------------------------------------V-D.H-
B8DL48_DESVM/259-282--------------------------------------------------------------------------Q-N.R-
C5Z8P2_SORBI/58-82--------------------------------------------------------------------------A-R.D-
Y2130_DICDI/94-119--------------------------------------------------------------------------V-V.D-
Y2130_DICDI/154-178--------------------------------------------------------------------------A-D.D-
Q5CFX1_CRYHO/96-121--------------------------------------------------------------------------V-E.A-
Q4QG09_LEIMA/54-79--------------------------------------------------------------------------L-V.S-
A9SKA0_PHYPA/9-34--------------------------------------------------------------------------V-I.D-
C9SFB3_VERA1/63-87--------------------------------------------------------------------------M-R.Q-
Q4D2E0_TRYCC/138-163--------------------------------------------------------------------------I-V.D-
A2FET7_TRIVA/16-40--------------------------------------------------------------------------F-K.Q-
C3YD91_BRAFL/134-159--------------------------------------------------------------------------V-R.Q-
A4YRX7_BRASO/88-113--------------------------------------------------------------------------L-Q.D-
A0DSC5_PARTE/21-44--------------------------------------------------------------------------L-E.I-
A7APE2_BABBO/16-41--------------------------------------------------------------------------M-L.D-
A7T743_NEMVE/31-54--------------------------------------------------------------------------L-K.A-
B4KQ48_DROMO/52-76--------------------------------------------------------------------------L-Y.D-
D3B5T3_POLPA/148-172--------------------------------------------------------------------------I-D.D-
B9SPR6_RICCO/147-171--------------------------------------------------------------------------I-E.K-
A9UX06_MONBE/90-113--------------------------------------------------------------------------I-A.A-
A3LTX1_PICST/205-231--------------------------------------------------------------------------L-R.S-
A7S611_NEMVE/41-67--------------------------------------------------------------------------L-G.E-
B0W1J6_CULQU/268-292--------------------------------------------------------------------------F-EIA-
Q0UM05_PHANO/88-113--------------------------------------------------------------------------L-L.S-
B9GL46_POPTR/156-181--------------------------------------------------------------------------I-V.D-
Q15VG6_PSEA6/81-104--------------------------------------------------------------------------L-E.S-
B8CE53_THAPS/330-354--------------------------------------------------------------------------L-R.D-
Q47I72_DECAR/140-163--------------------------------------------------------------------------V-Q.N-
A8XVB7_CAEBR/473-497--------------------------------------------------------------------------I-D.A-
Q3A3S2_PELCD/55-78--------------------------------------------------------------------------L-I.D-
A0C9M2_PARTE/19-43--------------------------------------------------------------------------I-K.E-
Q4N591_THEPA/813-837--------------------------------------------------------------------------V-E.D-
Q3JEE9_NITOC/75-99--------------------------------------------------------------------------L-A.L-
C1FF66_MICSR/33-57--------------------------------------------------------------------------V-Q.A-
B9H0C7_POPTR/143-167--------------------------------------------------------------------------I-K.E-
CML50_ARATH/188-213--------------------------------------------------------------------------I-V.A-
A4RU14_OSTLU/441-466--------------------------------------------------------------------------L-H.D-
D3BNS7_POLPA/96-121--------------------------------------------------------------------------V-I.D-
C4XIW2_DESMR/87-110--------------------------------------------------------------------------M-E.V-
A0DMF3_PARTE/401-425--------------------------------------------------------------------------I-Q.T-
A4RZI0_OSTLU/14-38--------------------------------------------------------------------------L-Q.H-
Q804W1_DANRE/83-107--------------------------------------------------------------------------T-K.A-
B7G459_PHATC/14-38--------------------------------------------------------------------------F-R.E-
A8IXR0_CHLRE/4-29--------------------------------------------------------------------------I-Q.Q-
D3EQM6_ATETH/729-752--------------------------------------------------------------------------L-Q.R-
A9UZJ7_MONBE/82-106--------------------------------------------------------------------------I-Q.A-
A0CIV5_PARTE/365-389--------------------------------------------------------------------------I-E.K-
B6SX62_MAIZE/19-43--------------------------------------------------------------------------L-RPA-
A9VD02_MONBE/88-111--------------------------------------------------------------------------I-E.G-
B7GBA5_PHATC/485-509--------------------------------------------------------------------------F-I.D-
A0DK50_PARTE/458-483--------------------------------------------------------------------------I-I.A-
C5KL06_PERM5/719-743--------------------------------------------------------------------------M-E.A-
A5K4A9_PLAVS/215-237--------------------------------------------------------------------------L-D.D-
B9HHH3_POPTR/20-42--------------------------------------------------------------------------F-K.A-
C5XIL1_SORBI/222-246--------------------------------------------------------------------------I-E.E-
D7SNZ6_VITVI/403-425--------------------------------------------------------------------------L-R.D-
F1QUS0_DANRE/67-89--------------------------------------------------------------------------.-K.E-
F4HZU8_ARATH/290-313--------------------------------------------------------------------------L-K.R-
F6HHF9_VITVI/59-82--------------------------------------------------------------------------I-R.S-
G4VN18_SCHMA/14-37--------------------------------------------------------------------------L-R.E-
H2LE63_ORYLA/44-67--------------------------------------------------------------------------I-K.K-
H2TUR2_TAKRU/25-48--------------------------------------------------------------------------.-Q.D-
I1Q944_ORYGL/86-110--------------------------------------------------------------------------L-K.D-
I3NG46_SPETR/107-130--------------------------------------------------------------------------.-M.K-
K3XLQ6_SETIT/156-179--------------------------------------------------------------------------.-V.D-
K7UU06_MAIZE/38-61--------------------------------------------------------------------------M-Q.R-
Q22RP4_TETTS/886-908--------------------------------------------------------------------------.-D.A-
Q57W92_TRYB2/288-312--------------------------------------------------------------------------I-N.T-
Q5CMP5_CRYHO/287-309--------------------------------------------------------------------------L-Q.S-
Q6N380_RHOPA/95-117--------------------------------------------------------------------------L-K.D-

PF13833

D4A938_RAT/121-173----------------------------------------PTGTVDMHSMKVAL.RNV..GIQ.......LGPQE.M-C-
EFCB3_RAT/61-113----------------------------------------RTGCIDSHGLMSTV.AKL..GMN.......LNAYD.I-Y-
C5LZ40_PERM5/135-187----------------------------------------AKQLVEPSDIRVMM.AKV..GTE.......LTEEE.A-E-
A5ARZ8_VITVI/40-93----------------------------------------DKGVITFESLKRNS.ATL..GLQN......LSDDE.L-R-
B9INT1_POPTR/41-94----------------------------------------DRGVITMESLKKNA.AFL..GLQD......LSEDE.L-V-
PBP1_ARATH/50-104----------------------------------------DKGVITFESLRRNASTVL..GLGD......LTDDD.V-R-
B9RPS2_RICCO/36-90----------------------------------------EKGVITVESLRRNSCSVL..GIKD......LEEDE.I-V-
B9I910_POPTR/47-100----------------------------------------EKGLITSESLRRNS.ALL..GMEG......MSKED.A-E-
C5XT26_SORBI/52-106----------------------------------------ARGAITPDSLRRGAAAAL..GVAG......MSHAE.A-D-
Q6Z727_ORYSJ/59-117----------------------------------------ARGAITAESLRRSAASVL..GLGGGG..GEMTVEE.A-A-
D0NVB9_PHYIT/85-137----------------------------------------TSGVITAADLSSCM.RSL..NRI.......PTKGE.V-Q-
D0P2Y1_PHYIT/101-153----------------------------------------HSRVIKNEDLYEAI.KAL..GKV.......CSKKE.V-S-
Q54HB8_DICDI/91-143----------------------------------------KGGSMTFDDLLS........GLAVCG..KSTEKDK.V-N-
A0CF79_PARTE/166-215----------------------------------------QKGYITTDDLLMAMKND.............FGSNE.I-F-
D0MVE6_PHYIT/108-160----------------------------------------EKDGLDFEGLKAALNAM...GAH.......IKESD.V-S-
A0DTQ9_PARTE/83-135----------------------------------------GQGQISTEDMRLFL.SKV..RLG.......LNNTQ.L-T-
B4MB62_DROVI/283-336----------------------------------------AGADISRGALKHISDVLV..GVP.......LSAHV.I-D-
PCAT1_MOUSE/432-483----------------------------------------EDGSIDEANLSCILKTAL...........GVSELT.V-T-
PCAT1_HUMAN/432-483----------------------------------------EDGSVGEGDLSCILKTAL...........GVAELT.V-T-
B4JIX5_DROGR/476-528----------------------------------------STQQIDRDSFTR........LLRHAG..SKLNEQK.A-Q-
PCAT1_DROME/455-507----------------------------------------SSQQIDRESFVR........LMRHAG..GKLNEQK.A-Q-
B4L1J4_DROMO/476-528----------------------------------------SSEKISRENFTR........LMKHGG..SKMTEQK.T-Q-
B7G2K7_PHATC/364-418----------------------------------------QGQILDKDTFRRIL......KKSRQD..GHISNAE.V-D-
Q011J8_OSTTA/384-441----------------------------------------NQHSVTKEALRDAMAL....DASRDI..GTPSHDEIL-T-
C3Z2D7_BRAFL/396-448----------------------------------------DRDKVTREAFKR........GLKGAK..IPLSAYE.I-E-
C3Z612_BRAFL/548-601----------------------------------------GTDLITQQEFRAAIESRF..GIE.......VSDQD.F-E-
C3Z612_BRAFL/788-840----------------------------------------HTGFVTREEFHD........VLTELC..VQLSEYE.K-H-
Q69Z12_CAEEL/55-111----------------------------------------SGARITVEEFIPIYKK....VEAACG..RSTTLKE.F-Q-
B0WLJ4_CULQU/72-125----------------------------------------PNGKLTPAKFVD........MYKMFF..PSGNAEEFC-D-
A2FHL4_TRIVA/21-75----------------------------------------KKDKIGRDEFYKLY......KQLQKK..DDIPKSN.S-D-
C3Y1D3_BRAFL/16-70----------------------------------------GGGGLDPDEFRQAIKRTM..GNKT......VDDHE.L-E-
C3YJD8_BRAFL/199-252----------------------------------------EAGNMTLDEFKEAVSSTL..GTP.......AWNDQ.I-D-
Q5CKV1_CRYHO/78-129----------------------------------------KNGYLTQSEFLNILNDNP............ITDEQYR-T-
B9I051_POPTR/94-147----------------------------------------EKGVITFDSLKKNS.ALL..GLQD......LSDDD.L-R-
I1LRV1_SOYBN/37-90----------------------------------------EKGVITLESLRRNA.ALL..GLQD......LKEDE.L-V-
I1M2E4_SOYBN/41-94----------------------------------------EKKVITFESLKKNS.ALL..GLEG......MNDDE.L-R-
Q57WF9_TRYB2/87-140----------------------------------------PDGIFTRATLQETAGKVG..STQD.....TLSVEE.V-D-
U7E2X2_POPTR/82-134----------------------------------------.NGVLTKKDFQRASSQLC..GIS.......ITNNL.V-D-
W5K518_ASTMX/94-144----------------------------------------PRGLISKKDFSKAM.DS...QKQ.......YSPSE.I-Q-
W5KKQ5_ASTMX/545-603----------------------------------------.DMEISVTELQTILNRIISKH..KDLKTDGFGPEA.C-R-

PF13499

2AB2B_ARATH/319-416----------------------------------------------------------------------------I-Y-
B6KGE8_TOXGO/127-187----------------------------------------------------------------------------T-R-
Q4P6U4_USTMA/672-732----------------------------------------------------------------------------V-G-
E9AEY5_LEIMA/94-154----------------------------------------------------------------------------I-H-
C5KAV7_PERM5/53-118----------------------------------------------------------------------------V-K-
A5DT65_LODEL/101-174----------------------------------------------------------------------------I-K-
Q4DJW4_TRYCC/98-179----------------------------------------------------------------------------L-R-
Q6CTN2_KLULA/17-79----------------------------------------------------------------------------H-L-
C5LZE0_PERM5/571-637----------------------------------------------------------------------------V-D-
A4S628_OSTLU/7-65----------------------------------------------------------------------------L-K-
C1MJG0_MICPC/7-65----------------------------------------------------------------------------L-R-
A0CR76_PARTE/24-84----------------------------------------------------------------------------L-K-
A0C466_PARTE/37-95----------------------------------------------------------------------------I-E-
Q9T0I9_ARATH/34-104----------------------------------------------------------------------------V-E-
C5DF93_LACTC/138-199----------------------------------------------------------------------------A-T-
B4M2X5_DROVI/20-84----------------------------------------------------------------------------L-E-
A8Y4B4_CAEBR/164-224----------------------------------------------------------------------------L-A-
A0CA88_PARTE/346-407----------------------------------------------------------------------------M-M-
Q94172_CAEEL/116-188----------------------------------------------------------------------------L-D-
A7EZ28_SCLS1/21-80----------------------------------------------------------------------------L-Q-
D3Q0B0_STANL/11-86----------------------------------------------------------------------------L-L-
E9AD64_LEIMA/546-607----------------------------------------------------------------------------L-A-
A7SF01_NEMVE/191-251----------------------------------------------------------------------------L-G-
B9DI81_HUMAN/21-82----------------------------------------------------------------------------L-K-
C1MTV5_MICPC/26-99----------------------------------------------------------------------------C-D-
A9TA03_PHYPA/310-419----------------------------------------------------------------------------V-L-
A4S0C9_OSTLU/307-416----------------------------------------------------------------------------V-L-
A8HXI4_CHLRE/147-257----------------------------------------------------------------------------I-L-
B7PD77_IXOSC/544-602----------------------------------------------------------------------------I-Q-
A2FGB1_TRIVA/33-96----------------------------------------------------------------------------L-R-
Q17J61_AEDAE/78-142----------------------------------------------------------------------------L-T-
A8IZT4_CHLRE/137-198----------------------------------------------------------------------------L-A-
Q03ZC4_LEUMM/204-291----------------------------------------------------------------------------A-S-
A0DXA6_PARTE/81-139----------------------------------------------------------------------------L-K-
B5YLV0_THAPS/67-154----------------------------------------------------------------------------L-F-
B4K5H6_DROMO/74-153----------------------------------------------------------------------------I-F-
B0WSP5_CULQU/59-139----------------------------------------------------------------------------D-E-
B0W4V1_CULQU/110-173----------------------------------------------------------------------------V-F-
B0WCB9_CULQU/106-173----------------------------------------------------------------------------A-A-
EFCB9_HUMAN/107-165----------------------------------------------------------------------------S-R-
A7SE27_NEMVE/8-67----------------------------------------------------------------------------L-K-
A0D5N6_PARTE/352-411----------------------------------------------------------------------------L-K-
Q7Q2Y5_ANOGA/8169-8229----------------------------------------------------------------------------L-T-
A4RWN7_OSTLU/4056-4116----------------------------------------------------------------------------L-L-
Q8ILL9_PLAF7/783-852----------------------------------------------------------------------------L-F-
Q4UGG2_THEAN/782-851----------------------------------------------------------------------------L-F-
C3YCL0_BRAFL/81-149----------------------------------------------------------------------------M-M-
A0D4G3_PARTE/101-174----------------------------------------------------------------------------C-M-
A9V1M1_MONBE/552-631----------------------------------------------------------------------------L-M-
Q54K53_DICDI/26-86----------------------------------------------------------------------------L-K-
A7T5T7_NEMVE/487-550----------------------------------------------------------------------------M-K-
Q4QI25_LEIMA/178-238----------------------------------------------------------------------------L-R-
Q4QF91_LEIMA/96-156----------------------------------------------------------------------------L-V-
Q4DR78_TRYCC/191-251----------------------------------------------------------------------------I-Y-
Q4UGG2_THEAN/880-947----------------------------------------------------------------------------L-K-
A0D4H2_PARTE/77-137----------------------------------------------------------------------------L-E-
A7T5L6_NEMVE/10-71----------------------------------------------------------------------------L-K-
C4MAN5_ENTHI/232-311----------------------------------------------------------------------------R-R-
Q5CJ82_CRYHO/80-140----------------------------------------------------------------------------A-V-
D2W3R3_NAEGR/30-88----------------------------------------------------------------------------A-Q-
A4HAL6_LEIBR/162-223----------------------------------------------------------------------------V-A-
A5K537_PLAVS/488-549----------------------------------------------------------------------------I-Y-
Q5CMC1_CRYHO/504-568----------------------------------------------------------------------------L-R-
Q22C61_TETTS/123-193----------------------------------------------------------------------------A-Q-
B0BNB8_RAT/13-73----------------------------------------------------------------------------Y-K-
A0C1K7_PARTE/125-206----------------------------------------------------------------------------Y-K-
PCAT1_RAT/421-480----------------------------------------------------------------------------I-Q-
A9T6F9_PHYPA/80-149----------------------------------------------------------------------------I-R-
Q4DBK1_TRYCC/327-389----------------------------------------------------------------------------I-H-
Q7XUK2_ORYSJ/678-738----------------------------------------------------------------------------I-G-
Q7QDS4_ANOGA/165-226----------------------------------------------------------------------------D-R-
A0E9H8_PARTE/90-163----------------------------------------------------------------------------A-K-
Q5CGQ9_CRYHO/289-358----------------------------------------------------------------------------R-G-
RHBL3_HUMAN/39-99----------------------------------------------------------------------------W-K-
A0DXN4_PARTE/413-473----------------------------------------------------------------------------A-R-
Q179P5_AEDAE/122-190----------------------------------------------------------------------------V-K-
B4KQ53_DROMO/123-191----------------------------------------------------------------------------M-I-
B3M0W6_DROAN/115-183----------------------------------------------------------------------------M-R-
A0C6I2_PARTE/150-211----------------------------------------------------------------------------L-E-
D2VAM2_NAEGR/289-351----------------------------------------------------------------------------I-Y-
C1FGJ2_MICSR/18-90----------------------------------------------------------------------------L-R-
C1N9C6_MICPC/140-214----------------------------------------------------------------------------A-R-
B0S5T5_DANRE/258-354----------------------------------------------------------------------------.-.-
B4NST7_DROSI/43-103----------------------------------------------------------------------------I-K-
B9GTR6_POPTR/25-95----------------------------------------------------------------------------I-C-
C4MAF9_ENTHI/49-108----------------------------------------------------------------------------.-Q-
E0CTM8_VITVI/298-362----------------------------------------------------------------------------I-K-
E1F4J4_GIAIA/10-69----------------------------------------------------------------------------.-R-
F1QW82_DANRE/249-322----------------------------------------------------------------------------.-.-
F6HM70_VITVI/151-214----------------------------------------------------------------------------I-R-
F7H9X0_CALJA/17-81----------------------------------------------------------------------------L-K-
H2U588_TAKRU/111-173----------------------------------------------------------------------------.-.-
H3DPT5_TETNG/12-74----------------------------------------------------------------------------L-R-
K7TRT5_MAIZE/101-199----------------------------------------------------------------------------I-C-
O77424_DROME/31-136----------------------------------------------------------------------------L-H-
Q22Y73_TETTS/421-480----------------------------------------------------------------------------L-Q-
Q383U3_TRYB2/34-97----------------------------------------------------------------------------L-Q-
Q384M5_TRYB2/13-73----------------------------------------------------------------------------L-K-
Q5KK44_CRYNJ/682-741----------------------------------------------------------------------------L-R-
EFCB7_MOUSE/109-167----------------------------------------------------------------------------.-.-
Q9VDI5_DROME/174-250----------------------------------------------------------------------------.-.-
U5FYB3_POPTR/322-384----------------------------------------------------------------------------.-.-
V5BH06_TOXGO/908-973----------------------------------------------------------------------------I-R-

PF12763

END3_ASHGO/1-104----------------------------------------MP...KLEQFEIKKYWQIFSGLSPSDNKVTHDQVAPILHN
END3_PICST/1-104----------------------------------------MP...RLEDWEIKKYWEIFQGLDPVNKKLTGDKVAPVLKN
END3_PICGU/1-104----------------------------------------MP...QLEEWEIKKYWEIFQGLKPQDNKLSGSKVSPVLKN
END3_LODEL/1-104----------------------------------------MP...RLEESEIKKYWQIFQGLKPENNKVSGEQVSPVLKN
END3_AJECN/1-106----------------------------------------MSE.KKIEQWEVERYWEIFSSLSNGQPHLNNAQAATVLRN
C4R6X1_PICPG/1-105----------------------------------------MP..EKLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKN
C4Y889_CLAL4/1-104----------------------------------------MP...RLEEWEIKKYWEIFQGLQPKDNKLTGDRVSPVLKN
C5DUA9_ZYGRC/1-104----------------------------------------MP...KLEQFEIKKYWQIFSGLKPENNKVNHDQVLPILFN
END3_CANAL/1-104----------------------------------------MP...RLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKN
END3_DEBHA/1-104----------------------------------------MP...RLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKN
END3_YARLI/1-107----------------------------------------MSAQGKLEEWEINKYWDIFSGLKPVNNVLTGDQVSPVLKN
END3_SCHPO/1-101----------------------------------------MD......PQEKNKYWEIFRGLNPENGYLSGSKAAGVLRS
END3_MAGO7/3-105----------------------------------------.P...RIEAQEIETYWNIFSARTNGSKFLTGEQAAPVLKN

PF14788

E1BJE0_BOVIN/197-246--------------------------------------------------------------------------K-M-SF
F1RBD7_DANRE/179-228--------------------------------------------------------------------------K-M-SL
B0S4U2_DANRE/156-205--------------------------------------------------------------------------K-M-SL
D4A881_RAT/153-202--------------------------------------------------------------------------R-M-SF
PLCD4_BOVIN/153-202--------------------------------------------------------------------------R-M-SF
G3GVA5_CRIGR/185-234--------------------------------------------------------------------------K-M-NF
G3PRC9_GASAC/150-198--------------------------------------------------------------------------K-M-SY
H2UZG6_TAKRU/153-201--------------------------------------------------------------------------K-M-SY
H2V6N1_TAKRU/134-183--------------------------------------------------------------------------K-M-TL
H3CR59_TETNG/181-230--------------------------------------------------------------------------K-L-TQ

PF10591

Q29BA1_DROPS/165-277PRICDGEDLKEFPRRMRDWLFNVMRDLAERDELT.........................EHYMQMELEAETNNSRRW-S-
Q1HPY3_BOMMO/181-294MPDCTESEMSDFPRRMRDWLFNIMRDMAERRELT.........................PHYLKMEREAESNLTRRW-A-
SPRC_CHICK/147-284IPACLDTELTEFPLRMRDWLKNVLITLYERDEDNNLLTEKQKLKVK.NIHENEKRLEAGDHTVELLARDFEKNYNMY-I-
A7SG90_NEMVE/110-218VSECARDNLLQFGERYLEWILISRRRLVNRYYQV.............................KESEKGHNLPPDMR-K-
A7SPL6_NEMVE/109-215MTDCPKWMLEQFPYRFLDWLYLTRELSRDPRFEI...............................AKRGEQLTGDEI-K-
A7RFR0_NEMVE/170-293QDNCTRFENATLGARLLDWFHVLRAEYIKTESRKAGHPVD............QPIFPKMDIREAHVPFPCGHSHQEC-R-
A8Y2J4_CAEBR/138-252LDECTEEHMAQFPERMADWLFQVMKELKKRRELH........................KLEWEELLSEAENDDEKKH-V-
TICN1_HUMAN/195-304RSACTDKELRNLASRLKDWFGALHEDANRVIKPT..........................SSNTAQGRFDTSILPIC-K-
Q16II0_AEDAE/177-290MPDCSENDLADFPRRMRDWLFNVMRDLAVRNELP.........................EAYMELEQEAESNLTKRW-T-
A0MT19_STRPU/148-261MGSCSAEDLREYPERMTNWFIKSLALIRNRPEEH.........................GGLSQKEKETLQQEWSQS-T-
Q7PRF4_ANOGA/338-442RNECKPQQLTAIGNRLLDWFSVIMADSKKRRQHQ...............................QQKNKVHFPAAC-K-
TICN3_PONAB/198-308KRACSDLEFREVANRLRDWFKALHESGSQNKKTK.........................TLLRPERSRFDTSILPIC-K-
B0BM14_XENTR/192-300.ETCTGQDLADLGDRLRDWFQLLHENSKQNNTSN..........................PGSKQVNVLDKSLVAGC-K-
E9QJD8_DANRE/162-269.RECGNAEMTEVVSRLREWITVLHESGNTNKKYK...........................FQKPEKKVDMSKVPLC-K-
F6T3M2_CIOIN/214-350.QPCGEHELSEYPTRMRSWIKNIYLQMYDEAEDMGGLNEKQRFHGRKLVANRDRLQTYEEHHIDLMSREFQKFYPLY-K-
G3UR35_MELGA/364-501.PHCTDYEVGQFPLRMRDWLKNILMQYYERDQDKPGFLTEKQRNKVKKIYLNEKRLVSGEHPVELLLHDFEKNYHMY-V-
G3V7X5_RAT/483-620.PACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAGDHPIELLLRDFKKNYHMY-V-
H2LN90_ORYLA/63-169.KVCSESELKEVVSRLRDWFRVLHENGNHKRVKI...........................QKPEKSKFEVGASPIC-K-
H2TJA1_TAKRU/149-286.PSCLDAELVQFPLRMRDWLKNVLLQLYDHDSTAPGFLTAKQRFKVKKIFESERRLHAGNHSAELLAQDFEKNYNMY-I-
H3C0L7_TETNG/120-229.TGCTDSELHSLAARLKDWFRVLHLDANRDLKSS.........................DNFDSTTGHFDTSILPIC-K-
H3CJ51_TETNG/117-225.NSCTGQDLADLGDRLKDWFQLLHGNAKQNNSGR..........................PGSGTSSALDRSLGASC-K-

PF05042

M0ZSZ7_SOLTU/18-187--------------------------------------------------------------------------HEL-T-
PXG4_ARATH/14-183--------------------------------------------------------------------------EED-N-
W5GVY7_WHEAT/41-208--------------------------------------------------------------------------..T-T-
A9TDR9_PHYPA/60-230--------------------------------------------------------------------------NGY-S-
N1PPK3_MYCP1/103-267--------------------------------------------------------------------------QDQ-S-
A7F628_SCLS1/71-243--------------------------------------------------------------------------RHL-T-
K4CW85_SOLLC/66-235--------------------------------------------------------------------------NGM-S-
B2VUB2_PYRTR/75-243--------------------------------------------------------------------------AHQ-T-
D8TIC1_VOLCA/23-191--------------------------------------------------------------------------.TM-T-
S8ELD9_FOMPI/63-230--------------------------------------------------------------------------SNQ-T-
G9P0S4_HYPAI/77-245--------------------------------------------------------------------------QNQ-T-
E4ZR70_LEPMJ/128-296--------------------------------------------------------------------------TKR-S-
K5X1I2_AGABU/20-182--------------------------------------------------------------------------.SN-T-
M2RFF2_CERS8/70-238--------------------------------------------------------------------------SDQ-T-
D8S798_SELML/1-165--------------------------------------------------------------------------...-.-
K4BNV2_SOLLC/17-184--------------------------------------------------------------------------..P-T-
B6GVQ0_PENCW/53-222--------------------------------------------------------------------------.GY-S-
J3LZI1_ORYBR/63-232--------------------------------------------------------------------------RQM-S-
J4IAJ5_FIBRA/68-243--------------------------------------------------------------------------KNF-S-
M2SX69_COCSN/76-244--------------------------------------------------------------------------SHQ-T-
M1WCH0_CLAP2/79-251--------------------------------------------------------------------------QHQ-S-
K4ASA8_SOLLC/11-179--------------------------------------------------------------------------DEL-T-
U1GYE4_ENDPU/86-255--------------------------------------------------------------------------QHQ-T-
W1NF78_AMBTC/26-195--------------------------------------------------------------------------EEM-S-
D8QM27_SCHCM/3-166--------------------------------------------------------------------------...-.-
W5B7W5_WHEAT/64-233--------------------------------------------------------------------------QQR-S-
D7T8M1_VITVI/24-191--------------------------------------------------------------------------..L-S-
E9CG96_CAPO3/77-246--------------------------------------------------------------------------HQT-T-
V5FPI1_BYSSN/68-238--------------------------------------------------------------------------KDY-S-
H6BKU8_EXODN/53-222--------------------------------------------------------------------------AQL-T-
G2WXT5_VERDV/79-249--------------------------------------------------------------------------RHQ-T-
M1CV68_SOLTU/61-230--------------------------------------------------------------------------HGM-S-
C5WSN8_SORBI/57-226--------------------------------------------------------------------------RGM-S-
R1H351_BOTPV/148-315--------------------------------------------------------------------------QDK-T-
B9SQU8_RICCO/58-227--------------------------------------------------------------------------HGL-S-
E9EBJ4_METAQ/18-186--------------------------------------------------------------------------SEN-S-
J5JK78_BEAB2/77-245--------------------------------------------------------------------------KNS-T-
M7ZYZ8_TRIUA/63-232--------------------------------------------------------------------------GQK-S-
U9TJL4_RHIID/120-291--------------------------------------------------------------------------TRK-S-
I2G1F4_USTH4/56-233--------------------------------------------------------------------------KGL-T-
D8S1Z4_SELML/28-200--------------------------------------------------------------------------AEM-T-
C4JJV1_UNCRE/84-252--------------------------------------------------------------------------SNQ-T-
B9HJF5_POPTR/20-189--------------------------------------------------------------------------NDH-N-
N4U5F7_FUSC1/46-215--------------------------------------------------------------------------EKL-S-
I1BMD1_RHIO9/14-180--------------------------------------------------------------------------.KE-N-
G2YVJ3_BOTF4/138-309--------------------------------------------------------------------------KHL-T-
M4D7A9_BRARP/18-187--------------------------------------------------------------------------EGY-T-
A8N0P5_COPC7/81-240--------------------------------------------------------------------------KTN-T-
F2D072_HORVD/38-206--------------------------------------------------------------------------ANM-T-
M0U3Y1_MUSAM/16-185--------------------------------------------------------------------------MQM-T-
B0DXN4_LACBS/89-257--------------------------------------------------------------------------KKN-T-
R7YGA5_CONA1/24-193--------------------------------------------------------------------------.KG-T-
I1NI03_SOYBN/61-226--------------------------------------------------------------------------HNL-S-
I1P3Z8_ORYGL/21-188--------------------------------------------------------------------------..A-T-
Q0CAM3_ASPTN/84-254--------------------------------------------------------------------------KEY-T-
F8PYI9_SERL3/62-238--------------------------------------------------------------------------QEY-T-
G7EB36_MIXOS/116-285--------------------------------------------------------------------------EGY-T-
K1XCK9_MARBU/55-223--------------------------------------------------------------------------.DL-T-
I1GZ91_BRADI/42-211--------------------------------------------------------------------------ANM-T-
D7MF58_ARALL/62-231--------------------------------------------------------------------------YGL-S-
G0SB95_CHATD/83-254--------------------------------------------------------------------------ENN-T-
W1PLQ7_AMBTC/57-226--------------------------------------------------------------------------YNL-S-
M9LJZ6_PSEA3/74-245--------------------------------------------------------------------------...-.-
G2QID9_THIHA/80-250--------------------------------------------------------------------------RDH-T-
A8HQE8_CHLRE/45-210--------------------------------------------------------------------------SGL-T-
D7M708_ARALL/59-228--------------------------------------------------------------------------QDM-S-
K2RRQ6_MACPH/115-282--------------------------------------------------------------------------QDK-T-
M0X087_HORVD/44-210--------------------------------------------------------------------------.GM-T-
Q7XQ03_ORYSJ/64-233--------------------------------------------------------------------------HHL-S-
H1UX75_COLHI/78-246--------------------------------------------------------------------------RHQ-T-
K3YU83_SETIT/135-302--------------------------------------------------------------------------..A-T-
W5GSM3_WHEAT/39-208--------------------------------------------------------------------------RNM-T-
PXG7_ARATH/25-194--------------------------------------------------------------------------EKM-T-
C5Z7Z3_SORBI/47-216--------------------------------------------------------------------------SNM-T-
Q652U4_ORYSJ/37-206--------------------------------------------------------------------------.EL-T-
F9X765_MYCGM/51-216--------------------------------------------------------------------------KNQ-T-
N1S4R5_FUSC4/79-247--------------------------------------------------------------------------RDQ-T-
A9S8P8_PHYPA/81-250--------------------------------------------------------------------------NDY-T-
M4GDA9_MAGP6/75-243--------------------------------------------------------------------------SHQ-T-
S2JK15_MUCC1/22-192--------------------------------------------------------------------------HEE-S-
U4LKU1_PYROM/77-244--------------------------------------------------------------------------SHQ-T-
C5Z7Z5_SORBI/35-203--------------------------------------------------------------------------.NM-T-
W5G9X6_WHEAT/41-207--------------------------------------------------------------------------...-T-
I1IEG7_BRADI/42-209--------------------------------------------------------------------------..T-T-
D8UI18_VOLCA/50-224--------------------------------------------------------------------------TNR-T-
S3E0E9_GLAL2/112-280--------------------------------------------------------------------------RDQ-S-
E3S5H2_PYRTT/120-288--------------------------------------------------------------------------HDR-T-
F7W396_SORMK/75-245--------------------------------------------------------------------------EDY-T-
F8QCR1_SERL3/58-235--------------------------------------------------------------------------SEY-S-
C6TFE2_SOYBN/28-195--------------------------------------------------------------------------..E-N-
R7YKW5_CONA1/107-275--------------------------------------------------------------------------EDA-T-
M2N5S0_BAUCO/46-214--------------------------------------------------------------------------RHL-T-
G7XD39_ASPKW/82-248--------------------------------------------------------------------------...-T-
M0TPW2_MUSAM/57-226--------------------------------------------------------------------------HHL-S-
M7WRI9_RHOT1/151-321--------------------------------------------------------------------------KDE-P-
B8P3H3_POSPM/64-231--------------------------------------------------------------------------RRE-T-
I1H7Y6_BRADI/58-227--------------------------------------------------------------------------RGM-S-
K5WCX1_PHACS/70-244--------------------------------------------------------------------------IQK-T-
G3JTA5_CORMM/75-243--------------------------------------------------------------------------KHQ-T-
H6BSL1_EXODN/85-253--------------------------------------------------------------------------QHQ-S-
PXG3_ARATH/57-226--------------------------------------------------------------------------KGM-S-
D8QH68_SCHCM/4-176--------------------------------------------------------------------------GEK-T-
N4V954_COLOR/75-245--------------------------------------------------------------------------SEY-T-
A8HVK1_CHLRE/24-187--------------------------------------------------------------------------..Y-T-
D8U9T4_VOLCA/1289-1463--------------------------------------------------------------------------..L-T-
G4MNQ2_MAGO7/84-252--------------------------------------------------------------------------SDQ-T-
H1V486_COLHI/87-256--------------------------------------------------------------------------KNY-T-
I1Q199_ORYGL/36-205--------------------------------------------------------------------------ANM-T-
K4ASA7_SOLLC/17-186--------------------------------------------------------------------------EEP-T-
B8LTU3_TALSN/62-232--------------------------------------------------------------------------KEY-T-
Q6Z2H7_ORYSJ/195-363--------------------------------------------------------------------------.GV-T-
Q8H813_ORYSJ/96-265--------------------------------------------------------------------------RGM-S-
W5HJG6_WHEAT/30-200--------------------------------------------------------------------------.EL-T-
K1WV35_MARBU/115-286--------------------------------------------------------------------------RRK-T-
D8S185_SELML/60-228--------------------------------------------------------------------------SGL-S-
D7MKF7_ARALL/61-230--------------------------------------------------------------------------NGL-S-
M7SQ47_EUTLA/66-234--------------------------------------------------------------------------EDK-T-
M7X9U8_RHOT1/104-273--------------------------------------------------------------------------END-S-
I1JRR6_SOYBN/60-229--------------------------------------------------------------------------NDM-S-
E1ZMG0_CHLVA/1-167--------------------------------------------------------------------------...-.-
T0K8D8_COLGC/77-245--------------------------------------------------------------------------RHQ-T-
N1JIF2_BLUG1/65-234--------------------------------------------------------------------------RHQ-T-
A9SGT1_PHYPA/66-235--------------------------------------------------------------------------NGY-S-
W5AQ78_WHEAT/122-291--------------------------------------------------------------------------HNM-S-
K3YZS5_SETIT/43-212--------------------------------------------------------------------------.GM-T-
M3D239_SPHMS/91-258--------------------------------------------------------------------------QHQ-T-

PF14658

KASH5_MOUSE/108-175------------------------------------------------------------------------------N-
Q4CNH0_TRYCC/14-77------------------------------------------------------------------------------K-
B3SBZ9_TRIAD/28-95------------------------------------------------------------------------------E-
C3YNF3_BRAFL/170-239------------------------------------------------------------------------------D-
B4JT32_DROGR/32-94------------------------------------------------------------------------------E-
G1M6G8_AILME/38-105------------------------------------------------------------------------------N-
W5LGH7_ASTMX/234-299------------------------------------------------------------------------------D-

PF09279

PLCB3_MOUSE/225-316--------------------------------------------------------------------------D-I-D-
PLCD1_ARATH/25-104--------------------------------------------------------------------------E-I-K-
PIPA_DROME/227-318--------------------------------------------------------------------------D-I-E-
PLCL1_HUMAN/315-397--------------------------------------------------------------------------E-V-Y-
PLCH1_HUMAN/216-298--------------------------------------------------------------------------D-L-Y-
Q7ZZ38_DANRE/226-317--------------------------------------------------------------------------E-V-E-
PLCH2_HUMAN/243-325--------------------------------------------------------------------------D-L-Y-
PLCL2_MOUSE/344-426--------------------------------------------------------------------------E-I-Y-
PLCD3_MOUSE/251-332--------------------------------------------------------------------------E-L-E-
PLCD4_MOUSE/207-289--------------------------------------------------------------------------E-I-E-
PLCB2_RAT/220-311--------------------------------------------------------------------------E-I-D-
PLCB1_RAT/224-315--------------------------------------------------------------------------E-I-D-
PLCD1_RAT/213-295--------------------------------------------------------------------------E-I-D-
PIP1_DROME/225-317--------------------------------------------------------------------------E-V-E-
PLCB4_BOVIN/57-148--------------------------------------------------------------------------D-I-E-
PLCZ1_BOVIN/72-154--------------------------------------------------------------------------E-I-I-
Q21754_CAEEL/231-315--------------------------------------------------------------------------D-L-R-
PLCD4_BOVIN/207-289--------------------------------------------------------------------------E-V-Q-
PLCZ1_CHICK/74-156--------------------------------------------------------------------------E-F-H-
PLCD2_ARATH/26-102--------------------------------------------------------------------------E-I-K-
Q5CLA7_CRYHO/282-364--------------------------------------------------------------------------E-L-R-
Q5QIB9_STRPU/216-298--------------------------------------------------------------------------D-L-Q-
Q75IL8_ORYSJ/23-116--------------------------------------------------------------------------E-L-G-
PLCZ1_PIG/72-154--------------------------------------------------------------------------E-I-I-
PLCZ1_HUMAN/72-154--------------------------------------------------------------------------E-I-I-
PLCD5_ARATH/28-111--------------------------------------------------------------------------D-V-V-
PLCD7_ARATH/26-102--------------------------------------------------------------------------E-I-K-
F6RLC5_XENTR/205-287--------------------------------------------------------------------------E-V-L-
H2URW6_TAKRU/236-318--------------------------------------------------------------------------E-I-F-
H3BZL2_TETNG/219-301--------------------------------------------------------------------------D-V-Y-
H3CA47_TETNG/202-292--------------------------------------------------------------------------E-I-Q-
H3CCU1_TETNG/213-295--------------------------------------------------------------------------D-L-Y-
H3CD03_TETNG/222-302--------------------------------------------------------------------------.-L-F-
H3CWV7_TETNG/225-313--------------------------------------------------------------------------E-L-S-
H3CYP8_TETNG/204-284--------------------------------------------------------------------------E-L-D-
H3D277_TETNG/236-318--------------------------------------------------------------------------E-I-Y-
H3DAI2_TETNG/204-285--------------------------------------------------------------------------D-V-L-
H3DBC1_TETNG/153-234--------------------------------------------------------------------------D-L-Y-
H3DF29_TETNG/5-86--------------------------------------------------------------------------D-I-Q-
H3DJB0_TETNG/220-306--------------------------------------------------------------------------E-I-L-
H3DK53_TETNG/240-322--------------------------------------------------------------------------E-I-Y-
I1JI90_SOYBN/27-105--------------------------------------------------------------------------E-I-K-
K4C1V6_SOLLC/26-104--------------------------------------------------------------------------D-V-K-
K4C5V3_SOLLC/26-100--------------------------------------------------------------------------D-I-K-
M1BNL7_SOLTU/25-110--------------------------------------------------------------------------E-I-K-
W4XJU2_STRPU/224-315--------------------------------------------------------------------------D-I-E-

PF09068

G4LZH2_SCHMA/859-1166CDLMKSM..KQFNTVR..FSDYRTGLKLRRLQKEL..................................CFDSIS-ISIV
F6VUQ0_XENTR/3078-3196TELFQSL..GDLNNVR..FSAYRTAMKIRRLQKTL..................................CLDLLE-LSTT
H2MTI0_ORYLA/24-148RQIFVELGDQNFDSIC..LSTYRTACKLRFIQKRC..................................NLHLID-IYNV
E7ES64_HUMAN/16-140RQLFIEMRAQNFDVIR..LSTYRTACKLRFVQKRC..................................NLHLVD-IWNM
F4WQ21_ACREC/20-144LQLLQEMRQQNFDTIR..FASYRTACKLRFIQKKV..................................HLHNVD-IWNV
U1NS43_ASCSU/3208-3327VEIMEKL..ANFNQVK..FSAYRTAMKLRAIQKRL..................................CLDLLS-LQEL
A8QB20_BRUMA/2997-3116VEIMEEL..TTFNQVK..FSAYRTAMKLRAIQKRL..................................CLDLLT-LEDI
V6CLV8_CAEEL/3071-3190VEIVKEL..SQFNRVK..FLAYRTAMKLRALQKRL..................................CLDLVD-LTLL
B3MR84_DROAN/47-170.SIIDELQ.MKYGNYK..YTVYRCASKFVALQKIF..................................HTGKVP-YKLV
T1KPK1_TETUR/326-448IDLMNSL..VEFNEIR..YSAYRTAMKLRTIQRSL..................................NIDYIH-LGSL
W5JYZ3_ASTMX/396-514TQLFQSM..ADLEHVR..FSAYRTSMKSRRVQKAL..................................CLDLLE-LAMA
W4YT69_STRPU/407-526TELFHSL..SDLNAVK..FSAYRTGMKLRRLQKSL..................................CLYLLN-LASA
B3S724_TRIAD/427-546TEIYDLL..VNNNFIK..YAAYRTAMKLRKLQKCL..................................FLNFIE-LNSL
H3DP81_TETNG/17-141RQLFVELGEQDFDAIR..LSTYRTACKLRFIQKRC..................................NLHLID-IYNV
A4QNP9_XENTR/357-475TELYQAL..GDLNNIK..FSAYRTAMKLRRVQKAL..................................RLDLVT-LPLL
H3BBK9_LATCH/301-419TELYHTL..ADLNNVK..FSAYRTAMKLRRVQKAL..................................RLDLVT-LTSA
H2XWJ0_CIOIN/5-129AELMESM..LDLNDVR..FTAYRTSMKLQRLQKAL..................................CLDLLN-LDTA
B4MYA9_DROWI/9-131..ILQDLRLQTFDSIR..FASYRTASKLRYIQKST..................................NLHLVD-IWNV
T1IRG4_STRMM/3028-3147TELIQSL..AELNDVR..FSAYRTAMKLRTLQKKL..................................CLDLLN-MNNA
I1G265_AMPQE/2-122NTLLGEL..ATYNDIR..FPRYRLCFKLRRLQTCF..................................LLHRLE-LSNL
H9J473_BOMMO/544-669SQLLQEMREQNFDLIR..FASYRTACKLRFVQKKC..................................NLHVID-IWNV
H2WIC0_CAEJA/49-173QQLIDDMRLQDFDSIR..FATYRAACKLRFIQQNT..................................KIHLVD-IWNM
A7T3M8_NEMVE/40-160IQLMQDL..AELNNIK..YAAYRTAMKLRAIHKKT..................................QLYLVE-IPIL
D6WMD4_TRICA/16-140.ALIHEMSAHNFDLIR..FASYRTATKLRFIQKKV..................................SLHAVD-IWNV
W4X438_ATTCE/2-122ENIMRSM..QECNAIR..YPSYRTAAKMQILHREL..................................NMTHVQ-LELI
K1R5C0_CRAGI/40-163.TLLTEMRAQNFDVIR..FATYRTACKLRFIQKKT..................................NLSLVD-IWNI
F8W2P0_DANRE/15-139KQLFMDMKTQNYDTIR..LSTYRTACKLRFVQKKC..................................NLHLVD-VWNM
E9GLP4_DAPPU/11-134..LANDIHTQNFNVIR..LASYRTAVKFRFIQRRT..................................HLHLID-VWNL
T1HS05_RHOPR/9-135KQILEDV..QSCNCIR..YAAYRTAAKLDILQKNL..................................GLDRVG-LTLI
U6HT61_ECHMU/107-238RRLLAELKAKKFDQIR..FAAYRTASKLRYIQKRT..................................LLSSIE-LWRL
A7S5C8_NEMVE/343-462TELYHQI..AELNDIK..YSAYRTAMKLRCIQKAT..................................KLDLVT-LNNL
Q24175_DROME/44-168STIMDDLQ.RDYGNYK..YTVYRCASKFVALQKIF..................................HTGKIP-YKLV
H2VBW2_TAKRU/4-122TELYQTL..ADLNNVR..FSAYRTAMKIRRLQKAL..................................CLDLLD-LNVA
Q7QHZ2_ANOGA/39-157.........EKYAGAR..YSTYRCAGKLHALQKAL..................................HTSYIP-FEMV
D6WPN9_TRICA/33-153IELKHTI..DDWNYVK..YSKYRVGLKFRALQKAL..................................FMEEVT-LSTV
G6D4U9_DANPL/34-152SKILKTL..DEYNDIK..YSAYRIAFKIFALQRSL..................................KVPPLR-ISS.
F1KWZ8_ASCSU/20-144QALIDEMRLQDFDSIR..FATYRAACKLRFIQKKT..................................SVHLVD-IWNM
E9H0W1_DAPPU/6-127RELLAAL..NQFANIR..YVAYRTAAKLKFIQSQT..................................KLDCIK-LTQI
B0WQW4_CULQU/32-156..ILNKIN.EKFATSK..YSTYRCACKLFALQKAL..................................FTNYIP-FQTI
H0ZKJ9_TAEGU/14-132TDLFQSL..ADLNNVR..FSAYRTAIKIRRLQKAL..................................CLDLLD-LNTT
K1P9S0_CRAGI/40-170.KVMEEL..DEYRDIR..YAAYRTAFKIRHIQKRL......................KCKYPEHAHAGQKVHHVK-LEAM
K1S5H9_CRAGI/1252-1371TDLMDTL..ADLNNVR..FAAYRTAMKLRMLQKKL..................................RLDLVA-MTLA
E9FTM1_DAPPU/561-680EELMNSL..SEFNDVR..FSAYRMALKLRRVQKFL..................................CLDKLE-LNTA
J9K968_ACYPI/1839-1958MELMSSL..SEFNDVR..FSAYRTAMKLRTVQKRM..................................SLDLLT-LEAA
H2N287_ORYLA/21-139AELYQSL..ADLNNVR..FSAYRTAMKLRRLQKAL..................................CLDLLS-MQAA
A2CJ02_DANRE/16-140RQLFAEMRALDLDSIR..LSTYRTACKLRFIQKRC..................................NLHLVD-IWNI
M3XQ41_MUSPF/16-140RQLFAEMRAQDLDRIR..LSTYRTACKLRFVQKKC..................................NLHLVD-IWNV
C3Y1B5_BRAFL/354-478RQLMTEMRTQNFDVIR..LGTYRTACKLRFVQKKT..................................NLHLVD-IWNM
E9J516_SOLIN/156-275IELMSSL..ADLNEVR..FSAYRTAMKLRTVQKRL..................................CLDMLS-LSTA
H9J3Q2_BOMMO/34-162IKLWQSL..SVYDDIK..YAVYRIAFKIHALQKQI..................................RVPPLR-ISS.
B7PND6_IXOSC/52-205VAIMDKL..TSFNDIK..YAAYRTGAKLICLQKELLREQHCSTKGLSSSPGVHPVPTDDYHAFRGALSPAVSNVH-VSML
H2YGZ2_CIOSA/280-404VELMESM..LDLNDVR..FAAYRTAMKLQRLQKAL..................................CLDLLT-LDTA
I1F8U3_AMPQE/47-168TELFKEL..RTLDVIRPAYGAYRVASKLRTLQVIT..................................NLHKVS-KENV
G7YU45_CLOSI/641-909SDLMQSM..KQMNAFR..FAEYRTALKLRKLQKTL..................................CLDSLS-ISIL
H3CSW5_TETNG/23-146RQLFVEMRAHDLDSIR..LSTYRTACKLRFVQKKC..................................NMHLVD-IWNV
T1HBK6_RHOPR/21-145LQLMQEMRSQNFDLIR..FASYRTACKLRFLQRKL..................................NLHLVD-IWNV
M3XL49_LATCH/21-139TELYQSL..ADLNNVR..FSAYRTAMKLRRLQKAL..................................CLDLLS-LSAA
T1J1M8_STRMM/34-154NTVMEEL..SDYKIVK..YSTYRLALKLRALQNVF..................................KLHLVS-TEIL
U6IGP1_HYMMI/87-218RRLLAELKAKKFDQIR..FAAYRTASKLRYIQKRT..................................LLSLIE-LWRL
I3J386_ORENI/308-426TELYQAL..ADLNNIK..FSAYRTAMKLRRVQKAL..................................RLDLVA-LSSL
G7Y732_CLOSI/88-223.RLLAEMKLRQFDTIR..FAAYRTASKLRYIQQRT..................................LFRFME-LGRV
Q175I9_AEDAE/173-287IELMKSL..ADLNEVR..FSAYRTALKLRTVQKRL..................................AFDRIA-MNVA
D6WLG0_TRICA/462-581LELATSL..LQLNEVR..FSAYRTALKLRAIQKKL..................................CLDLVS-INGA
E0VJZ9_PEDHC/394-512LELMTSL..SELNEIR..FSAYRTAMKLRAVQKRL..................................CLDMIP-LSAA
B4GVZ3_DROPE/35-163SAIMEKLQ.VDYGKYK..YTVYRCASKFVALQKIF..................................HTSKIP-YKLV
T1K642_TETUR/2001-2122TEIINNL..NEFSEVK..FAAYRTAMKLRSIQRHL..................................CLDLIH-LTSL
J9JV60_ACYPI/13-138LQLLQEMRCQNYDMIR..FASYRTACKLRYVQKKV..................................YLHMID-IWNV
B3S1D5_TRIAD/20-144TDILREI..DQLNYIK..FAAYRTAIKMRIIQQRF....................................DKVE-FLRL

PF00404

GUNC_CLOCE/439-459--------------------------------------------------------------------------------
GUNC_CLOCE/406-426--------------------------------------------------------------------------------
GUNG_CLOCE/696-716--------------------------------------------------------------------------------
NAGH_CLOPE/1579-1599--------------------------------------------------------------------------------
Q7UQ89_RHOBA/1857-1877--------------------------------------------------------------------------------
GUNA_CLOCE/415-435--------------------------------------------------------------------------------
Q7UVW2_RHOBA/78-98--------------------------------------------------------------------------------
Q7UQX3_RHOBA/91-111--------------------------------------------------------------------------------
Q97KK3_CLOAB/669-689--------------------------------------------------------------------------------
Q7UJQ5_RHOBA/112-132--------------------------------------------------------------------------------
XYNZ_CLOTH/430-450--------------------------------------------------------------------------------
Q7UJQ3_RHOBA/298-318--------------------------------------------------------------------------------
Q97KK1_CLOAB/403-423--------------------------------------------------------------------------------
Q7NPJ6_GLOVI/26-46--------------------------------------------------------------------------------
Q7NPL8_GLOVI/39-59--------------------------------------------------------------------------------
Q7UI70_RHOBA/1743-1763--------------------------------------------------------------------------------
GUNB_CLOC7/387-407--------------------------------------------------------------------------------
Q8XKX6_CLOPE/1300-1320--------------------------------------------------------------------------------
Q7UY66_RHOBA/134-154--------------------------------------------------------------------------------
Q97KK6_CLOAB/459-479--------------------------------------------------------------------------------
Q97DK6_CLOAB/957-977--------------------------------------------------------------------------------
Q7UWM1_RHOBA/1723-1743--------------------------------------------------------------------------------
Q7UJQ5_RHOBA/144-164--------------------------------------------------------------------------------
GUNB_CLOC7/419-439--------------------------------------------------------------------------------
Q7ULP1_RHOBA/1765-1785--------------------------------------------------------------------------------
Q97DK6_CLOAB/989-1009--------------------------------------------------------------------------------
GUNH_CLOTH/872-892--------------------------------------------------------------------------------
Q97KK0_CLOAB/809-829--------------------------------------------------------------------------------
Q7UY66_RHOBA/95-115--------------------------------------------------------------------------------
Q97KK2_CLOAB/482-502--------------------------------------------------------------------------------
Q9HNT7_HALSA/533-553--------------------------------------------------------------------------------
Q7UFE7_RHOBA/629-649--------------------------------------------------------------------------------
Q7UYG2_RHOBA/96-116--------------------------------------------------------------------------------
Q97KK7_CLOAB/705-725--------------------------------------------------------------------------------
Q7NPJ5_GLOVI/58-78--------------------------------------------------------------------------------
Q7UUS9_RHOBA/5863-5883--------------------------------------------------------------------------------
Q7UF11_RHOBA/73-93--------------------------------------------------------------------------------
Q7NPJ7_GLOVI/30-50--------------------------------------------------------------------------------
Q7UNV4_RHOBA/5954-5974--------------------------------------------------------------------------------
Q97KK0_CLOAB/777-797--------------------------------------------------------------------------------
Q7UF08_RHOBA/1987-2007--------------------------------------------------------------------------------
Q977Y3_CLOAB/584-604--------------------------------------------------------------------------------
Q7UF12_RHOBA/1289-1309--------------------------------------------------------------------------------
Q7UVU1_RHOBA/870-890--------------------------------------------------------------------------------
Q977Y3_CLOAB/552-572--------------------------------------------------------------------------------
GUNH_CLOTH/833-853--------------------------------------------------------------------------------
Q7UI80_RHOBA/1559-1579--------------------------------------------------------------------------------
Q8ESB0_OCEIH/16-36--------------------------------------------------------------------------------
GUNF_CLOTH/670-690--------------------------------------------------------------------------------
GUNB_CLOTH/534-554--------------------------------------------------------------------------------
GUNG_CLOTH/503-523--------------------------------------------------------------------------------
Q7UF11_RHOBA/111-131--------------------------------------------------------------------------------
Q7UKT7_RHOBA/597-617--------------------------------------------------------------------------------
GUNF_CLOTH/709-729--------------------------------------------------------------------------------
Q7UUS9_RHOBA/5821-5841--------------------------------------------------------------------------------
Q97KK2_CLOAB/515-535--------------------------------------------------------------------------------
GUND_CLOCE/530-550--------------------------------------------------------------------------------
GUNF_CLOCE/699-719--------------------------------------------------------------------------------
Q7UUT0_RHOBA/783-803--------------------------------------------------------------------------------
Q7UI80_RHOBA/1600-1620--------------------------------------------------------------------------------
Q7UNV3_RHOBA/7352-7372--------------------------------------------------------------------------------
Q7UF08_RHOBA/2027-2047--------------------------------------------------------------------------------
GUNA_CLOCE/446-466--------------------------------------------------------------------------------
GUNF_CLOCE/667-687--------------------------------------------------------------------------------
XYNZ_CLOTH/464-484--------------------------------------------------------------------------------
GUND_CLOCE/562-582--------------------------------------------------------------------------------
Q7UF12_RHOBA/1249-1269--------------------------------------------------------------------------------
A3DBF5_CLOTH/714-734--------------------------------------------------------------------------------
A3DBF6_CLOTH/507-526--------------------------------------------------------------------------------
GUB_CLOTH/308-327--------------------------------------------------------------------------------
A3DC30_CLOTH/418-438--------------------------------------------------------------------------------
CELK_CLOTH/834-854--------------------------------------------------------------------------------
A3DCH2_CLOTH/1195-1214--------------------------------------------------------------------------------
A3DD30_CLOTH/1292-1312--------------------------------------------------------------------------------
A3DD31_CLOTH/646-665--------------------------------------------------------------------------------
A3DDK3_CLOTH/415-435--------------------------------------------------------------------------------
A3DDK4_CLOTH/506-526--------------------------------------------------------------------------------
GUND_CLOTH/621-640--------------------------------------------------------------------------------
A3DDW7_CLOTH/768-788--------------------------------------------------------------------------------
A3DGI0_CLOTH/560-580--------------------------------------------------------------------------------
A3DHC1_CLOTH/590-610--------------------------------------------------------------------------------
A3DJ81_CLOTH/560-579--------------------------------------------------------------------------------
A3DJ82_CLOTH/549-569--------------------------------------------------------------------------------
B8I2F6_CLOCE/406-426--------------------------------------------------------------------------------
B8I7V4_CLOCE/827-847--------------------------------------------------------------------------------
B8I7V7_CLOCE/736-756--------------------------------------------------------------------------------
B8I7V8_CLOCE/33-53--------------------------------------------------------------------------------
B8I7V9_CLOCE/505-525--------------------------------------------------------------------------------
B8I7W0_CLOCE/623-643--------------------------------------------------------------------------------
B8I7W1_CLOCE/480-500--------------------------------------------------------------------------------
D9SP57_CLOC7/281-301--------------------------------------------------------------------------------
D9SS67_CLOC7/65-85--------------------------------------------------------------------------------
D9SS71_CLOC7/661-681--------------------------------------------------------------------------------
D9SS72_CLOC7/674-694--------------------------------------------------------------------------------
D9SV64_CLOC7/1016-1036--------------------------------------------------------------------------------
D9SX08_CLOC7/1284-1304--------------------------------------------------------------------------------
D9SX09_CLOC7/800-820--------------------------------------------------------------------------------
E6UCK3_RUMA7/387-407--------------------------------------------------------------------------------
CIPA_CLOTH/1824-1842--------------------------------------------------------------------------------

PF08976

EFCB6_HUMAN/1160-1260---------------------------------------------------------------------ATADRDILARL
EFCB6_MOUSE/1177-1281---------------------------------------------------------------------ETAHRDIVARV

PF08726

ACTN2_MOUSE/824-890--------------------------------------------------------------------------D-T-DT
ACTN1_HUMAN/822-888--------------------------------------------------------------------------D-T-DT
Q21408_CAEEL/2361-2431--------------------------------------------------------------------------N-I-QS
SPTA1_HUMAN/2350-2418--------------------------------------------------------------------------N-I-KS
ACTN3_HUMAN/831-897--------------------------------------------------------------------------E-T-DT
Q5AVH3_EMENI/605-676--------------------------------------------------------------------------D-Q-NT
A8Y3R8_CAEBR/827-893--------------------------------------------------------------------------D-Q-DT
Q4P6F1_USTMA/566-633--------------------------------------------------------------------------D-T-TS
Q2U7P8_ASPOR/559-630--------------------------------------------------------------------------D-Q-NT
Q29EZ8_DROPS/2344-2414--------------------------------------------------------------------------N-V-QS
Q5KJM5_CRYNJ/626-704--------------------------------------------------------------------------D-A-SS
Q0UG56_PHANO/635-706--------------------------------------------------------------------------D-Q-NT
Q0CDG2_ASPTN/559-630--------------------------------------------------------------------------D-Q-NT
A8DV03_NEMVE/329-399--------------------------------------------------------------------------N-V-GS
C4QKY6_SCHMA/335-403--------------------------------------------------------------------------N-V-QS
F7B6H7_XENTR/829-895--------------------------------------------------------------------------E-T-DT
H9GE13_ANOCA/826-892--------------------------------------------------------------------------E-T-DT
W5NV97_SHEEP/169-237--------------------------------------------------------------------------N-V-KS

PF09069

DMD_MOUSE/3204-3295----------------------------------------------------------------------------L-E-
DTNA_HUMAN/144-232----------------------------------------------------------------------------I-M-
DMDA_DROME/3001-3101----------------------------------------------------------------------------L-E-
A2CJ03_DANRE/144-232----------------------------------------------------------------------------I-L-
DTN1_CAEEL/165-253----------------------------------------------------------------------------L-V-
Q7Q0M7_ANOGA/698-797----------------------------------------------------------------------------L-E-
Q8K0N0_MOUSE/144-232----------------------------------------------------------------------------M-L-
DMD_CAEEL/3205-3295----------------------------------------------------------------------------L-E-
A2CI99_DANRE/430-521----------------------------------------------------------------------------I-Q-
A7RKW6_NEMVE/120-213----------------------------------------------------------------------------L-V-
DYTN_DANRE/122-217----------------------------------------------------------------------------L-S-
Q1RL59_CIOIN/141-229----------------------------------------------------------------------------L-V-
A7S5C8_NEMVE/466-557----------------------------------------------------------------------------L-D-
A4QNP9_XENTR/479-570----------------------------------------------------------------------------V-K-
A7RTQ0_NEMVE/138-234----------------------------------------------------------------------------L-Q-
C3YXT6_BRAFL/1286-1377----------------------------------------------------------------------------L-E-
F6VUQ0_XENTR/3200-3291----------------------------------------------------------------------------L-E-
F8W2P0_DANRE/143-230----------------------------------------------------------------------------L-V-
G4LZH2_SCHMA/1170-1277----------------------------------------------------------------------------L-D-
H0WG43_OTOGA/434-523----------------------------------------------------------------------------.-K-
H2XWJ0_CIOIN/133-223----------------------------------------------------------------------------I-E-
H3C7H8_TETNG/23-109----------------------------------------------------------------------------L-V-
K1S5H9_CRAGI/1375-1466----------------------------------------------------------------------------L-D-
Q0E9B2_DROME/135-223----------------------------------------------------------------------------L-V-

PF01023

L5JUY8_PTEAL/7-48----------------------------------------------------------------------------.EES
F1ST21_PIG/4-46----------------------------------------------------------------------------LLQS
G3W2L6_SARHA/7-48----------------------------------------------------------------------------.ENS
G3UWB8_MOUSE/9-48----------------------------------------------------------------------------.EHK
W5MVL0_LEPOC/4-46----------------------------------------------------------------------------LENA
H2RLM4_TAKRU/5-46----------------------------------------------------------------------------LQSA
G3TRT9_LOXAF/9-51----------------------------------------------------------------------------LETA
Q7ZVA4_DANRE/5-47----------------------------------------------------------------------------LERA
F7F9N6_MONDO/4-45----------------------------------------------------------------------------LLGN
M4A7L2_XIPMA/4-45----------------------------------------------------------------------------LETS
F6SL70_MONDO/45-87----------------------------------------------------------------------------LEIA
L5JX40_PTEAL/5-47----------------------------------------------------------------------------LESA
H3A562_LATCH/5-46----------------------------------------------------------------------------LELA
H2TTX5_TAKRU/8-48----------------------------------------------------------------------------..TA
F7DLP7_XENTR/4-43----------------------------------------------------------------------------LENS
S10A9_RAT/9-51----------------------------------------------------------------------------LERS
G3Q9D9_GASAC/4-46----------------------------------------------------------------------------LETA
E2QTP3_CANFA/4-46----------------------------------------------------------------------------LEKA
H0UWS1_CAVPO/8-50----------------------------------------------------------------------------LEKA
H0XIU7_OTOGA/6-47----------------------------------------------------------------------------.QRC
V8NEZ7_OPHHA/66-108----------------------------------------------------------------------------TERC
M3XQH5_MUSPF/4-46----------------------------------------------------------------------------LEKA
J9JIL5_PIG/7-49----------------------------------------------------------------------------TERC
H0UWS6_CAVPO/8-50----------------------------------------------------------------------------LERS
G1RQ12_NOMLE/7-46----------------------------------------------------------------------------M..A
S10AC_BOVIN/4-46----------------------------------------------------------------------------LEDH
H3A3I9_LATCH/6-44----------------------------------------------------------------------------.EIA
H0ZIJ7_TAEGU/4-45----------------------------------------------------------------------------LETA
W5QIV2_SHEEP/5-47----------------------------------------------------------------------------LLRS
G3HUU3_CRIGR/4-46----------------------------------------------------------------------------LLQG
L9J9X1_TUPCH/5-46----------------------------------------------------------------------------LEQA
H0WV54_OTOGA/5-47----------------------------------------------------------------------------LEKA
F7A2F5_MONDO/6-45----------------------------------------------------------------------------MEHD
G3W1A3_SARHA/8-50----------------------------------------------------------------------------LENS
H2N5P8_PONAB/8-50----------------------------------------------------------------------------LERN
F6TJM4_MONDO/2-44----------------------------------------------------------------------------LLKS
H0W7W0_CAVPO/4-46----------------------------------------------------------------------------LLQG
G3VRV7_SARHA/22-64----------------------------------------------------------------------------LEKA
I3NDP4_SPETR/4-46----------------------------------------------------------------------------LEEH
H2M4U6_ORYLA/4-46----------------------------------------------------------------------------LETA
G1TIX1_RABIT/6-47----------------------------------------------------------------------------MEDS
J3QPE5_MOUSE/4-46----------------------------------------------------------------------------MEQA
H2Q028_PANTR/5-47----------------------------------------------------------------------------LEKA
S10AC_HUMAN/4-46----------------------------------------------------------------------------LEEH
L5MCF4_MYODS/5-47----------------------------------------------------------------------------MENT
W5LAM8_ASTMX/17-56----------------------------------------------------------------------------LEAA
S10A7_BOVIN/6-45----------------------------------------------------------------------------LEQA
Q5T7Y4_HUMAN/5-47----------------------------------------------------------------------------LETA
W5MJL4_LEPOC/1-43----------------------------------------------------------------------------MEAA
G5BER0_HETGA/19-58----------------------------------------------------------------------------.ERA
H3DJK9_TETNG/9-51----------------------------------------------------------------------------MEAA
G3GWD0_CRIGR/4-46----------------------------------------------------------------------------LETA
M3VW16_FELCA/21-62----------------------------------------------------------------------------LEIA
H0V5V5_CAVPO/5-46----------------------------------------------------------------------------LEQA
G1SAS4_NOMLE/10-52----------------------------------------------------------------------------TERC
S10A9_MOUSE/9-51----------------------------------------------------------------------------MERS
I3JHV0_ORENI/7-47----------------------------------------------------------------------------..GA
Q4RLA4_TETNG/7-46----------------------------------------------------------------------------...A
W5MF75_LEPOC/8-48----------------------------------------------------------------------------LENA
V8N500_OPHHA/66-108----------------------------------------------------------------------------MEKH
G3U1S6_LOXAF/4-46----------------------------------------------------------------------------LLEN
W5MJW5_LEPOC/15-56----------------------------------------------------------------------------.QQA
G5BEQ8_HETGA/21-62----------------------------------------------------------------------------LEQA
G1SNF3_RABIT/4-46----------------------------------------------------------------------------LLKS
G1NWG9_MYOLU/10-51----------------------------------------------------------------------------.ETA
I3KUM8_ORENI/18-59----------------------------------------------------------------------------.QTA
L9JAM5_TUPCH/51-93----------------------------------------------------------------------------LECA
G3R010_GORGO/5-44----------------------------------------------------------------------------MEHT
L8Y375_TUPCH/4-46----------------------------------------------------------------------------LLRS
F6Q7S6_ORNAN/5-46----------------------------------------------------------------------------LEEA
S10A9_RABIT/8-50----------------------------------------------------------------------------LERS
M3ZN15_XIPMA/4-43----------------------------------------------------------------------------LESG
G1QFV3_MYOLU/4-46----------------------------------------------------------------------------LLQG
L5MD08_MYODS/74-116----------------------------------------------------------------------------LLEN
G1PBJ1_MYOLU/4-45----------------------------------------------------------------------------LLRN
H9GT13_ANOCA/4-46----------------------------------------------------------------------------MENA
G1RH71_NOMLE/4-46----------------------------------------------------------------------------LLRN
G3VKN0_SARHA/4-46----------------------------------------------------------------------------LLKS
W5LHL3_ASTMX/5-46----------------------------------------------------------------------------LENA
S10AC_RABIT/4-46----------------------------------------------------------------------------LEDH
W5MEL8_LEPOC/5-47----------------------------------------------------------------------------LERA
G1Q439_MYOLU/4-46----------------------------------------------------------------------------LLNS
Q1LUV5_DANRE/8-48----------------------------------------------------------------------------LEKA
G3I8A7_CRIGR/4-46----------------------------------------------------------------------------MEQG
G1M0L8_AILME/8-50----------------------------------------------------------------------------LECS
G3T7T2_LOXAF/4-46----------------------------------------------------------------------------LLRS
G5B5Z0_HETGA/5-44----------------------------------------------------------------------------TEHA
H2M1Y6_ORYLA/10-52----------------------------------------------------------------------------LEKS
G3HUU5_CRIGR/4-47----------------------------------------------------------------------------LLRG
F7E9V1_CALJA/9-51----------------------------------------------------------------------------LELA
G1PYZ6_MYOLU/2-41----------------------------------------------------------------------------MEHA
G1TLH6_RABIT/12-51----------------------------------------------------------------------------LLRG
I3JGI1_ORENI/5-47----------------------------------------------------------------------------LEKS
F7F9Z9_MONDO/4-46----------------------------------------------------------------------------LLQS
F6R2K0_HORSE/5-46----------------------------------------------------------------------------L.EN
L5JU87_PTEAL/66-106----------------------------------------------------------------------------..EN
G3SM10_LOXAF/9-51----------------------------------------------------------------------------LEEY
V8N1F0_OPHHA/6-48----------------------------------------------------------------------------LEKC
G3UBX1_LOXAF/5-46----------------------------------------------------------------------------LEQA
H9H0S2_MELGA/14-56----------------------------------------------------------------------------LEQA
G3I8A9_CRIGR/9-51----------------------------------------------------------------------------LEQS
G3HUU7_CRIGR/5-44----------------------------------------------------------------------------MEHA
I3IZ81_ORENI/5-45----------------------------------------------------------------------------.QVS
TCHL1_MOUSE/4-47----------------------------------------------------------------------------LLRG
W5KR67_ASTMX/5-47----------------------------------------------------------------------------LEKA
H0Z0V8_TAEGU/5-46----------------------------------------------------------------------------LEDA
F6SK92_MONDO/5-47----------------------------------------------------------------------------LECA
M3WK02_FELCA/4-46----------------------------------------------------------------------------LEEH
H0XNW8_OTOGA/5-46----------------------------------------------------------------------------LEMA
G3UIG4_LOXAF/7-48----------------------------------------------------------------------------.EES
J9P8R6_CANFA/4-45----------------------------------------------------------------------------LLRN
L9KHS5_TUPCH/4-46----------------------------------------------------------------------------LETA
G1SXG6_RABIT/5-47----------------------------------------------------------------------------LENS
HORN_MOUSE/4-46----------------------------------------------------------------------------LLES
F7B1J7_CALJA/5-46----------------------------------------------------------------------------LETA
H0XUJ3_OTOGA/5-44----------------------------------------------------------------------------MQHA
G3NAC2_GASAC/5-47----------------------------------------------------------------------------LQTA
I3LG91_PIG/4-46----------------------------------------------------------------------------LLRS
I3IZ83_ORENI/4-46----------------------------------------------------------------------------LETS
F7C5Y6_MONDO/4-46----------------------------------------------------------------------------LLNS
G5BEQ9_HETGA/8-50----------------------------------------------------------------------------LEKA
G3NGI8_GASAC/5-46----------------------------------------------------------------------------.QKA
G3W0M1_SARHA/9-51----------------------------------------------------------------------------LKDC
Q28J00_XENTR/119-161----------------------------------------------------------------------------META
I3MVD9_SPETR/8-50----------------------------------------------------------------------------MESS
H0VP20_CAVPO/10-52----------------------------------------------------------------------------LLRA
M4AAE1_XIPMA/4-46----------------------------------------------------------------------------LEMA
V8NEZ7_OPHHA/348-387----------------------------------------------------------------------------LEHA
W5QIV5_SHEEP/4-46----------------------------------------------------------------------------LLRS
F7AJJ0_MONDO/6-48----------------------------------------------------------------------------MEKA
G3WVS2_SARHA/4-46----------------------------------------------------------------------------LLQS
F7EU24_MONDO/4-46----------------------------------------------------------------------------LLQS
H9GTJ3_ANOCA/4-46----------------------------------------------------------------------------LLNS
L9J9Y0_TUPCH/22-64----------------------------------------------------------------------------MENS
H3DJK5_TETNG/6-48----------------------------------------------------------------------------LEHA
U3KBZ3_FICAL/7-51----------------------------------------------------------------------------LEWA
I3MT07_SPETR/5-47----------------------------------------------------------------------------LEKA
A5WW28_DANRE/1-43----------------------------------------------------------------------------MESA
M4AWV1_XIPMA/5-47----------------------------------------------------------------------------LEGA
H0X9K4_OTOGA/4-46----------------------------------------------------------------------------LEEH
H2T287_TAKRU/29-71----------------------------------------------------------------------------LEKC
H2M1B8_ORYLA/10-52----------------------------------------------------------------------------LENA
F7GK08_MONDO/11-54----------------------------------------------------------------------------.ERC
M4AK45_XIPMA/1-43----------------------------------------------------------------------------MEAA
G5ALL3_HETGA/8-50----------------------------------------------------------------------------LERS
H9H249_MELGA/9-51----------------------------------------------------------------------------LEKA
G3WVB3_SARHA/10-54----------------------------------------------------------------------------TERC
G5B8K2_HETGA/4-46----------------------------------------------------------------------------LLRS
W5LL26_ASTMX/1-43----------------------------------------------------------------------------MESA
D3ZSW4_RAT/4-45----------------------------------------------------------------------------LLRN
V8NB04_OPHHA/9-51----------------------------------------------------------------------------LELA
H3DR68_TETNG/7-49----------------------------------------------------------------------------LEGA
F7FV87_ORNAN/4-46----------------------------------------------------------------------------LEKS
G3VQW8_SARHA/4-46----------------------------------------------------------------------------LETA
M126_CHICK/14-56----------------------------------------------------------------------------LEKA
F7G3H7_ORNAN/5-46----------------------------------------------------------------------------LETA
F1M053_RAT/8-50----------------------------------------------------------------------------TERC
G1SQV2_RABIT/4-43----------------------------------------------------------------------------LETA
H2N5S9_PONAB/4-46----------------------------------------------------------------------------LLEN
L5JS91_PTEAL/23-65----------------------------------------------------------------------------MERC
S10A8_BOVIN/5-47----------------------------------------------------------------------------LECA
F7DMV8_XENTR/7-49----------------------------------------------------------------------------LETA
F6SKU1_MONDO/5-47----------------------------------------------------------------------------LEKC
A5WW33_DANRE/9-51----------------------------------------------------------------------------LESA
W5LAN5_ASTMX/4-45----------------------------------------------------------------------------LQQA
H9H071_MELGA/6-45----------------------------------------------------------------------------..DS
G3PE20_GASAC/4-46----------------------------------------------------------------------------LEKC
H0XY71_OTOGA/8-50----------------------------------------------------------------------------LERS
H3BAP4_LATCH/17-58----------------------------------------------------------------------------LETA
W5KP80_ASTMX/4-46----------------------------------------------------------------------------LENC
W5NQH6_SHEEP/8-50----------------------------------------------------------------------------MESS
I3IZ76_ORENI/24-63----------------------------------------------------------------------------LEEA
W5NR21_SHEEP/6-45----------------------------------------------------------------------------LEQA
M3WT77_FELCA/4-46----------------------------------------------------------------------------LLGN
W5QIV3_SHEEP/4-46----------------------------------------------------------------------------LLRD
G3W262_SARHA/5-47----------------------------------------------------------------------------LEGA
H0WH38_OTOGA/4-46----------------------------------------------------------------------------LEEH
F1ST30_PIG/5-46----------------------------------------------------------------------------L.RD
K7GPL5_PIG/5-46----------------------------------------------------------------------------LEQG
F6T046_HORSE/3-45----------------------------------------------------------------------------MERD
V8NST6_OPHHA/5-47----------------------------------------------------------------------------LEEA
I3LX36_SPETR/6-48----------------------------------------------------------------------------LEQA
G3TZS9_LOXAF/5-45----------------------------------------------------------------------------LERA
S10A8_MOUSE/5-47----------------------------------------------------------------------------LEKA
H2ZZH2_LATCH/9-50----------------------------------------------------------------------------LEAA
U3KBY8_FICAL/8-50----------------------------------------------------------------------------LEQA
F6SK72_MONDO/8-50----------------------------------------------------------------------------LENA
E9PTQ1_RAT/4-46----------------------------------------------------------------------------LLES
W5MJT4_LEPOC/29-71----------------------------------------------------------------------------LERT
G5B8K1_HETGA/4-46----------------------------------------------------------------------------LLNS
W5MMW1_LEPOC/5-46----------------------------------------------------------------------------LESA
U3IKT7_ANAPL/4-45----------------------------------------------------------------------------LQEN
F6SL13_MONDO/5-46----------------------------------------------------------------------------LENA
G1PAG3_MYOLU/43-85----------------------------------------------------------------------------LKAA
W5MWM7_LEPOC/5-47----------------------------------------------------------------------------LENS
H0Z1L6_TAEGU/6-45----------------------------------------------------------------------------..DS
G3WW94_SARHA/4-46----------------------------------------------------------------------------LLNS
G1RM73_NOMLE/4-46----------------------------------------------------------------------------LETA
E2R805_CANFA/4-46----------------------------------------------------------------------------LLRD
G3VQV2_SARHA/4-46----------------------------------------------------------------------------LLSS
G3W673_SARHA/5-47----------------------------------------------------------------------------LEQA
F7HI59_CALJA/4-46----------------------------------------------------------------------------LLNS
G5BIG3_HETGA/5-47----------------------------------------------------------------------------MEKA
H9G3V9_ANOCA/12-54----------------------------------------------------------------------------TERC
F6RMH6_ORNAN/9-50----------------------------------------------------------------------------.EKE
H9GKD3_ANOCA/9-51----------------------------------------------------------------------------MESC
H2MLR9_ORYLA/5-46----------------------------------------------------------------------------LQGA
F6S8H1_HORSE/5-47----------------------------------------------------------------------------LEKA
H9L051_CHICK/10-51----------------------------------------------------------------------------.EMA
Q4SS39_TETNG/11-50----------------------------------------------------------------------------LEKG
F6QF97_ORNAN/6-46----------------------------------------------------------------------------..RS
G1M0L5_AILME/9-51----------------------------------------------------------------------------LEDH
Q28J00_XENTR/12-54----------------------------------------------------------------------------TERS
RPTN_MOUSE/4-46----------------------------------------------------------------------------LLNS

PF13405

F5HLN4_ANOGA/622-651.K----R-------------------F-E-T--I-------.D------------.KE...KK-G..--Y-VS.IT-DI-
B9PZD1_TOXGO/10-39.Q----A-------------------F-Q-A--L-------.D------------.SG...HR-G..--A-LG.RD-EM-
Q7QH58_ANOGA/21-50.E----K-------------------F-E-E--I-------.D------------.TN...KD-G..--F-IE.LK-EL-
B9PML0_TOXGO/103-132.V----C-------------------F-D-V--F-------.D------------.PE...GR-G..--V-CS.VK-DV-
C4Q5J4_SCHMA/2655-2684.D----L-------------------F-H-R--K-------.D------------.RD...RD-G..--R-LT.RA-EF-
B9PRI1_TOXGO/15-44.G----A-------------------F-D-E--F-------.D------------.TK...KT-G..--Y-LS.LN-RF-
Q001X5_TOXGO/73-102.E----L-------------------F-K-A--A-------.D------------.IG...GS-G..--K-IG.RT-AM-
Q95UJ7_TOXGO/149-178.E----A-------------------F-A-Y--F-------.D------------.VS...KH-G..--Y-LT.RK-QM-
CAN8_HUMAN/536-564.R----L-------------------F-E-K--L-------..------------.AG...KD-S..--E-IT.AN-AL-
A9V4Q3_MONBE/290-319.V----A-------------------F-D-K--I-------.D------------.KD...HD-H..--R-ID.FG-EF-
A9V4Q3_MONBE/492-521.D----V-------------------F-E-Q--L-------.D------------.TS...GD-K..--Q-LS.QE-EF-
A0BQH1_PARTE/99-128.Q----V-------------------F-D-Y--Y-------.D------------.SE...QA-G..--I-LS.PN-DL-
A0BQH1_PARTE/172-202.R----V-------------------Y-R-K--Y-------.D------------.KN...NK-G..--F-VT.LQ-DL-
B3DGM2_DANRE/12-41.E----C-------------------F-S-L--Y-------.D------------.KK...RK-G..--K-IE.AK-DL-
B3DGM2_DANRE/85-114.E----A-------------------M-R-M--T-------.D------------.KH...KK-G..--Y-IQ.AS-EL-
B4G986_DROPE/40-69.K----A-------------------F-D-L--F-------.D------------.TE...CT-G..--F-IE.VK-EL-
B4G986_DROPE/113-142.K----A-------------------F-A-F--F-------.D------------.DD...RT-N..--R-CT.FD-NL-
EFCB6_PONAB/24-53.K----A-------------------F-K-L--I-------.D------------.VN...KT-G..--L-VR.PQ-EL-
EFCB6_PONAB/255-284.K----A-------------------L-L-I--I-------.N------------.TK...PD-G..--P-IT.RE-EF-
EFCB6_PONAB/699-728.K----N-------------------F-L-E--T-------.D------------.NE...GN-G..--I-LR.RR-DI-
EFCB6_PONAB/816-845.K----A-------------------F-T-K--I-------.D------------.KS...KT-N..--Y-IS.IC-KM-
B4GVA6_DROPE/51-80.R----I-------------------V-D-R--I-------.D------------.ED...NN-G..--Y-LT.LV-EL-
B4GVA6_DROPE/139-169.R----R-------------------W-A-V--A-------.D------------.ND...LD-D..--S-LT.LE-EF-
B4GVA6_DROPE/217-247.K----V-------------------F-A-K--F-------LD------------.HN...GD-G..--Y-LS.EA-EV-
C5KAW4_PERM5/19-48.E----A-------------------F-E-I--F-------.D------------.KQ...KL-G..--V-IN.YS-QL-
C5KAW4_PERM5/93-122.E----A-------------------F-R-A--F-------.D------------.PD...GR-G..--L-IR.VE-EL-
A0E4G3_PARTE/299-328.E----Q-------------------F-S-K--Y-------.D------------.LD...KE-G..--N-LD.FN-EF-
B4K4U2_DROMO/29-58.L----A-------------------F-S-L--F-------.D------------.TN...NT-G..--I-IP.MK-QL-
B4K4U2_DROMO/102-131.L----A-------------------F-K-V--F-------.D------------.RE...GN-G..--W-IH.EN-EF-
A0BG74_PARTE/108-137.R----A-------------------F-H-L--F-------.S------------.QG...ND-N..--F-IT.FE-NL-
B5Y3F8_PHATC/258-286.K----V-------------------F-K-K--F-------.D------------.VS...QN-G..--E-IS.LS-EF-
Q7Y0H2_CHLRE/18-47.R----A-------------------F-N-T--I-------.D------------.SK...GD-K..--K-ID.AE-EL-
C5Z5N8_SORBI/67-96.D----M-------------------F-A-F--F-------.D------------.TE...GR-G..--Q-LD.YA-QI-
C5Z5N8_SORBI/134-163.R----I-------------------F-Q-A--I-------.D------------.VE...HN-G..--C-IL.PE-EL-
A7SG62_NEMVE/12-41.E----S-------------------F-E-L--Y-------.D------------.KQ...GD-E..--K-ID.SS-QL-
A7SG62_NEMVE/87-116.D----S-------------------L-R-V--F-------.D------------.ND...GS-G..--M-IN.EG-EL-
Q240R2_TETTS/29-58.K----S-------------------F-K-F--F-------.D------------.LQ...NN-G..--L-LS.KN-EF-
B5DYP3_DROPS/28-57.T----V-------------------F-D-M--F-------.D------------.PE...NT-G..--V-LP.LK-QI-
A7RGK2_NEMVE/11-40.E----A-------------------F-S-L--F-------.D------------.RV...GD-G..--K-IE.CD-QI-
A7RGK2_NEMVE/86-115.E----G-------------------L-R-V--F-------.D------------.RD...GT-G..--T-VL.AA-EL-
Q4DGX2_TRYCC/326-357.R----A-------------------F-V-S--C-------.N------------.VN...GS-G..--F-LS.RE-EV-
A9V7J3_MONBE/330-359.S----L-------------------W-K-Q--A-------.D------------.YN...GN-G..--G-CS.LA-EL-
A9V7J3_MONBE/402-431.D----V-------------------F-E-D--L-------.D------------.TG...DD-R..--R-ID.LP-EF-
Q4Y2X6_PLACH/19-48.E----C-------------------F-S-L--F-------.D------------.TS...KS-G..--Y-ID.IR-EF-
B3LYL3_DROAN/28-57.E----A-------------------F-A-L--F-------.D------------.NE...DT-K..--V-IS.IK-YL-
A0E0C2_PARTE/300-329.E----L-------------------F-A-E--L-------.D------------.MT...KD-K..--A-LN.VN-EL-
C3YDW3_BRAFL/85-114.D----A-------------------L-K-Y--T-------.D------------.RQ...GR-G..--F-VM.AT-EL-
Q0IEY6_AEDAE/74-103.I----I-------------------V-D-K--I-------.D------------.TD...KD-S..--F-VN.LA-EL-
Q0IEY6_AEDAE/240-270.E----T-------------------F-N-N--F-------RD------------.KD...KD-G..--F-MN.NQ-EV-
A9VBL4_MONBE/184-215.C----I-------------------F-E-L--F-------.D------------.QD...RS-G..--K-FE.YE-EF-
A0E3X2_PARTE/219-248.E----V-------------------F-E-I--F-------.D------------.YN...KD-G..--H-IE.FN-EF-
MYL6B_HUMAN/145-174.E----G-------------------F-R-V--F-------.D------------.KE...GN-G..--K-VM.GA-EL-
Q7QCU7_ANOGA/79-109.E----A-------------------F-A-K--A-------.D------------.TN...GD-K..--H-LT.VQ-EL-
Q7QCU7_ANOGA/211-241.D----I-------------------L-R-Q--F-------.D------------.VD...GD-D..--H-LT.VE-EF-
D0NI99_PHYIT/995-1024.R----R-------------------L-Q-A--L-------.D------------.TE...RR-G..--S-VT.PS-SL-
D0NZK1_PHYIT/776-806.S----A-------------------F-N-E--L-------.D------------.AN...GF-G..--R-VT.KL-EW-
C1FGB5_MICSR/2004-2033.E----A-------------------F-H-F--V-------.D------------.AD...HG-G..--D-ID.EN-EL-
C1FGB5_MICSR/2077-2106.V----G-------------------F-D-C--F-------.D------------.LA...RK-G..--F-IV.LE-DV-
C1FGB5_MICSR/2208-2238.D----L-------------------I-G-A--L-------.K------------.RD...SD-G..--D-GS.LS-EM-
D3AYI6_POLPA/6-35.E----C-------------------F-A-I--Y-------.D------------.KD...ND-G..--K-VI.ID-EL-
D3AYI6_POLPA/79-108.D----A-------------------F-K-A--L-------.D------------.KE...GH-G..--S-IQ.EA-EL-
A2ERW3_TRIVA/9-39.A----R-------------------F-D-A--L-------.D------------.EG...RD-G..--K-MK.PA-EF-
A2ERW3_TRIVA/82-111.M----I-------------------F-R-A--F-------.D------------.KD...RS-R..--S-ID.VN-EI-
A7RV39_NEMVE/88-117.E----C-------------------F-K-V--F-------.D------------.RN...GN-G..--L-IG.AA-EL-
A2DT12_TRIVA/7-37.Q----L-------------------F-D-K--A-------.D------------.KG...KD-G..--L-LK.FE-EF-
A2DT12_TRIVA/80-109.V----L-------------------F-R-A--H-------.D------------.KD...RS-G..--T-LE.TA-EI-
A4UNW1_CHICK/97-126.N----A-------------------F-K-I--F-------.D------------.PE...GK-G..--H-IK.AD-YI-
A2DIY5_TRIVA/14-43.M----A-------------------F-D-G--F-------.D------------.TN...HT-G..--R-VD.KA-YL-
A2DIY5_TRIVA/85-114.D----I-------------------F-K-T--L-------.D------------.KN...GS-G..--R-IP.AD-LA-
A8N2E2_COPC7/129-158.E----A-------------------F-E-S--F-------.D------------.EN...DT-G..--M-VK.VE-EM-
A0CCH5_PARTE/297-326.E----L-------------------F-S-F--F-------.D------------.QD...KT-G..--K-LA.PG-DV-
A0BPZ4_PARTE/198-233.R----I-------------------F-T-M--I-------.D------------.SD...QS-G..--Y-IT.ET-EV-
Q01GA6_OSTTA/40-69.R----C-------------------F-E-T--I-------.D------------.AE...RA-G..--S-IA.VE-EF-
Q01GA6_OSTTA/181-223.K----V-------------------F-E-L--I-------.D------------.YD...ED-G..--E-VT.LV-EF-
B6K7R4_SCHJY/10-39.E----A-------------------F-N-L--Y-------.D------------.ID...ND-G..--L-IP.TS-HV-
B6K7R4_SCHJY/79-108.K----A-------------------F-A-V--F-------.D------------.RD...NT-G..--M-IE.TS-RF-
C3YGP7_BRAFL/22-51.E----A-------------------F-D-I--F-------.D------------.HE...SN-K..--T-VD.VR-EI-
Q240Z1_TETTS/371-400.V----Q-------------------F-K-K--I-------.D------------.KD...QT-G..--L-IR.VD-EL-
Q240Z1_TETTS/445-474.S----I-------------------F-K-Y--F-------.D------------.PS...NT-N..--Y-IS.IA-DL-
C3ZWG8_BRAFL/29-59.E----F-------------------F-K-D--F-------.D------------.RL...RS-G..--F-IT.AS-QF-
Q7T2F7_DANRE/113-143.F----A-------------------F-R-L--Y-------.D------------.LD...RD-D..--K-IS.RD-EL-
B4LIU4_DROVI/12-41.R----V-------------------F-D-K--Y-------.D------------.ED...RN-G..--S-IE.AR-DL-
B4LIU4_DROVI/85-114.K----A-------------------F-E-V--F-------.D------------.RQ...GD-G..--Y-FN.AL-DV-
A0C7B9_PARTE/44-73.E----F-------------------F-T-D--F-------.D------------.RL...RK-G..--W-VT.ED-KF-
A0C7B9_PARTE/522-551.E----F-------------------L-R-D--F-------.D------------.KL...RS-G..--T-IT.VT-QL-
D0NQW3_PHYIT/447-476.V----L-------------------F-S-E--V-------.S------------.RD...GS-E..--R-VG.LE-EF-
B4KPB2_DROMO/13-42.L----I-------------------Y-D-K--H-------.D------------.VN...RT-G..--K-ID.IR-QL-
A7SK46_NEMVE/37-66.E----A-------------------F-N-I--I-------.D------------.QD...RN-G..--I-IT.RD-DL-
A7SK46_NEMVE/105-134.R----A-------------------F-S-C--L-------.D------------.DG...GD-G..--K-LS.AK-ML-
A7S7W7_NEMVE/508-546.S----K-------------------F-K-E--F-------.F------------.DNLSGRD-G..--E-ID.AK-EL-
A7S7W7_NEMVE/583-612.K----I-------------------F-Q-V--F-------.D------------.ED...KS-G..--E-MD.TY-EL-
A9SC48_PHYPA/64-94.E----L-------------------F-M-K--I-------.S------------.HSV.IDD-G..--L-IH.KE-EF-
A9SC48_PHYPA/138-175.F----A-------------------F-K-L--Y-------.D------------.LH...QT-G..--Y-IE.RE-EV-
Q4N995_THEPA/859-892.R----A-------------------F-S-H--Y-------.D------------.KE...HV-G..--K-VY.VN-EF-
B8PFW7_POSPM/47-76.E----A-------------------F-S-L--I-------.D------------.HD...GN-G..--V-VS.EQ-DL-
B8CDF2_THAPS/17-48.R----I-------------------F-N-H--I-------.D------------.AE...KE-Y..--E-VN.TQ-QF-
A2EWU3_TRIVA/26-55.Q----A-------------------F-N-L--F-------.D------------.TD...GA-G..--I-IK.AE-EI-
A2EWU3_TRIVA/99-128.R----A-------------------F-R-K--L-------.D------------.AD...GN-D..--A-IS.LQ-DL-
Q4PFY7_USTMA/49-78.E----A-------------------F-A-L--F-------.D------------.KK...GT-G..--T-IA.RE-SL-
B9S960_RICCO/440-471.S----L-------------------F-A-E--F-------.D------------.KD...DN-K..--K-MT.AR-EL-
D0N3P0_PHYIT/23-52.A----A-------------------F-D-M--F-------.D------------.KE...KK-G..--R-VI.QE-EV-
D0N3P0_PHYIT/102-131.A----A-------------------F-R-V--I-------.D------------.TE...KK-G..--Y-IE.AE-VM-
D0NIV0_PHYIT/360-387.E----V-------------------F-H-S--M-------.D------------.SN...KK-G..--S-LS.RD-EF-
C4R6X4_PICPG/24-55.Q----L-------------------F-E-R--L-------.D------------.IQ...HS-G..--A-IS.LS-GF-
B7PVC0_IXOSC/891-929.I----I-------------------F-D-M--C-------.D------------.KN...GN-G..--M-IQ.KQ-EL-
A2F2K1_TRIVA/16-45.K----A-------------------F-N-H--Y-------.S------------.RQ...NN-G..--I-LK.PE-DL-
A2F2K1_TRIVA/87-116.N----A-------------------F-K-I--F-------.D------------.KK...KQ-G..--K-LP.TA-TI-
B3MTC1_DROAN/109-140.T----A-------------------F-Q-L--F-------.D------------.RQ...GN-G..--T-VS.YA-DF-
B3DFQ1_DANRE/118-147.A----I-------------------Y-K-K--Y-------.D------------.AD...QS-G..--V-IG.SD-EL-
Q4DBB8_TRYCC/35-64.E----A-------------------F-D-L--F-------.D------------.SE...GT-G..--R-IK.AL-DV-
Q4DBB8_TRYCC/108-137.R----A-------------------F-R-L--I-------.D------------.VA...EK-G..--Y-IS.VD-DL-
B6AAA3_CRYMR/149-179.L----G-------------------F-R-L--L-------.D------------.RN...NS-E..--Y-IT.AL-EL-
B6KGE8_TOXGO/126-155.A----L-------------------F-N-E--I-------.D------------.VE...AK-G..--L-LD.PN-QI-
B6KGE8_TOXGO/199-230.E----A-------------------F-A-L--M-------.D------------.VD...SS-G..--I-VD.VA-RL-
B8CB62_THAPS/13-42.D----L-------------------F-K-I--I-------.D------------.LT...GD-G..--L-IS.LL-EL-
Q6CKI4_KLULA/78-107.K----A-------------------F-Q-V--F-------.D------------.KD...NT-G..--K-VS.PG-DI-
C5DMF9_LACTC/14-45.T----L-------------------F-S-T--I-------.D------------.IN...GT-G..--K-VS.LE-DL-
A8J3S1_CHLRE/300-329.D----A-------------------F-K-F--I-------.D------------.RD...AS-G..--A-LS.LE-EL-
A5DJ68_PICGU/64-95.Y----L-------------------F-R-V--F-------.D------------.VD...NS-K..--Y-ID.FK-EF-
A0CPY1_PARTE/103-143.V----I-------------------F-S-L--Y-------.D------------.FD...HN-K..--T-IT.RN-EL-
A8XS91_CAEBR/6-35.E----V-------------------F-A-Y--F-------.D------------.SK...GD-E..--R-IS.VQ-QV-
A2DQT8_TRIVA/13-42.N----A-------------------F-D-A--F-------.D------------.ED...RD-D..--M-IT.KD-VL-
A2DQT8_TRIVA/83-112.D----A-------------------F-R-V--F-------.D------------.KE...GT-G..--K-LP.KD-QV-
A0DCA4_PARTE/23-52.E----A-------------------F-V-A--F-------.D------------.KN...VS-G..--Y-IE.KD-EL-
Q5KN37_CRYNJ/88-117.K----G-------------------F-Q-V--F-------.D------------.KA...GN-G..--F-IG.AG-EL-
A0BDG8_PARTE/301-330.K----V-------------------F-N-K--Y-------.D------------.KS...GD-K..--S-LD.MK-EL-
Q66HU4_DANRE/630-659.E----I-------------------F-K-R--Y-------.D------------.FD...HN-D..--T-IS.SY-EM-
C5LCN0_PERM5/396-425.K----K-------------------F-M-A--V-------.D------------.RD...GD-G..--F-ID.AN-EL-
A9UUF1_MONBE/6-34.D----L-------------------F-R-E--L-------.D------------.N....GH-D..--K-IR.CK-DF-
C1EI49_MICSR/48-79.E----V-------------------F-K-T--Y-------.D------------.KD...GT-G..--T-LG.EN-QL-
B7PJB2_IXOSC/18-48.S----V-------------------F-R-S--V-------.V------------.RD...RT-T..--T-IT.AS-EL-
B3M2P5_DROAN/85-114.E----V-------------------F-S-L--F-------.D------------.TD...CD-G..--L-IS.KE-DL-
A8BSJ2_GIAIC/8-37.E----V-------------------F-E-T--F-------.D------------.TS...NT-G..--T-VD.MW-RI-
A8J2K6_CHLRE/48-77.E----V-------------------F-Q-L--F-------.D------------.TE...DK-G..--Y-FT.KD-DL-
A8XSA6_CAEBR/77-106.T----L-------------------L-S-H--F-------.D------------.RD...GN-G..--Q-IP.IV-EL-
CBPF_DICDI/13-45.K----F-------------------V-K-N--Y-------.D------------.LN...KD-G..--S-VT.SF-DI-
C8JQR9_CAEEL/144-173.E----M-------------------F-A-D--M-------.D------------.RN...HD-G..--L-VD.VV-EM-
Q6FSJ6_CANGA/19-48.D----A-------------------F-Q-L--I-------.D------------.ED...GD-G..--N-IG.RS-DM-
A0BKS7_PARTE/17-46.D----A-------------------F-E-A--Y-------.D------------.KM...GY-G..--T-LE.VE-EL-
Q4DSH4_TRYCC/48-77.Q----W-------------------F-R-A--V-------.S------------.SS...SG-G..--Y-IS.VP-QL-
Q4Y7U7_PLACH/93-122.S----L-------------------F-E-M--L-------.D------------.EN...KK-G..--F-IT.SK-DF-
A9U253_PHYPA/229-258.E----V-------------------F-T-D--M-------.D------------.SY...ND-G..--A-IS.FE-EL-
B0WB65_CULQU/256-285.E----F-------------------K-K-I--I-------.D------------.KN...KD-G..--K-AD.RG-EL-
A4I3F5_LEIIN/12-41.K----H-------------------F-D-L--F-------.D------------.RD...KI-G..--R-AR.NE-DF-
A4I3F5_LEIIN/85-114.E----A-------------------F-Q-G--F-------.D------------.PD...KR-G..--L-IT.PH-EL-
A0BU82_PARTE/29-57.R----R-------------------F-Q-R--M-------..------------.TN...GS-N..--F-LT.KN-QF-
Q755U9_ASHGO/14-45.Q----L-------------------F-R-R--L-------.D------------.LD...GT-G..--R-VD.LA-TL-
A8I1S7_CHLRE/186-215.K----L-------------------F-K-M--Y-------.D------------.ND...GS-G..--R-VH.FE-DF-
A4HZA9_LEIIN/84-113.A----A-------------------L-K-V--L-------.D------------.DD...AD-G..--Y-LT.TT-QL-
A0D306_PARTE/59-88.K----V-------------------F-Q-F--F-------.D------------.IS...ND-G..--R-ID.SH-EF-
Q4Q2P9_LEIMA/35-64.R----S-------------------L-G-I--A-------.D------------.DL...GS-T..--Q-VT.AE-EL-
A0E3G8_PARTE/176-205.K----I-------------------F-T-L--W-------.D------------.EE...GK-G..--K-VT.VK-NI-
A9V0G9_MONBE/68-97.S----A-------------------F-K-V--F-------.D------------.HQ...SD-N..--S-ID.VR-EL-
A7AQR4_BABBO/777-815.Q----K-------------------F-Q-D--Y-------.D------------.KV...GG-G..--L-LS.YN-DF-
A7AQR4_BABBO/875-908.Q----A-------------------F-H-S--Y-------.D------------.RS...HN-G..--S-IY.IH-EF-
A4HBM1_LEIBR/11-40.L----Q-------------------F-L-L--L-------.D------------.QD...SD-G..--F-IR.SH-EL-
A0CNQ7_PARTE/356-385.F----K-------------------F-E-E--F-------.D------------.RD...NS-G..--T-IS.VK-EM-
A0CNQ7_PARTE/435-464.G----L-------------------F-K-Q--F-------.D------------.ID...NK-N..--Y-IT.TM-DV-
B3L806_PLAKH/94-123.S----L-------------------F-D-L--L-------.D------------.TS...KR-G..--Y-IS.TR-SF-
C3Y3X5_BRAFL/109-138.E----C-------------------F-M-L--C-------.D------------.VD...HN-G..--F-LE.KS-DL-
C3Y3X5_BRAFL/178-207.E----A-------------------F-E-N--L-------.D------------.AA...GT-G..--.-IH.KD-GF-
C5E2K8_LACTC/5-34.D----I-------------------F-T-L--F-------.D------------.RQ...AK-G..--T-IS.KQ-QL-
D0NMF2_PHYIT/62-91.H----I-------------------F-C-Q--I-------.D------------.TD...NS-G..--I-ML.RS-EL-
B9RGV3_RICCO/45-74.S----L-------------------F-N-F--F-------.D------------.GA...NS-G..--F-ID.YT-QI-
A0DZF8_PARTE/406-435.K----L-------------------F-K-Q--F-------.D------------.TD...VN-Q..--V-LD.LV-EF-
D0NPC8_PHYIT/30-59.E----A-------------------F-A-R--V-------.D------------.TD...MD-G..--K-VN.AI-DI-
D3B753_POLPA/41-70.E----K-------------------F-M-L--Y-------.D------------.VN...NS-G..--D-ID.LY-EL-
A7RJ54_NEMVE/73-101.T----A-------------------F-D-V--F-------.D------------.SD...HK-E..--F-IE.SG-DI-
C3ZK54_BRAFL/145-176.R----R-------------------W-E-T--A-------.D------------.SD...DD-K..--H-LT.KE-EF-
Q23CU0_TETTS/69-99.Q----V-------------------F-D-L--Y-------.D------------.QT...GE-G..--Y-LN.PG-KI-
EFCB7_HUMAN/106-135.K----S-------------------F-K-Q--L-------.D------------.VN...DD-G..--C-IL.HT-DL-
Q4P615_USTMA/58-87.E----A-------------------F-N-M--I-------.D------------.AD...SD-G..--L-IT.TN-DV-
A0BMA1_PARTE/125-154.E----A-------------------F-N-F--L-------.D------------.MN...KD-G..--G-IT.SE-DL-
A7RI54_NEMVE/73-102.T----T-------------------F-M-Q--Y-------.D------------.SD...RS-G..--T-ME.PH-EL-
Q7RNY5_PLAYO/47-76.R----V-------------------F-K-M--M-------.D------------.KD...NT-G..--K-IS.AC-NL-
A8QGG8_BRUMA/91-120.A----A-------------------F-E-L--F-------.D------------.SD...FK-G..--Y-IT.VD-DL-
A0NGM4_ANOGA/720-749.A----V-------------------F-K-L--Y-------.D------------.TE...GS-G..--R-LS.PF-QL-
A0CQY7_PARTE/181-210.K----I-------------------F-N-S--W-------.D------------.ED...AN-G..--A-IS.VK-NL-
A2FZQ0_TRIVA/11-40.Q----S-------------------F-E-E--F-------.D------------.ND...KD-G..--F-IE.TS-MV-
A2FZQ0_TRIVA/82-111.K----A-------------------F-T-L--F-------.D------------.RD...GT-G..--K-VH.KD-VV-
PLSI_BOVIN/15-46.E----A-------------------F-N-K--I-------.D------------.ID...NS-G..--Y-VS.DY-EL-
A0BVC0_PARTE/355-384.F----I-------------------F-K-K--I-------.D------------.LN...NS-G..--I-IT.VQ-EL-
A0BVC0_PARTE/444-473.S----I-------------------F-K-Y--F-------.D------------.TR...NE-N..--H-LS.RE-AI-
A8J258_CHLRE/12-41.F----A-------------------F-E-T--L-------.D------------.AE...RT-G..--S-VS.RK-QL-
A8J258_CHLRE/85-114.R----A-------------------F-Q-L--F-------.D------------.VL...GQ-G..--A-ID.FV-TL-
A0BLQ1_PARTE/56-85.E----N-------------------F-Q-L--F-------.D------------.RD...GD-E..--R-IS.FT-EL-
A0BLQ1_PARTE/129-158.E----A-------------------F-K-S--V-------.D------------.LE...NT-G..--Y-IQ.SE-YF-
D3B3V9_POLPA/20-49.H----I-------------------F-D-H--F-------.D------------.KD...KD-G..--S-LS.RY-EL-
C6WP87_ACTMD/55-86.V----L-------------------A-D-H--L-------.D------------.VD...RD-G..--R-IT.LD-EF-
B0CEP3_ACAM1/69-106.F----A-------------------F-Q-L--H-------.D------------.GN...DD-G..--C-ID.KQ-EL-
B4JQZ6_DROGR/12-41.Q----I-------------------F-L-Q--F-------.D------------.QC...GD-C..--N-IS.HS-QL-
B4JQZ6_DROGR/95-124.S----G-------------------L-R-F--F-------.D------------.EH...KT-G..--Y-IS.AD-RL-
B3RJS5_TRIAD/515-551.E----I-------------------F-D-R--V-------..------------.AG...TD-E..--E-VD.AF-EL-
B3RJS5_TRIAD/588-617.D----N-------------------F-Q-K--F-------.D------------.TD...KS-G..--S-FS.SY-EL-
B4LWK2_DROVI/652-680.E----C-------------------F-Y-L--F-------..------------..A...RS-G..--Q-INNLD-EL-
B4LWK2_DROVI/720-749.A----A-------------------F-K-A--A-------.D------------.PQ...NK-G..--T-IS.AK-QL-
Q236L3_TETTS/181-210.K----I-------------------F-N-A--W-------.D------------.DN...CT-G..--A-ID.PK-NA-
A9UU69_MONBE/7-36.L----C-------------------F-E-L--F-------.D------------.KT...NS-G..--T-IT.AE-DA-
A9UU69_MONBE/73-102.D----A-------------------F-S-T--F-------.D------------.SH...SA-G..--Y-MS.LT-EL-
B3SAM3_TRIAD/385-414.D----F-------------------F-F-A--L-------.D------------.KD...KS-M..--S-IT.RD-EF-
D0N7S9_PHYIT/33-62.R----W-------------------F-D-S--L-------.D------------.AD...GS-G..--E-VG.LD-EL-
B4J628_DROGR/30-59.R----L-------------------F-D-S--I-------..------------.AG...KD-M..--E-VD.WM-EL-
C5DUR9_ZYGRC/19-48.D----A-------------------F-Q-T--I-------.D------------.DD...GD-G..--A-IS.QK-DL-
B8CFT6_THAPS/84-113.M----Y-------------------F-R-I--Y-------.D------------.HG...NK-G..--Y-ID.LQ-DL-
C3YER0_BRAFL/167-196.E----V-------------------F-D-L--F-------.D------------.RT...GG-G..--T-FD.AE-EL-
A8X3X6_CAEBR/106-135.K----V-------------------F-E-D--F-------.D------------.ED...FN-M..--A-LS.RD-EL-
A0BXL7_PARTE/42-71.K----I-------------------F-R-K--M-------.D------------.TM...GT-G..--Y-IS.QQ-NF-
A0BXL7_PARTE/114-145.Y----V-------------------F-Q-M--L-------.D------------.SD...HD-N..--F-IS.KK-DL-
A0DNH6_PARTE/2304-2334.E----V-------------------F-K-T--I-------.D------------.QD...YS-G..--S-VS.KD-EF-
A8XVF9_CAEBR/36-65.D----V-------------------F-K-M--F-------.D------------.ED...CD-G..--L-IE.TE-EI-
A0D1H3_PARTE/66-95.K----L-------------------F-E-F--F-------.D------------.VN...GD-R..--K-LQ.LD-DF-
A0D1H3_PARTE/181-210.N----F-------------------F-R-K--L-------.D------------.QK...QK-G..--Y-LV.FN-DF-
B7PU66_IXOSC/252-281.A----T-------------------W-R-K--L-------.N------------.VG...RN-G..--Y-LQ.VQ-EL-
A9UV27_MONBE/2126-2155.E----V-------------------F-E-K--L-------.D------------.ID...HD-R..--R-IE.RA-EF-
B4L3F1_DROMO/11-40.N----T-------------------F-A-I--L-------.D------------.VD...GS-G..--L-LT.AR-EL-
B3RIN1_TRIAD/205-233.E----L-------------------F-A-S--V-------.D------------.KD...KN-W..--Q-IS.AD-EM-
A5WWC4_DANRE/533-569.R----L-------------------F-S-Q--V-------..------------.AG...SD-S..--E-VS.VL-EL-
A5WWC4_DANRE/606-635.E----I-------------------F-K-H--R-------.D------------.TD...NS-G..--T-MS.SL-EM-
A0D218_PARTE/76-105.K----V-------------------F-Q-M--L-------.K------------.KK...DV-D..--Y-FD.AK-DI-
C5LZ40_PERM5/40-69.D----C-------------------F-A-L--L-------.D------------.QD...ED-G..--L-IG.PE-EL-
Q011E6_OSTTA/74-105.E----L-------------------F-D-A--L-------.D------------.SD...GG-G..--E-VE.FE-EF-
Q384M5_TRYB2/12-41.R----R-------------------F-D-A--F-------.D------------.HD...KI-G..--R-IP.LS-DL-
C1E207_MICSR/45-75.K----I-------------------F-K-A--W-------.D------------.KN...QD-K..--T-VD.LK-EL-
Q6FMX6_CANGA/187-217.Q----L-------------------F-H-N--H-------.D------------.VR...GK-E..--R-LT.AE-EL-
A7AP31_BABBO/33-62.D----A-------------------F-N-L--F-------.D------------.RD...GD-G..--H-LT.VF-EC-
A2ETB6_TRIVA/14-43.S----V-------------------F-K-E--L-------.D------------.TD...NT-G..--K-LE.IQ-LV-
Q6C7R0_YARLI/24-53.V----L-------------------F-E-V--A-------.D------------.RK...KT-G..--K-VT.EA-DW-
Q6C7R0_YARLI/130-160.Q----A-------------------F-G-H--Y-------.D------------.PN...GT-G..--F-ID.RL-QF-
A7EII8_SCLS1/126-155.S----A-------------------W-K-E--F-------.D------------.HS...LN-G..--S-IT.AA-QL-
B7Q3R8_IXOSC/111-140.K----A-------------------F-R-A--S-------.D------------.KS...GS-G..--Q-IS.GW-EL-
Q8SS75_ENCCU/23-52.E----A-------------------F-N-F--M-------.D------------.VN...SD-T..--F-VD.RG-DL-
Q8SS75_ENCCU/92-121.N----A-------------------L-K-E--F-------.D------------.DN...GD-G..--T-ID.EK-VL-
Q7RGT1_PLAYO/1340-1369.D----I-------------------F-L-K--T-------.D------------.TN...HN-G..--S-LS.HR-EI-
D0MWK2_PHYIT/425-454.P----F-------------------F-H-A--Y-------.D------------.KN...RD-H..--R-MD.AD-EL-
A0DI75_PARTE/65-94.R----I-------------------F-R-I--F-------.D------------.LS...SS-G..--K-IE.TL-EF-
Q00XI4_OSTTA/186-215.Q----L-------------------F-K-R--I-------.D------------.SL...DT-G..--Y-IS.QR-EV-
Q2R1L7_ORYSJ/123-154.Q----A-------------------F-L-V--F-------.D------------.ED...ND-G..--Y-ID.AL-DL-
C5LG68_PERM5/14-43.E----A-------------------F-S-M--F-------.D------------.RE...SE-G..--E-IP.VE-EL-
A2DMA5_TRIVA/14-43.N----A-------------------F-D-T--F-------.D------------.SN...SD-N..--C-LE.PN-EL-
C4QYA1_PICPG/220-250.N----R-------------------F-K-E--A-------.D------------.YR...RK-G..--F-LT.ES-EL-
C4QYA1_PICPG/287-316.E----V-------------------F-F-I--Y-------.D------------.RD...HS-Y..--S-IS.FN-EF-
A7SIU0_NEMVE/415-444.D----L-------------------F-R-R--L-------.D------------.KD...QS-M..--Q-VS.VR-EF-
A2EU49_TRIVA/304-333.T----M-------------------F-K-P--Y-------.D------------.RS...GN-G..--L-VP.KT-IF-
A8HPL4_CHLRE/259-288.Y----V-------------------F-S-C--Y-------.D------------.KN...ED-Y..--R-LE.LS-EV-
CPNS2_HUMAN/153-182.C----V-------------------Y-K-Q--Y-------.D------------.RD...HS-G..--S-LG.SS-QL-
Q4E300_TRYCC/191-222.E----A-------------------F-K-I--Y-------.D------------.PQ...GR-G..--V-VD.VE-VL-
D0MRM4_PHYIT/32-61.Q----Q-------------------F-T-D--F-------.D------------.TS...GD-G..--S-IA.AS-EL-
Q6DG81_DANRE/12-43.E----A-------------------F-G-K--V-------.D------------.LN...GN-G..--F-IC.DH-EL-
B4I7K3_DROSE/14-43.E----A-------------------F-C-I--F-------.D------------.TH...GD-K..--Y-ID.SR-NV-
C5DUA6_ZYGRC/18-49.K----L-------------------F-R-R--L-------.D------------.CE...DR-G..--Y-LD.FE-GL-
A0CDJ6_PARTE/157-186.Q----A-------------------F-Q-M--I-------.D------------.HY...QL-G..--Y-FT.AQ-HL-
A0CRT3_PARTE/42-71.D----M-------------------F-V-Y--F-------.D------------.KS...GN-K..--T-IQ.RE-DL-
A0CRT3_PARTE/115-144.N----A-------------------L-K-I--F-------.E------------.KN...KS-G..--Y-ID.VK-EI-
C5KE42_PERM5/17-46.A----T-------------------F-R-L--C-------.D------------.GD...GD-G..--H-IT.KK-EA-
A7RPN5_NEMVE/525-553.I----A-------------------F-E-M--Y-------.C------------.R....KD-Y..--K-IP.TK-AL-
A7RPN5_NEMVE/596-627.D----A-------------------F-H-V--F-------.D------------.RD...KM-G..--Y-FD.LD-KL-
C5KKB0_PERM5/33-64.E----Y-------------------F-N-K--Y-------.D------------.LS...RD-G..--C-LD.RD-EL-
A7RMQ1_NEMVE/11-40.D----A-------------------F-S-L--F-------.D------------.KT...GK-G..--Y-ID.AD-IV-
A7RMQ1_NEMVE/82-111.E----G-------------------L-R-A--F-------.D------------.NN...SD-G..--T-MS.SA-QL-
Q5CZ29_CRYPI/514-545.N----V-------------------F-Y-K--L-------.D------------.TR...QI-G..--K-IN.LY-DL-
Q2A943_DANRE/33-62.C----L-------------------F-D-K--Y-------.D------------.PE...NS-G..--F-IS.TE-RF-
A7S688_NEMVE/8-37.D----I-------------------F-D-L--Y-------.D------------.TT...GS-E..--K-ID.VG-YL-
A7S688_NEMVE/84-113.D----C-------------------F-K-H--F-------.D------------.RS...DS-G..--Y-IS.SS-ML-
D0NHY4_PHYIT/209-239.Q----L-------------------L-I-E--G-------.D------------.TD...ST-G..--F-VS.LE-QL-
Q4U8S4_THEAN/16-45.D----Q-------------------F-K-L--V-------.D------------.SD...GD-R..--L-IN.ED-EF-
C1FIV9_MICSR/85-114.R----A-------------------Y-N-S--L-------.G------------.LS...RS-G..--R-MT.QE-DV-
EFC13_HUMAN/456-485.N----F-------------------C-E-A--I-------.S------------.KL...QE-N..--Y-IA.AE-EL-
Q4SJD6_TETNG/29-56.K----R-------------------F-K-Q--L-------.S------------.HN....E-E..--T-LR.RE-HF-
E8RNE1_ASTEC/46-76.R----I-------------------F-A-E--F-------.D------------.RN...RD-G..--S-IT.ED-EA-
A0DCS1_PARTE/72-101.K----Y-------------------F-S-S--L-------.D------------.GD...GS-G..--A-IG.IE-EL-
Q9EMH8_AMEPV/24-53.Y----I-------------------F-D-L--I-------.N------------.TS...GN-G..--E-IT.AE-EL-
A0CH88_PARTE/390-419.R----V-------------------G-K-I--L-------.D------------.AD...HD-G..--M-LN.LT-EF-
A0CH88_PARTE/696-725.Y----R-------------------F-Q-L--Y-------.D------------.KS...HL-N..--A-LS.YQ-EW-
C4R1V0_PICPG/25-54.A----I-------------------F-E-I--M-------.D------------.QD...SD-G..--K-IS.IN-DL-
Q01A96_OSTTA/1800-1831.T----A-------------------F-E-M--F-------.D------------.TS...GN-G..--R-LQ.ES-DL-
Q01A96_OSTTA/2035-2064.D----A-------------------F-R-A--F-------.D------------.GE...HI-G..--R-LT.YE-AL-
A7SHW4_NEMVE/108-138.Y----A-------------------F-K-I--F-------.D------------.FD...GD-Q..--K-LG.PT-DL-
D0MWI5_PHYIT/661-691.D----R-------------------L-N-I--L-------.D------------.RD...SD-G..--V-LS.AE-EL-
C3YCK9_BRAFL/241-275.D----K-------------------F-D-E--Y-------.D------------.SD...QS-T..--Q-IT.VE-EY-
B3MPK2_DROAN/57-86.E----I-------------------F-L-M--H-------.D------------.HR...GD-N..--K-IS.II-DL-
A9RFM6_PHYPA/328-362.K----L-------------------F-G-H--F-------.D------------..D...GD-G..--L-LT.RA-EL-
Q01AN9_OSTTA/334-364.A----L-------------------F-S-E--W-------.D------------.TD...GS-G..--T-LS.ST-EL-
Q4Z5E3_PLABA/655-693.Q----K-------------------F-K-N--F-------.D------------.KF...GD-G..--Y-LD.YS-DF-
D2VTY7_NAEGR/97-134.Y----I-------------------F-E-Y--Y-------.D------------.GD...GS-G..--V-IE.RD-EL-
Q6BFU2_PARTE/195-224.R----V-------------------F-N-K--F-------.Q------------.K.....N-G..--F-IT.QN-EA-
Q5ZLW0_CHICK/14-43.E----A-------------------F-S-K--V-------.D------------.VS...GN-G..--F-ID.AN-DL-
B5Y4Q9_PHATC/8-42.D----A-------------------F-R-L--F-------.D------------.KE...NT-Q..--S-IL.LK-DV-
B5Y4Q9_PHATC/86-115.K----V-------------------F-D-L--F-------.D------------.EG...RK-G..--H-IN.VQ-DL-
B7QKE4_IXOSC/612-641.Q----K-------------------F-Q-A--I-------.D------------.KD...RK-G..--Y-IS.VV-DL-
Q0V5Q9_PHANO/214-243.E----C-------------------F-S-V--M-------.D------------.RD...ND-G..--H-VN.SA-DV-
Q4DIV1_TRYCC/166-195.E----A-------------------F-C-V--L-------.D------------.LS...RR-G..--Y-LE.AE-EM-
Q7Q4L8_ANOGA/103-139.H----A-------------------F-R-I--Y-------.D------------.FD...GD-D..--M-IG.RN-DL-
A8XE93_CAEBR/628-657.E----R-------------------F-N-Q--L-------.D------------.KD...RK-G..--H-IT.VN-DL-
A7RJ83_NEMVE/514-548.D----V-------------------F-H-Q--M-------..------------.AG...ED-G..--E-VD.QY-EL-
A7RJ83_NEMVE/585-614.N----H-------------------F-H-K--Y-------.D------------.RD...HS-G..--D-MN.AY-EL-
A4HWJ1_LEIIN/25-54.S----T-------------------W-N-L--F-------.D------------.ER...HT-G..--S-VS.HI-DL-
A2EBQ1_TRIVA/14-43.E----A-------------------F-D-T--F-------.D------------.KD...GD-G..--Y-IE.PD-LI-
A2EBQ1_TRIVA/84-113.D----A-------------------F-H-V--F-------.D------------.EK...ET-G..--Y-IP.TK-DI-
Q4D662_TRYCC/188-217.S----L-------------------F-M-V--F-------.D------------.TE...NK-G..--F-LT.RS-QL-
Q4D662_TRYCC/269-298.L----Q-------------------F-R-G--Y-------.D------------.LE...GR-G..--F-LD.WK-DF-
A0EFA3_PARTE/319-348.K----V-------------------F-L-E--M-------.D------------.QN...NN-G..--V-VE.YD-DF-
A9RGD0_PHYPA/476-506.Q----M-------------------F-T-L--F-------.D------------.RN...TD-G..--V-IS.MD-EF-
Q8SRF8_ENCCU/100-129.Y----L-------------------F-D-I--F-------.D------------.LN...GD-G..--R-LC.RN-VL-
B8BV66_THAPS/328-359.E----E-------------------F-E-K--L-------.D------------.EN...GN-G..--E-IS.LE-GF-
A7SIU1_NEMVE/364-393.D----L-------------------F-N-C--L-------.D------------.KD...KS-R..--S-VS.PE-EL-
D0NLH6_PHYIT/779-808.E----V-------------------F-D-H--F-------.D------------.LD...ND-G..--V-LA.RD-EF-
C1MVN8_MICPC/105-141.S----V-------------------F-D-K--C-------.D------------.AD...KN-G..--V-VS.LE-EL-
B5DN90_DROPS/53-82.L----L-------------------V-D-L--M-------.D------------.GD...SN-G..--M-VT.LT-EL-
A0BWN9_PARTE/584-613.D----L-------------------F-R-K--Y-------.D------------.KT...ES-Q..--S-LD.MK-EF-
A0DZH6_PARTE/32-61.R----L-------------------F-N-L--Y-------.C------------.NP...RT-R..--R-ID.LK-DV-
Q5CTT5_CRYPI/66-93.D----I-------------------V-S-K--Y-------.G------------.KR...KN-G..--Y-LT.QD-EF-
A0C693_PARTE/354-383.Q----K-------------------F-K-E--L-------.D------------.KD...ED-G..--F-IT.PQ-EL-
A7SZ62_NEMVE/480-509.D----L-------------------F-N-Q--F-------.D------------.KD...NS-L..--S-VT.RD-EF-
C1MZG1_MICPC/117-146.E----V-------------------F-R-L--L-------.D------------.DD...DS-G..--A-LD.AE-EL-
Q4DZ37_TRYCC/328-358.V----A-------------------F-R-K--I-------.D------------.ID...GY-G..--R-IT.RD-EV-
B3RKL5_TRIAD/438-467.D----L-------------------F-N-R--F-------.D------------.RD...NS-R..--T-VD.KR-EF-
A2Q7S2_ASPNC/15-46.A----L-------------------F-Q-Q--A-------.D------------.KS...GE-G..--K-LA.LP-EF-
C1E2H7_MICSR/61-97.K----L-------------------F-E-S--V-------.D------------.VD...GS-G..--G-VD.YL-EL-
A9SRE6_PHYPA/269-299.T----Q-------------------F-S-L--L-------.E------------.PN...KS-G..--R-IS.YD-NF-
C1FI51_MICSR/18-54.K----I-------------------F-D-Q--C-------.D------------.DD...KS-G..--T-VS.LD-EL-
B8MY97_ASPFN/34-63.E----A-------------------F-Q-V--L-------.D------------.RD...ND-G..--S-VN.KD-DV-
B3S580_TRIAD/58-91.H----Y-------------------F-K-L--H-------.D------------.TD...NN-G..--K-LD.GL-EI-
C5KSZ3_PERM5/370-399.R----V-------------------F-A-W--I-------.D------------.TK...KD-D..--I-LD.YE-EI-
D0N582_PHYIT/1409-1438.I----R-------------------L-A-R--L-------.D------------.ED...GS-G..--D-LD.QH-EW-
B7G8H4_PHATC/377-408.A----E-------------------F-A-R--I-------.D------------.KD...NG-G..--T-IE.KA-EL-
A0E9E9_PARTE/44-75.E----T-------------------F-H-L--I-------.D------------.RD...HS-N..--S-IE.LD-EL-
A7RMQ2_NEMVE/10-39.D----G-------------------F-M-L--F-------.D------------.QI...GD-G..--N-IN.YD-QI-
A7RMQ2_NEMVE/82-111.E----G-------------------L-K-V--F-------.D------------.RE...AN-G..--K-ID.SG-TF-
B6AAT1_CRYMR/92-121.N----A-------------------F-N-I--L-------.D------------.RS...GN-G..--K-VL.VS-DL-
Q1DGU0_AEDAE/85-114.R----I-------------------F-A-A--L-------.D------------.KG...AT-S..--Y-VT.ME-TW-
C4VC48_NOSCE/64-95.R----L-------------------F-N-T--I-------.N------------.IS...QS-N..--H-ID.FH-EL-
B4M210_DROVI/76-106.E----I-------------------F-D-K--H-------.D------------.SD...RD-G..--L-IN.TH-EL-
D0N398_PHYIT/276-305.E----V-------------------F-A-S--G-------.D------------.SE...NT-G..--L-LT.VA-EI-
Q4PE44_USTMA/739-769.A----K-------------------F-K-L--L-------.D------------.VN...RD-G..--K-LD.SK-DL-
EFCB9_HUMAN/28-56.E----Y-------------------F-H-I--L-------.D------------.VH...GK-N..--T-LN.DV-LF-
A4HY14_LEIIN/110-138.H----L-------------------F-R-G--Y-------.D------------.IN...NE-G..--V-IT.FK-KF-
A0BNY1_PARTE/42-71.A----V-------------------F-K-S--I-------.D------------.RD...KS-K..--F-LD.RS-EL-
A9RBC3_PHYPA/187-216.E----A-------------------F-D-L--I-------.D------------.TD...AS-G..--A-VD.SK-DL-
A8P593_BRUMA/121-151.Y----A-------------------F-R-I--Y-------.D------------.FD...GD-D..--Q-LG.HD-DL-
CEX1_CAEEL/29-68.R----I-------------------F-S-L--F-------FD------------.RN...AS-H..--Q-VD.WG-DF-
A7SPN7_NEMVE/582-611.K----V-------------------F-S-W--F-------.D------------.TQ...GR-G..--F-IT.VH-DL-
A4FU16_HUMAN/38-67.V----L-------------------F-D-Q--F-------.D------------.PG...NT-G..--Y-IS.TG-KF-
C3YAW3_BRAFL/215-244.D----F-------------------F-M-R--F-------.D------------.KN...KQ-W..--L-VS.RE-DF-
D2V6N0_NAEGR/12-41.H----S-------------------F-S-L--L-------.D------------.TD...RK-G..--F-VT.ID-DI-
D2V6N0_NAEGR/215-245.E----L-------------------F-S-I--F-------ED------------.VN...DK-G..--Y-IT.KA-SL-
Q5CUC1_CRYPI/325-356.R----F-------------------F-N-A--L-------.D------------.ED...GN-G..--Q-IN.QD-EL-
D2VL69_NAEGR/86-115.R----A-------------------F-E-I--L-------.D------------.PE...RN-G..--L-IP.SE-KL-
B8BVX2_THAPS/190-219.S----A-------------------F-Q-K--N-------.D------------.AN...GD-G..--I-LE.QF-EF-
A2FS38_TRIVA/86-115.E----L-------------------F-E-T--I-------.D------------.AG...HD-N..--F-ID.PQ-DV-
A9V750_MONBE/19-48.S----E-------------------F-A-R--T-------.D------------.KD...GS-G..--D-ID.LQ-EI-
C5LX97_PERM5/270-303.E----V-------------------F-D-A--M-------.D------------.VD...GS-G..--T-LT.EN-EF-
A2FHL4_TRIVA/83-112.I----I-------------------F-R-S--F-------.D------------.KD...RN-G..--A-LT.TD-SV-
A9FD96_SORC5/187-216.R----R-------------------F-E-E--I-------.D------------.RD...HD-R..--K-LS.ED-EL-
Q6BG59_PARTE/363-394.S----V-------------------F-R-S--L-------.D------------.LD...ND-G..--Y-FS.IS-EL-
A0DQE8_PARTE/49-78.K----I-------------------F-I-N--F-------.D------------.RD...KS-K..--N-ID.IS-EM-
A2DGG1_TRIVA/1002-1031.E----T-------------------F-N-H--F-------.D------------.KD...HT-N..--F-LQ.YF-EL-
A8IAC5_CHLRE/27-56.K----W-------------------F-E-L--V-------.D------------.DD...GS-R..--T-LS.HS-EL-
C3YFC2_BRAFL/86-117.D----V-------------------F-R-R--F-------.D------------.KK...QN-M..--V-IT.VE-EF-
A9VC94_MONBE/198-229.V----I-------------------F-R-R--A-------.E------------.TK...GN-G..--L-LE.PW-EY-
C5KSU3_PERM5/80-110.E----A-------------------F-K-L--Y-------.D------------.PN...DT-G..--Y-VD.MK-TV-
C5L8H3_PERM5/62-92.R----W-------------------F-N-T--Y-------.D------------.VN...KD-G..--Y-LN.FT-EL-
Q01DB0_OSTTA/332-361.S----V-------------------F-D-K--F-------.D------------.TS...QN-G..--V-LE.LD-EL-
Q4UF53_THEAN/443-471.R----S-------------------F-F-S--I-------.N------------.TS...KS-G..--T-IS.FS-EF-
A8XPA0_CAEBR/61-90.K----I-------------------F-Q-L--M-------.D------------.DD...GS-G..--T-IS.SS-EV-
A2FQM2_TRIVA/14-43.N----Y-------------------F-T-D--F-------.D------------.DD...GD-G..--E-IE.VQ-CV-
A7RTI1_NEMVE/216-246.M----Q-------------------F-K-V--F-------.D------------.TN...DD-F..--H-LD.TQ-EL-
C5LI98_PERM5/493-523.E----T-------------------F-I-T--L-------.D------------.KD...NS-G..--G-LS.PQ-EI-
B6AJS6_CRYMR/55-84.N----L-------------------I-K-L--I-------.D------------.KD...SN-N..--I-LD.ES-EI-
A0D0W9_PARTE/274-302.E----L-------------------I-K-L--Y-------.Q------------.TN.....-...--E-LR.FE-NA-
A2E466_TRIVA/79-108.S----A-------------------F-K-V--F-------.D------------.RD...GT-G..--K-IK.QA-TA-
C1N3J2_MICPC/18-47.L----A-------------------F-D-H--L-------.D------------.LD...GS-G..--D-LA.RH-EV-
D2VIE2_NAEGR/8-38.E----I-------------------F-E-L--Y-------.D------------.TD...RK-G..--Y-LT.KI-EY-
Q7QIB4_ANOGA/279-317.F----M-------------------F-R-L--Y-------.D------------.TD...GN-G..--V-LD.TT-ET-
Q8T5H8_ANOGA/12-41.F----V-------------------F-S-V--Y-------.D------------.WE...GS-G..--Q-MD.AM-DL-
D0N994_PHYIT/33-63.E----T-------------------F-K-G--L-------.A------------.NG...KD-G.I--S-VD.KE-TF-
C1MU07_MICPC/540-583.A----L-------------------F-R-A--L-------.D------------.KS...GD-G..--F-VT.IR-EL-
B0XJB8_CULQU/36-75.D----V-------------------W-S-H--Y-------.D------------.GD...GN-G..--Y-IE.GT-EL-
A8J3A0_CHLRE/99-128.R----A-------------------F-R-A--F-------.D------------.PD...GR-G..--F-ID.AE-SF-
D0MVE6_PHYIT/210-253.S----A-------------------Y-L-L--F-------.D------------.ND...AS-G..--T-IQ.TS-EV-
Q5CPW8_CRYPI/89-118.N----I-------------------F-S-C--L-------.D------------.IK...KT-G..--T-ID.LE-DL-
Q6NYK0_DANRE/29-57.S----R-------------------F-Q-Y--L-------.T------------.QD...ED-...--T-LR.RE-HL-
D4AID5_ARTBC/715-746.R----L-------------------F-R-K--W-------.D------------.VD...GN-G..--G-LS.LQ-NV-
O97201_LEIMA/270-300.G----I-------------------F-M-M--F-------.D------------.G....GT-G..--R-LS.RG-RL-
B3M0N0_DROAN/117-151.L----L-------------------F-N-M--F-------.D------------.HN...KD-G..--R-IT.KV-DL-
A9UXC0_MONBE/17-46.Q----V-------------------F-D-A--I-------.D------------.HE...QD-G..--D-LQ.AS-EI-
A2F622_TRIVA/94-129.D----A-------------------Y-K-K--L-------.D------------.TD...GD-D..--V-VD.ID-EL-
CAN11_RAT/548-584.E----L-------------------F-E-T--L-------..------------.AN...RD-S..--Q-VD.MY-DL-
B4QEJ5_DROSI/103-132.Q----A-------------------F-K-I--L-------.D------------.PE...NK-G..--Y-LT.KE-SF-
A8JI98_CHLRE/149-179.S----A-------------------F-Q-Q--Y-------.D------------.SS...GD-G..--Y-LD.VG-EL-
D3ZRP1_RAT/120-151.K----Y-------------------F-Q-R--L-------.D------------.KE...GN-G..--L-LE.KT-DF-
B4MVV8_DROWI/30-59.R----I-------------------F-L-T--H-------.A------------.MR...SD-K..--K-IS.TA-QL-
C4IYW7_MAIZE/57-84.T----I-------------------F-E-Q--F-------.D------------.SN.....-G..--E-ID.KE-EL-
A2FJN7_TRIVA/18-47.D----A-------------------F-N-I--F-------.D------------.RN...SH-V..--K-VS.EN-EL-
B6AIK9_CRYMR/17-46.E----T-------------------F-N-L--A-------.D------------.DD...SD-G..--K-IT.FD-QA-
A9UQV7_MONBE/115-144.K----S-------------------F-S-E--A-------.D------------.IN...SD-G..--L-ID.VA-EL-
A9SXN2_PHYPA/278-307.A----L-------------------F-P-I--F-------.D------------.DR...GR-G..--R-LT.VN-DL-
Q4YSX9_PLABA/63-94.I----S-------------------F-K-Q--L-------.D------------.KN...NN-N..--F-VD.FN-EF-
B9R7E2_RICCO/18-47.N----W-------------------L-K-G--F-------.D------------.TD...QD-G..--K-IS.RV-EL-
A0E9R2_PARTE/21-50.E----T-------------------F-N-L--F-------.A------------.QD...KK-G..--Y-VD.KK-EI-
Q5KK44_CRYNJ/681-710.T----Q-------------------F-E-R--F-------.D------------.FD...HD-Q..--R-IT.RA-DL-
D0N6S6_PHYIT/203-232.Q----L-------------------F-R-M--F-------.D------------.QD...KS-D..--S-ID.FE-EY-
Q4Q156_LEIMA/33-65.D----L-------------------F-D-S--L-------.D------------.VD...HS-G..--T-VS.VE-VV-
A7RPN6_NEMVE/2-31.D----A-------------------F-S-V--Y-------.N------------.KD...GS-D..--N-IK.TT-LV-
A4H5I7_LEIBR/177-206.V----V-------------------F-S-E--F-------.D------------.NK...GT-R..--M-ID.VD-DF-
C1ECT5_MICSR/271-300.E----I-------------------F-D-R--F-------.D------------.VD...ED-E..--H-VT.EP-EL-
A9V6X3_MONBE/1141-1170.A----I-------------------F-K-T--Y-------.D------------.KD...NS-G..--N-IN.EK-EM-
C3ZP66_BRAFL/54-83.K----T-------------------F-M-E--M-------.D------------.EN...NN-G..--E-LG.MM-EV-
C0H4A2_PLAF7/13-41.S----I-------------------F-K-E--Y-------.D------------.TN...KD-G..--.-VS.GE-KL-
A9VBY6_MONBE/239-268.D----M-------------------F-N-Q--S-------.D------------.LN...ND-K..--Q-LN.LE-EI-
D2UXJ1_NAEGR/416-444.A----V-------------------F-G-Y--I-------.D------------GQT...KD-N..--V-LD.IH-EF-
B4MM19_DROWI/36-65.K----S-------------------F-D-I--Y-------.D------------.FQ...QV-G..--S-IE.VN-KM-
Q4DRI4_TRYCC/49-79.E----L-------------------F-K-K--F-------.D------------.KN...ET-G..--K-LC.YD-EV-
B3S1G2_TRIAD/152-183.Y----A-------------------F-R-V--Y-------.D------------.FN...DD-D..--L-ID.IA-DL-
CIB4_MOUSE/101-132.Y----A-------------------F-R-I--Y-------.D------------.FN...EN-G..--F-ID.EE-DL-
C1EBS6_MICSR/387-416.R----A-------------------F-A-T--Y-------.D------------.RD...ED-G..--K-MA.RG-EF-
B4N916_DROWI/114-145.F----A-------------------F-E-V--Y-------.N------------.TK...GT-G..--Y-ID.RE-QV-
Q8IE29_PLAF7/251-282.M----V-------------------F-K-K--L-------.D------------.IN...KN-K..--Y-ID.YI-EF-
CAN8_MOUSE/536-572.S----L-------------------S-E-E--F-------..------------.AD...KD-S..--E-IS.AH-QL-
A0BF71_PARTE/385-419.E----I-------------------F-N-G--L-------.D------------.LD...KN-G..--R-LT.KP-EL-
B0WSM1_CULQU/659-688.A----V-------------------F-N-L--Y-------.D------------.LD...AS-G..--H-LD.RK-EL-
Q32KM4_BOVIN/68-99.R----V-------------------F-F-A--F-------.D------------.KD...ND-N..--Y-IN.VK-EW-
D2V5I4_NAEGR/35-64.M----I-------------------Y-Y-Q--Y-------.D------------.KD...HS-G..--T-LN.KK-EF-
CAN11_MOUSE/547-583.Q----L-------------------F-K-I--M-------..------------.AN...ED-G..--E-VD.MY-AL-
A7RK77_NEMVE/68-97.D----T-------------------F-N-E--W-------.D------------.TN...SD-G..--F-ID.ID-EF-
A0C4R5_PARTE/23-53.S----T-------------------F-D-S--I-------.D------------.SN...KN-G..--T-IE.LN-EL-
Q4QBQ5_LEIMA/330-359.Q----L-------------------F-H-W--V-------.D------------.LN...GN-N..--F-IG.YA-EF-
B4LJI0_DROVI/124-155.F----V-------------------F-S-I--Y-------.D------------.EN...DR-G..--Y-LE.RE-DV-
C3YQL6_BRAFL/328-359.T----A-------------------L-R-E--S-------.N------------.LD...KN-D..--T-ID.KT-EL-
A0C1C8_PARTE/336-372.H----I-------------------F-N-N--I-------.Q------------.KA...NN-Q..--Y-LT.LQ-EF-
D0NH53_PHYIT/26-55.V----I-------------------F-R-Y--F-------.D------------.TD...GD-G..--A-VS.AD-QA-
RFIP3_DANRE/710-739.A----V-------------------F-Q-A--L-------.D------------.QD...GD-G..--F-VH.IE-EF-
A0DZK5_PARTE/70-97.E----E-------------------F-L-S--Y-------.D------------.LD...ED-G..--I-LR.ID-EL-
EFCB3_BOVIN/51-80.D----A-------------------Y-N-F--F-------.N------------.KD...KT-G..--C-ID.LH-GM-
C1EDZ9_MICSR/29-59.D----L-------------------F-N-R--L-------.D------------.RD...RD-G..--R-IT.VY-EL-
C1N631_MICPC/47-78.R----L-------------------F-S-E--F-------.D------------.VD...ES-G..--G-LG.RE-QT-
C1MXG3_MICPC/631-660.A----V-------------------F-D-E--F-------.D------------.ED...GS-G..--T-LT.IE-EL-
Q6DFZ8_DANRE/606-635.D----V-------------------Y-S-K--N-------.D------------.KD...QS-G..--T-MS.SM-EM-
C5LJH8_PERM5/404-433.E----A-------------------F-R-S--F-------.D------------.RD...GR-G..--K-LD.AA-DL-
B9RD69_RICCO/210-239.L----H-------------------F-F-Q--F-------.D------------.EE...GS-G..--L-LT.VR-DL-
Q4DDH8_TRYCC/10-40.D----V-------------------F-N-V--F-------.D------------.EE...GT-G..--S-IS.MQ-EL-
A0CSU8_PARTE/30-61.P----I-------------------M-H-R--L-------.D------------.SN...NQ-G..--H-IT.SY-DI-
C5KYQ1_PERM5/23-54.E----V-------------------F-K-E--A-------.D------------.KE...GR-G..--W-IS.EE-EF-
A2CE70_DANRE/30-58.S----R-------------------F-H-S--L-------.D------------.KG...EN-G..--G-LS.RE-DF-
C5L8Y2_PERM5/254-290.M----L-------------------F-E-E--L-------.D------------.ED...GS-G..--E-LS.SQ-EF-
A7SHJ6_NEMVE/330-359.E----M-------------------F-S-R--Y-------.D------------.PE...NT-G..--K-VS.KH-EL-
A0C9U0_PARTE/401-432.E----L-------------------F-E-Q--F-------.A------------.TT...KQ-D..--T-LE.RH-QF-
A9RZV6_PHYPA/322-351.A----A-------------------Y-D-A--C-------.N------------.LQ...NS-D..--C-IS.QL-EL-
A0CIN3_PARTE/412-441.G----I-------------------F-D-I--I-------.D------------.SR...CS-G..--F-LD.WS-QF-
A7RLF8_NEMVE/106-135.A----F-------------------F-D-V--L-------.D------------.ED...NL-G..--Y-VT.QD-EL-
C3ZDD3_BRAFL/389-419.Q----H-------------------F-K-Q--Y-------.D------------.RN...ND-F..--H-LD.LA-EV-
A8X343_CAEBR/192-230.V----V-------------------F-H-V--Y-------.D------------.SD...GN-G..--F-LD.KS-EI-
C5L7A7_PERM5/27-55.K----D-------------------F-D-G--F-------.D------------.QD...AD-G..--V-ID.AQ-EI-
B3RJJ4_TRIAD/113-142.K----K-------------------F-M-E--A-------.D------------.KD...GN-G..--E-ID.EK-EL-
A7T7P5_NEMVE/35-64.E----A-------------------F-R-T--F-------.D------------.GD...DK-G..--Y-IF.SN-EI-
A8IMX5_CHLRE/147-180.K----S-------------------F-M-F--F-------.D------------.SS...AD-G..--C-IE.RK-EL-
Q8STQ3_ENCCU/76-105.N----S-------------------F-R-R--L-------.D------------.VD...NT-S..--Y-ID.AG-RL-
Q6FSU4_CANGA/603-632.R----L-------------------F-N-R--W-------.D------------.SA...KV-G..--E-LT.LN-DV-
D0NT24_PHYIT/227-256.A----I-------------------F-N-L--F-------.D------------.VQ...GN-G..--C-IS.ED-DL-
Q5ZJB5_CHICK/68-103LH----Y-------------------F-K-M--H-------.D------------.YD...GN-N..--L-LD.GL-EL-
Q4CS95_TRYCC/33-65.E----L-------------------F-D-S--L-------.D------------.TE...HN-G..--Y-LA.IE-DV-
Q00WG8_OSTTA/33-61.A----R-------------------F-R-S--L-------.D------------.KR...HK-G..--F-LT.ED-EL-
RASEF_XENTR/9-38.A----L-------------------F-H-T--F-------.D------------.SK...SS-G..--R-LE.KG-QF-
Q6TXM2_STRPU/582-611.E----A-------------------F-L-Q--Y-------.D------------.RD...RS-G..--N-ID.VN-EL-
D2VGQ0_NAEGR/231-261.E----I-------------------F-N-L--L-------.D------------.AN...QS-G..--T-IG.KA-EI-
D0MVJ8_PHYIT/2641-2670.D----L-------------------F-E-L--L-------.D------------.DA...GS-G..--E-LS.RE-RT-
A9V7D4_MONBE/231-262.R----W-------------------F-H-L--L-------.D------------.SD...GN-G..--D-LS.FR-EL-
C5LFC0_PERM5/84-113.G----A-------------------F-Q-T--L-------.D------------.PS...RT-G..--V-MA.GD-IL-
Q01DN6_OSTTA/94-123.R----R-------------------F-D-D--L-------.D------------.RA...RT-G..--R-VT.TD-DL-
B7G332_PHATC/130-165.C----A-------------------G-K-H--L-------.D------------.HN...KN-G..--K-LD.RD-EL-
B3S581_TRIAD/59-96.H----F-------------------F-K-L--H-------.D------------.YD...DN-S..--K-LD.GL-EI-
Q4XYU2_PLACH/524-554.E----I-------------------F-K-H--L-------.D------------.ND...KD-S..--Y-IT.KE-DL-
B0CNF8_LACBS/51-83.S----F-------------------F-Q-L--H-------.D------------.LD...RN-G..--F-WD.RD-EI-
A0E1J3_PARTE/38-73.R----L-------------------F-D-T--Y-------.D------------.RD...RN-G..--Q-ID.NV-EV-
D3BGC9_POLPA/56-86.E----I-------------------F-S-R--Y-------.D------------.AD...ND-G..--M-LT.ID-EL-
C1N8S9_MICPC/55-85.R----L-------------------F-A-A--V-------.D------------.GD...DD-G..--S-VD.VI-EL-
B3RSL0_TRIAD/112-148.Y----A-------------------F-R-I--Y-------.D------------.YN...DS-N..--Y-LE.DD-DL-
C1MSB0_MICPC/627-658.Y----A-------------------F-V-V--L-------.D------------.AD...RD-G..--R-VH.VD-EL-
C3YY99_BRAFL/15-44.R----C-------------------F-D-M--L-------.D------------.KD...KD-G..--F-LL.SR-EL-
B8C8A3_THAPS/287-317.K----K-------------------F-A-I--A-------.D------------.KS...NC-G..--S-LS.IE-EF-
D7AV60_NOCDD/14-45.D----L-------------------F-T-R--L-------.D------------.TD...QD-G..--S-IN.IH-EW-
Q94LH2_ORYSJ/29-58.K----W-------------------F-M-K--F-------.N------------.TN...ND-G..--R-IS.GV-EL-
A8Q891_MALGO/17-46.R----V-------------------F-Y-A--L-------.D------------.KN...AN-G..--R-VS.DS-DV-
C5LPQ5_PERM5/9-38.R----M-------------------F-D-L--F-------.D------------.TD...GS-G..--I-IE.LR-KF-
A8IJ90_CHLRE/3-32.S----A-------------------F-N-A--L-------.D------------.AD...GS-S..--T-VT.TD-EL-
B7G8B5_PHATC/86-115.S----T-------------------F-D-L--I-------.D------------.SG...GK-G..--Y-LT.KD-DV-
A4I9Q9_LEIIN/181-211.E----A-------------------F-R-I--Y-------.D------------.PH...NT-H..--Y-VE.EE-VL-
C5LIS6_PERM5/226-255.Y----V-------------------F-L-L--L-------.D------------.TD...NT-G..--Y-IK.VD-DL-
C6KTA8_PLAF7/77-106.D----I-------------------F-H-F--Y-------.D------------.TN...KT-G..--K-IS.KE-KL-
A0CSB1_PARTE/153-182.L----L-------------------F-D-F--F-------.D------------.SK...KN-G..--T-ID.YN-EF-
B9PLU7_TOXGO/4-33.S----I-------------------F-K-V--F-------.D------------.SD...GD-G..--K-LT.CI-EM-
Q4DPM5_TRYCC/184-213.T----V-------------------F-D-A--L-------.D------------.AQ...QK-G..--Y-LL.FT-DL-
B8LD33_THAPS/828-857.A----V-------------------F-D-K--I-------.D------------.SD...GG-G..--E-ID.KD-EM-
C1MUU0_MICPC/12-42.L----K-------------------F-D-A--A-------.D------------.ED...GS-D..--G-IE.MD-EF-
C3YUG8_BRAFL/425-454.R----V-------------------F-G-E--H-------.D------------.VD...KD-T..--K-LS.QE-EA-
Q4U8G1_THEAN/76-105.E----L-------------------F-R-F--Y-------.D------------.PN...NT-G..--R-IS.KK-QL-
A7SXZ3_NEMVE/9-37.D----V-------------------F-R-R--A-------.D------------.KN...DD-G..--A-LS.WE-EF-
Q8IJ97_PLAF7/12-41.K----N-------------------F-N-L--I-------.D------------.NN...ND-K..--K-IS.PE-EF-
A0BF28_PARTE/345-376.A----S-------------------F-I-S--L-------.D------------.SN...DV-G..--Y-LT.ES-QF-
Q4E2K6_TRYCC/617-646.S----I-------------------F-C-R--H-------.D------------.AD...RN-G..--I-VN.AQ-EF-
Q4E1U1_TRYCC/7-40.Q----I-------------------F-D-L--Y-------.D------------.TD...RA-G..--W-IP.TK-RI-
A0C5R3_PARTE/309-338.Q----A-------------------F-Q-F--F-------.D------------.LD...VD-G..--S-IG.LQ-DL-
A0ED28_PARTE/72-103.D----C-------------------F-N-F--Y-------.D------------.PQ...KS-G..--Y-IN.RQ-NL-
D2VR29_NAEGR/607-636.K----L-------------------F-R-E--I-------.D------------.IN...RD-G..--I-LN.QV-EI-
B8BSH1_THAPS/111-142.K----A-------------------F-R-L--L-------.D------------.HD...GT-N..--S-IS.RD-SI-
Q5KAJ1_CRYNJ/665-697.R----M-------------------F-F-A--W-------.D------------.TQ...GQ-G..--S-LS.LQ-DV-
C3YDH3_BRAFL/26-58WH----F-------------------F-K-S--H-------.D------------.SD...KN-M..--K-LD.GL-EI-
B3S2Z7_TRIAD/64-96.Y----Y-------------------F-K-L--H-------.D------------.TN...KD-N..--K-LD.GL-EI-
Q5CKJ4_CRYHO/151-180.S----Y-------------------F-R-K--Y-------.D------------.LR...GN-G..--K-IS.RQ-QF-
A2DPY5_TRIVA/83-112.R----A-------------------F-Q-F--F-------.D------------.KT...KS-G..--L-IS.FD-TA-
C5KLK8_PERM5/99-128.Q----K-------------------F-D-R--H-------.D------------.VE...GS-G..--R-IR.VS-QL-
A0D7T4_PARTE/77-106.L----L-------------------F-E-K--F-------.D------------.ND...GS-K..--A-LD.FI-EV-
A0DSQ2_PARTE/47-76.Q----F-------------------Y-A-F--F-------.D------------.TF...NQ-R..--K-IT.RL-DF-
C1FHF3_MICSR/35-68.A----A-------------------F-I-A--G-------.D------------.TD...RN-G..--V-LD.AQ-EL-
A0BCE1_PARTE/120-149.S----A-------------------F-S-V--F-------.D------------.FD...KN-G..--T-ID.SK-KI-
B7FPG8_PHATC/98-128.R----A-------------------F-D-L--L-------.D------------.EA...GK-G..--M-IV.LE-DL-
C3XQZ6_BRAFL/437-468.D----F-------------------F-K-S--F-------.D------------.KE...GD-L..--L-VT.VE-EF-
Q22DM3_TETTS/41-68.E----K-------------------F-R-L--L-------..------------.SD...NK-P..--T-LT.LN-GF-
C7YTC4_NECH7/525-554.A----M-------------------L-R-Q--Y-------.D------------.AD...ES-G..--Q-IS.RI-EL-
D3BH77_POLPA/977-1008.A----C-------------------L-A-N--C-------.D------------.LN...RD-N..--N-ID.KN-EL-
B7PAY1_IXOSC/102-130.N----A-------------------F-S-M--F-------.D------------.Q....GN-G..--F-CT.EE-RL-
A8WRH5_CAEBR/109-138.L----V-------------------F-R-N--I-------.D------------.QA...RN-G..--S-VT.FL-DF-
C5KU24_PERM5/19-48.S----V-------------------F-Y-L--F-------.D------------.AD...AD-G..--R-LT.SD-EF-
CAN11_HUMAN/571-609.H----L-------------------F-K-I--V-------.A------------.GE....G-K..--E-IG.VY-EL-
D0MUI2_PHYIT/445-475.L----M-------------------F-S-L--M-------.D------------.TD...GS-L..--E-LS.ST-KV-
A0BTT3_PARTE/62-91.Q----I-------------------F-N-V--F-------.D------------.YN...DS-K..--T-LD.IA-EM-
A0DVD9_PARTE/23-52.G----A-------------------F-S-D--L-------.D------------.VN...NS-G..--E-IE.ID-DL-
C3ZDD2_BRAFL/477-508.D----M-------------------F-V-K--Y-------.D------------.KS...RD-F..--N-LD.MG-EL-
B8BTK8_THAPS/174-205.D----E-------------------F-K-Q--P-------.D------------.VD...GD-D..--R-IS.RT-EF-
B8CFD8_THAPS/313-348.M----E-------------------F-E-K--Y-------.D------------.KE...GT-G..--E-IT.LD-TL-
A2AB62_MOUSE/109-138.D----I-------------------F-K-L--F-------.S------------.CS...PT-G..--T-VD.MQ-SM-
C3Y3L2_BRAFL/18-48.N----I-------------------F-S-L--C-------.D------------.VD...EK-G..--F-IT.MR-DL-
A0EAZ9_PARTE/45-80.R----I-------------------F-K-M--L-------.D------------.SE...NN-G..--F-IT.EK-HF-
C5LYE4_PERM5/81-110.E----A-------------------F-R-V--L-------.D------------.VT...GS-G..--K-VS.VK-DI-
D3BHC5_POLPA/246-276.S----I-------------------F-D-R--F-------.D------------.LN...KD-N..--S-LS.VK-EL-
CDPKP_ARATH/437-466.E----T-------------------F-K-T--I-------.D------------.SG...KS-G..--R-VT.YK-EL-
B9R7D2_RICCO/19-48.G----L-------------------L-K-R--Y-------.D------------.SN...GD-G..--K-LS.RK-DL-
B3RQP5_TRIAD/251-279.K----V-------------------L-A-E--S-------.N------------.ID...ED-A..--I-ID.KT-EL-
C3YEV6_BRAFL/628-656.K----R-------------------F-N-K--V-------..------------.AG...AK-G..--F-IT.HV-DL-
A1CBB6_ASPCL/49-87SS----F-------------------F-G-L--H-------.D------------.FD...AS-G..--A-WT.PD-EV-
C3Z5Z5_BRAFL/533-562.K----A-------------------L-A-A--A-------.D------------.VN...RD-K..--Q-VD.FE-EW-
D0NH29_PHYIT/57-87.K----L-------------------F-S-L--F-------.N------------.PG...ED-G..--M-VS.YE-GF-
B7XIJ8_ENTBH/72-101.E----A-------------------F-K-I--L-------.D------------.TE...NT-G..--Y-VK.AK-DL-
A0DMG4_PARTE/351-381.M----K-------------------F-E-E--L-------.D------------.RD...NS-G..--T-IN.EV-EF-
C3YV00_BRAFL/85-114.R----G-------------------F-G-D--H-------.D------------.TD...QD-M..--K-LS.KQ-EA-
B7FUB0_PHATC/1084-1115.G----I-------------------F-D-A--F-------.D------------.RL...GS-G..--T-PS.AV-EI-
C3ZH49_BRAFL/1174-1204.T----I-------------------L-K-A--Q-------.N------------.KD...HT-S..--T-VS.RE-EL-
A7RK79_NEMVE/188-218.E----T-------------------Y-R-E--W-------.D------------.YD...GD-G..--V-IS.VT-EI-
B3S1A6_TRIAD/67-96..----A-------------------F-A-I--Y-------.D------------.FD...GD-N..--S-IG.RS-DL-
Q29IA0_DROPS/39-68.E----I-------------------Y-N-M--F-------.D------------.PS...NS-T..--G-IS.EA-DL-
A4S9A6_OSTLU/2128-2162.H----D-------------------F-D-E--T-------.D------------.TD...GS-G..--G-ID.KS-EL-
A0CCU0_PARTE/82-111.M----I-------------------F-Q-I--M-------.D------------.TT...NS-G..--K-IS.KD-EL-
B7Q350_IXOSC/1399-1442NT----F-------------------F-A-M--H-------.D------------.LN...GD-G..--Q-LD.QD-EI-
C1MT69_MICPC/45-75.S----F-------------------F-R-A--L-------.D------------.KD...DD-G..--Q-IE.RA-EL-
A9URG6_MONBE/582-611.D----V-------------------L-N-R--I-------.D------------.ST...RE-G..--K-LT.RK-DM-
B7PQS4_IXOSC/34-61.E----L-------------------F-T-L--C-------.D------------.KE...DK-G..--F-IN.KR-DM-
A0BSR5_PARTE/180-209.Q----C-------------------F-R-Q--I-------.D------------.KD...DM-G..--V-IS.YE-EG-
A0BM15_PARTE/63-92.Q----I-------------------F-R-T--L-------.D------------.CN...NE-G..--V-LT.LA-HL-
Q29GA6_DROPS/127-159.T----L-------------------H-R-I--M-------.D------------.VN...HD-G..--V-IS.YD-DF-
Q4E142_TRYCC/257-286.A----L-------------------F-Q-R--L-------.D------------.KH...GN-G..--Y-LE.LK-EL-
B3L1G0_PLAKH/13-41.S----I-------------------F-N-E--F-------.D------------.KN...KN-G..--.-LD.GK-QL-
B8C031_THAPS/320-349.C----I-------------------F-A-W--H-------.D------------.TK...GY-G..--V-IN.NS-DF-
A8XF67_CAEBR/57-86.Y----Y-------------------F-K-V--G-------.D------------.QN...LD-H..--F-LD.GI-EL-
Q38C77_TRYB2/16-45.E----A-------------------F-R-L--F-------.D------------.SA...DE-G..--V-IA.MS-RV-
Q4U910_THEAN/477-506.Y----A-------------------F-R-L--Y-------.D------------.KD...YD-G..--K-LS.FN-TF-
B7PG89_IXOSC/60-90.E----L-------------------T-E-H--A-------.D------------.FN...KD-R..--I-VE.FD-EW-
B8NHB5_ASPFN/61-89.A----D-------------------F-Y-K--A-------.D------------.FD...RD-G..--H-IT.LQ-EL-
C3ZYS2_BRAFL/1605-1634.A----L-------------------F-A-M--A-------.D------------.VD...SD-G..--T-VT.SS-EL-
A9VCA0_MONBE/80-109.A----A-------------------F-K-A--Y-------.D------------.QA...GT-G..--T-IS.KA-DL-
A7SIS2_NEMVE/98-139.Y----F-------------------F-K-L--H-------.D------------.YD...NN-Q..--K-LD.GL-EL-
B0DIL9_LACBS/626-655.R----L-------------------F-F-F--W-------.D------------.TS...CK-G..--A-LS.FQ-DL-
C7G032_DICDI/508-537.R----M-------------------F-K-L--M-------.D------------.KD...DD-N..--L-LN.FK-EL-
D2A071_TRICA/143-179FY----Y-------------------F-Q-V--H-------.D------------.TD...KN-S..--K-LD.GL-EI-
A0EAP2_PARTE/324-354.A----S-------------------F-I-S--L-------.D------------.FD...DQ-G..--Y-IS.ET-QF-
A8P2X2_COPC7/487-516.Q----Y-------------------L-K-Q--Y-------.D------------.TD...DT-N..--T-MS.HL-EL-
A0DU71_PARTE/549-578.Q----M-------------------F-Q-Q--I-------.D------------.YN...FS-G..--Y-LN.WR-EF-
Q8LKK4_CHLRE/572-601.S----S-------------------V-I-A--A-------.D------------.KS...GS-G..--A-LT.GD-DL-
Q54E45_DICDI/138-166.M----I-------------------F-R-L--F-------.S------------.RN...G.-K..--T-IG.AD-EL-
A0ECX0_PARTE/269-298.E----M-------------------F-I-F--I-------.D------------.KN...ND-G..--F-ID.VN-EM-
Q4DLY4_TRYCC/95-128.G----I-------------------F-N-D--Y-------.D------------.VN...GN-G..--R-LS.KE-TV-
B7Q8D4_IXOSC/82-118.Y----F-------------------F-R-M--H-------.D------------.FD...NN-N..--K-LD.GL-EL-
D0N3C9_PHYIT/174-204.A----A-------------------L-N-Q--I-------.D------------.RN...ND-G..--R-ID.EE-EF-
C5KYD8_PERM5/173-202.E----C-------------------F-E-V--W-------.D------------.SD...GD-G..--K-LN.PS-EL-
A9V4G2_MONBE/147-180.Q----T-------------------F-D-Q--F-------.D------------.TD...SD-G..--Q-LS.KA-ET-
A9UU76_MONBE/93-122.A----A-------------------F-R-V--F-------.D------------.KL...GN-G..--T-VP.AK-EF-
CGRE1_MOUSE/75-112.S----L-------------------F-A-L--H-------.D------------.YD...QN-G..--Q-LD.GL-EL-
D0NLT0_PHYIT/68-97.A----L-------------------F-T-A--L-------.D------------.TD...EN-G..--L-VD.AL-EF-
A5KCC4_PLAVS/562-593.Y----L-------------------F-N-Q--Y-------AH------------.TE...YP-N..--C-IS.FK-RF-
Q54EU2_DICDI/187-217.E----I-------------------F-D-R--F-------.D------------.RN...KD-N..--C-LN.KA-EM-
A8WXW8_CAEBR/591-622.S----I-------------------F-K-K--I-------.D------------.KE...GR-G..--T-FS.SS-DL-
Q5Z905_ORYSJ/274-303.Q----A-------------------F-R-Y--F-------.D------------.QN...RA-G..--Y-LK.VD-DL-
Q4P545_USTMA/20-49.S----R-------------------F-R-T--L-------.D------------.VE...EK-G..--S-IP.KQ-DV-
A2EYC2_TRIVA/29-61.A----A-------------------F-H-D--V-------.D------------.KS...NT-G..--R-IT.KD-QF-
A0DQ90_PARTE/27-67.K----K-------------------F-Q-Q--L-------.D------------.TN...NK-G..--F-VS.AA-DF-
B4NGA9_DROWI/115-153.F----A-------------------F-K-V--Y-------.D------------.VM...GV-G..--S-LD.GD-VI-
D0NB87_PHYIT/1035-1065.A----L-------------------F-E-K--Y-------.D------------.VD...GD-G..--H-LA.EP-EL-
B6K3A4_SCHJY/20-48.E----Q-------------------F-G-R--L-------.D------------.VD...GK-G..--Y-ID.QP-ST-
C4Y9V5_CLAL4/13-44.N----A-------------------F-T-L--I-------.D------------.SD..SKD-G..--K-IT.LS-DL-
Q2H4R6_CHAGB/754-784.R----L-------------------F-Q-K--W-------.D------------.TD...SS-S..--A-LT.LQ-KV-
A7SHV8_NEMVE/147-177.S----I-------------------F-S-G--W-------.D------------.TN...ND-G..--F-IT.VD-EV-
A4I027_LEIIN/173-200.Q----V-------------------W-M-M--Y-------.D------------.KD...NS-G..--D-LS.YA-EM-
B3MG51_DROAN/125-154.F----A-------------------F-S-V--Y-------.D------------.RG...DR-G..--Q-LN.SE-EV-
EFCB8_MOUSE/115-143.K----V-------------------F-E-K--E-------..------------.AD...EN-G..--A-LK.KE-GF-
A5K8W6_PLAVS/148-177.K----M-------------------F-S-H--F-------.D------------.NN...AS-G..--F-LT.KN-QM-
A8P5P9_BRUMA/6-33.E----I-------------------F-L-L--Y-------.D------------.EE...LD-G..--K-ID.GT-QI-
B8LWL3_TALSN/221-250.R----A-------------------F-E-L--F-------.D------------.EG...GK-G..--Y-ID.LE-DL-
C3YK83_BRAFL/11-40.D----G-------------------F-P-L--F-------.D------------.NK...GD-G..--K-ID.GA-QL-
C4LT56_ENTHI/7-35.D----Y-------------------F-A-I--L-------.D------------.ID...HD-K..--K-IS.RD-QV-
C4LUQ9_ENTHI/16-43.D----A-------------------F-D-M--F-------.D------------.SS...KK-G..--Y-LD.KD-DV-
F1R647_DANRE/83-111.T----M-------------------F-K-R--F-------.D------------.SG...KD-G..--F-ID.LM-EL-
F7GNT1_CALJA/685-713.A----S-------------------F-N-H--F-------.D------------.RK...KT-G..--M-MD.TD-DF-
G3HZP5_CRIGR/33-62.E----A-------------------S-N-M--I-------.D------------.QN...RD-G..--F-ID.KE-DL-
H0ZMF4_TAEGU/54-83.E----A-------------------F-L-L--F-------.D------------.RT...GD-A..--K-IT.LS-QV-
H2VC11_TAKRU/55-86.D----A-------------------F-T-L--F-------.D------------.ET...PT-GEL--K-IT.FA-QC-
H3CP38_TETNG/179-208.L----A-------------------F-K-M--F-------.E------------.AE...ED-G..--A-IT.QL-EL-
I1LLG5_SOYBN/78-108.E----A-------------------F-E-M--Y-------ND------------.TE...MF-G..--F-IT.PK-SL-
M9MSK2_DROME/7-36.T----A-------------------F-D-L--L-------.D------------.RN...RD-G..--R-VT.AN-EL-
Q236J2_TETTS/59-87.Q----A-------------------F-K-I--I-------.D------------.YR...NT-G..--Q-IT.SE-QL-
Q38AA2_TRYB2/25-54.E----V-------------------F-S-I--L-------.D------------.VD...GT-E..--T-IT.PN-DL-
Q38EV6_TRYB2/74-103.T----A-------------------L-R-A--F-------.D------------.GN...DS-G..--Q-LK.LS-EL-
CML9_ORYSJ/91-119.A----C-------------------L-D-V--F-------.D------------.DA...RS-G..--V-IP.AE-QL-
Q8LHQ5_ORYSJ/28-57.A----W-------------------L-M-H--F-------.D------------.GD...GD-E..--H-IS.RR-EL-

PF00036

S10AC_RABIT/53-81-R----I-------------------F-R-D--L--------D-------------ED---GD-H----Q-VD-FK-EF-
UCP8_SCHPO/337-365-R----I-------------------W-D-T--V--------D-------------TQ---DR-G----Y-ID-KD-EF-
RPTN_MOUSE/53-81-T----I-------------------L-E-H--L--------D-------------RD---RN-G----Y-VD-FH-EY-
2AB2E_ARATH/385-413-Y----W-------------------F-K-C--V--------D-------------LD---GN-G----V-IT-SN-EM-
RBOHE_ARATH/272-300-I----F-------------------F-D-M--A--------D-------------SN---ED-G----K-IT-RE-EI-
CALM4_ARATH/48-76-D----M-------------------I-N-E--V--------D-------------AD---GN-G----T-ID-FP-EF-
CALM4_ARATH/85-113-E----A-------------------F-R-V--F--------D-------------KD---QN-G----F-IS-AA-EL-
CALM4_ARATH/121-149-E----M-------------------I-R-E--A--------D-------------VD---GD-G----Q-IN-YE-EF-
YLJ5_CAEEL/51-79-K----I-------------------F-Q-L--M--------D-------------DD---GS-G----T-IS-SS-EV-
YLJ5_CAEEL/87-115-A----V-------------------M-R-S--S--------D-------------VS---GD-G----Q-ID-FE-EF-
DGK3_CAEEL/174-202-V----V-------------------F-H-V--Y--------D-------------SD---GN-G----F-LD-KS-EI-
DGK3_CAEEL/219-247-Q----M-------------------M-V-D--I--------D-------------YD---ND-G----I-VS-FD-EW-
Q21408_CAEEL/2329-2357-R----I-------------------L-D-I--V--------D-------------PN---RD-G----Y-VT-LQ-EY-
END3_EMENI/46-74-K----V-------------------W-D-L--A--------D-------------LD---GD-G----E-LD-FE-EF-
EP15R_MOUSE/276-304-E----I-------------------F-L-K--T--------D-------------LD---LD-G----Y-VS-GQ-EV-
Q94288_CAEEL/100-128-E----A-------------------F-L-L--F--------D-------------KD---GN-G----T-IS-IK-EL-
Q94288_CAEEL/136-164-E----I-------------------I-H-D--V--------D-------------LD---GN-G----Q-VE-FP-EF-
Q94288_CAEEL/172-200-E----A-------------------F-K-I--F--------D-------------RD---GN-G----V-IT-AN-EF-
CAN9_MOUSE/595-623-D----L-------------------F-L-Q--F--------D-------------VD---KS-G----T-MS-SY-EL-
CABP1_HUMAN/343-370-E----I-------------------I-R-D--V--------D-------------LN---GD-G----R-VD-FE-EF-
O16343_CAEEL/114-142-F----A-------------------F-K-M--Y--------D-------------LN---KN-N----Y-IT-RE-EF-
O16343_CAEEL/155-183-K----T-------------------L-E-E--A--------D-------------QD---RD-G----K-IS-FE-DF-
PLSL_HUMAN/13-41-E----A-------------------F-A-K--V--------D-------------TD---GN-G----Y-IS-FN-EL-
PLSL_HUMAN/53-81-N----L-------------------M-A-T--G--------D-------------LD---QD-G----R-IS-FD-EF-
DGKG_HUMAN/179-207-F----M-------------------F-R-L--Y--------D-------------SD---EN-G----L-LD-QA-EM-
DGKG_HUMAN/224-252-E----M-------------------L-Q-G--M--------D-------------YD---RD-G----F-VS-LQ-EW-
RYR2_HUMAN/4027-4055-D----T-------------------F-K-E--Y--------D-------------PD---GK-G----V-IS-KR-DF-
GPDM_HUMAN/627-655-K----R-------------------F-H-K--F--------D-------------AD---QK-G----F-IT-IV-DV-
GPDM_HUMAN/663-691-E----I-------------------L-N-E--V--------D-------------LN---KN-G----Q-VE-LN-EF-
DGKA_HUMAN/114-142-F----T-------------------F-K-L--Y--------D-------------TD---RN-G----I-LD-SS-EV-
DGKA_HUMAN/159-187-E----M-------------------M-K-E--I--------D-------------YD---GS-G----S-VS-QA-EW-
Q93640_CAEEL/121-149-Y----A-------------------F-R-I--Y--------D-------------YD---GD-E----L-LG-HD-DL-
Q93640_CAEEL/162-190-R----I-------------------I-E-E--A--------D-------------LD---GD-S----S-IN-FA-EF-
ITSN2_MOUSE/58-86-E----I-------------------W-A-L--S--------D-------------LN---KD-G----K-MD-QQ-EF-
ITSN2_MOUSE/282-310-T----I-------------------W-T-L--A--------D-------------ID---GD-G----Q-LK-AE-EF-
CALML_DICDI/10-38-E----A-------------------F-N-L--F--------D-------------KD---KD-G----K-IT-IQ-EL-
CALML_DICDI/46-73-D----I-------------------A-K-E--I--------D-------------.D---GS-G----L-VD-FS-KF-
CALML_DICDI/82-110-Q----A-------------------F-K-V--F--------D-------------KK---GN-G----Y-AN-IQ-DL-
CAM2_SCHPO/10-38-E----A-------------------F-V-L--Y--------D-------------ID---KD-G----L-IP-TS-HV-
CAM2_SCHPO/79-107-K----A-------------------F-R-V--F--------D-------------KD---NS-G----Y-IE-TA-KF-
CAN9_HUMAN/565-593-N----I-------------------I-S-L--M--------D-------------TS---GN-G----K-LE-FD-EF-
CAN9_HUMAN/595-623-N----L-------------------F-L-R--F--------D-------------AD---KS-G----T-MS-TY-EL-
PPE1_HUMAN/570-598-I----I-------------------F-N-A--I--------D-------------TD---HS-G----L-IS-VE-EF-
PPE1_HUMAN/610-638-K----L-------------------A-N-I--M--------D-------------LN---KD-G----S-ID-FN-EF-
PPE2_HUMAN/572-600-S----E-------------------F-K-K--H--------D-------------AD---KV-G----L-IT-LS-DW-
PPE2_HUMAN/656-684-T----I-------------------F-R-I--I--------D-------------SD---HS-G----F-IS-LD-EF-
O16158_DROME/11-39-L----F-------------------N-V-F--F--------D-------------VN---QS-G----E-ID-VK-DF-
O16158_DROME/62-90-G----L-------------------R-S-K--A--------D-------------KD---ND-G----Q-VS-VD-EW-
O16158_DROME/104-132-F----M-------------------F-D-L--E--------D-------------AS---HD-G----G-ID-VT-EF-
O18058_CAEEL/24-52-Q----A-------------------F-K-L--F--------D-------------KD---GN-N----T-MN-IK-EL-
O18058_CAEEL/60-88-N----M-------------------V-N-E--Y--------D-------------VD---GN-G----K-ID-FG-EF-
O18058_CAEEL/96-124-L----A-------------------F-K-V--F--------D-------------KD---GN-G----Y-IT-AQ-EF-
O18058_CAEEL/132-160-E----I-------------------I-R-E--V--------D-------------KD---GD-E----Q-ID-LD-EF-
SCMC1_RABIT/23-51-T----L-------------------F-Q-A--L--------D-------------RN---GD-G----V-VD-IR-EL-
SCMC1_RABIT/59-87-K----I-------------------F-T-T--G--------D-------------VN---KD-G----K-LD-FE-EF-
SCMC1_RABIT/90-118-L----A-------------------F-K-S--L--------D-------------KN---ND-G----K-IE-AS-EI-
CML5_ARATH/65-93-R----V-------------------F-Q-M--F--------D-------------KN---GD-G----R-IT-KE-EL-
CML5_ARATH/101-129-Q----M-------------------I-H-K--I--------D-------------AN---GD-G----C-VD-ID-EF-
CML5_ARATH/143-171-D----A-------------------F-N-V--F--------D-------------QD---GD-G----F-IT-VE-EL-
CML5_ARATH/181-209-K----M-------------------I-M-Q--V--------D-------------AD---GD-G----R-VN-YK-EF-
Y1515_ARATH/10-38-R----I-------------------F-Q-Q--F--------D-------------GN---HD-G----G-LN-RE-EM-
CML19_ARATH/27-55-E----I-------------------F-D-L--F--------D-------------ID---GS-G----S-ID-AS-EL-
CML19_ARATH/63-91-E----L-------------------M-A-E--V--------D-------------KN---QS-G----A-ID-FD-EF-
CML19_ARATH/100-128-K----A-------------------F-K-I--I--------D-------------HD---NN-G----K-IS-PR-DI-
CML19_ARATH/136-164-E----M-------------------I-E-E--A--------D-------------RD---KD-G----E-VN-LE-EF-
CML8_ARATH/49-77-D----I-------------------I-T-E--I--------D-------------SD---SN-G----T-IE-FA-EF-
PPE2_MOUSE/576-604-V----E-------------------F-R-K--R--------D-------------PD---ES-G----V-IT-LS-DW-
PPE2_MOUSE/700-728-D----L-------------------A-R-S--I--------D-------------FN---KD-G----H-ID-IN-EF-
ONCO_CAVPO/43-71-D----V-------------------F-R-F--I--------D-------------ND---QS-G----Y-LD-EE-EL-
ONCO_CAVPO/82-109-S----L-------------------M-A-A--A--------D-------------ND---GD-G----K-IG-AD-EF-
CALU_RAT/72-100-M----I-------------------V-D-K--I--------D-------------TD---KD-G----F-VT-EG-EL-
CALU_RAT/108-136-N----Q-------------------W-Q-E--F--------D-------------MN---QD-G----L-IS-WD-EY-
CHP2_HUMAN/115-143-Y----A-------------------F-Q-L--Y--------D-------------LD---RD-G----K-IS-RH-EM-
CHP2_HUMAN/156-184-R----T-------------------V-Q-E--A--------D-------------ED---GD-G----A-VS-FV-EF-
CALU_HUMAN/72-100-K----I-------------------V-S-K--I--------D-------------GD---KD-G----F-VT-VD-EL-
CALU_HUMAN/192-220-E----T-------------------M-E-D--I--------D-------------KN---AD-G----F-ID-LE-EY-
O45313_CAEEL/236-262-K----I-------------------F-A-E--L--------D-------------CD---RD-G----L-VT-YD-DM-
GEM1_SCHPO/188-216-R----I-------------------F-F-L--I--------D-------------KN---ND-D----L-LS-VD-EL-
GEM1_SCHPO/308-336-D----L-------------------F-Y-Q--F--------D-------------RD---ND-G----A-LN-NE-EL-
FIMB_SCHPO/55-83-E----A-------------------I-R-E--V--------N-------------VD---SS-G----R-VE-PE-DF-
CALM_KLULA/12-40-E----A-------------------F-A-L--F--------D-------------KD---NS-G----S-IS-AS-EL-
CALM_KLULA/48-76-D----L-------------------M-N-E--I--------D-------------VD---GN-H----A-IE-FS-EF-
CALM_KLULA/85-113-E----A-------------------F-K-V--F--------D-------------KN---GD-G----L-IS-AA-EL-
CALM_KLULA/121-147-E----M-------------------L-R-E--V--------.-------------SD---GS-G----E-IN-IK-QF-
O61604_DROME/18-46-E----K-------------------F-I-E--L--------D-------------AN---KD-G----F-ID-LH-EL-
O64866_ARATH/24-52-E----R-------------------F-A-A--L--------D-------------LN---KD-G----V-LS-RS-EL-
O64866_ARATH/73-101-S----I-------------------F-E-K--F--------D-------------TD---QS-G----S-VD-LE-EF-
CDC31_SCHPO/38-66-E----A-------------------F-K-L--F--------D-------------SD---KD-N----A-ID-YH-EL-
CDC31_SCHPO/74-102-K----I-------------------L-R-D--F--------D-------------KT---GK-G----Y-LQ-ME-DF-
CDC31_SCHPO/147-175-A----M-------------------I-E-E--F--------D-------------LD---QD-G----E-IN-EQ-EF-
CMC1_HUMAN/90-118-V----A-------------------F-Q-L--F--------D-------------KS---GN-G----E-VT-FE-NV-
CMC1_HUMAN/161-189-Q----A-------------------F-A-L--K--------D-------------KS---KS-G----M-IS-GL-DF-
CIB2_HUMAN/107-135-Y----A-------------------F-K-I--Y--------D-------------FN---TD-N----F-IC-KE-DL-
CIB2_HUMAN/148-176-K----V-------------------I-E-E--A--------D-------------LD---GD-G----K-LG-FA-DF-
SEGN_HUMAN/16-44-Q----V-------------------W-Q-R--F--------D-------------AD---EK-G----Y-IE-EK-EL-
SEGN_HUMAN/109-137-Q----I-------------------W-R-K--Y--------D-------------AD---SS-G----F-IS-AA-EL-
SEGN_HUMAN/201-229-K----I-------------------F-A-Y--Y--------D-------------VS---KT-G----A-LE-GP-EV-
SEGN_HUMAN/245-273-I----L-------------------L-R-H--C--------D-------------VN---KD-G----K-IQ-KS-EL-
O76670_CAEEL/18-46-D----S-------------------F-D-L--V--------D-------------AN---ND-G----K-LS-EK-EL-
O76670_CAEEL/50-78-E----Y-------------------F-Q-R--F--------D-------------LD---RN-G----H-LD-IS-EF-
O76670_CAEEL/117-145-G----I-------------------L-S-I--A--------D-------------TN---RD-G----Q-LT-YA-EF-
O76670_CAEEL/158-186-Q----L-------------------L-S-F--I--------D-------------AN---GD-N----K-LD-QL-EL-
O76670_CAEEL/195-223-Q----I-------------------F-A-M--L--------D-------------KN---QD-G----Y-LT-EN-EL-
RBOHA_ARATH/225-253-T----F-------------------F-A-M--V--------D-------------KD---SD-G----R-LN-EA-EV-
CNBL4_ARATH/75-103-R----I-------------------F-D-V--F--------D-------------VK---RN-G----V-IE-FG-EF-
CNBL4_ARATH/112-140-F----A-------------------F-K-L--Y--------D-------------LR---QT-G----F-IE-RE-EL-
CNBL4_ARATH/156-184-K----A-------------------F-V-Q--A--------D-------------RK---ND-G----K-ID-ID-EW-
CNBL1_ARATH/71-99-R----I-------------------F-D-M--F--------D-------------VK---RK-G----V-ID-FG-DF-
CNBL1_ARATH/108-136-F----T-------------------F-R-L--Y--------D-------------MD---CT-G----Y-IE-RQ-EV-
YC22_ARATH/388-416-E----L-------------------W-V-R--A--------D-------------LD---GN-G----V-FD-YE-EL-
CML20_ARATH/100-128-K----A-------------------F-Q-I--I--------D-------------LD---KN-G----K-IS-PD-DI-
CML20_ARATH/136-164-E----M-------------------V-E-E--A--------D-------------RD---RD-G----E-VN-MD-EF-
CABP1_RAT/157-185-E----A-------------------F-R-E--F--------D-------------KD---KD-G----Y-IN-CR-DL-
CABP1_RAT/234-262-D----A-------------------F-R-E--F--------D-------------TN---GD-G----E-IS-TS-EL-
O93409_DANRE/30-58-E----A-------------------F-T-I--I--------D-------------QN---RD-G----I-IS-KD-DL-
RCN1_TAKRU/74-102-K----I-------------------V-D-R--I--------D-------------GD---GN-S----Y-IT-TD-EL-
RCN1_TAKRU/110-138-K----V-------------------W-A-D--Y--------D-------------LN---KD-N----K-IS-WE-EY-
RCN1_TAKRU/198-226-E----T-------------------L-E-D--I--------D-------------KN---SD-G----H-VD-ED-EY-
YFFE_SCHPO/13-41-E----A-------------------F-D-L--F--------D-------------VT---HK-G----Y-ID-FE-DL-
FKBP9_HUMAN/492-520-N----L-------------------F-E-E--I--------D-------------KD---GN-G----E-VL-LE-EF-
FKBP9_HUMAN/537-563-N----M-------------------F-T-N--Q--------D-------------RN---GD-G----K-VT-AE-EF-
GUC1C_HUMAN/56-84-Q----V-------------------Y-N-T--F--------D-------------TN---KD-G----F-VD-FL-EF-
GUC1C_HUMAN/92-120-W----Y-------------------F-K-L--Y--------D-------------AD---GN-G----S-ID-KN-EL-
GUC1C_HUMAN/134-162-L----V-------------------F-H-K--I--------D-------------IN---ND-G----E-LT-LE-EF-
O96676_DROME/127-155-T----L-------------------H-R-I--L--------D-------------VN---HD-G----V-VS-FD-DF-
O96676_DROME/249-277-V----S-------------------F-A-V--I--------D-------------KN---GD-G----Q-LS-LK-EF-
TNNC2_PIG/94-122-E----C-------------------F-R-I--F--------D-------------RN---MD-G----Y-ID-AE-EL-
TNNC2_CHICK/98-126-N----C-------------------F-R-I--F--------D-------------KN---AD-G----F-ID-IE-EL-
CALMS_CHICK/121-149-E----M-------------------I-K-E--A--------D-------------CN---ND-G----Q-VN-YE-EF-
CALM_DICDI/87-115-E----A-------------------F-K-V--F--------D-------------KD---GN-G----Y-IS-AA-EL-
CALM_DICDI/123-151-E----M-------------------I-R-E--A--------D-------------LD---GD-G----Q-VN-YD-EF-
MLE1_CHICK/52-80-E----A-------------------F-L-L--F--------D-------------RT---GD-A----K-IT-LS-QV-
MLE1_CHICK/129-157-E----G-------------------L-R-V--F--------D-------------KE---GN-G----T-VM-GA-EL-
MYL6_CHICK/11-39-E----A-------------------F-Q-L--F--------D-------------RT---GD-G----K-IL-YS-QC-
MLRS_CHICK/28-56-E----A-------------------F-T-V--I--------D-------------QN---RD-G----I-ID-KD-DL-
MLRA_CHICK/133-161-Q----M-------------------F-A-A--F--------P-------------PD---VS-G----N-LD-YK-NL-
MLRB_CHICK/97-125-N----A-------------------F-K-I--F--------D-------------PE---GK-G----H-IK-AD-YI-
MLRM_CHICK/138-166-E----M-------------------Y-R-E--A--------P-------------ID---KK-G----N-FN-YV-EF-
PRVB_LATCH/42-70-A----I-------------------F-K-I--L--------D-------------QD---KS-G----F-IE-DE-EL-
PRVA_LATCH/44-72-E----V-------------------F-G-I--L--------D-------------QD---KS-G----Y-IE-EE-EL-
PRVA_LATCH/83-111-A----L-------------------L-K-A--G--------D-------------QD---GD-D----K-IG-VD-EF-
S100G_BOVIN/49-77-E----L-------------------F-E-E--L--------D-------------KN---GD-G----E-VS-FE-EF-
S100B_BOVIN/53-81-K----V-------------------M-E-T--L--------D-------------SD---GD-G----E-CD-FQ-EF-
S10A1_BOVIN/54-82-K----V-------------------M-K-E--L--------D-------------EN---GD-G----E-VD-FQ-EY-
SPE1A_STRPU/14-42-R----R-------------------F-K-N--K--------D-------------TD---KS-K----S-IT-AE-EL-
SPE1A_STRPU/50-78-K----M-------------------I-S-D--V--------D-------------TD---ES-G----T-ID-FS-EM-
SPE1A_STRPU/88-116-K----A-------------------F-D-D--M--------D-------------KD---GN-G----S-LS-PQ-EL-
SPE2A_STRPU/14-42-S----S-------------------F-K-S--E--------D-------------TD---GD-G----K-IT-SE-EL-
SPE2A_STRPU/50-78-E----M-------------------M-G-M--V--------D-------------KD---GS-K----D-MD-FS-EF-
SPE2A_STRPU/122-150-A----I-------------------I-E-K--A--------D-------------CN---GD-G----K-IC-LE-EF-
SPE2C_STRPU/50-76-E----M-------------------M-S-M--V--------D-------------KD---GS-R----P-VD-FS-EI-
SPE2C_STRPU/85-113-K----A-------------------F-D-A--L--------D-------------TD---KS-G----S-LS-PE-EL-
SPE2C_STRPU/122-150-A----I-------------------I-K-K--A--------D-------------GN---ND-G----E-IR-RA-EF-
CALB1_CHICK/16-44-E----I-------------------W-H-H--Y--------D-------------SD---GN-G----Y-MD-GK-EL-
CALB1_CHICK/103-131-Q----T-------------------W-R-K--Y--------D-------------SD---HS-G----F-ID-SE-EL-
CALB1_BOVIN/15-43-E----I-------------------W-L-H--F--------D-------------AD---GS-G----Y-LE-GK-EL-
CALB1_BOVIN/102-130-K----T-------------------W-R-K--Y--------D-------------TD---HS-G----F-IE-TE-EL-
CALB1_BOVIN/146-174-L----M-------------------L-K-L--F--------D-------------SN---ND-G----K-LE-LT-EM-
CALB1_BOVIN/190-218-K----A-------------------F-E-L--Y--------D-------------QD---GN-G----Y-ID-EN-EL-
CALL_CAEEL/25-53-E----A-------------------F-M-M--F--------D-------------KD---GN-G----T-IS-TK-EL-
CALL_CAEEL/61-89-E----M-------------------I-N-E--V--------D-------------ID---GN-G----Q-IE-FP-EF-
CALL_CAEEL/97-125-E----A-------------------F-R-V--F--------D-------------KD---GN-G----V-IT-AQ-EF-
CALL_CAEEL/133-161-E----M-------------------I-K-E--V--------D-------------VD---GD-G----E-ID-YE-EF-
ACTNA_DICDI/733-761-A----C-------------------F-S-H--F--------D-------------KD---ND-N----K-LN-RL-EF-
ACTNA_DICDI/769-797-Q----V-------------------I-S-K--I--------D-------------TD---GN-G----T-IS-FE-EF-
S10A8_HUMAN/50-78-V----W-------------------F-K-E--L--------D-------------IN---TD-G----A-VN-FQ-EF-
CALM_SCHPO/13-41-E----A-------------------F-S-L--F--------D-------------RD---QD-G----N-IT-SN-EL-
CALM_SCHPO/86-114-E----A-------------------F-K-V--F--------D-------------KD---GN-G----Y-IT-VE-EL-
CALM_SCHPO/122-150-D----M-------------------I-R-E--A--------D-------------TD---GD-G----V-IN-YE-EF-
CDC31_YEAST/24-52-E----A-------------------F-S-L--F--------D-------------MN---ND-G----F-LD-YH-EL-
CDC31_YEAST/97-125-R----A-------------------F-Q-L--F--------D-------------DD---HT-G----K-IS-IK-NL-
CDC31_YEAST/133-161-A----M-------------------I-E-E--F--------D-------------LD---GD-G----E-IN-EN-EF-
SPTA1_MOUSE/2271-2299-T----T-------------------Y-K-H--F--------D-------------EN---LT-G----R-LT-HK-EF-
SPTA1_MOUSE/2314-2342-K----F-------------------L-N-A--V--------D-------------PG---RK-G----Y-VS-LE-DY-
MLE_DICDI/7-35-E----C-------------------F-S-I--F--------D-------------KD---ND-G----K-VS-VE-DI-
MLE_DICDI/79-107-D----A-------------------F-K-A--L--------D-------------KE---GH-G----T-IQ-GA-EL-
S10A2_BOVIN/54-82-K----L-------------------M-G-D--L--------D-------------EN---SD-Q----Q-VD-FQ-EY-
CAYP1_CANFA/25-53-R----F-------------------F-R-R--L--------D-------------RD---RS-R----S-LD-SR-EL-
CAYP1_CANFA/61-89-G----V-------------------C-R-R--W--------D-------------RD---GS-G----T-LD-LE-EF-
CAYP1_CANFA/97-125-A----A-------------------F-A-K--L--------D-------------RS---GD-G----V-VT-VD-DL-
PLCD1_BOVIN/144-172-S----C-------------------L-R-K--A--------D-------------KN---KD-N----K-MS-FK-EL-
MLRV_HUMAN/98-126-N----A-------------------F-K-V--F--------D-------------PE---GK-G----V-LK-AD-YV-
ACTN1_HUMAN/750-778-A----S-------------------F-N-H--F--------D-------------RD---HS-G----T-LG-PE-EF-
ACTN1_HUMAN/791-819-R----I-------------------M-S-I--V--------D-------------PN---RL-G----V-VT-FQ-AF-
PDCD6_MOUSE/27-55-N----V-------------------F-Q-R--V--------D-------------KD---RS-G----V-IS-DN-EL-
PDCD6_MOUSE/94-122-N----V-------------------F-R-T--Y--------D-------------RD---NS-G----M-ID-KN-EL-
CPNS1_BOVIN/138-166-S----M-------------------V-A-V--M--------D-------------SD---TT-G----K-LG-FE-EF-
CPNS1_BOVIN/168-196-A----V-------------------Y-K-Q--F--------D-------------VD---RS-G----T-IG-SS-EL-
MRLCA_RAT/33-61-E----A-------------------F-N-M--I--------D-------------QN---RD-G----F-ID-KE-DL-
MRLCA_RAT/102-130-N----A-------------------F-A-C--F--------D-------------EE---AI-G----T-IQ-ED-YL-
MLR_DICDI/24-52-E----A-------------------F-E-L--F--------D-------------KD---RT-G----F-IK-KD-AL-
MLR_DICDI/60-88-A----M-------------------F-A-E--A--------D-------------TT---KS-G----A-IG-FP-EF-
MLR_DICDI/97-125-N----A-------------------F-K-T--F--------D-------------PE---GN-G----Y-IL-TK-DL-
SPE2D_STRPU/112-140-E----M-------------------I-E-K--A--------D-------------FP---ND-G----K-CS-LE-EF-
SPTN1_RAT/2327-2355-M----M-------------------F-K-H--F--------D-------------KD---KS-G----R-LN-HQ-EF-
SPTN1_RAT/2370-2398-A----I-------------------L-D-T--V--------D-------------PN---RD-G----H-VS-LQ-EY-
ACTN_DROME/782-810-S----S-------------------F-N-H--F--------D-------------KN---RT-G----R-LS-PE-EF-
ACTN_DROME/823-851-R----I-------------------L-A-V--V--------D-------------PN---NT-G----Y-VH-FD-AF-
MLR_DROME/79-107-E----A-------------------F-Q-L--M--------D-------------AD---KD-G----I-IG-KN-DL-
PLSI_CHICK/15-43-E----A-------------------F-N-K--I--------D-------------ID---NS-G----Y-VS-DY-EL-
PLSI_CHICK/55-83-K----I-------------------F-A-V--T--------D-------------SN---KD-G----K-IN-FE-EF-
MLR1_CAEEL/28-56-E----A-------------------F-G-I--M--------D-------------QN---KD-G----I-ID-KS-DL-
PRVT_CHICK/82-109-A----F-------------------L-A-A--G--------D-------------TD---GD-G----K-IG-VE-EF-
CAN3_HUMAN/696-724-S----M-------------------I-A-L--M--------D-------------TD---GS-G----K-LN-LQ-EF-
FILA_HUMAN/53-81-V----F-------------------M-D-H--L--------D-------------ID---HN-K----K-ID-FT-EF-
RECO_BOVIN/65-93-H----V-------------------F-R-S--F--------D-------------AN---SD-G----T-LD-FK-EY-
RECO_BOVIN/101-129-W----A-------------------F-S-L--Y--------D-------------VD---GN-G----T-IS-KN-EV-
TRHY_SHEEP/53-81-L----V-------------------L-E-L--Q--------D-------------RD---RD-G----L-ID-FH-EF-
S10AB_CHICK/58-86-R----M-------------------M-K-R--L--------D-------------IN---SD-G----Q-LD-FQ-EF-
CML24_ARATH/17-45-K----V-------------------F-Q-R--F--------D-------------KN---GD-G----K-IS-VD-EL-
CML24_ARATH/53-81-T----M-------------------M-K-Q--F--------D-------------LD---GN-G----F-ID-LD-EF-
CML24_ARATH/94-122-E----A-------------------F-E-L--Y--------D-------------LD---GN-G----R-IS-AK-EL-
CML24_ARATH/130-158-K----M-------------------I-S-K--V--------D-------------ID---GD-G----C-VN-FD-EF-
CML12_ARATH/12-40-E----S-------------------F-R-L--F--------D-------------KN---GD-G----S-IT-KK-EL-
CML12_ARATH/48-76-D----L-------------------M-N-E--A--------D-------------LD---GD-G----T-ID-FP-EF-
CML12_ARATH/191-219-E----A-------------------F-R-V--F--------D-------------KN---GD-G----Y-IT-VN-EL-
CML12_ARATH/227-255-D----M-------------------I-N-E--A--------D-------------AD---GD-G----T-IS-FS-EF-
CANB_YEAST/25-53-K----R-------------------F-M-K--L--------D-------------RD---SS-G----S-ID-KN-EF-
CANB_YEAST/57-85-R----I-------------------M-E-V--F--------D-------------AD---NS-G----D-VD-FQ-EF-
CANB_YEAST/94-122-F----A-------------------F-K-I--Y--------D-------------ID---KD-G----F-IS-NG-EL-
CANB_YEAST/135-163-R----T-------------------I-V-E--N--------D-------------SD---GD-G----R-LS-FE-EF-
S10AA_CHICK/51-79-K----I-------------------M-K-D--L--------D-------------QC---RD-G----K-VG-FQ-SF-
S10A8_MOUSE/50-78-N----L-------------------F-R-E--L--------D-------------IN---SD-N----A-IN-FE-EF-
CALL3_HUMAN/48-76-D----M-------------------M-S-E--I--------D-------------RD---GN-G----T-VD-FP-EF-
CALL3_HUMAN/121-149-E----M-------------------I-R-A--A--------D-------------TD---GD-G----Q-VN-YE-EF-
M126_CHICK/63-91-Q----I-------------------F-K-D--L--------D-------------NN---KD-Q----Q-LS-FG-EV-
CANB2_RAT/22-50-R----S-------------------F-K-K--M--------D-------------LD---KS-G----S-LS-VD-EF-
CANB2_RAT/132-160-K----S-------------------I-L-V--L--------D-------------KD---GD-G----R-IS-FE-EF-
CDPK_SOYBN/339-367-E----L-------------------F-K-M--I--------D-------------TD---NS-G----T-IT-FD-EL-
CDPK_SOYBN/375-403-D----L-------------------M-D-A--A--------D-------------ID---KS-G----T-ID-YG-EF-
CDPK_SOYBN/411-439-S----A-------------------F-S-Y--F--------D-------------KD---GS-G----Y-IT-LD-EI-
CDPK_SOYBN/445-473-D----M-------------------I-K-E--I--------D-------------QD---ND-G----Q-ID-YG-EF-
GRAN_HUMAN/93-121-I----M-------------------I-A-M--L--------D-------------RD---HT-G----K-MG-FN-AF-
GRAN_HUMAN/123-151-E----N-------------------F-M-T--V--------D-------------QD---GS-G----T-VE-HH-EL-
S10A9_BOVIN/58-86-E----I-------------------M-E-D--L--------D-------------TN---VD-K----Q-LS-FE-EF-
CML10_ARATH/12-40-E----Q-------------------F-S-V--Y--------D-------------KN---GD-G----H-IT-TE-EF-
CML10_ARATH/48-76-E----E-------------------I-N-D--S--------D-------------LD---GD-G----T-IN-FT-EF-
CML10_ARATH/82-110-K----D-------------------F-R-L--F--------D-------------ID---KN-G----F-IS-AA-EM-
CML10_ARATH/118-146-E----I-------------------I-K-A--A--------D-------------VD---GD-G----Q-IN-YR-EF-
CML35_ARATH/70-98-Q----A-------------------F-K-L--I--------D-------------RD---DD-G----V-VS-RG-DL-
CML35_ARATH/145-173-E----V-------------------F-E-I--F--------D-------------VD---RN-G----K-IS-AE-EL-
CML35_ARATH/182-210-R----M-------------------I-A-T--V--------D-------------GN---GD-G----F-VC-FD-DF-
YNE5_CAEEL/81-109-S----A-------------------F-K-L--F--------D-------------PE---SK-G----T-IT-VA-NL-
YNE5_CAEEL/117-145-E----M-------------------I-R-E--A--------G-------------GD---NN-T----G-IN-EQ-QF-
S10A7_HUMAN/54-82-D----V-------------------F-E-K--K--------D-------------KN---ED-K----K-ID-FS-EF-
S10A9_MOUSE/59-87-D----I-------------------M-E-D--L--------D-------------TN---QD-N----Q-LS-FE-EC-
PLC1_YEAST/273-301-E----F-------------------F-Q-L--A--------D-------------IN---HN-G----L-LN-YF-EF-
PAN1_YEAST/603-631-K----I-------------------F-E-T--F--------D-------------TQ---NK-G----L-LD-SP-TA-
PAN1_YEAST/637-665-Q----I-------------------W-N-L--C--------D-------------IN---NT-G----Q-LN-KQ-EF-
S10A5_HUMAN/51-79-D----L-------------------M-K-S--L--------D-------------KN---SD-Q----E-ID-FK-EY-
EDE1_YEAST/51-79-Q----V-------------------W-A-T--V--------D-------------ID---NK-G----F-LN-LN-EF-
EDE1_YEAST/171-199-E----I-------------------W-A-L--C--------D-------------RD---AS-G----V-LD-KS-EF-
CBPP_DICDI/403-431-A----A-------------------F-R-I--H--------D-------------SN---CS-G----T-LS-KK-EF-
CBPP_DICDI/439-467-M----L-------------------F-H-S--I--------D-------------RD---YS-G----S-LS-ER-EF-
S10A4_BOVIN/54-82-K----L-------------------M-S-N--L--------D-------------CN---KD-N----E-VD-FQ-EY-
ACTN2_HUMAN/757-785-A----S-------------------F-N-H--F--------D-------------RR---KN-G----L-MD-HE-DF-
ACTN2_HUMAN/793-821-R----I-------------------M-T-L--V--------D-------------PN---GQ-G----T-VT-FQ-SF-
NCS1_CAEEL/64-92-F----V-------------------F-K-V--F--------D-------------EN---KD-G----A-IE-FH-EF-
NCS1_CAEEL/100-128-W----A-------------------F-K-L--Y--------D-------------LD---QD-G----F-IT-RN-EM-
NCS1_CAEEL/148-176-R----I-------------------F-R-M--M--------D-------------KN---ND-A----Q-LT-LE-EF-
NCS2_CAEEL/66-94-H----V-------------------F-R-T--F--------D-------------TD---NS-G----F-ID-FK-EF-
NCS2_CAEEL/102-130-W----A-------------------F-R-M--Y--------D-------------ID---GN-G----T-ID-EK-EM-
NCS2_CAEEL/149-177-M----I-------------------F-E-K--M--------D-------------VN---ND-K----E-LT-LK-EF-
FREQ_DROME/100-128-W----A-------------------F-R-L--Y--------D-------------VD---ND-G----Y-IT-RE-EM-
FREQ_DROME/147-175-K----I-------------------F-D-Q--M--------D-------------KN---HD-G----K-LT-LE-EF-
TRHY_RABIT/53-81-V----M-------------------L-E-L--L--------D-------------RD---SD-G----L-VG-FD-EF-
GEM1_YEAST/205-233-R----I-------------------F-L-L--S--------D-------------LN---QD-S----Y-LD-DN-EI-
GEM1_YEAST/334-362-D----I-------------------F-L-K--F--------D-------------ID---ND-G----G-LN-NQ-EL-
RDGC_DROME/445-473-D----E-------------------F-R-K--Y--------D-------------PK---DS-G----Y-IS-IS-HW-
RDGC_DROME/530-558-A----I-------------------F-N-I--I--------D-------------AD---NS-G----E-IT-LD-EF-
RDGC_DROME/570-598-E----K-------------------C-R-M--M--------D-------------LN---GD-G----K-VD-LN-EF-
PLC1_SCHPO/334-362-E----T-------------------F-Q-K--A--------D-------------AD---HS-G----K-LS-FE-EF-
CAB32_DROME/39-67-D----V-------------------W-A-H--Y--------D-------------KD---GN-G----Y-IE-GT-EL-
CAB32_DROME/89-117-C----F-------------------M-E-A--Y--------D-------------DN---QD-G----K-ID-IR-EL-
CAB32_DROME/135-163-K----I-------------------W-R-E--Y--------D-------------TD---NS-G----Y-IE-AD-EL-
CAB32_DROME/228-256-K----V-------------------F-S-L--Y--------D-------------RD---NS-G----T-IE-NE-EL-
MYL5_FELCA/34-62-E----A-------------------F-T-L--M--------D-------------QN---RD-G----F-ID-KE-DL-
MYL5_FELCA/104-132-N----A-------------------F-K-M--L--------D-------------PE---GK-G----S-IN-KD-YI-
CBPA_DICDI/8-36-D----M-------------------L-R-K--F--------D-------------SN---GD-G----N-IT-FD-EA-
CBPA_DICDI/44-72-S----M-------------------F-I-S--L--------D-------------KD---KD-G----I-IS-IK-EI-
CBPA_DICDI/84-112-N----F-------------------L-K-G--Y--------D-------------TD---KD-G----R-I