Sequence alignment for CL0220

PF13405

F5HLN4_ANOGA/622-651--------------------------------------------------------------------------M-Y-V.
B9PZD1_TOXGO/10-39--------------------------------------------------------------------------K-C-R.
Q7QH58_ANOGA/21-50--------------------------------------------------------------------------E-M-R.
B9PML0_TOXGO/103-132--------------------------------------------------------------------------E-L-K.
C4Q5J4_SCHMA/2655-2684--------------------------------------------------------------------------R-V-I.
B9PRI1_TOXGO/15-44--------------------------------------------------------------------------E-L-K.
Q001X5_TOXGO/73-102--------------------------------------------------------------------------D-L-K.
Q95UJ7_TOXGO/149-178--------------------------------------------------------------------------D-L-V.
CAN8_HUMAN/536-564--------------------------------------------------------------------------Q-F-R.
A9V4Q3_MONBE/290-319--------------------------------------------------------------------------K-L-S.
A9V4Q3_MONBE/492-521--------------------------------------------------------------------------Q-I-L.
A0BQH1_PARTE/99-128--------------------------------------------------------------------------D-I-K.
A0BQH1_PARTE/172-202--------------------------------------------------------------------------T-I-R.
B3DGM2_DANRE/12-41--------------------------------------------------------------------------E-F-K.
B3DGM2_DANRE/85-114--------------------------------------------------------------------------E-I-L.
B4G986_DROPE/40-69--------------------------------------------------------------------------D-I-K.
B4G986_DROPE/113-142--------------------------------------------------------------------------D-M-L.
EFCB6_PONAB/24-53--------------------------------------------------------------------------T-V-M.
EFCB6_PONAB/255-284--------------------------------------------------------------------------S-L-K.
EFCB6_PONAB/699-728--------------------------------------------------------------------------D-L-S.
EFCB6_PONAB/816-845--------------------------------------------------------------------------D-I-S.
B4GVA6_DROPE/51-80--------------------------------------------------------------------------R-L-G.
B4GVA6_DROPE/139-169--------------------------------------------------------------------------R-D-R.
B4GVA6_DROPE/217-247--------------------------------------------------------------------------R-E-R.
C5KAW4_PERM5/19-48--------------------------------------------------------------------------A-F-K.
C5KAW4_PERM5/93-122--------------------------------------------------------------------------V-L-M.
A0E4G3_PARTE/299-328--------------------------------------------------------------------------K-I-Q.
B4K4U2_DROMO/29-58--------------------------------------------------------------------------D-L-T.
B4K4U2_DROMO/102-131--------------------------------------------------------------------------E-V-I.
A0BG74_PARTE/108-137--------------------------------------------------------------------------E-I-E.
B5Y3F8_PHATC/258-286--------------------------------------------------------------------------F-L-R.
Q7Y0H2_CHLRE/18-47--------------------------------------------------------------------------E-L-E.
C5Z5N8_SORBI/67-96--------------------------------------------------------------------------R-I-R.
C5Z5N8_SORBI/134-163--------------------------------------------------------------------------E-L-Y.
A7SG62_NEMVE/12-41--------------------------------------------------------------------------Q-L-R.
A7SG62_NEMVE/87-116--------------------------------------------------------------------------D-F-V.
Q240R2_TETTS/29-58--------------------------------------------------------------------------T-L-I.
B5DYP3_DROPS/28-57--------------------------------------------------------------------------D-C-T.
A7RGK2_NEMVE/11-40--------------------------------------------------------------------------E-Y-R.
A7RGK2_NEMVE/86-115--------------------------------------------------------------------------E-F-V.
Q4DGX2_TRYCC/326-357--------------------------------------------------------------------------E-I-H.
A9V7J3_MONBE/330-359--------------------------------------------------------------------------A-L-K.
A9V7J3_MONBE/402-431--------------------------------------------------------------------------R-L-W.
Q4Y2X6_PLACH/19-48--------------------------------------------------------------------------E-I-Y.
B3LYL3_DROAN/28-57--------------------------------------------------------------------------D-L-E.
A0E0C2_PARTE/300-329--------------------------------------------------------------------------D-I-G.
C3YDW3_BRAFL/85-114--------------------------------------------------------------------------E-I-L.
Q0IEY6_AEDAE/74-103--------------------------------------------------------------------------R-L-G.
Q0IEY6_AEDAE/240-270--------------------------------------------------------------------------H-E-R.
A9VBL4_MONBE/184-215--------------------------------------------------------------------------L-V-D.
A0E3X2_PARTE/219-248--------------------------------------------------------------------------S-L-K.
MYL6B_HUMAN/145-174--------------------------------------------------------------------------D-Y-L.
Q7QCU7_ANOGA/79-109--------------------------------------------------------------------------E-L-T.
Q7QCU7_ANOGA/211-241--------------------------------------------------------------------------L-V-D.
D0NI99_PHYIT/995-1024--------------------------------------------------------------------------L-L-T.
D0NZK1_PHYIT/776-806--------------------------------------------------------------------------V-L-L.
C1FGB5_MICSR/2004-2033--------------------------------------------------------------------------E-L-T.
C1FGB5_MICSR/2077-2106--------------------------------------------------------------------------A-L-D.
C1FGB5_MICSR/2208-2238--------------------------------------------------------------------------D-V-R.
D3AYI6_POLPA/6-35--------------------------------------------------------------------------Q-I-A.
D3AYI6_POLPA/79-108--------------------------------------------------------------------------E-M-L.
A2ERW3_TRIVA/9-39--------------------------------------------------------------------------A-I-E.
A2ERW3_TRIVA/82-111--------------------------------------------------------------------------Q-Y-K.
A7RV39_NEMVE/88-117--------------------------------------------------------------------------Y-F-M.
A2DT12_TRIVA/7-37--------------------------------------------------------------------------E-F-S.
A2DT12_TRIVA/80-109--------------------------------------------------------------------------L-T-K.
A4UNW1_CHICK/97-126--------------------------------------------------------------------------T-I-L.
A2DIY5_TRIVA/14-43--------------------------------------------------------------------------L-Y-K.
A2DIY5_TRIVA/85-114--------------------------------------------------------------------------E-L-T.
A8N2E2_COPC7/129-158--------------------------------------------------------------------------E-L-I.
A0CCH5_PARTE/297-326--------------------------------------------------------------------------D-F-L.
A0BPZ4_PARTE/198-233--------------------------------------------------------------------------V-A-R.
B6K7R4_SCHJY/10-39--------------------------------------------------------------------------E-M-N.
B6K7R4_SCHJY/79-108--------------------------------------------------------------------------E-F-I.
C3YGP7_BRAFL/22-51--------------------------------------------------------------------------K-I-T.
Q240Z1_TETTS/371-400--------------------------------------------------------------------------S-L-K.
Q240Z1_TETTS/445-474--------------------------------------------------------------------------K-I-W.
C3ZWG8_BRAFL/29-59--------------------------------------------------------------------------R-V-S.
Q7T2F7_DANRE/113-143--------------------------------------------------------------------------K-L-L.
B4LIU4_DROVI/12-41--------------------------------------------------------------------------E-L-K.
B4LIU4_DROVI/85-114--------------------------------------------------------------------------N-L-R.
A0C7B9_PARTE/44-73--------------------------------------------------------------------------R-V-R.
A0C7B9_PARTE/522-551--------------------------------------------------------------------------R-I-A.
D0NQW3_PHYIT/447-476--------------------------------------------------------------------------D-A-L.
B4KPB2_DROMO/13-42--------------------------------------------------------------------------E-L-R.
A7SK46_NEMVE/37-66--------------------------------------------------------------------------L-F-K.
A7SK46_NEMVE/105-134--------------------------------------------------------------------------I-I-L.
A7S7W7_NEMVE/508-546--------------------------------------------------------------------------T-L-N.
A7S7W7_NEMVE/583-612--------------------------------------------------------------------------K-W-M.
A9SC48_PHYPA/64-94--------------------------------------------------------------------------A-L-Y.
A9SC48_PHYPA/138-175--------------------------------------------------------------------------K-I-Q.
Q4N995_THEPA/859-892--------------------------------------------------------------------------S-L-K.
B8PFW7_POSPM/47-76--------------------------------------------------------------------------Q-F-R.
B8CDF2_THAPS/17-48--------------------------------------------------------------------------S-Y-A.
A2EWU3_TRIVA/26-55--------------------------------------------------------------------------E-L-R.
A2EWU3_TRIVA/99-128--------------------------------------------------------------------------D-L-K.
B9S960_RICCO/440-471--------------------------------------------------------------------------K-I-R.
D0N3P0_PHYIT/23-52--------------------------------------------------------------------------R-I-R.
D0N3P0_PHYIT/102-131--------------------------------------------------------------------------T-L-L.
D0NIV0_PHYIT/360-387--------------------------------------------------------------------------M-A-A.
C4R6X4_PICPG/24-55--------------------------------------------------------------------------R-Y-K.
B7PVC0_IXOSC/891-929--------------------------------------------------------------------------K-F-R.
A2F2K1_TRIVA/16-45--------------------------------------------------------------------------S-F-K.
A2F2K1_TRIVA/87-116--------------------------------------------------------------------------E-L-I.
B3MTC1_DROAN/109-140--------------------------------------------------------------------------L-Y-R.
B3DFQ1_DANRE/118-147--------------------------------------------------------------------------R-W-Q.
Q4DBB8_TRYCC/35-64--------------------------------------------------------------------------Q-L-R.
Q4DBB8_TRYCC/108-137--------------------------------------------------------------------------E-A-I.
B6AAA3_CRYMR/149-179--------------------------------------------------------------------------E-I-Q.
B6KGE8_TOXGO/199-230--------------------------------------------------------------------------K-V-V.
B8CB62_THAPS/13-42--------------------------------------------------------------------------E-F-A.
Q6CKI4_KLULA/78-107--------------------------------------------------------------------------D-F-I.
C5DMF9_LACTC/14-45--------------------------------------------------------------------------R-F-K.
A8J3S1_CHLRE/300-329--------------------------------------------------------------------------R-L-I.
A5DJ68_PICGU/64-95--------------------------------------------------------------------------Y-C-H.
A0CPY1_PARTE/103-143--------------------------------------------------------------------------K-A-N.
A8XS91_CAEBR/6-35--------------------------------------------------------------------------D-C-R.
A2DQT8_TRIVA/13-42--------------------------------------------------------------------------N-Y-K.
A2DQT8_TRIVA/83-112--------------------------------------------------------------------------E-L-V.
A0DCA4_PARTE/23-52--------------------------------------------------------------------------K-C-Y.
Q5KN37_CRYNJ/88-117--------------------------------------------------------------------------E-F-I.
A0BDG8_PARTE/301-330--------------------------------------------------------------------------D-L-E.
Q66HU4_DANRE/630-659--------------------------------------------------------------------------Q-W-Q.
C5LCN0_PERM5/396-425--------------------------------------------------------------------------D-M-R.
A9UUF1_MONBE/6-34--------------------------------------------------------------------------R-L-L.
C1EI49_MICSR/48-79--------------------------------------------------------------------------F-L-A.
B7PJB2_IXOSC/18-48--------------------------------------------------------------------------F-L-M.
B3M2P5_DROAN/85-114--------------------------------------------------------------------------E-L-K.
A8BSJ2_GIAIC/8-37--------------------------------------------------------------------------R-C-R.
A8J2K6_CHLRE/48-77--------------------------------------------------------------------------L-L-K.
A8XSA6_CAEBR/77-106--------------------------------------------------------------------------E-F-Q.
CBPF_DICDI/13-45--------------------------------------------------------------------------E-V-Q.
C8JQR9_CAEEL/144-173--------------------------------------------------------------------------K-L-A.
Q6FSJ6_CANGA/19-48--------------------------------------------------------------------------K-L-K.
A0BKS7_PARTE/17-46--------------------------------------------------------------------------A-A-K.
Q4DSH4_TRYCC/48-77--------------------------------------------------------------------------E-A-V.
Q4Y7U7_PLACH/93-122--------------------------------------------------------------------------K-I-K.
A9U253_PHYPA/229-258--------------------------------------------------------------------------T-L-K.
B0WB65_CULQU/256-285--------------------------------------------------------------------------R-K-A.
A4I3F5_LEIIN/12-41--------------------------------------------------------------------------F-F-R.
A4I3F5_LEIIN/85-114--------------------------------------------------------------------------E-V-R.
A0BU82_PARTE/29-57--------------------------------------------------------------------------E-L-H.
Q755U9_ASHGO/14-45--------------------------------------------------------------------------R-H-E.
A8I1S7_CHLRE/186-215--------------------------------------------------------------------------R-M-R.
A4HZA9_LEIIN/84-113--------------------------------------------------------------------------E-L-Y.
A0D306_PARTE/59-88--------------------------------------------------------------------------E-V-D.
Q4Q2P9_LEIMA/35-64--------------------------------------------------------------------------S-F-S.
A0E3G8_PARTE/176-205--------------------------------------------------------------------------N-F-Q.
A9V0G9_MONBE/68-97--------------------------------------------------------------------------A-I-A.
A7AQR4_BABBO/777-815--------------------------------------------------------------------------A-L-F.
A7AQR4_BABBO/875-908--------------------------------------------------------------------------S-L-R.
A4HBM1_LEIBR/11-40--------------------------------------------------------------------------R-A-S.
A0CNQ7_PARTE/356-385--------------------------------------------------------------------------S-L-R.
A0CNQ7_PARTE/435-464--------------------------------------------------------------------------R-I-W.
B3L806_PLAKH/94-123--------------------------------------------------------------------------K-I-R.
C3Y3X5_BRAFL/109-138--------------------------------------------------------------------------E-F-K.
C3Y3X5_BRAFL/178-207--------------------------------------------------------------------------V-L-L.
C5E2K8_LACTC/5-34--------------------------------------------------------------------------T-Q-K.
D0NMF2_PHYIT/62-91--------------------------------------------------------------------------F-F-R.
B9RGV3_RICCO/45-74--------------------------------------------------------------------------R-I-R.
A0DZF8_PARTE/406-435--------------------------------------------------------------------------S-L-V.
D0NPC8_PHYIT/30-59--------------------------------------------------------------------------L-L-R.
D3B753_POLPA/41-70--------------------------------------------------------------------------K-Y-K.
A7RJ54_NEMVE/73-101--------------------------------------------------------------------------E-I-R.
C3ZK54_BRAFL/145-176--------------------------------------------------------------------------R-D-L.
Q23CU0_TETTS/69-99--------------------------------------------------------------------------I-Y-K.
EFCB7_HUMAN/106-135--------------------------------------------------------------------------E-L-L.
A0A0D1DU76_USTMA/58-87--------------------------------------------------------------------------G-F-K.
A0BMA1_PARTE/125-154--------------------------------------------------------------------------E-I-K.
A7RI54_NEMVE/73-102--------------------------------------------------------------------------Q-W-K.
Q7RNY5_PLAYO/47-76--------------------------------------------------------------------------N-L-Q.
A8QGG8_BRUMA/91-120--------------------------------------------------------------------------E-M-H.
A0NGM4_ANOGA/720-749--------------------------------------------------------------------------K-W-K.
A0CQY7_PARTE/181-210--------------------------------------------------------------------------N-F-Q.
A2FZQ0_TRIVA/11-40--------------------------------------------------------------------------K-Y-K.
A2FZQ0_TRIVA/82-111--------------------------------------------------------------------------Q-L-I.
PLSI_BOVIN/15-46--------------------------------------------------------------------------E-L-Q.
A0BVC0_PARTE/355-384--------------------------------------------------------------------------K-L-Q.
A0BVC0_PARTE/444-473--------------------------------------------------------------------------K-L-W.
A8J258_CHLRE/12-41--------------------------------------------------------------------------A-V-L.
A8J258_CHLRE/85-114--------------------------------------------------------------------------E-H-R.
A0BLQ1_PARTE/56-85--------------------------------------------------------------------------K-Y-R.
A0BLQ1_PARTE/129-158--------------------------------------------------------------------------Q-L-V.
D3B3V9_POLPA/20-49--------------------------------------------------------------------------K-L-R.
C6WP87_ACTMD/55-86--------------------------------------------------------------------------W-W-E.
B0CEP3_ACAM1/69-106--------------------------------------------------------------------------P-L-E.
B4JQZ6_DROGR/12-41--------------------------------------------------------------------------K-M-R.
B4JQZ6_DROGR/95-124--------------------------------------------------------------------------Q-F-K.
B3RJS5_TRIAD/515-551--------------------------------------------------------------------------A-F-H.
B3RJS5_TRIAD/588-617--------------------------------------------------------------------------S-W-K.
B4LWK2_DROVI/652-680--------------------------------------------------------------------------E-F-R.
B4LWK2_DROVI/720-749--------------------------------------------------------------------------E-V-I.
Q236L3_TETTS/181-210--------------------------------------------------------------------------N-F-Q.
A9UU69_MONBE/7-36--------------------------------------------------------------------------D-I-K.
A9UU69_MONBE/73-102--------------------------------------------------------------------------E-T-M.
B3SAM3_TRIAD/385-414--------------------------------------------------------------------------R-L-I.
D0N7S9_PHYIT/33-62--------------------------------------------------------------------------L-M-R.
B4J628_DROGR/30-59--------------------------------------------------------------------------S-L-R.
C5DUR9_ZYGRC/19-48--------------------------------------------------------------------------R-L-K.
B8CFT6_THAPS/84-113--------------------------------------------------------------------------E-I-A.
C3YER0_BRAFL/167-196--------------------------------------------------------------------------S-F-R.
A8X3X6_CAEBR/106-135--------------------------------------------------------------------------Y-F-A.
A0BXL7_PARTE/42-71--------------------------------------------------------------------------N-L-H.
A0BXL7_PARTE/114-145--------------------------------------------------------------------------V-V-A.
A0DNH6_PARTE/2304-2334--------------------------------------------------------------------------D-L-F.
A8XVF9_CAEBR/36-65--------------------------------------------------------------------------R-L-F.
A0D1H3_PARTE/66-95--------------------------------------------------------------------------S-L-W.
A0D1H3_PARTE/181-210--------------------------------------------------------------------------Q-L-E.
B7PU66_IXOSC/252-281--------------------------------------------------------------------------Y-L-R.
A9UV27_MONBE/2126-2155--------------------------------------------------------------------------Q-I-F.
B4L3F1_DROMO/11-40--------------------------------------------------------------------------E-I-C.
B3RIN1_TRIAD/205-233--------------------------------------------------------------------------P-L-..
A5WWC4_DANRE/533-569--------------------------------------------------------------------------H-F-K.
A5WWC4_DANRE/606-635--------------------------------------------------------------------------K-Y-L.
A0D218_PARTE/76-105--------------------------------------------------------------------------Q-L-E.
C5LZ40_PERM5/40-69--------------------------------------------------------------------------K-Y-S.
C1E207_MICSR/45-75--------------------------------------------------------------------------R-L-M.
Q6FMX6_CANGA/187-217--------------------------------------------------------------------------I-A-I.
A7AP31_BABBO/33-62--------------------------------------------------------------------------E-V-E.
A2ETB6_TRIVA/14-43--------------------------------------------------------------------------E-L-Q.
Q6C7R0_YARLI/24-53--------------------------------------------------------------------------S-Y-A.
Q6C7R0_YARLI/130-160--------------------------------------------------------------------------R-V-R.
A7EII8_SCLS1/126-155--------------------------------------------------------------------------E-W-K.
B7Q3R8_IXOSC/111-140--------------------------------------------------------------------------E-I-V.
Q8SS75_ENCCU/23-52--------------------------------------------------------------------------E-L-R.
Q8SS75_ENCCU/92-121--------------------------------------------------------------------------S-I-F.
Q7RGT1_PLAYO/1340-1369--------------------------------------------------------------------------Y-I-N.
D0MWK2_PHYIT/425-454--------------------------------------------------------------------------V-I-R.
A0DI75_PARTE/65-94--------------------------------------------------------------------------E-T-E.
Q2R1L7_ORYSJ/123-154--------------------------------------------------------------------------E-V-K.
C5LG68_PERM5/14-43--------------------------------------------------------------------------E-A-K.
A2DMA5_TRIVA/14-43--------------------------------------------------------------------------S-L-Q.
C4QYA1_PICPG/220-250--------------------------------------------------------------------------I-M-M.
C4QYA1_PICPG/287-316--------------------------------------------------------------------------Y-W-E.
A7SIU0_NEMVE/415-444--------------------------------------------------------------------------R-V-V.
A2EU49_TRIVA/304-333--------------------------------------------------------------------------N-I-W.
A8HPL4_CHLRE/259-288--------------------------------------------------------------------------E-I-A.
CPNS2_HUMAN/153-182--------------------------------------------------------------------------K-W-Q.
Q4E300_TRYCC/191-222--------------------------------------------------------------------------P-V-K.
D0MRM4_PHYIT/32-61--------------------------------------------------------------------------Q-M-K.
Q6DG81_DANRE/12-43--------------------------------------------------------------------------E-L-R.
B4I7K3_DROSE/14-43--------------------------------------------------------------------------K-I-S.
C5DUA6_ZYGRC/18-49--------------------------------------------------------------------------R-Y-E.
A0CDJ6_PARTE/157-186--------------------------------------------------------------------------S-V-Q.
A0CRT3_PARTE/42-71--------------------------------------------------------------------------Q-I-M.
A0CRT3_PARTE/115-144--------------------------------------------------------------------------V-I-I.
C5KE42_PERM5/17-46--------------------------------------------------------------------------A-I-E.
A7RPN5_NEMVE/525-553--------------------------------------------------------------------------E-F-K.
A7RPN5_NEMVE/596-627--------------------------------------------------------------------------D-I-L.
C5KKB0_PERM5/33-64--------------------------------------------------------------------------Q-I-R.
A7RMQ1_NEMVE/11-40--------------------------------------------------------------------------E-L-K.
A7RMQ1_NEMVE/82-111--------------------------------------------------------------------------E-F-I.
Q5CZ29_CRYPI/514-545--------------------------------------------------------------------------N-L-R.
Q2A943_DANRE/33-62--------------------------------------------------------------------------Q-W-K.
A7S688_NEMVE/8-37--------------------------------------------------------------------------L-L-K.
A7S688_NEMVE/84-113--------------------------------------------------------------------------S-V-I.
D0NHY4_PHYIT/209-239--------------------------------------------------------------------------R-L-E.
Q4U8S4_THEAN/16-45--------------------------------------------------------------------------L-I-R.
C1FIV9_MICSR/85-114--------------------------------------------------------------------------T-M-L.
EFC13_HUMAN/456-485--------------------------------------------------------------------------T-L-E.
Q4SJD6_TETNG/29-56--------------------------------------------------------------------------V-L-H.
E8RNE1_ASTEC/46-76--------------------------------------------------------------------------E-I-K.
A0DCS1_PARTE/72-101--------------------------------------------------------------------------E-L-R.
Q9EMH8_AMEPV/24-53--------------------------------------------------------------------------N-I-R.
A0CH88_PARTE/390-419--------------------------------------------------------------------------S-L-Y.
A0CH88_PARTE/696-725--------------------------------------------------------------------------N-I-Q.
C4R1V0_PICPG/25-54--------------------------------------------------------------------------K-L-Q.
A7SHW4_NEMVE/108-138--------------------------------------------------------------------------K-V-K.
D0MWI5_PHYIT/661-691--------------------------------------------------------------------------H-V-G.
C3YCK9_BRAFL/241-275--------------------------------------------------------------------------M-L-M.
B3MPK2_DROAN/57-86--------------------------------------------------------------------------E-L-H.
A9RFM6_PHYPA/328-362--------------------------------------------------------------------------V-L-K.
Q4Z5E3_PLABA/655-693--------------------------------------------------------------------------A-L-F.
D2VTY7_NAEGR/97-134--------------------------------------------------------------------------L-L-R.
Q6BFU2_PARTE/195-224--------------------------------------------------------------------------L-A-E.
Q5ZLW0_CHICK/14-43--------------------------------------------------------------------------E-L-R.
B5Y4Q9_PHATC/8-42--------------------------------------------------------------------------D-L-R.
B5Y4Q9_PHATC/86-115--------------------------------------------------------------------------E-I-Q.
B7QKE4_IXOSC/612-641--------------------------------------------------------------------------Q-Y-I.
Q0V5Q9_PHANO/214-243--------------------------------------------------------------------------S-M-R.
Q4DIV1_TRYCC/166-195--------------------------------------------------------------------------A-I-Y.
Q7Q4L8_ANOGA/103-139--------------------------------------------------------------------------K-A-E.
A8XE93_CAEBR/628-657--------------------------------------------------------------------------K-A-K.
A7RJ83_NEMVE/514-548--------------------------------------------------------------------------E-F-W.
A7RJ83_NEMVE/585-614--------------------------------------------------------------------------K-W-K.
A4HWJ1_LEIIN/25-54--------------------------------------------------------------------------E-W-S.
A2EBQ1_TRIVA/14-43--------------------------------------------------------------------------T-L-H.
A2EBQ1_TRIVA/84-113--------------------------------------------------------------------------E-L-I.
Q4D662_TRYCC/188-217--------------------------------------------------------------------------Q-I-V.
Q4D662_TRYCC/269-298--------------------------------------------------------------------------E-A-L.
A0EFA3_PARTE/319-348--------------------------------------------------------------------------G-L-A.
A9RGD0_PHYPA/476-506--------------------------------------------------------------------------L-D-D.
Q8SRF8_ENCCU/100-129--------------------------------------------------------------------------R-I-R.
B8BV66_THAPS/328-359--------------------------------------------------------------------------G-L-R.
A7SIU1_NEMVE/364-393--------------------------------------------------------------------------R-A-V.
D0NLH6_PHYIT/779-808--------------------------------------------------------------------------E-I-K.
C1MVN8_MICPC/105-141--------------------------------------------------------------------------K-I-R.
B5DN90_DROPS/53-82--------------------------------------------------------------------------R-L-G.
A0BWN9_PARTE/584-613--------------------------------------------------------------------------N-I-Y.
A0DZH6_PARTE/32-61--------------------------------------------------------------------------E-L-Y.
Q5CTT5_CRYPI/66-93--------------------------------------------------------------------------I-L-R.
A0C693_PARTE/354-383--------------------------------------------------------------------------K-L-S.
A7SZ62_NEMVE/480-509--------------------------------------------------------------------------R-L-V.
C1MZG1_MICPC/117-146--------------------------------------------------------------------------E-I-R.
Q4DZ37_TRYCC/328-358--------------------------------------------------------------------------V-L-E.
B3RKL5_TRIAD/438-467--------------------------------------------------------------------------R-I-I.
A2Q7S2_ASPNC/15-46--------------------------------------------------------------------------E-L-K.
C1E2H7_MICSR/61-97--------------------------------------------------------------------------G-L-A.
A9SRE6_PHYPA/269-299--------------------------------------------------------------------------Y-L-Q.
C1FI51_MICSR/18-54--------------------------------------------------------------------------K-I-K.
B8MY97_ASPFN/34-63--------------------------------------------------------------------------H-R-G.
B3S580_TRIAD/58-91--------------------------------------------------------------------------M-V-M.
C5KSZ3_PERM5/370-399--------------------------------------------------------------------------A-L-K.
D0N582_PHYIT/1409-1438--------------------------------------------------------------------------Q-L-A.
B7G8H4_PHATC/377-408--------------------------------------------------------------------------N-L-I.
A0E9E9_PARTE/44-75--------------------------------------------------------------------------I-V-T.
A7RMQ2_NEMVE/10-39--------------------------------------------------------------------------E-F-R.
A7RMQ2_NEMVE/82-111--------------------------------------------------------------------------D-F-L.
B6AAT1_CRYMR/92-121--------------------------------------------------------------------------E-L-I.
Q1DGU0_AEDAE/85-114--------------------------------------------------------------------------M-L-G.
C4VC48_NOSCE/64-95--------------------------------------------------------------------------F-V-F.
B4M210_DROVI/76-106--------------------------------------------------------------------------K-M-R.
D0N398_PHYIT/276-305--------------------------------------------------------------------------Y-L-S.
A0A0D1CVJ0_USTMA/739-769--------------------------------------------------------------------------E-L-R.
EFCB9_HUMAN/28-56--------------------------------------------------------------------------A-L-A.
A4HY14_LEIIN/110-138--------------------------------------------------------------------------Y-Y-D.
A0BNY1_PARTE/42-71--------------------------------------------------------------------------M-M-K.
A9RBC3_PHYPA/187-216--------------------------------------------------------------------------Q-I-C.
A8P593_BRUMA/121-151--------------------------------------------------------------------------K-L-K.
CEX1_CAEEL/29-68--------------------------------------------------------------------------K-W-E.
A7SPN7_NEMVE/582-611--------------------------------------------------------------------------Y-Y-K.
A4FU16_HUMAN/38-67--------------------------------------------------------------------------H-W-K.
C3YAW3_BRAFL/215-244--------------------------------------------------------------------------R-L-L.
D2V6N0_NAEGR/12-41--------------------------------------------------------------------------Q-F-K.
D2V6N0_NAEGR/215-245--------------------------------------------------------------------------N-M-D.
Q5CUC1_CRYPI/325-356--------------------------------------------------------------------------K-I-H.
D2VL69_NAEGR/86-115--------------------------------------------------------------------------Q-L-L.
B8BVX2_THAPS/190-219--------------------------------------------------------------------------A-I-I.
A2FS38_TRIVA/86-115--------------------------------------------------------------------------E-I-D.
A9V750_MONBE/19-48--------------------------------------------------------------------------Q-I-A.
C5LX97_PERM5/270-303--------------------------------------------------------------------------R-I-V.
A2FHL4_TRIVA/83-112--------------------------------------------------------------------------Q-Y-K.
A9FD96_SORC5/187-216--------------------------------------------------------------------------F-A-W.
Q6BG59_PARTE/363-394--------------------------------------------------------------------------E-I-Y.
A0DQE8_PARTE/49-78--------------------------------------------------------------------------V-I-K.
A2DGG1_TRIVA/1002-1031--------------------------------------------------------------------------E-F-R.
A8IAC5_CHLRE/27-56--------------------------------------------------------------------------M-I-E.
C3YFC2_BRAFL/86-117--------------------------------------------------------------------------R-I-S.
A9VC94_MONBE/198-229--------------------------------------------------------------------------F-A-A.
C5KSU3_PERM5/80-110--------------------------------------------------------------------------P-I-A.
C5L8H3_PERM5/62-92--------------------------------------------------------------------------T-C-R.
Q4UF53_THEAN/443-471--------------------------------------------------------------------------E-V-Y.
A8XPA0_CAEBR/61-90--------------------------------------------------------------------------E-V-F.
A2FQM2_TRIVA/14-43--------------------------------------------------------------------------E-V-R.
A7RTI1_NEMVE/216-246--------------------------------------------------------------------------D-M-F.
C5LI98_PERM5/493-523--------------------------------------------------------------------------Q-M-R.
B6AJS6_CRYMR/55-84--------------------------------------------------------------------------R-F-G.
A0D0W9_PARTE/274-302--------------------------------------------------------------------------N-L-N.
A2E466_TRIVA/79-108--------------------------------------------------------------------------E-L-V.
C1N3J2_MICPC/18-47--------------------------------------------------------------------------M-L-H.
D2VIE2_NAEGR/8-38--------------------------------------------------------------------------D-I-E.
Q7QIB4_ANOGA/279-317--------------------------------------------------------------------------K-L-E.
Q8T5H8_ANOGA/12-41--------------------------------------------------------------------------K-A-Q.
D0N994_PHYIT/33-63--------------------------------------------------------------------------L-L-R.
C1MU07_MICPC/540-583--------------------------------------------------------------------------E-M-R.
B0XJB8_CULQU/36-75--------------------------------------------------------------------------Q-F-M.
A8J3A0_CHLRE/99-128--------------------------------------------------------------------------T-L-L.
D0MVE6_PHYIT/210-253--------------------------------------------------------------------------L-M-I.
Q5CPW8_CRYPI/89-118--------------------------------------------------------------------------D-A-V.
Q6NYK0_DANRE/29-57--------------------------------------------------------------------------K-L-H.
D4AID5_ARTBC/715-746--------------------------------------------------------------------------F-L-K.
O97201_LEIMA/270-300--------------------------------------------------------------------------Q-L-V.
B3M0N0_DROAN/117-151--------------------------------------------------------------------------K-L-Q.
A9UXC0_MONBE/17-46--------------------------------------------------------------------------L-L-R.
A2F622_TRIVA/94-129--------------------------------------------------------------------------F-I-Q.
CAN11_RAT/548-584--------------------------------------------------------------------------N-S-V.
B4QEJ5_DROSI/103-132--------------------------------------------------------------------------K-I-L.
A8JI98_CHLRE/149-179--------------------------------------------------------------------------A-A-M.
D3ZRP1_RAT/120-151--------------------------------------------------------------------------G-L-G.
B4MVV8_DROWI/30-59--------------------------------------------------------------------------R-I-R.
C4IYW7_MAIZE/57-84--------------------------------------------------------------------------K-C-K.
A2FJN7_TRIVA/18-47--------------------------------------------------------------------------E-A-K.
B6AIK9_CRYMR/17-46--------------------------------------------------------------------------A-V-R.
A9UQV7_MONBE/115-144--------------------------------------------------------------------------R-A-E.
A9SXN2_PHYPA/278-307--------------------------------------------------------------------------E-V-D.
Q4YSX9_PLABA/63-94--------------------------------------------------------------------------K-A-K.
B9R7E2_RICCO/18-47--------------------------------------------------------------------------E-F-K.
A0E9R2_PARTE/21-50--------------------------------------------------------------------------K-I-L.
D0N6S6_PHYIT/203-232--------------------------------------------------------------------------N-A-R.
Q4Q156_LEIMA/33-65--------------------------------------------------------------------------R-I-Q.
A7RPN6_NEMVE/2-31--------------------------------------------------------------------------E-F-E.
A4H5I7_LEIBR/177-206--------------------------------------------------------------------------K-L-R.
C1ECT5_MICSR/271-300--------------------------------------------------------------------------T-P-R.
A9V6X3_MONBE/1141-1170--------------------------------------------------------------------------E-M-E.
C3ZP66_BRAFL/54-83--------------------------------------------------------------------------S-S-K.
C0H4A2_PLAF7/13-41--------------------------------------------------------------------------E-I-E.
A9VBY6_MONBE/239-268--------------------------------------------------------------------------W-L-R.
D2UXJ1_NAEGR/416-444--------------------------------------------------------------------------Y-F-N.
B4MM19_DROWI/36-65--------------------------------------------------------------------------T-I-K.
Q4DRI4_TRYCC/49-79--------------------------------------------------------------------------R-R-I.
B3S1G2_TRIAD/152-183--------------------------------------------------------------------------K-I-E.
CIB4_MOUSE/101-132--------------------------------------------------------------------------K-I-E.
C1EBS6_MICSR/387-416--------------------------------------------------------------------------E-L-R.
B4N916_DROWI/114-145--------------------------------------------------------------------------K-M-Q.
Q8IE29_PLAF7/251-282--------------------------------------------------------------------------K-A-L.
CAN8_MOUSE/536-572--------------------------------------------------------------------------H-F-W.
A0BF71_PARTE/385-419--------------------------------------------------------------------------Q-I-Q.
B0WSM1_CULQU/659-688--------------------------------------------------------------------------Q-W-Q.
Q32KM4_BOVIN/68-99--------------------------------------------------------------------------L-M-N.
D2V5I4_NAEGR/35-64--------------------------------------------------------------------------Q-A-Q.
CAN11_MOUSE/547-583--------------------------------------------------------------------------D-S-L.
A7RK77_NEMVE/68-97--------------------------------------------------------------------------T-T-R.
A0C4R5_PARTE/23-53--------------------------------------------------------------------------D-L-K.
Q4QBQ5_LEIMA/330-359--------------------------------------------------------------------------R-F-V.
B4LJI0_DROVI/124-155--------------------------------------------------------------------------R-M-Q.
C3YQL6_BRAFL/328-359--------------------------------------------------------------------------K-F-L.
A0C1C8_PARTE/336-372--------------------------------------------------------------------------Q-I-E.
D0NH53_PHYIT/26-55--------------------------------------------------------------------------D-L-R.
RFIP3_DANRE/710-739--------------------------------------------------------------------------A-L-R.
A0DZK5_PARTE/70-97--------------------------------------------------------------------------Q-I-Y.
EFCB3_BOVIN/51-80--------------------------------------------------------------------------A-F-Q.
C1EDZ9_MICSR/29-59--------------------------------------------------------------------------S-T-Q.
C1N631_MICPC/47-78--------------------------------------------------------------------------F-L-E.
C1MXG3_MICPC/631-660--------------------------------------------------------------------------Q-V-G.
Q6DFZ8_DANRE/606-635--------------------------------------------------------------------------L-F-V.
C5LJH8_PERM5/404-433--------------------------------------------------------------------------E-V-V.
B9RD69_RICCO/210-239--------------------------------------------------------------------------E-L-V.
Q4DDH8_TRYCC/10-40--------------------------------------------------------------------------D-I-L.
A0CSU8_PARTE/30-61--------------------------------------------------------------------------S-L-K.
C5KYQ1_PERM5/23-54--------------------------------------------------------------------------H-L-H.
A2CE70_DANRE/30-58--------------------------------------------------------------------------R-L-Y.
C5L8Y2_PERM5/254-290--------------------------------------------------------------------------A-L-K.
A7SHJ6_NEMVE/330-359--------------------------------------------------------------------------G-I-V.
A0C9U0_PARTE/401-432--------------------------------------------------------------------------N-I-R.
A9RZV6_PHYPA/322-351--------------------------------------------------------------------------Q-M-K.
A0CIN3_PARTE/412-441--------------------------------------------------------------------------M-A-R.
A7RLF8_NEMVE/106-135--------------------------------------------------------------------------M-M-N.
C3ZDD3_BRAFL/389-419--------------------------------------------------------------------------E-H-Y.
A8X343_CAEBR/192-230--------------------------------------------------------------------------K-L-D.
C5L7A7_PERM5/27-55--------------------------------------------------------------------------E-Y-E.
B3RJJ4_TRIAD/113-142--------------------------------------------------------------------------A-A-E.
A7T7P5_NEMVE/35-64--------------------------------------------------------------------------E-L-L.
A8IMX5_CHLRE/147-180--------------------------------------------------------------------------L-M-E.
Q8STQ3_ENCCU/76-105--------------------------------------------------------------------------E-L-Q.
Q6FSU4_CANGA/603-632--------------------------------------------------------------------------F-L-K.
D0NT24_PHYIT/227-256--------------------------------------------------------------------------R-M-R.
Q5ZJB5_CHICK/68-103--------------------------------------------------------------------------E-L-Q.
Q4CS95_TRYCC/33-65--------------------------------------------------------------------------K-L-Q.
Q00WG8_OSTTA/33-61--------------------------------------------------------------------------A-L-Y.
RASEF_XENTR/9-38--------------------------------------------------------------------------R-L-R.
Q6TXM2_STRPU/582-611--------------------------------------------------------------------------S-L-T.
D2VGQ0_NAEGR/231-261--------------------------------------------------------------------------Y-L-K.
D0MVJ8_PHYIT/2641-2670--------------------------------------------------------------------------D-V-G.
A9V7D4_MONBE/231-262--------------------------------------------------------------------------L-A-T.
C5LFC0_PERM5/84-113--------------------------------------------------------------------------R-L-I.
B7G332_PHATC/130-165--------------------------------------------------------------------------L-M-R.
B3S581_TRIAD/59-96--------------------------------------------------------------------------M-N-F.
Q4XYU2_PLACH/524-554--------------------------------------------------------------------------S-L-Y.
B0CNF8_LACBS/51-83--------------------------------------------------------------------------D-I-G.
A0E1J3_PARTE/38-73--------------------------------------------------------------------------V-A-R.
D3BGC9_POLPA/56-86--------------------------------------------------------------------------A-L-R.
C1N8S9_MICPC/55-85--------------------------------------------------------------------------G-I-G.
B3RSL0_TRIAD/112-148--------------------------------------------------------------------------K-A-A.
C1MSB0_MICPC/627-658--------------------------------------------------------------------------A-A-R.
C3YY99_BRAFL/15-44--------------------------------------------------------------------------L-F-K.
B8C8A3_THAPS/287-317--------------------------------------------------------------------------L-L-R.
D7AV60_NOCDD/14-45--------------------------------------------------------------------------E-A-R.
Q94LH2_ORYSJ/29-58--------------------------------------------------------------------------E-F-K.
A8Q891_MALGO/17-46--------------------------------------------------------------------------Q-L-Q.
C5LPQ5_PERM5/9-38--------------------------------------------------------------------------L-I-E.
A8IJ90_CHLRE/3-32--------------------------------------------------------------------------E-F-R.
B7G8B5_PHATC/86-115--------------------------------------------------------------------------N-M-Q.
A4I9Q9_LEIIN/181-211--------------------------------------------------------------------------A-V-G.
C5LIS6_PERM5/226-255--------------------------------------------------------------------------E-L-Q.
C6KTA8_PLAF7/77-106--------------------------------------------------------------------------G-L-L.
A0CSB1_PARTE/153-182--------------------------------------------------------------------------N-V-K.
B9PLU7_TOXGO/4-33--------------------------------------------------------------------------N-L-E.
Q4DPM5_TRYCC/184-213--------------------------------------------------------------------------R-I-R.
B8LD33_THAPS/828-857--------------------------------------------------------------------------I-F-I.
C1MUU0_MICPC/12-42--------------------------------------------------------------------------Q-M-K.
C3YUG8_BRAFL/425-454--------------------------------------------------------------------------M-H-R.
Q4U8G1_THEAN/76-105--------------------------------------------------------------------------N-L-T.
A7SXZ3_NEMVE/9-37--------------------------------------------------------------------------I-F-L.
Q8IJ97_PLAF7/12-41--------------------------------------------------------------------------L-F-E.
A0BF28_PARTE/345-376--------------------------------------------------------------------------A-M-M.
Q4E2K6_TRYCC/617-646--------------------------------------------------------------------------R-F-H.
Q4E1U1_TRYCC/7-40--------------------------------------------------------------------------A-L-M.
A0C5R3_PARTE/309-338--------------------------------------------------------------------------S-I-S.
A0ED28_PARTE/72-103--------------------------------------------------------------------------E-I-R.
D2VR29_NAEGR/607-636--------------------------------------------------------------------------K-F-V.
B8BSH1_THAPS/111-142--------------------------------------------------------------------------L-L-T.
Q5KAJ1_CRYNJ/665-697--------------------------------------------------------------------------L-I-D.
C3YDH3_BRAFL/26-58--------------------------------------------------------------------------E-L-E.
B3S2Z7_TRIAD/64-96--------------------------------------------------------------------------E-K-L.
A2DPY5_TRIVA/83-112--------------------------------------------------------------------------E-L-I.
C5KLK8_PERM5/99-128--------------------------------------------------------------------------R-L-R.
A0D7T4_PARTE/77-106--------------------------------------------------------------------------E-L-T.
A0DSQ2_PARTE/47-76--------------------------------------------------------------------------D-L-N.
C1FHF3_MICSR/35-68--------------------------------------------------------------------------Q-A-K.
A0BCE1_PARTE/120-149--------------------------------------------------------------------------L-L-E.
B7FPG8_PHATC/98-128--------------------------------------------------------------------------R-A-E.
C3XQZ6_BRAFL/437-468--------------------------------------------------------------------------R-L-I.
Q22DM3_TETTS/41-68--------------------------------------------------------------------------R-L-R.
C7YTC4_NECH7/525-554--------------------------------------------------------------------------F-W-R.
D3BH77_POLPA/977-1008--------------------------------------------------------------------------Q-Y-Q.
B7PAY1_IXOSC/102-130--------------------------------------------------------------------------V-I-V.
A8WRH5_CAEBR/109-138--------------------------------------------------------------------------Y-A-E.
C5KU24_PERM5/19-48--------------------------------------------------------------------------D-E-R.
CAN11_HUMAN/571-609--------------------------------------------------------------------------D-F-L.
D0MUI2_PHYIT/445-475--------------------------------------------------------------------------T-I-K.
A0BTT3_PARTE/62-91--------------------------------------------------------------------------E-L-K.
A0DVD9_PARTE/23-52--------------------------------------------------------------------------D-I-N.
C3ZDD2_BRAFL/477-508--------------------------------------------------------------------------H-H-F.
B8BTK8_THAPS/174-205--------------------------------------------------------------------------R-E-Y.
B8CFD8_THAPS/313-348--------------------------------------------------------------------------D-L-R.
A2AB62_MOUSE/109-138--------------------------------------------------------------------------A-F-Q.
C3Y3L2_BRAFL/18-48--------------------------------------------------------------------------M-A-Q.
A0EAZ9_PARTE/45-80--------------------------------------------------------------------------V-A-R.
C5LYE4_PERM5/81-110--------------------------------------------------------------------------S-L-R.
D3BHC5_POLPA/246-276--------------------------------------------------------------------------T-L-R.
CDPKP_ARATH/437-466--------------------------------------------------------------------------E-L-R.
B9R7D2_RICCO/19-48--------------------------------------------------------------------------Q-M-K.
B3RQP5_TRIAD/251-279--------------------------------------------------------------------------R-F-L.
C3YEV6_BRAFL/628-656--------------------------------------------------------------------------R-Y-T.
A1CBB6_ASPCL/49-87--------------------------------------------------------------------------S-F-DP
C3Z5Z5_BRAFL/533-562--------------------------------------------------------------------------D-I-Q.
D0NH29_PHYIT/57-87--------------------------------------------------------------------------R-M-N.
B7XIJ8_ENTBH/72-101--------------------------------------------------------------------------N-I-D.
A0DMG4_PARTE/351-381--------------------------------------------------------------------------Y-L-K.
C3YV00_BRAFL/85-114--------------------------------------------------------------------------L-A-G.
B7FUB0_PHATC/1084-1115--------------------------------------------------------------------------L-L-S.
C3ZH49_BRAFL/1174-1204--------------------------------------------------------------------------K-F-L.
A7RK79_NEMVE/188-218--------------------------------------------------------------------------T-T-E.
B3S1A6_TRIAD/67-96--------------------------------------------------------------------------E-L-..
Q29IA0_DROPS/39-68--------------------------------------------------------------------------N-L-R.
A4S9A6_OSTLU/2128-2162--------------------------------------------------------------------------P-.-M.
A0CCU0_PARTE/82-111--------------------------------------------------------------------------N-F-E.
B7Q350_IXOSC/1399-1442--------------------------------------------------------------------------D-F-DP
C1MT69_MICPC/45-75--------------------------------------------------------------------------S-F-R.
A9URG6_MONBE/582-611--------------------------------------------------------------------------R-A-C.
B7PQS4_IXOSC/34-61--------------------------------------------------------------------------K-A-L.
A0BSR5_PARTE/180-209--------------------------------------------------------------------------L-L-Y.
A0BM15_PARTE/63-92--------------------------------------------------------------------------E-L-K.
Q29GA6_DROPS/127-159--------------------------------------------------------------------------K-M-R.
Q4E142_TRYCC/257-286--------------------------------------------------------------------------A-D-H.
B3L1G0_PLAKH/13-41--------------------------------------------------------------------------E-I-E.
B8C031_THAPS/320-349--------------------------------------------------------------------------L-L-K.
A8XF67_CAEBR/57-86--------------------------------------------------------------------------K-F-..
Q38C77_TRYB2/16-45--------------------------------------------------------------------------D-L-Q.
Q4U910_THEAN/477-506--------------------------------------------------------------------------E-L-K.
B7PG89_IXOSC/60-90--------------------------------------------------------------------------W-W-N.
B8NHB5_ASPFN/61-89--------------------------------------------------------------------------D-F-L.
C3ZYS2_BRAFL/1605-1634--------------------------------------------------------------------------K-S-R.
A9VCA0_MONBE/80-109--------------------------------------------------------------------------D-V-L.
A7SIS2_NEMVE/98-139--------------------------------------------------------------------------G-I-F.
B0DIL9_LACBS/626-655--------------------------------------------------------------------------F-I-D.
C7G032_DICDI/508-537--------------------------------------------------------------------------L-L-D.
D2A071_TRICA/143-179--------------------------------------------------------------------------E-L-E.
A0EAP2_PARTE/324-354--------------------------------------------------------------------------S-M-M.
A8P2X2_COPC7/487-516--------------------------------------------------------------------------F-W-R.
A0DU71_PARTE/549-578--------------------------------------------------------------------------L-A-K.
Q8LKK4_CHLRE/572-601--------------------------------------------------------------------------A-V-R.
Q54E45_DICDI/138-166--------------------------------------------------------------------------Q-L-E.
A0ECX0_PARTE/269-298--------------------------------------------------------------------------D-L-Q.
Q4DLY4_TRYCC/95-128--------------------------------------------------------------------------V-I-R.
B7Q8D4_IXOSC/82-118--------------------------------------------------------------------------T-V-F.
D0N3C9_PHYIT/174-204--------------------------------------------------------------------------E-I-R.
C5KYD8_PERM5/173-202--------------------------------------------------------------------------K-I-R.
A9V4G2_MONBE/147-180--------------------------------------------------------------------------W-I-K.
A9UU76_MONBE/93-122--------------------------------------------------------------------------T-L-Y.
CGRE1_MOUSE/75-112--------------------------------------------------------------------------V-L-L.
D0NLT0_PHYIT/68-97--------------------------------------------------------------------------L-S-G.
A5KCC4_PLAVS/562-593--------------------------------------------------------------------------F-L-K.
Q54EU2_DICDI/187-217--------------------------------------------------------------------------V-L-R.
A8WXW8_CAEBR/591-622--------------------------------------------------------------------------Q-I-A.
Q5Z905_ORYSJ/274-303--------------------------------------------------------------------------E-L-L.
A0A0D1DQL2_USTMA/20-49--------------------------------------------------------------------------G-L-I.
A2EYC2_TRIVA/29-61--------------------------------------------------------------------------K-L-K.
A0DQ90_PARTE/27-67--------------------------------------------------------------------------R-I-H.
B4NGA9_DROWI/115-153--------------------------------------------------------------------------K-S-E.
D0NB87_PHYIT/1035-1065--------------------------------------------------------------------------R-L-R.
B6K3A4_SCHJY/20-48--------------------------------------------------------------------------T-L-T.
C4Y9V5_CLAL4/13-44--------------------------------------------------------------------------Q-V-R.
Q2H4R6_CHAGB/754-784--------------------------------------------------------------------------F-L-Q.
A7SHV8_NEMVE/147-177--------------------------------------------------------------------------G-I-V.
A4I027_LEIIN/173-200--------------------------------------------------------------------------K-I-M.
B3MG51_DROAN/125-154--------------------------------------------------------------------------K-M-E.
EFCB8_MOUSE/115-143--------------------------------------------------------------------------D-L-Q.
A5K8W6_PLAVS/148-177--------------------------------------------------------------------------E-L-I.
A8P5P9_BRUMA/6-33--------------------------------------------------------------------------E-L-K.
B8LWL3_TALSN/221-250--------------------------------------------------------------------------E-I-L.
C4LT56_ENTHI/7-35--------------------------------------------------------------------------.-I-D.
C4LUQ9_ENTHI/16-43--------------------------------------------------------------------------E-L-K.
F1R647_DANRE/83-111--------------------------------------------------------------------------.-M-E.
F7GNT1_CALJA/685-713--------------------------------------------------------------------------E-F-R.
G3HZP5_CRIGR/33-62--------------------------------------------------------------------------E-F-K.
H0ZMF4_TAEGU/54-83--------------------------------------------------------------------------D-F-K.
H2VC11_TAKRU/55-86--------------------------------------------------------------------------E-F-R.
H3CP38_TETNG/179-208--------------------------------------------------------------------------.-M-K.
I1LLG5_SOYBN/78-108--------------------------------------------------------------------------D-L-E.
M9MSK2_DROME/7-36--------------------------------------------------------------------------Y-L-R.
Q236J2_TETTS/59-87--------------------------------------------------------------------------E-I-E.
Q38AA2_TRYB2/25-54--------------------------------------------------------------------------D-I-K.
Q38EV6_TRYB2/74-103--------------------------------------------------------------------------D-L-R.
CML9_ORYSJ/91-119--------------------------------------------------------------------------.-L-A.
Q8LHQ5_ORYSJ/28-57--------------------------------------------------------------------------R-F-K.

PF00036

S10AC_RABIT/53-81--------------------------------------------------------------------------T-V-D-
UCP8_SCHPO/337-365--------------------------------------------------------------------------E-L-A-
RPTN_MOUSE/53-81--------------------------------------------------------------------------T-V-E-
2AB2E_ARATH/385-413--------------------------------------------------------------------------S-L-E-
RBOHE_ARATH/272-300--------------------------------------------------------------------------R-L-Q-
CALM4_ARATH/48-76--------------------------------------------------------------------------E-L-Q-
CALM4_ARATH/85-113--------------------------------------------------------------------------E-L-K-
CALM4_ARATH/121-149--------------------------------------------------------------------------E-V-E-
YLJ5_CAEEL/51-79--------------------------------------------------------------------------K-V-F-
YLJ5_CAEEL/87-115--------------------------------------------------------------------------V-V-Q-
DGK3_CAEEL/174-202--------------------------------------------------------------------------K-L-D-
DGK3_CAEEL/219-247--------------------------------------------------------------------------V-I-R-
Q21408_CAEEL/2329-2357--------------------------------------------------------------------------E-F-Q-
END3_EMENI/46-74--------------------------------------------------------------------------Q-L-E-
EP15R_MOUSE/276-304--------------------------------------------------------------------------R-F-D-
Q94288_CAEEL/100-128--------------------------------------------------------------------------E-F-K-
Q94288_CAEEL/136-164--------------------------------------------------------------------------Q-M-M-
Q94288_CAEEL/172-200--------------------------------------------------------------------------M-I-R-
CAN9_MOUSE/595-623--------------------------------------------------------------------------H-W-M-
CABP1_HUMAN/343-370--------------------------------------------------------------------------D-I-E-
O16343_CAEEL/114-142--------------------------------------------------------------------------K-L-R-
O16343_CAEEL/155-183--------------------------------------------------------------------------I-A-D-
PLSL_HUMAN/13-41--------------------------------------------------------------------------E-L-R-
PLSL_HUMAN/53-81--------------------------------------------------------------------------I-T-E-
DGKG_HUMAN/179-207--------------------------------------------------------------------------K-L-E-
DGKG_HUMAN/224-252--------------------------------------------------------------------------I-L-K-
RYR2_HUMAN/4027-4055--------------------------------------------------------------------------T-S-S-
GPDM_HUMAN/627-655--------------------------------------------------------------------------R-Y-K-
GPDM_HUMAN/663-691--------------------------------------------------------------------------T-L-H-
DGKA_HUMAN/114-142--------------------------------------------------------------------------K-L-E-
DGKA_HUMAN/159-187--------------------------------------------------------------------------I-L-Q-
Q93640_CAEEL/121-149--------------------------------------------------------------------------K-L-K-
Q93640_CAEEL/162-190--------------------------------------------------------------------------I-I-E-
ITSN2_MOUSE/58-86--------------------------------------------------------------------------V-L-A-
ITSN2_MOUSE/282-310--------------------------------------------------------------------------Q-L-A-
CALML_DICDI/10-38--------------------------------------------------------------------------L-Y-K-
CALML_DICDI/46-73--------------------------------------------------------------------------E-L-K-
CALML_DICDI/82-110--------------------------------------------------------------------------D-I-K-
CAM2_SCHPO/10-38--------------------------------------------------------------------------E-M-K-
CAM2_SCHPO/79-107--------------------------------------------------------------------------E-Y-I-
CAN9_HUMAN/565-593--------------------------------------------------------------------------S-C-K-
CAN9_HUMAN/595-623--------------------------------------------------------------------------Q-W-I-
PPE1_HUMAN/570-598--------------------------------------------------------------------------D-L-E-
PPE1_HUMAN/610-638--------------------------------------------------------------------------Q-V-N-
PPE2_HUMAN/572-600--------------------------------------------------------------------------D-L-L-
PPE2_HUMAN/656-684--------------------------------------------------------------------------N-L-E-
O16158_DROME/11-39--------------------------------------------------------------------------L-L-F-
O16158_DROME/62-90--------------------------------------------------------------------------I-W-T-
O16158_DROME/104-132--------------------------------------------------------------------------Y-M-N-
O18058_CAEEL/24-52--------------------------------------------------------------------------E-F-A-
O18058_CAEEL/60-88--------------------------------------------------------------------------E-L-L-
O18058_CAEEL/96-124--------------------------------------------------------------------------L-I-R-
O18058_CAEEL/132-160--------------------------------------------------------------------------E-V-D-
SCMC1_RABIT/23-51--------------------------------------------------------------------------R-Y-E-
SCMC1_RABIT/59-87--------------------------------------------------------------------------A-E-E-
SCMC1_RABIT/90-118--------------------------------------------------------------------------K-M-K-
CML5_ARATH/65-93--------------------------------------------------------------------------E-L-K-
CML5_ARATH/101-129--------------------------------------------------------------------------D-L-T-
CML5_ARATH/143-171--------------------------------------------------------------------------D-M-K-
CML5_ARATH/181-209--------------------------------------------------------------------------G-C-K-
Y1515_ARATH/10-38--------------------------------------------------------------------------K-V-K-
CML19_ARATH/27-55--------------------------------------------------------------------------E-I-R-
CML19_ARATH/63-91--------------------------------------------------------------------------Q-I-N-
CML19_ARATH/100-128--------------------------------------------------------------------------E-L-S-
CML19_ARATH/136-164--------------------------------------------------------------------------D-I-E-
CML8_ARATH/49-77--------------------------------------------------------------------------E-L-H-
PPE2_MOUSE/576-604--------------------------------------------------------------------------D-L-L-
PPE2_MOUSE/700-728--------------------------------------------------------------------------G-I-C-
ONCO_CAVPO/43-71--------------------------------------------------------------------------Q-V-K-
ONCO_CAVPO/82-109--------------------------------------------------------------------------E-T-K-
CALU_RAT/72-100--------------------------------------------------------------------------K-L-G-
CALU_RAT/108-136--------------------------------------------------------------------------N-V-E-
CHP2_HUMAN/115-143--------------------------------------------------------------------------K-L-H-
CHP2_HUMAN/156-184--------------------------------------------------------------------------I-A-D-
CALU_HUMAN/72-100--------------------------------------------------------------------------R-L-G-
CALU_HUMAN/192-220--------------------------------------------------------------------------V-V-Q-
O45313_CAEEL/236-262--------------------------------------------------------------------------R-A-T-
GEM1_SCHPO/188-216--------------------------------------------------------------------------A-L-S-
GEM1_SCHPO/308-336--------------------------------------------------------------------------F-L-V-
FIMB_SCHPO/55-83--------------------------------------------------------------------------E-V-R-
CALM_KLULA/12-40--------------------------------------------------------------------------E-F-K-
CALM_KLULA/48-76--------------------------------------------------------------------------E-V-A-
CALM_KLULA/85-113--------------------------------------------------------------------------E-L-L-
CALM_KLULA/121-147--------------------------------------------------------------------------E-V-D-
O61604_DROME/18-46--------------------------------------------------------------------------E-I-K-
O64866_ARATH/24-52--------------------------------------------------------------------------S-V-D-
O64866_ARATH/73-101--------------------------------------------------------------------------L-Y-D-
CDC31_SCHPO/38-66--------------------------------------------------------------------------D-I-N-
CDC31_SCHPO/74-102--------------------------------------------------------------------------E-V-L-
CDC31_SCHPO/147-175--------------------------------------------------------------------------E-L-E-
CMC1_HUMAN/90-118--------------------------------------------------------------------------M-F-I-
CMC1_HUMAN/161-189--------------------------------------------------------------------------H-A-R-
CIB2_HUMAN/107-135--------------------------------------------------------------------------K-A-N-
CIB2_HUMAN/148-176--------------------------------------------------------------------------V-C-D-
SEGN_HUMAN/16-44--------------------------------------------------------------------------G-F-W-
SEGN_HUMAN/109-137--------------------------------------------------------------------------E-F-M-
SEGN_HUMAN/201-229--------------------------------------------------------------------------D-F-E-
SEGN_HUMAN/245-273--------------------------------------------------------------------------F-R-E-
O76670_CAEEL/18-46--------------------------------------------------------------------------A-Q-N-
O76670_CAEEL/50-78--------------------------------------------------------------------------D-G-Q-
O76670_CAEEL/117-145--------------------------------------------------------------------------I-I-D-
O76670_CAEEL/158-186--------------------------------------------------------------------------Q-A-L-
O76670_CAEEL/195-223--------------------------------------------------------------------------D-V-Q-
RBOHA_ARATH/225-253--------------------------------------------------------------------------R-L-R-
CNBL4_ARATH/75-103--------------------------------------------------------------------------F-A-D-
CNBL4_ARATH/112-140--------------------------------------------------------------------------K-V-K-
CNBL4_ARATH/156-184--------------------------------------------------------------------------M-V-D-
CNBL1_ARATH/71-99--------------------------------------------------------------------------F-A-N-
CNBL1_ARATH/108-136--------------------------------------------------------------------------K-I-D-
YC22_ARATH/388-416--------------------------------------------------------------------------E-T-K-
CML20_ARATH/100-128--------------------------------------------------------------------------E-L-T-
CML20_ARATH/136-164--------------------------------------------------------------------------E-I-R-
CABP1_RAT/157-185--------------------------------------------------------------------------E-L-R-
CABP1_RAT/234-262--------------------------------------------------------------------------E-L-R-
O93409_DANRE/30-58--------------------------------------------------------------------------E-Y-K-
RCN1_TAKRU/74-102--------------------------------------------------------------------------R-L-S-
RCN1_TAKRU/110-138--------------------------------------------------------------------------N-V-V-
RCN1_TAKRU/198-226--------------------------------------------------------------------------V-V-L-
YFFE_SCHPO/13-41--------------------------------------------------------------------------E-A-E-
FKBP9_HUMAN/492-520--------------------------------------------------------------------------V-S-P-
FKBP9_HUMAN/537-563--------------------------------------------------------------------------I-V-K-
GUC1C_HUMAN/56-84--------------------------------------------------------------------------H-I-D-
GUC1C_HUMAN/92-120--------------------------------------------------------------------------K-L-K-
GUC1C_HUMAN/134-162--------------------------------------------------------------------------F-I-N-
O96676_DROME/127-155--------------------------------------------------------------------------K-M-R-
O96676_DROME/249-277--------------------------------------------------------------------------D-A-A-
TNNC2_PIG/94-122--------------------------------------------------------------------------E-L-A-
TNNC2_CHICK/98-126--------------------------------------------------------------------------E-L-A-
CALMS_CHICK/121-149--------------------------------------------------------------------------E-V-D-
CALM_DICDI/87-115--------------------------------------------------------------------------E-I-R-
CALM_DICDI/123-151--------------------------------------------------------------------------E-V-D-
MLE1_CHICK/52-80--------------------------------------------------------------------------D-F-K-
MLE1_CHICK/129-157--------------------------------------------------------------------------D-F-V-
MYL6_CHICK/11-39--------------------------------------------------------------------------E-F-K-
MLRS_CHICK/28-56--------------------------------------------------------------------------E-F-K-
MLRA_CHICK/133-161--------------------------------------------------------------------------E-I-D-
MLRB_CHICK/97-125--------------------------------------------------------------------------T-I-L-
MLRM_CHICK/138-166--------------------------------------------------------------------------E-V-D-
PRVB_LATCH/42-70--------------------------------------------------------------------------E-L-E-
PRVA_LATCH/44-72--------------------------------------------------------------------------T-L-K-
PRVA_LATCH/83-111--------------------------------------------------------------------------E-T-K-
S100G_BOVIN/49-77--------------------------------------------------------------------------T-L-D-
S100B_BOVIN/53-81--------------------------------------------------------------------------V-V-D-
S10A1_BOVIN/54-82--------------------------------------------------------------------------A-V-D-
SPE1A_STRPU/14-42--------------------------------------------------------------------------E-F-K-
SPE1A_STRPU/50-78--------------------------------------------------------------------------Q-I-D-
SPE1A_STRPU/88-116--------------------------------------------------------------------------H-Y-T-
SPE2A_STRPU/14-42--------------------------------------------------------------------------L-F-K-
SPE2A_STRPU/50-78--------------------------------------------------------------------------K-I-D-
SPE2A_STRPU/122-150--------------------------------------------------------------------------E-I-D-
SPE2C_STRPU/50-76--------------------------------------------------------------------------K-I-D-
SPE2C_STRPU/85-113--------------------------------------------------------------------------Q-Y-F-
SPE2C_STRPU/122-150--------------------------------------------------------------------------E-I-D-
CALB1_CHICK/16-44--------------------------------------------------------------------------Q-F-F-
CALB1_CHICK/103-131--------------------------------------------------------------------------D-F-M-
CALB1_BOVIN/15-43--------------------------------------------------------------------------Q-F-F-
CALB1_BOVIN/102-130--------------------------------------------------------------------------E-F-M-
CALB1_BOVIN/146-174--------------------------------------------------------------------------Y-T-D-
CALB1_BOVIN/190-218--------------------------------------------------------------------------E-F-N-
CALL_CAEEL/25-53--------------------------------------------------------------------------E-F-R-
CALL_CAEEL/61-89--------------------------------------------------------------------------E-I-L-
CALL_CAEEL/97-125--------------------------------------------------------------------------M-I-R-
CALL_CAEEL/133-161--------------------------------------------------------------------------E-V-D-
ACTNA_DICDI/733-761--------------------------------------------------------------------------E-F-K-
ACTNA_DICDI/769-797--------------------------------------------------------------------------Q-L-N-
S10A8_HUMAN/50-78--------------------------------------------------------------------------G-A-D-
CALM_SCHPO/13-41--------------------------------------------------------------------------E-F-R-
CALM_SCHPO/86-114--------------------------------------------------------------------------E-V-R-
CALM_SCHPO/122-150--------------------------------------------------------------------------E-V-A-
CDC31_YEAST/24-52--------------------------------------------------------------------------E-I-Y-
CDC31_YEAST/97-125--------------------------------------------------------------------------E-I-K-
CDC31_YEAST/133-161--------------------------------------------------------------------------E-L-R-
SPTA1_MOUSE/2271-2299--------------------------------------------------------------------------E-F-S-
SPTA1_MOUSE/2314-2342--------------------------------------------------------------------------K-F-E-
MLE_DICDI/7-35--------------------------------------------------------------------------Q-I-Q-
MLE_DICDI/79-107--------------------------------------------------------------------------E-M-L-
S10A2_BOVIN/54-82--------------------------------------------------------------------------G-L-K-
CAYP1_CANFA/25-53--------------------------------------------------------------------------G-L-A-
CAYP1_CANFA/61-89--------------------------------------------------------------------------E-A-E-
CAYP1_CANFA/97-125--------------------------------------------------------------------------V-I-A-
PLCD1_BOVIN/144-172--------------------------------------------------------------------------W-I-H-
MLRV_HUMAN/98-126--------------------------------------------------------------------------T-I-L-
ACTN1_HUMAN/750-778--------------------------------------------------------------------------E-F-R-
ACTN1_HUMAN/791-819--------------------------------------------------------------------------E-F-A-
PDCD6_MOUSE/27-55--------------------------------------------------------------------------F-L-W-
PDCD6_MOUSE/94-122--------------------------------------------------------------------------D-W-Q-
CPNS1_BOVIN/138-166--------------------------------------------------------------------------T-C-R-
CPNS1_BOVIN/168-196--------------------------------------------------------------------------K-W-Q-
MRLCA_RAT/33-61--------------------------------------------------------------------------E-F-K-
MRLCA_RAT/102-130--------------------------------------------------------------------------V-I-R-
MLR_DICDI/24-52--------------------------------------------------------------------------E-L-K-
MLR_DICDI/60-88--------------------------------------------------------------------------Q-L-D-
MLR_DICDI/97-125--------------------------------------------------------------------------I-L-M-
SPE2D_STRPU/112-140--------------------------------------------------------------------------K-I-K-
SPTN1_RAT/2327-2355--------------------------------------------------------------------------E-F-S-
SPTN1_RAT/2370-2398--------------------------------------------------------------------------E-F-E-
ACTN_DROME/782-810--------------------------------------------------------------------------E-F-R-
ACTN_DROME/823-851--------------------------------------------------------------------------D-F-Q-
MLR_DROME/79-107--------------------------------------------------------------------------E-F-K-
PLSI_CHICK/15-43--------------------------------------------------------------------------E-L-R-
PLSI_CHICK/55-83--------------------------------------------------------------------------I-I-E-
MLR1_CAEEL/28-56--------------------------------------------------------------------------E-F-K-
PRVT_CHICK/82-109--------------------------------------------------------------------------E-T-K-
CAN3_HUMAN/696-724--------------------------------------------------------------------------S-C-R-
FILA_HUMAN/53-81--------------------------------------------------------------------------M-V-D-
RECO_BOVIN/65-93--------------------------------------------------------------------------Y-A-Q-
RECO_BOVIN/101-129--------------------------------------------------------------------------K-L-E-
TRHY_SHEEP/53-81--------------------------------------------------------------------------T-V-D-
S10AB_CHICK/58-86--------------------------------------------------------------------------V-V-D-
CML24_ARATH/17-45--------------------------------------------------------------------------D-I-K-
CML24_ARATH/53-81--------------------------------------------------------------------------E-T-V-
CML24_ARATH/94-122--------------------------------------------------------------------------D-L-K-
CML24_ARATH/130-158--------------------------------------------------------------------------D-C-K-
CML12_ARATH/12-40--------------------------------------------------------------------------E-Y-R-
CML12_ARATH/48-76--------------------------------------------------------------------------D-L-Q-
CML12_ARATH/191-219--------------------------------------------------------------------------E-F-R-
CML12_ARATH/227-255--------------------------------------------------------------------------E-L-Q-
CANB_YEAST/25-53--------------------------------------------------------------------------R-L-R-
CANB_YEAST/57-85--------------------------------------------------------------------------L-A-G-
CANB_YEAST/94-122--------------------------------------------------------------------------K-L-R-
CANB_YEAST/135-163--------------------------------------------------------------------------I-V-D-
S10AA_CHICK/51-79--------------------------------------------------------------------------A-L-D-
S10A8_MOUSE/50-78--------------------------------------------------------------------------N-I-E-
CALL3_HUMAN/48-76--------------------------------------------------------------------------E-L-R-
CALL3_HUMAN/121-149--------------------------------------------------------------------------E-V-D-
M126_CHICK/63-91--------------------------------------------------------------------------S-I-D-
CANB2_RAT/22-50--------------------------------------------------------------------------R-L-G-
CANB2_RAT/132-160--------------------------------------------------------------------------L-V-D-
CDPK_SOYBN/339-367--------------------------------------------------------------------------G-L-K-
CDPK_SOYBN/375-403--------------------------------------------------------------------------E-I-K-
CDPK_SOYBN/411-439--------------------------------------------------------------------------N-L-V-
CDPK_SOYBN/445-473--------------------------------------------------------------------------H-I-D-
GRAN_HUMAN/93-121--------------------------------------------------------------------------T-C-R-
GRAN_HUMAN/123-151--------------------------------------------------------------------------A-W-K-
S10A9_BOVIN/58-86--------------------------------------------------------------------------A-I-N-
CML10_ARATH/12-40--------------------------------------------------------------------------E-F-R-
CML10_ARATH/48-76--------------------------------------------------------------------------E-L-Q-
CML10_ARATH/82-110--------------------------------------------------------------------------D-L-K-
CML10_ARATH/118-146--------------------------------------------------------------------------E-I-D-
CML35_ARATH/70-98--------------------------------------------------------------------------E-L-V-
CML35_ARATH/145-173--------------------------------------------------------------------------E-L-R-
CML35_ARATH/182-210--------------------------------------------------------------------------E-C-M-
YNE5_CAEEL/81-109--------------------------------------------------------------------------E-M-R-
YNE5_CAEEL/117-145--------------------------------------------------------------------------D-F-D-
S10A7_HUMAN/54-82--------------------------------------------------------------------------Y-L-A-
S10A9_MOUSE/59-87--------------------------------------------------------------------------L-I-N-
PLC1_YEAST/273-301--------------------------------------------------------------------------Q-L-L-
PAN1_YEAST/603-631--------------------------------------------------------------------------L-F-Y-
PAN1_YEAST/637-665--------------------------------------------------------------------------D-L-E-
S10A5_HUMAN/51-79--------------------------------------------------------------------------S-I-D-
EDE1_YEAST/51-79--------------------------------------------------------------------------L-L-S-
EDE1_YEAST/171-199--------------------------------------------------------------------------T-L-G-
CBPP_DICDI/403-431--------------------------------------------------------------------------A-A-S-
CBPP_DICDI/439-467--------------------------------------------------------------------------Q-T-K-
S10A4_BOVIN/54-82--------------------------------------------------------------------------A-F-Q-
ACTN2_HUMAN/757-785--------------------------------------------------------------------------E-F-R-
ACTN2_HUMAN/793-821--------------------------------------------------------------------------E-F-A-
NCS1_CAEEL/64-92--------------------------------------------------------------------------F-A-S-
NCS1_CAEEL/100-128--------------------------------------------------------------------------K-L-H-
NCS1_CAEEL/148-176--------------------------------------------------------------------------R-V-D-
NCS2_CAEEL/66-94--------------------------------------------------------------------------F-C-E-
NCS2_CAEEL/102-130--------------------------------------------------------------------------K-L-E-
NCS2_CAEEL/149-177--------------------------------------------------------------------------R-A-K-
FREQ_DROME/100-128--------------------------------------------------------------------------K-L-Q-
FREQ_DROME/147-175--------------------------------------------------------------------------R-V-D-
TRHY_RABIT/53-81--------------------------------------------------------------------------T-V-D-
GEM1_YEAST/205-233--------------------------------------------------------------------------A-L-K-
GEM1_YEAST/334-362--------------------------------------------------------------------------F-L-V-
RDGC_DROME/445-473--------------------------------------------------------------------------E-L-E-
RDGC_DROME/530-558--------------------------------------------------------------------------S-L-V-
RDGC_DROME/570-598--------------------------------------------------------------------------E-M-L-
PLC1_SCHPO/334-362--------------------------------------------------------------------------F-L-E-
CAB32_DROME/39-67--------------------------------------------------------------------------Q-F-M-
CAB32_DROME/89-117--------------------------------------------------------------------------L-K-S-
CAB32_DROME/135-163--------------------------------------------------------------------------E-F-M-
CAB32_DROME/228-256--------------------------------------------------------------------------D-I-E-
MYL5_FELCA/34-62--------------------------------------------------------------------------E-F-K-
MYL5_FELCA/104-132--------------------------------------------------------------------------T-I-L-
CBPA_DICDI/8-36--------------------------------------------------------------------------D-V-E-
CBPA_DICDI/44-72--------------------------------------------------------------------------A-A-S-
CBPA_DICDI/84-112--------------------------------------------------------------------------I-C-N-
CBPA_DICDI/122-150--------------------------------------------------------------------------I-V-E-
EPS15_HUMAN/52-80--------------------------------------------------------------------------I-L-G-
EPS15_HUMAN/164-192--------------------------------------------------------------------------I-L-G-
EPS15_HUMAN/227-255--------------------------------------------------------------------------K-Y-D-
PRVU_CHICK/43-71--------------------------------------------------------------------------Q-L-K-
GUC1A_BOVIN/55-83--------------------------------------------------------------------------Y-V-E-
GUC1A_BOVIN/91-119--------------------------------------------------------------------------K-L-R-
GUC1A_BOVIN/135-163--------------------------------------------------------------------------F-T-D-
TNNC1_DROME/12-40--------------------------------------------------------------------------L-L-R-
TNNC1_DROME/48-76--------------------------------------------------------------------------T-L-A-
TNNC2_DROME/51-79--------------------------------------------------------------------------I-L-D-
TNNC2_DROME/91-119--------------------------------------------------------------------------E-L-R-
CANB1_DROME/22-50--------------------------------------------------------------------------R-L-G-
CANB1_DROME/54-82--------------------------------------------------------------------------L-V-Q-
CANB1_DROME/91-119--------------------------------------------------------------------------K-L-R-
CANB1_DROME/132-160--------------------------------------------------------------------------I-V-D-
E631_DROME/39-67--------------------------------------------------------------------------D-L-R-
E631_DROME/131-159--------------------------------------------------------------------------D-L-I-
E631_DROME/167-193--------------------------------------------------------------------------Q-L-E-
CDPK2_MAIZE/370-398--------------------------------------------------------------------------G-L-K-
CDPK2_MAIZE/406-434--------------------------------------------------------------------------E-V-K-
CDPK2_MAIZE/442-470--------------------------------------------------------------------------H-L-F-
CDPK2_MAIZE/477-505--------------------------------------------------------------------------T-I-R-
CALL_DROME/11-39--------------------------------------------------------------------------E-F-K-
CALL_DROME/47-75--------------------------------------------------------------------------E-L-Q-
CALL_DROME/84-112--------------------------------------------------------------------------E-M-R-
CALL_DROME/120-148--------------------------------------------------------------------------E-I-D-
DGKB_RAT/152-180--------------------------------------------------------------------------K-L-E-
DGKB_RAT/197-225--------------------------------------------------------------------------I-L-H-
CCH1_YEAST/1791-1819--------------------------------------------------------------------------K-Y-I-
S10A8_RAT/50-78--------------------------------------------------------------------------N-T-E-
GUC1B_BOVIN/60-88--------------------------------------------------------------------------Y-V-E-
GUC1B_BOVIN/96-124--------------------------------------------------------------------------K-L-K-
GUC1B_BOVIN/149-177--------------------------------------------------------------------------V-V-D-
PRVA_CAVPO/38-66--------------------------------------------------------------------------E-V-K-
ONCO_MOUSE/43-71--------------------------------------------------------------------------Q-L-K-
MLC1_YEAST/85-113--------------------------------------------------------------------------D-F-V-
GYP2_YEAST/642-670--------------------------------------------------------------------------A-I-N-
CDPK1_ORYSJ/413-440--------------------------------------------------------------------------E-I-N-
CDPK1_ORYSJ/448-476--------------------------------------------------------------------------H-L-M-
CDPK1_ORYSJ/482-510--------------------------------------------------------------------------F-L-E-
CDPKB_ORYSJ/384-412--------------------------------------------------------------------------G-L-R-
CDPKB_ORYSJ/490-518--------------------------------------------------------------------------L-L-E-
MLC2_DROME/11-39--------------------------------------------------------------------------E-F-Q-
MLC2_DROME/84-112--------------------------------------------------------------------------D-F-I-
CBP2_DICDI/17-45--------------------------------------------------------------------------D-L-E-
CBP2_DICDI/92-120--------------------------------------------------------------------------D-V-E-
CBP2_DICDI/128-156--------------------------------------------------------------------------I-T-D-
CAF1_DICDI/10-38--------------------------------------------------------------------------E-V-Q-
CAF1_DICDI/133-161--------------------------------------------------------------------------S-A-N-
FIMB_DICDI/11-39--------------------------------------------------------------------------E-F-K-
FIMB_DICDI/47-75--------------------------------------------------------------------------E-V-R-
CALM_EMENI/121-149--------------------------------------------------------------------------E-V-D-
NCS1_RAT/148-176--------------------------------------------------------------------------R-V-D-
VISL1_RAT/150-178--------------------------------------------------------------------------R-V-D-
CANB1_RAT/132-160--------------------------------------------------------------------------I-V-D-
TAL_SYNY3/356-384--------------------------------------------------------------------------G-T-D-
S10AC_BOVIN/53-81--------------------------------------------------------------------------T-I-D-
PRVA_FELCA/43-71--------------------------------------------------------------------------D-I-K-
PRVA_FELCA/82-110--------------------------------------------------------------------------E-T-K-
S10AC_PIG/53-81--------------------------------------------------------------------------T-I-D-
S10AC_HUMAN/53-81--------------------------------------------------------------------------V-I-D-
NUCB2_MOUSE/245-273--------------------------------------------------------------------------D-P-K-
NUCB2_MOUSE/297-325--------------------------------------------------------------------------M-R-E-
HPCA_RAT/64-92--------------------------------------------------------------------------F-A-E-
HPCA_RAT/100-128--------------------------------------------------------------------------K-L-M-
HPCA_RAT/148-176--------------------------------------------------------------------------R-T-E-
CANB_NEUCR/25-53--------------------------------------------------------------------------R-L-R-
CANB_NEUCR/57-85--------------------------------------------------------------------------L-A-T-
CANB_NEUCR/135-163--------------------------------------------------------------------------I-V-D-
GPDM_CAEEL/628-656--------------------------------------------------------------------------R-A-K-
GPDM_CAEEL/664-692--------------------------------------------------------------------------V-L-H-
P90802_CAEEL/57-85--------------------------------------------------------------------------E-Y-R-
P90802_CAEEL/93-121--------------------------------------------------------------------------E-L-D-
P90802_CAEEL/167-195--------------------------------------------------------------------------I-I-D-
P91423_CAEEL/51-79--------------------------------------------------------------------------F-L-I-
A60DA_DROME/691-719--------------------------------------------------------------------------V-V-G-
A60DA_DROME/774-802--------------------------------------------------------------------------H-I-E-
CDPKE_ARATH/359-387--------------------------------------------------------------------------C-I-K-
CDPKE_ARATH/395-423--------------------------------------------------------------------------D-I-Q-
CDPKE_ARATH/431-459--------------------------------------------------------------------------H-L-K-
CDPKE_ARATH/467-495--------------------------------------------------------------------------V-V-E-
S100G_MOUSE/49-77--------------------------------------------------------------------------T-L-D-
MLRA_HUMAN/36-64--------------------------------------------------------------------------E-F-K-
MLRA_HUMAN/106-134--------------------------------------------------------------------------A-I-L-
NCS1_YEAST/64-92--------------------------------------------------------------------------F-A-N-
NCS1_YEAST/100-128--------------------------------------------------------------------------K-L-S-
NCS1_YEAST/148-176--------------------------------------------------------------------------R-V-K-
MLC2_YEAST/19-47--------------------------------------------------------------------------K-L-K-
CDPK1_ARATH/455-483--------------------------------------------------------------------------G-L-K-
CDPK1_ARATH/491-519--------------------------------------------------------------------------E-I-L-
CDPK1_ARATH/527-555--------------------------------------------------------------------------H-L-F-
CDPK1_ARATH/561-589--------------------------------------------------------------------------R-I-E-
TRHY_HUMAN/53-81--------------------------------------------------------------------------T-V-D-
ACTN3_HUMAN/764-792--------------------------------------------------------------------------E-F-R-
CAST_SOLTU/40-68--------------------------------------------------------------------------R-L-R-
CAST_SOLTU/129-157--------------------------------------------------------------------------D-L-K-
CAST_SOLTU/167-195--------------------------------------------------------------------------R-V-E-
MLR4_SCHPO/78-106--------------------------------------------------------------------------E-F-V-
MLRH_CAEEL/102-130--------------------------------------------------------------------------V-I-R-
NCS1_SCHPO/64-92--------------------------------------------------------------------------F-A-E-
NCS1_SCHPO/100-128--------------------------------------------------------------------------K-L-I-
NCS1_SCHPO/148-176--------------------------------------------------------------------------R-V-N-
Q09980_CAEEL/8-36--------------------------------------------------------------------------E-I-R-
Q09980_CAEEL/44-72--------------------------------------------------------------------------K-I-E-
Q09980_CAEEL/81-109--------------------------------------------------------------------------E-L-R-
Q09980_CAEEL/117-145--------------------------------------------------------------------------E-A-K-
CANA_DROME/703-731--------------------------------------------------------------------------V-C-R-
CANA_DROME/733-761--------------------------------------------------------------------------K-W-K-
YT67_CAEEL/52-80--------------------------------------------------------------------------E-Y-R-
YT67_CAEEL/88-116--------------------------------------------------------------------------E-I-D-
YT67_CAEEL/127-155--------------------------------------------------------------------------L-I-R-
YT67_CAEEL/162-190--------------------------------------------------------------------------L-A-E-
PKD2_HUMAN/754-782--------------------------------------------------------------------------E-I-E-
CAYP1_HUMAN/25-53--------------------------------------------------------------------------G-L-A-
PLSI_HUMAN/55-83--------------------------------------------------------------------------I-V-E-
RCN1_HUMAN/83-111--------------------------------------------------------------------------R-L-G-
Q18136_CAEEL/22-50--------------------------------------------------------------------------D-L-K-
Q18136_CAEEL/58-86--------------------------------------------------------------------------E-L-D-
Q18136_CAEEL/91-119--------------------------------------------------------------------------S-L-K-
Q18874_CAEEL/420-448--------------------------------------------------------------------------V-V-S-
Q18887_CAEEL/66-94--------------------------------------------------------------------------S-I-K-
Q18887_CAEEL/193-221--------------------------------------------------------------------------I-V-N-
Q18887_CAEEL/276-304--------------------------------------------------------------------------E-V-N-
CMC3_CAEEL/74-102--------------------------------------------------------------------------K-I-R-
CMC3_CAEEL/140-168--------------------------------------------------------------------------R-L-A-
Q19770_CAEEL/423-451--------------------------------------------------------------------------M-V-D-
Q19770_CAEEL/452-480--------------------------------------------------------------------------P-F-I-
CDPKI_ARATH/457-485--------------------------------------------------------------------------R-S-R-
CDPKI_ARATH/487-515--------------------------------------------------------------------------S-I-E-
CDPKJ_ARATH/440-468--------------------------------------------------------------------------E-V-K-
CDPKJ_ARATH/476-504--------------------------------------------------------------------------N-L-F-
CDPKJ_ARATH/511-539--------------------------------------------------------------------------M-I-K-
Q20358_CAEEL/23-51--------------------------------------------------------------------------Q-L-S-
Q20358_CAEEL/59-87--------------------------------------------------------------------------E-L-D-
Q20358_CAEEL/96-124--------------------------------------------------------------------------E-L-E-
CMC2_CAEEL/77-105--------------------------------------------------------------------------Q-I-R-
CMC2_CAEEL/144-172--------------------------------------------------------------------------K-L-A-
Q21201_CAEEL/82-110--------------------------------------------------------------------------D-F-I-
RASEF_CAEEL/37-65--------------------------------------------------------------------------D-L-R-
Q26572_SCHMA/11-39--------------------------------------------------------------------------D-V-H-
Q26572_SCHMA/84-112--------------------------------------------------------------------------T-F-I-
CATR1_PARTE/41-69--------------------------------------------------------------------------E-I-K-
CATR1_PARTE/77-105--------------------------------------------------------------------------T-I-Y-
CATR1_PARTE/114-142--------------------------------------------------------------------------D-I-Q-
CATR1_PARTE/150-178--------------------------------------------------------------------------E-L-Q-
S10A7_BOVIN/54-82--------------------------------------------------------------------------Y-L-S-
CDPK9_ARATH/468-496--------------------------------------------------------------------------N-L-Y-
CDPK9_ARATH/503-531--------------------------------------------------------------------------T-I-K-
CDPK4_ARATH/436-464--------------------------------------------------------------------------P-L-D-
CDPK5_ARATH/508-536--------------------------------------------------------------------------F-L-E-
CDPK6_ARATH/462-490--------------------------------------------------------------------------H-L-V-
CDPK7_ARATH/364-392--------------------------------------------------------------------------G-I-K-
CDPK7_ARATH/400-428--------------------------------------------------------------------------D-L-Q-
CDPK7_ARATH/436-464--------------------------------------------------------------------------H-L-H-
CDPK7_ARATH/473-501--------------------------------------------------------------------------V-I-A-
Q39890_SOYBN/121-149--------------------------------------------------------------------------E-V-E-
CDPKC_ARATH/363-391--------------------------------------------------------------------------E-I-Q-
CDPKC_ARATH/399-427--------------------------------------------------------------------------N-L-V-
CDPK8_ARATH/362-390--------------------------------------------------------------------------G-I-K-
CDPK3_ARATH/383-411--------------------------------------------------------------------------G-L-K-
CDPK3_ARATH/419-447--------------------------------------------------------------------------E-I-R-
CDPK3_ARATH/455-483--------------------------------------------------------------------------H-L-Y-
CDPK3_ARATH/490-518--------------------------------------------------------------------------S-I-K-
CML21_ARATH/58-86--------------------------------------------------------------------------N-C-K-
CML21_ARATH/149-177--------------------------------------------------------------------------T-L-V-
CBPC_DICDI/10-38--------------------------------------------------------------------------E-V-Q-
CBPC_DICDI/93-121--------------------------------------------------------------------------D-V-E-
CBPC_DICDI/128-156--------------------------------------------------------------------------D-R-D-
CBPB_DICDI/42-70--------------------------------------------------------------------------K-Y-K-
CBPB_DICDI/78-106--------------------------------------------------------------------------E-L-K-
CAB45_MOUSE/101-129--------------------------------------------------------------------------K-L-M-
CAB45_MOUSE/236-264--------------------------------------------------------------------------M-V-K-
CAB45_MOUSE/317-345--------------------------------------------------------------------------E-A-K-
RCN2_RAT/104-132--------------------------------------------------------------------------E-A-K-
PLCD4_RAT/174-202--------------------------------------------------------------------------Y-A-F-
TBCD9_HUMAN/890-918--------------------------------------------------------------------------L-A-S-
CAN8_RAT/579-607--------------------------------------------------------------------------T-C-R-
CAN8_RAT/609-637--------------------------------------------------------------------------T-Y-L-
CNBLA_ARATH/117-145--------------------------------------------------------------------------F-L-D-
CNBLA_ARATH/154-182--------------------------------------------------------------------------K-T-D-
CNBLA_ARATH/198-226--------------------------------------------------------------------------I-I-D-
CNBL5_ARATH/70-98--------------------------------------------------------------------------S-A-E-
CNBL5_ARATH/107-135--------------------------------------------------------------------------K-A-I-
CNBL5_ARATH/151-179--------------------------------------------------------------------------I-V-S-
GRP2_HUMAN/430-458--------------------------------------------------------------------------M-V-E-
RCN2_MOUSE/68-96--------------------------------------------------------------------------R-L-Q-
RCN2_MOUSE/193-221--------------------------------------------------------------------------V-I-Q-
RCN2_MOUSE/234-262--------------------------------------------------------------------------E-K-D-
GRP3_HUMAN/424-452--------------------------------------------------------------------------L-V-E-
GRP3_HUMAN/453-481--------------------------------------------------------------------------P-F-L-
CNBL2_ARATH/86-114--------------------------------------------------------------------------F-A-D-
CNBL2_ARATH/123-151--------------------------------------------------------------------------K-I-H-
CDPKD_ARATH/359-387--------------------------------------------------------------------------D-I-K-
CDPKD_ARATH/395-423--------------------------------------------------------------------------E-V-Q-
CDPKD_ARATH/467-495--------------------------------------------------------------------------V-A-N-
CAN3_CHICK/685-713--------------------------------------------------------------------------S-S-R-
CAN3_CHICK/715-743--------------------------------------------------------------------------S-W-Q-
CAN2_CHICK/576-604--------------------------------------------------------------------------T-C-K-
CAN2_CHICK/606-634--------------------------------------------------------------------------K-Y-Q-
Q94180_CAEEL/132-160--------------------------------------------------------------------------A-L-I-
MIRO_CAEEL/192-220--------------------------------------------------------------------------A-L-I-
MIRO_CAEEL/312-340--------------------------------------------------------------------------F-V-S-
CML13_ARATH/13-41--------------------------------------------------------------------------S-M-K-
TPC1_ARATH/326-354--------------------------------------------------------------------------M-L-E-
TPC1_ARATH/367-395--------------------------------------------------------------------------E-F-G-
S10A6_CHICK/52-80--------------------------------------------------------------------------E-I-A-
CHP1_HUMAN/114-142--------------------------------------------------------------------------K-L-H-
CHP1_HUMAN/155-183--------------------------------------------------------------------------I-A-D-
CIB1_HUMAN/107-135--------------------------------------------------------------------------K-S-H-
CIB1_HUMAN/152-180--------------------------------------------------------------------------L-I-D-
MICU1_HUMAN/412-440--------------------------------------------------------------------------V-C-D-
CNBL6_ARATH/161-189--------------------------------------------------------------------------I-I-D-
CML43_ARATH/111-139--------------------------------------------------------------------------D-L-E-
RBOHD_ARATH/257-285--------------------------------------------------------------------------K-L-Q-
CDPKN_ARATH/373-401--------------------------------------------------------------------------G-L-K-
CDPKN_ARATH/445-473--------------------------------------------------------------------------H-V-H-
CDPKN_ARATH/480-508--------------------------------------------------------------------------S-I-K-
CDPKA_ARATH/368-396--------------------------------------------------------------------------V-I-K-
CDPKA_ARATH/404-432--------------------------------------------------------------------------E-I-K-
CDPKA_ARATH/440-468--------------------------------------------------------------------------L-F-K-
CDPKA_ARATH/476-504--------------------------------------------------------------------------V-L-S-
CDPK3_PLAF7/422-450--------------------------------------------------------------------------K-L-K-
CDPK3_PLAF7/457-485--------------------------------------------------------------------------N-F-D-
GRP1_RAT/474-502--------------------------------------------------------------------------M-V-D-
RBOHB_ARATH/175-203--------------------------------------------------------------------------R-L-Q-
CANB_DROME/800-828--------------------------------------------------------------------------A-V-R-
KIC_ARATH/78-106--------------------------------------------------------------------------D-A-Q-
CML1_ARATH/50-78--------------------------------------------------------------------------E-M-R-
CML1_ARATH/86-114--------------------------------------------------------------------------D-V-P-
CML1_ARATH/121-149--------------------------------------------------------------------------D-I-R-
CML1_ARATH/157-185--------------------------------------------------------------------------D-C-N-
CML48_ARATH/56-84--------------------------------------------------------------------------E-I-V-
CML48_ARATH/125-153--------------------------------------------------------------------------Q-W-R-
CML6_ARATH/5-33--------------------------------------------------------------------------E-L-N-
CML6_ARATH/41-69--------------------------------------------------------------------------E-L-T-
CML6_ARATH/81-109--------------------------------------------------------------------------D-M-K-
CML6_ARATH/119-147--------------------------------------------------------------------------E-C-R-
CDPKM_ARATH/350-378--------------------------------------------------------------------------G-L-K-
CDPKM_ARATH/422-450--------------------------------------------------------------------------H-L-Y-
CDPKM_ARATH/457-485--------------------------------------------------------------------------N-A-K-
CDPKK_ARATH/439-467--------------------------------------------------------------------------G-L-K-
CDPKK_ARATH/511-539--------------------------------------------------------------------------H-L-F-
CDPKK_ARATH/545-573--------------------------------------------------------------------------H-L-D-
A0DAT1_PARTE/456-482--------------------------------------------------------------------------.-W-T-
A2DKH3_TRIVA/802-830--------------------------------------------------------------------------E-F-K-
A2DXW5_TRIVA/52-79--------------------------------------------------------------------------E-L-Q-
A5KBU9_PLAVS/422-448--------------------------------------------------------------------------E-V-D-
A7X9M1_PHYPA/417-443--------------------------------------------------------------------------.-L-K-
A8HNF8_CHLRE/23-50--------------------------------------------------------------------------.-C-R-
A8JC40_CHLRE/65-92--------------------------------------------------------------------------E-I-K-
B2RYZ0_XENTR/43-70--------------------------------------------------------------------------D-V-K-
B4HBA9_DROPE/62-88--------------------------------------------------------------------------.-W-D-
B4J6G6_DROGR/50-76--------------------------------------------------------------------------.-V-K-
C3YK83_BRAFL/11-38--------------------------------------------------------------------------E-M-K-
C3YYW0_BRAFL/109-136--------------------------------------------------------------------------E-I-L-
C3ZY23_BRAFL/55-82--------------------------------------------------------------------------E-L-Q-
C5MCF3_CANTT/85-112--------------------------------------------------------------------------D-V-D-
C5WY52_SORBI/565-591--------------------------------------------------------------------------.-L-E-
C5Y427_SORBI/388-414--------------------------------------------------------------------------.-L-K-
D2UYG7_NAEGR/127-154--------------------------------------------------------------------------E-V-D-
D2V5Z7_NAEGR/140-166--------------------------------------------------------------------------.-V-D-
D2VXQ7_NAEGR/141-168--------------------------------------------------------------------------E-L-R-
A8BQU2_GIAIC/144-171--------------------------------------------------------------------------E-L-L-
E2RU85_GIAIC/130-157--------------------------------------------------------------------------E-I-Q-
E1G510_LOALO/10-37--------------------------------------------------------------------------E-C-R-
F6RDI4_XENTR/92-118--------------------------------------------------------------------------.-L-K-
F6WJV7_XENTR/97-124--------------------------------------------------------------------------E-L-S-
F6X6F2_XENTR/50-78--------------------------------------------------------------------------D-F-K-
G4LZ30_SCHMA/475-502--------------------------------------------------------------------------E-I-D-
G4VAG2_SCHMA/1454-1481--------------------------------------------------------------------------.-I-N-
G4VR58_SCHMA/7-33--------------------------------------------------------------------------.-W-T-
I1KY83_SOYBN/402-429--------------------------------------------------------------------------.-L-K-
I1MDY1_SOYBN/29-57--------------------------------------------------------------------------E-I-K-
K3Y7C9_SETIT/399-425--------------------------------------------------------------------------.-L-K-
M0SNQ3_MUSAM/466-492--------------------------------------------------------------------------.-I-N-
M4CA48_BRARP/11-37--------------------------------------------------------------------------.-.-D-
M4E4B8_BRARP/7-33--------------------------------------------------------------------------.-.-E-
Q4CS04_TRYCC/28-55--------------------------------------------------------------------------E-L-T-
Q4CSZ0_TRYCC/139-167--------------------------------------------------------------------------E-L-R-
Q4DUP6_TRYCC/100-126--------------------------------------------------------------------------.-F-M-
TEGU_SCHMA/12-39--------------------------------------------------------------------------E-F-I-
GNPTA_MOUSE/989-1015--------------------------------------------------------------------------.-I-S-
Q6YYX3_ORYSJ/9-36--------------------------------------------------------------------------.-M-E-
Q7R9F4_PLAYO/85-113--------------------------------------------------------------------------E-L-I-
CDPK2_PLAF7/375-401--------------------------------------------------------------------------.-L-R-
CML1_ORYSJ/48-75--------------------------------------------------------------------------E-L-Q-
CDPKD_ARATH/432-458--------------------------------------------------------------------------.-L-R-
W5KKR2_ASTMX/43-70--------------------------------------------------------------------------D-I-K-
W5MGE4_LEPOC/20-48--------------------------------------------------------------------------E-F-K-

PF13202

Q3HNM6_TOXGO/470-493--------------------------------------------------------------------------L-A.A-
C4P7X0_CHLVA/167-192--------------------------------------------------------------------------I-V.D-
MICU1_XENTR/220-244--------------------------------------------------------------------------F-E.I-
O26668_METTH/8-31--------------------------------------------------------------------------I-E.D-
D3E367_METRM/266-289--------------------------------------------------------------------------I-N.D-
C3ZQ19_BRAFL/1361-1385--------------------------------------------------------------------------F-D.K-
C6T2C2_SOYBN/33-57--------------------------------------------------------------------------L-K.R-
A9T068_PHYPA/10-35--------------------------------------------------------------------------I-V.Q-
A9SKK3_PHYPA/38-62--------------------------------------------------------------------------L-V.D-
B5YG07_THEYD/135-158--------------------------------------------------------------------------T-D.S-
A9SIM5_PHYPA/377-401--------------------------------------------------------------------------L-R.D-
A9T5H9_PHYPA/22-46--------------------------------------------------------------------------L-S.D-
A9T5H9_PHYPA/107-131--------------------------------------------------------------------------L-A.T-
C4P7Y4_SORBI/152-177--------------------------------------------------------------------------I-V.D-
B9RDE4_RICCO/35-59--------------------------------------------------------------------------F-K.Q-
A0BVC5_PARTE/382-405--------------------------------------------------------------------------M-V.A-
C1N2Y6_MICPC/9-33--------------------------------------------------------------------------L-R.D-
B6TKT3_MAIZE/153-178--------------------------------------------------------------------------I-V.D-
A0DDA5_PARTE/353-376--------------------------------------------------------------------------M-D.E-
Q4UIH6_THEAN/479-503--------------------------------------------------------------------------F-N.Q-
B7QHF1_IXOSC/149-174--------------------------------------------------------------------------L-A.D-
C5L6B3_PERM5/255-280--------------------------------------------------------------------------L-GRD-
CML38_ARATH/44-69--------------------------------------------------------------------------L-E.A-
A0DVR4_PARTE/154-178--------------------------------------------------------------------------V-Q.V-
D2VRB9_NAEGR/331-355--------------------------------------------------------------------------L-K.A-
B6KJ69_TOXGO/232-256--------------------------------------------------------------------------L-E.K-
D2VB88_NAEGR/225-250--------------------------------------------------------------------------L-QIA-
D2VA25_NAEGR/11-35--------------------------------------------------------------------------L-R.P-
C5XIH5_SORBI/22-46--------------------------------------------------------------------------L-G.S-
B4HTW1_DROSE/40-64--------------------------------------------------------------------------L-R.T-
A4ZKI6_POPTR/152-177--------------------------------------------------------------------------I-V.D-
A0C5A2_PARTE/441-468--------------------------------------------------------------------------L-N.K-
C3ZF66_BRAFL/98-123--------------------------------------------------------------------------I-V.N-
C5WMF0_SORBI/24-48--------------------------------------------------------------------------L-RPA-
A0DA67_PARTE/343-367--------------------------------------------------------------------------M-K.A-
CANB_KLULA/26-50--------------------------------------------------------------------------L-K.K-
A4HVS3_LEIIN/72-97--------------------------------------------------------------------------L-M.E-
CNBL2_ARATH/167-192--------------------------------------------------------------------------I-I.D-
B0XGS0_CULQU/246-272--------------------------------------------------------------------------V-D.H-
B8DL48_DESVM/259-282--------------------------------------------------------------------------Q-N.R-
C5Z8P2_SORBI/58-82--------------------------------------------------------------------------A-R.D-
Y2130_DICDI/94-119--------------------------------------------------------------------------V-V.D-
Y2130_DICDI/154-178--------------------------------------------------------------------------A-D.D-
Q4QG09_LEIMA/54-79--------------------------------------------------------------------------L-V.S-
A9SKA0_PHYPA/9-34--------------------------------------------------------------------------V-I.D-
C9SFB3_VERA1/63-87--------------------------------------------------------------------------M-R.Q-
Q4D2E0_TRYCC/138-163--------------------------------------------------------------------------I-V.D-
A2FET7_TRIVA/16-40--------------------------------------------------------------------------F-K.Q-
C3YD91_BRAFL/134-159--------------------------------------------------------------------------V-R.Q-
A4YRX7_BRASO/88-113--------------------------------------------------------------------------L-Q.D-
A0DSC5_PARTE/21-44--------------------------------------------------------------------------L-E.I-
A7APE2_BABBO/16-41--------------------------------------------------------------------------M-L.D-
A7T743_NEMVE/31-54--------------------------------------------------------------------------L-K.A-
B4KQ48_DROMO/52-76--------------------------------------------------------------------------L-Y.D-
D3B5T3_POLPA/148-172--------------------------------------------------------------------------I-D.D-
B9SPR6_RICCO/147-171--------------------------------------------------------------------------I-E.K-
A9UX06_MONBE/90-113--------------------------------------------------------------------------I-A.A-
A3LTX1_PICST/205-231--------------------------------------------------------------------------L-R.S-
A7S611_NEMVE/41-67--------------------------------------------------------------------------L-G.E-
B0W1J6_CULQU/268-292--------------------------------------------------------------------------F-EIA-
Q0UM05_PHANO/88-113--------------------------------------------------------------------------L-L.S-
B9GL46_POPTR/156-181--------------------------------------------------------------------------I-V.D-
Q15VG6_PSEA6/81-104--------------------------------------------------------------------------L-E.S-
B8CE53_THAPS/330-354--------------------------------------------------------------------------L-R.D-
Q47I72_DECAR/140-163--------------------------------------------------------------------------V-Q.N-
A8XVB7_CAEBR/473-497--------------------------------------------------------------------------I-D.A-
Q3A3S2_PELCD/55-78--------------------------------------------------------------------------L-I.D-
A0C9M2_PARTE/19-43--------------------------------------------------------------------------I-K.E-
Q4N591_THEPA/813-837--------------------------------------------------------------------------V-E.D-
Q3JEE9_NITOC/75-99--------------------------------------------------------------------------L-A.L-
C1FF66_MICSR/33-57--------------------------------------------------------------------------V-Q.A-
B9H0C7_POPTR/143-167--------------------------------------------------------------------------I-K.E-
CML50_ARATH/188-213--------------------------------------------------------------------------I-V.A-
A4RU14_OSTLU/441-466--------------------------------------------------------------------------L-H.D-
D3BNS7_POLPA/96-121--------------------------------------------------------------------------V-I.D-
C4XIW2_DESMR/87-110--------------------------------------------------------------------------M-E.V-
A0DMF3_PARTE/401-425--------------------------------------------------------------------------I-Q.T-
A4RZI0_OSTLU/14-38--------------------------------------------------------------------------L-Q.H-
Q804W1_DANRE/83-107--------------------------------------------------------------------------T-K.A-
B7G459_PHATC/14-38--------------------------------------------------------------------------F-R.E-
A8IXR0_CHLRE/4-29--------------------------------------------------------------------------I-Q.Q-
D3EQM6_ATETH/729-752--------------------------------------------------------------------------L-Q.R-
A9UZJ7_MONBE/82-106--------------------------------------------------------------------------I-Q.A-
A0CIV5_PARTE/365-389--------------------------------------------------------------------------I-E.K-
B6SX62_MAIZE/19-43--------------------------------------------------------------------------L-RPA-
A9VD02_MONBE/88-111--------------------------------------------------------------------------I-E.G-
B7GBA5_PHATC/485-509--------------------------------------------------------------------------F-I.D-
A0DK50_PARTE/458-483--------------------------------------------------------------------------I-I.A-
C5KL06_PERM5/719-743--------------------------------------------------------------------------M-E.A-
A5K4A9_PLAVS/215-237--------------------------------------------------------------------------L-D.D-
B9HHH3_POPTR/20-42--------------------------------------------------------------------------F-K.A-
C5XIL1_SORBI/222-246--------------------------------------------------------------------------I-E.E-
D7SNZ6_VITVI/403-425--------------------------------------------------------------------------L-R.D-
F1QUS0_DANRE/67-89--------------------------------------------------------------------------.-K.E-
F4HZU8_ARATH/290-313--------------------------------------------------------------------------L-K.R-
F6HHF9_VITVI/59-82--------------------------------------------------------------------------I-R.S-
G4VN18_SCHMA/14-37--------------------------------------------------------------------------L-R.E-
H2LE63_ORYLA/44-67--------------------------------------------------------------------------I-K.K-
H2TUR2_TAKRU/25-48--------------------------------------------------------------------------.-Q.D-
I1Q944_ORYGL/86-110--------------------------------------------------------------------------L-K.D-
I3NG46_SPETR/107-130--------------------------------------------------------------------------.-M.K-
K3XLQ6_SETIT/156-179--------------------------------------------------------------------------.-V.D-
K7UU06_MAIZE/38-61--------------------------------------------------------------------------M-Q.R-
Q22RP4_TETTS/886-908--------------------------------------------------------------------------.-D.A-
Q57W92_TRYB2/288-312--------------------------------------------------------------------------I-N.T-
Q6N380_RHOPA/95-117--------------------------------------------------------------------------L-K.D-

PF13833

D4A938_RAT/94-146----------------------------------------PTGTVDMHSMKVAL.RNV..GIQ.......LGPQE.M-C-
EFCB3_RAT/61-113----------------------------------------RTGCIDSHGLMSTV.AKL..GMN.......LNAYD.I-Y-
C5LZ40_PERM5/135-187----------------------------------------AKQLVEPSDIRVMM.AKV..GTE.......LTEEE.A-E-
A5ARZ8_VITVI/40-93----------------------------------------DKGVITFESLKRNS.ATL..GLQN......LSDDE.L-R-
B9INT1_POPTR/41-94----------------------------------------DRGVITMESLKKNA.AFL..GLQD......LSEDE.L-V-
PBP1_ARATH/50-104----------------------------------------DKGVITFESLRRNASTVL..GLGD......LTDDD.V-R-
B9RPS2_RICCO/36-90----------------------------------------EKGVITVESLRRNSCSVL..GIKD......LEEDE.I-V-
B9I910_POPTR/47-100----------------------------------------EKGLITSESLRRNS.ALL..GMEG......MSKED.A-E-
C5XT26_SORBI/52-106----------------------------------------ARGAITPDSLRRGAAAAL..GVAG......MSHAE.A-D-
Q6Z727_ORYSJ/59-117----------------------------------------ARGAITAESLRRSAASVL..GLGGGG..GEMTVEE.A-A-
D0NVB9_PHYIT/85-137----------------------------------------TSGVITAADLSSCM.RSL..NRI.......PTKGE.V-Q-
D0P2Y1_PHYIT/101-153----------------------------------------HSRVIKNEDLYEAI.KAL..GKV.......CSKKE.V-S-
Q54HB8_DICDI/91-143----------------------------------------KGGSMTFDDLLS........GLAVCG..KSTEKDK.V-N-
A0CF79_PARTE/166-215----------------------------------------QKGYITTDDLLMAMKND.............FGSNE.I-F-
D0MVE6_PHYIT/108-160----------------------------------------EKDGLDFEGLKAALNAM...GAH.......IKESD.V-S-
A0DTQ9_PARTE/83-135----------------------------------------GQGQISTEDMRLFL.SKV..RLG.......LNNTQ.L-T-
B4MB62_DROVI/283-336----------------------------------------AGADISRGALKHISDVLV..GVP.......LSAHV.I-D-
PCAT1_MOUSE/432-483----------------------------------------EDGSIDEANLSCILKTAL...........GVSELT.V-T-
PCAT1_HUMAN/432-483----------------------------------------EDGSVGEGDLSCILKTAL...........GVAELT.V-T-
B4JIX5_DROGR/476-528----------------------------------------STQQIDRDSFTR........LLRHAG..SKLNEQK.A-Q-
PCAT1_DROME/455-507----------------------------------------SSQQIDRESFVR........LMRHAG..GKLNEQK.A-Q-
B4L1J4_DROMO/476-528----------------------------------------SSEKISRENFTR........LMKHGG..SKMTEQK.T-Q-
B7G2K7_PHATC/364-418----------------------------------------QGQILDKDTFRRIL......KKSRQD..GHISNAE.V-D-
C3Z2D7_BRAFL/396-448----------------------------------------DRDKVTREAFKR........GLKGAK..IPLSAYE.I-E-
C3Z612_BRAFL/548-601----------------------------------------GTDLITQQEFRAAIESRF..GIE.......VSDQD.F-E-
C3Z612_BRAFL/788-840----------------------------------------HTGFVTREEFHD........VLTELC..VQLSEYE.K-H-
Q69Z12_CAEEL/55-111----------------------------------------SGARITVEEFIPIYKK....VEAACG..RSTTLKE.F-Q-
B0WLJ4_CULQU/72-125----------------------------------------PNGKLTPAKFVD........MYKMFF..PSGNAEEFC-D-
A2FHL4_TRIVA/21-75----------------------------------------KKDKIGRDEFYKLY......KQLQKK..DDIPKSN.S-D-
C3Y1D3_BRAFL/16-70----------------------------------------GGGGLDPDEFRQAIKRTM..GNKT......VDDHE.L-E-
C3YJD8_BRAFL/199-252----------------------------------------EAGNMTLDEFKEAVSSTL..GTP.......AWNDQ.I-D-
B9I051_POPTR/94-147----------------------------------------EKGVITFDSLKKNS.ALL..GLQD......LSDDD.L-R-
I1LRV1_SOYBN/37-90----------------------------------------EKGVITLESLRRNA.ALL..GLQD......LKEDE.L-V-
I1M2E4_SOYBN/41-94----------------------------------------EKKVITFESLKKNS.ALL..GLEG......MNDDE.L-R-
Q57WF9_TRYB2/87-140----------------------------------------PDGIFTRATLQETAGKVG..STQD.....TLSVEE.V-D-
U7E2X2_POPTR/82-134----------------------------------------.NGVLTKKDFQRASSQLC..GIS.......ITNNL.V-D-
W5K518_ASTMX/94-144----------------------------------------PRGLISKKDFSKAM.DS...QKQ.......YSPSE.I-Q-
W5KKQ5_ASTMX/545-603----------------------------------------.DMEISVTELQTILNRIISKH..KDLKTDGFGPEA.C-R-

PF13499

B0W4V1_CULQU/107-174--------------------------------------------------------------------------D-I-KV
A0CA88_PARTE/343-408--------------------------------------------------------------------------K-S-AM
E9AEY5_LEIMA/91-155--------------------------------------------------------------------------R-S-VI
B4KQ53_DROMO/120-192--------------------------------------------------------------------------E-E-RM
Q9VDI5_DROME/166-252--------------------------------------------------------------------------E-A-EL
A8HXI4_CHLRE/156-258--------------------------------------------------------------------------F-Y-VI
C1FGJ2_MICSR/15-91--------------------------------------------------------------------------P-E-SL
Q22Y73_TETTS/418-482--------------------------------------------------------------------------D-F-NL
Q7XUK2_ORYSJ/675-739--------------------------------------------------------------------------D-A-RI
C5KAV7_PERM5/50-119--------------------------------------------------------------------------V-E-KV
F7H9X0_CALJA/14-82--------------------------------------------------------------------------L-D-EL
Q179P5_AEDAE/119-191--------------------------------------------------------------------------E-E-KV
Q03ZC4_LEUMM/205-292--------------------------------------------------------------------------S-S-AT
Q384M5_TRYB2/10-74--------------------------------------------------------------------------R-E-YL
A0A0D1DYS1_USTMA/669-733--------------------------------------------------------------------------D-R-DV
D2W3R3_NAEGR/27-89--------------------------------------------------------------------------I-S-QA
A7T5T7_NEMVE/484-551--------------------------------------------------------------------------F-S-DM
C1MJG0_MICPC/4-66--------------------------------------------------------------------------E-S-RL
A9TA03_PHYPA/319-420--------------------------------------------------------------------------F-Y-VI
Q8ILL9_PLAF7/780-853--------------------------------------------------------------------------S-V-AL
A0C6I2_PARTE/147-212--------------------------------------------------------------------------F-D-PL
A2FGB1_TRIVA/30-97--------------------------------------------------------------------------V-D-KL
Q4UGG2_THEAN/877-948--------------------------------------------------------------------------K-N-SL
Q4QI25_LEIMA/175-239--------------------------------------------------------------------------E-E-KL
Q4QF91_LEIMA/93-157--------------------------------------------------------------------------E-E-DL
Q4DBK1_TRYCC/324-390--------------------------------------------------------------------------F-D-EI
EFCB9_HUMAN/104-166--------------------------------------------------------------------------Y-R-HS
A8IZT4_CHLRE/134-199--------------------------------------------------------------------------K-L-GL
RHBL3_HUMAN/36-100--------------------------------------------------------------------------E-D-HW
Q94172_CAEEL/113-189--------------------------------------------------------------------------D-E-RL
B0WCB9_CULQU/103-174--------------------------------------------------------------------------R-V-KA
C4MAF9_ENTHI/45-109--------------------------------------------------------------------------F-K-EL
Q17J61_AEDAE/75-143--------------------------------------------------------------------------M-Q-EL
Q383U3_TRYB2/31-98--------------------------------------------------------------------------D-N-KL
F1QW82_DANRE/246-324--------------------------------------------------------------------------D-P-KT
B0BNB8_RAT/10-74--------------------------------------------------------------------------I-N-EY
C5DF93_LACTC/134-200--------------------------------------------------------------------------D-T-QI
A8Y4B4_CAEBR/161-225--------------------------------------------------------------------------E-Q-KL
2AB2B_ARATH/316-417--------------------------------------------------------------------------F-Y-VI
Q9T0I9_ARATH/31-105--------------------------------------------------------------------------D-K-FV
O77424_DROME/28-137--------------------------------------------------------------------------L-E-QL
A0E9H8_PARTE/87-164--------------------------------------------------------------------------T-T-TA
Q5KK44_CRYNJ/679-743--------------------------------------------------------------------------V-S-HL
Q4UGG2_THEAN/779-852--------------------------------------------------------------------------A-F-AL
C3YCL0_BRAFL/77-150--------------------------------------------------------------------------D-T-QL
A0C466_PARTE/34-96--------------------------------------------------------------------------F-Q-EI
F6HM70_VITVI/148-216--------------------------------------------------------------------------E-S-RI
B4NST7_DROSI/40-104--------------------------------------------------------------------------K-C-DI
B5YLV0_THAPS/86-155--------------------------------------------------------------------------F-K-AL
EFCB7_MOUSE/104-168--------------------------------------------------------------------------K-A-EL
Q7QDS4_ANOGA/162-227--------------------------------------------------------------------------M-K-RD
E0CTM8_VITVI/295-363--------------------------------------------------------------------------T-E-AI
B0WSP5_CULQU/60-140--------------------------------------------------------------------------E-E-KN
A0D4H2_PARTE/74-138--------------------------------------------------------------------------K-K-QL
D3Q0B0_STANL/8-87--------------------------------------------------------------------------R-R-KL
A0CR76_PARTE/21-85--------------------------------------------------------------------------F-S-DL
C4MAN5_ENTHI/247-312--------------------------------------------------------------------------T-E-VL
A4S628_OSTLU/4-66--------------------------------------------------------------------------Q-A-RL
B9GTR6_POPTR/22-99--------------------------------------------------------------------------N-A-QI
C5LZE0_PERM5/568-638--------------------------------------------------------------------------K-E-DV
Q4DR78_TRYCC/188-251--------------------------------------------------------------------------E-E-AI
Q6CTN2_KLULA/14-80--------------------------------------------------------------------------K-K-RH
A0DXA6_PARTE/78-140--------------------------------------------------------------------------R-S-QL
A4RWN7_OSTLU/4053-4117--------------------------------------------------------------------------R-M-RL
D2VAM2_NAEGR/286-352--------------------------------------------------------------------------L-K-KI
B3M0W6_DROAN/112-184--------------------------------------------------------------------------E-M-RM
A7T5L6_NEMVE/7-72--------------------------------------------------------------------------L-E-DL
C1MTV5_MICPC/22-100--------------------------------------------------------------------------F-D-TM
Q4DJW4_TRYCC/107-180--------------------------------------------------------------------------R-T-WI
Q22C61_TETTS/120-194--------------------------------------------------------------------------I-K-KA
Q54K53_DICDI/23-87--------------------------------------------------------------------------E-E-AL
B0S5T5_DANRE/253-355--------------------------------------------------------------------------F-Y-VI
V5BH06_TOXGO/905-976--------------------------------------------------------------------------K-S-SI
Q7Q2Y5_ANOGA/8166-8230--------------------------------------------------------------------------K-S-RL
A7SE27_NEMVE/5-68--------------------------------------------------------------------------S-T-GL
E9AD64_LEIMA/543-607--------------------------------------------------------------------------T-T-GL
A0C1K7_PARTE/138-207--------------------------------------------------------------------------R-N-LF
A7EZ28_SCLS1/18-81--------------------------------------------------------------------------I-F-GL
B7PD77_IXOSC/541-603--------------------------------------------------------------------------I-V-DI
H2U588_TAKRU/105-174--------------------------------------------------------------------------E-L-KA
A5DT65_LODEL/98-175--------------------------------------------------------------------------Q-Q-KI
C1N9C6_MICPC/137-215--------------------------------------------------------------------------A-D-DA
U5FYB3_POPTR/316-386--------------------------------------------------------------------------R-K-RI
A0DXN4_PARTE/410-474--------------------------------------------------------------------------E-N-MA
H3DPT5_TETNG/9-76--------------------------------------------------------------------------E-E-RL
PCAT1_RAT/418-481--------------------------------------------------------------------------L-A-TI
K7TRT5_MAIZE/98-201--------------------------------------------------------------------------A-Q-RI
A0D5N6_PARTE/349-412--------------------------------------------------------------------------Q-N-YL
A4S0C9_OSTLU/316-417--------------------------------------------------------------------------F-Y-VI
A0D4G3_PARTE/98-175--------------------------------------------------------------------------E-T-KC
A9T6F9_PHYPA/77-150--------------------------------------------------------------------------K-F-EI
B4M2X5_DROVI/17-85--------------------------------------------------------------------------K-Q-NL
A4HAL6_LEIBR/159-224--------------------------------------------------------------------------F-D-AV
A7SF01_NEMVE/188-252--------------------------------------------------------------------------K-E-VL
A5K537_PLAVS/485-550--------------------------------------------------------------------------Y-L-SI
B6KGE8_TOXGO/124-188--------------------------------------------------------------------------V-A-ST
A9V1M1_MONBE/549-632--------------------------------------------------------------------------K-P-AL
B4K5H6_DROMO/71-154--------------------------------------------------------------------------E-E-KI

PF12763

END3_ASHGO/1-104-----------------------------------MP...KLEQFEIKKYWQIFSGLSPSDNKVTHDQVAPILHN-S-KL
END3_PICST/1-104-----------------------------------MP...RLEDWEIKKYWEIFQGLDPVNKKLTGDKVAPVLKN-S-RL
END3_PICGU/1-104-----------------------------------MP...QLEEWEIKKYWEIFQGLKPQDNKLSGSKVSPVLKN-S-QL
END3_LODEL/1-104-----------------------------------MP...RLEESEIKKYWQIFQGLKPENNKVSGEQVSPVLKN-S-RL
END3_AJECN/1-106-----------------------------------MSE.KKIEQWEVERYWEIFSSLSNGQPHLNNAQAATVLRN-S-RL
C4R6X1_PICPG/1-105-----------------------------------MP..EKLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKN-S-QL
C4Y889_CLAL4/1-104-----------------------------------MP...RLEEWEIKKYWEIFQGLQPKDNKLTGDRVSPVLKN-S-RL
C5DUA9_ZYGRC/1-104-----------------------------------MP...KLEQFEIKKYWQIFSGLKPENNKVNHDQVLPILFN-S-KL
END3_CANAL/1-104-----------------------------------MP...RLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKN-S-QL
END3_DEBHA/1-104-----------------------------------MP...RLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKN-S-RL
END3_YARLI/1-107-----------------------------------MSAQGKLEEWEINKYWDIFSGLKPVNNVLTGDQVSPVLKN-S-NL
END3_SCHPO/1-101-----------------------------------MD......PQEKNKYWEIFRGLNPENGYLSGSKAAGVLRS-S-KL
END3_MAGO7/3-105-----------------------------------.P...RIEAQEIETYWNIFSARTNGSKFLTGEQAAPVLKN-S-GL

PF14788

E1BJE0_BOVIN/197-246-------------------------------------------------------KMSFKEIKNLLRMVNLDMNDMYAY-
F1RBD7_DANRE/179-228-------------------------------------------------------KMSLKELKHFLRQINIEVNDSYAE-
B0S4U2_DANRE/156-205-------------------------------------------------------KMSLKEVKSFLKDINVEVHEDYAE-
D4A881_RAT/153-202-------------------------------------------------------RMSFREAQRLLLLMNVEMDEEYAF-
PLCD4_BOVIN/153-202-------------------------------------------------------RMSFGEVQRLLHLMNVEMDQEYAF-
G3GVA5_CRIGR/185-234-------------------------------------------------------KMNFKELKDFLKELNIQVDDSYAR-
G3PRC9_GASAC/150-198-------------------------------------------------------KMSYDEVQTLLQMINIDLSDQYAR-
H2UZG6_TAKRU/153-201-------------------------------------------------------KMSYEEVKRLLQMINIDLSEQYAR-
H2V6N1_TAKRU/134-183-------------------------------------------------------KMTLKELKHFLRQINVEVDDVYAE-
H3CR59_TETNG/181-230-------------------------------------------------------KLTQSEMKNFLRLINIEVDDIYAE-

PF10591

Q29BA1_DROPS/165-277PRICDGEDLKEFPRRMRDWLFNVMRDLAERDELT.........................EHYMQMELEAETNNSRRWSNA
Q1HPY3_BOMMO/181-294MPDCTESEMSDFPRRMRDWLFNIMRDMAERRELT.........................PHYLKMEREAESNLTRRWANA
SPRC_CHICK/147-284IPACLDTELTEFPLRMRDWLKNVLITLYERDEDNNLLTEKQKLKVK.NIHENEKRLEAGDHTVELLARDFEKNYNMYIFP
A7SG90_NEMVE/110-218VSECARDNLLQFGERYLEWILISRRRLVNRYYQV.............................KESEKGHNLPPDMRKEL
A7SPL6_NEMVE/109-215MTDCPKWMLEQFPYRFLDWLYLTRELSRDPRFEI...............................AKRGEQLTGDEIKEV
A7RFR0_NEMVE/170-293QDNCTRFENATLGARLLDWFHVLRAEYIKTESRKAGHPVD............QPIFPKMDIREAHVPFPCGHSHQECREP
A8Y2J4_CAEBR/138-252LDECTEEHMAQFPERMADWLFQVMKELKKRRELH........................KLEWEELLSEAENDDEKKHVYP
TICN1_HUMAN/195-304RSACTDKELRNLASRLKDWFGALHEDANRVIKPT..........................SSNTAQGRFDTSILPICKDS
Q16II0_AEDAE/177-290MPDCSENDLADFPRRMRDWLFNVMRDLAVRNELP.........................EAYMELEQEAESNLTKRWTNA
A0MT19_STRPU/148-261MGSCSAEDLREYPERMTNWFIKSLALIRNRPEEH.........................GGLSQKEKETLQQEWSQSTHA
Q7PRF4_ANOGA/338-442RNECKPQQLTAIGNRLLDWFSVIMADSKKRRQHQ...............................QQKNKVHFPAACKLE
TICN3_PONAB/198-308KRACSDLEFREVANRLRDWFKALHESGSQNKKTK.........................TLLRPERSRFDTSILPICKDS
B0BM14_XENTR/192-300.ETCTGQDLADLGDRLRDWFQLLHENSKQNNTSN..........................PGSKQVNVLDKSLVAGCKDS
E9QJD8_DANRE/162-269.RECGNAEMTEVVSRLREWITVLHESGNTNKKYK...........................FQKPEKKVDMSKVPLCKDS
F6T3M2_CIOIN/214-350.QPCGEHELSEYPTRMRSWIKNIYLQMYDEAEDMGGLNEKQRFHGRKLVANRDRLQTYEEHHIDLMSREFQKFYPLYKYP
G3UR35_MELGA/364-501.PHCTDYEVGQFPLRMRDWLKNILMQYYERDQDKPGFLTEKQRNKVKKIYLNEKRLVSGEHPVELLLHDFEKNYHMYVYP
G3V7X5_RAT/483-620.PACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAGDHPIELLLRDFKKNYHMYVYP
H2LN90_ORYLA/63-169.KVCSESELKEVVSRLRDWFRVLHENGNHKRVKI...........................QKPEKSKFEVGASPICKDP
H2TJA1_TAKRU/149-286.PSCLDAELVQFPLRMRDWLKNVLLQLYDHDSTAPGFLTAKQRFKVKKIFESERRLHAGNHSAELLAQDFEKNYNMYIYP
H3C0L7_TETNG/120-229.TGCTDSELHSLAARLKDWFRVLHLDANRDLKSS.........................DNFDSTTGHFDTSILPICKDS
H3CJ51_TETNG/117-225.NSCTGQDLADLGDRLKDWFQLLHGNAKQNNSGR..........................PGSGTSSALDRSLGASCKDS

PF05042

M0ZSZ7_SOLTU/18-187--------------------------------------------------------------------------HEL---
PXG4_ARATH/14-183--------------------------------------------------------------------------EED---
W5GVY7_WHEAT/41-208--------------------------------------------------------------------------..T---
A9TDR9_PHYPA/60-230--------------------------------------------------------------------------NGY---
N1PPK3_DOTSN/103-267--------------------------------------------------------------------------QDQ---
A7F628_SCLS1/71-243--------------------------------------------------------------------------RHL---
K4CW85_SOLLC/66-235--------------------------------------------------------------------------NGM---
B2VUB2_PYRTR/75-243--------------------------------------------------------------------------AHQ---
D8TIC1_VOLCA/23-191--------------------------------------------------------------------------.TM---
S8ELD9_FOMPI/63-230--------------------------------------------------------------------------SNQ---
G9P0S4_HYPAI/77-245--------------------------------------------------------------------------QNQ---
E4ZR70_LEPMJ/128-296--------------------------------------------------------------------------TKR---
K5X1I2_AGABU/20-182--------------------------------------------------------------------------.SN---
M2RFF2_CERS8/70-238--------------------------------------------------------------------------SDQ---
D8S798_SELML/1-165--------------------------------------------------------------------------...---
K4BNV2_SOLLC/17-184--------------------------------------------------------------------------..P---
B6GVQ0_PENCW/53-222--------------------------------------------------------------------------.GY---
J3LZI1_ORYBR/63-232--------------------------------------------------------------------------RQM---
J4IAJ5_FIBRA/68-243--------------------------------------------------------------------------KNF---
M2SX69_COCSN/76-244--------------------------------------------------------------------------SHQ---
M1WCH0_CLAP2/79-251--------------------------------------------------------------------------QHQ---
K4ASA8_SOLLC/11-179--------------------------------------------------------------------------DEL---
U1GYE4_ENDPU/86-255--------------------------------------------------------------------------QHQ---
W1NF78_AMBTC/26-195--------------------------------------------------------------------------EEM---
D8QM27_SCHCM/3-166--------------------------------------------------------------------------...---
W5B7W5_WHEAT/64-233--------------------------------------------------------------------------QQR---
D7T8M1_VITVI/24-191--------------------------------------------------------------------------..L---
V5FPI1_BYSSN/68-238--------------------------------------------------------------------------KDY---
H6BKU8_EXODN/53-222--------------------------------------------------------------------------AQL---
G2WXT5_VERDV/79-249--------------------------------------------------------------------------RHQ---
M1CV68_SOLTU/61-230--------------------------------------------------------------------------HGM---
C5WSN8_SORBI/57-226--------------------------------------------------------------------------RGM---
R1H351_BOTPV/148-315--------------------------------------------------------------------------QDK---
B9SQU8_RICCO/58-227--------------------------------------------------------------------------HGL---
E9EBJ4_METAQ/18-186--------------------------------------------------------------------------SEN---
J5JK78_BEAB2/77-245--------------------------------------------------------------------------KNS---
M7ZYZ8_TRIUA/63-232--------------------------------------------------------------------------GQK---
U9TJL4_RHIID/120-291--------------------------------------------------------------------------TRK---
I2G1F4_USTH4/56-233--------------------------------------------------------------------------KGL---
D8S1Z4_SELML/28-200--------------------------------------------------------------------------AEM---
C4JJV1_UNCRE/84-252--------------------------------------------------------------------------SNQ---
B9HJF5_POPTR/20-189--------------------------------------------------------------------------NDH---
N4U5F7_FUSC1/46-215--------------------------------------------------------------------------EKL---
I1BMD1_RHIO9/14-180--------------------------------------------------------------------------.KE---
G2YVJ3_BOTF4/138-309--------------------------------------------------------------------------KHL---
M4D7A9_BRARP/18-187--------------------------------------------------------------------------EGY---
A8N0P5_COPC7/81-240--------------------------------------------------------------------------KTN---
F2D072_HORVD/38-206--------------------------------------------------------------------------ANM---
M0U3Y1_MUSAM/16-185--------------------------------------------------------------------------MQM---
B0DXN4_LACBS/89-257--------------------------------------------------------------------------KKN---
R7YGA5_CONA1/24-193--------------------------------------------------------------------------.KG---
I1NI03_SOYBN/61-226--------------------------------------------------------------------------HNL---
I1P3Z8_ORYGL/21-188--------------------------------------------------------------------------..A---
Q0CAM3_ASPTN/84-254--------------------------------------------------------------------------KEY---
F8PYI9_SERL3/62-238--------------------------------------------------------------------------QEY---
G7EB36_MIXOS/116-285--------------------------------------------------------------------------EGY---
K1XCK9_MARBU/55-223--------------------------------------------------------------------------.DL---
I1GZ91_BRADI/42-211--------------------------------------------------------------------------ANM---
D7MF58_ARALL/62-231--------------------------------------------------------------------------YGL---
G0SB95_CHATD/83-254--------------------------------------------------------------------------ENN---
W1PLQ7_AMBTC/57-226--------------------------------------------------------------------------YNL---
M9LJZ6_PSEA3/74-245--------------------------------------------------------------------------...---
G2QID9_THIHA/80-250--------------------------------------------------------------------------RDH---
A8HQE8_CHLRE/45-210--------------------------------------------------------------------------SGL---
D7M708_ARALL/59-228--------------------------------------------------------------------------QDM---
K2RRQ6_MACPH/115-282--------------------------------------------------------------------------QDK---
M0X087_HORVD/44-210--------------------------------------------------------------------------.GM---
Q7XQ03_ORYSJ/64-233--------------------------------------------------------------------------HHL---
H1UX75_COLHI/78-246--------------------------------------------------------------------------RHQ---
K3YU83_SETIT/135-302--------------------------------------------------------------------------..A---
W5GSM3_WHEAT/39-208--------------------------------------------------------------------------RNM---
PXG7_ARATH/25-194--------------------------------------------------------------------------EKM---
C5Z7Z3_SORBI/47-216--------------------------------------------------------------------------SNM---
Q652U4_ORYSJ/37-206--------------------------------------------------------------------------.EL---
F9X765_ZYMTI/51-216--------------------------------------------------------------------------KNQ---
N1S4R5_FUSC4/79-247--------------------------------------------------------------------------RDQ---
A9S8P8_PHYPA/81-250--------------------------------------------------------------------------NDY---
A0A0C4EDI6_MAGP6/75-243--------------------------------------------------------------------------SHQ---
S2JK15_MUCC1/22-192--------------------------------------------------------------------------HEE---
U4LKU1_PYROM/77-244--------------------------------------------------------------------------SHQ---
C5Z7Z5_SORBI/35-203--------------------------------------------------------------------------.NM---
A0A096UTL6_WHEAT/41-207--------------------------------------------------------------------------...---
I1IEG7_BRADI/42-209--------------------------------------------------------------------------..T---
D8UI18_VOLCA/50-224--------------------------------------------------------------------------TNR---
S3E0E9_GLAL2/112-280--------------------------------------------------------------------------RDQ---
E3S5H2_PYRTT/120-288--------------------------------------------------------------------------HDR---
F7W396_SORMK/75-245--------------------------------------------------------------------------EDY---
F8QCR1_SERL3/58-235--------------------------------------------------------------------------SEY---
C6TFE2_SOYBN/28-195--------------------------------------------------------------------------..E---
R7YKW5_CONA1/107-275--------------------------------------------------------------------------EDA---
M2N5S0_BAUCO/46-214--------------------------------------------------------------------------RHL---
G7XD39_ASPKW/82-248--------------------------------------------------------------------------...---
M0TPW2_MUSAM/57-226--------------------------------------------------------------------------HHL---
M7WRI9_RHOT1/151-321--------------------------------------------------------------------------KDE---
B8P3H3_POSPM/64-231--------------------------------------------------------------------------RRE---
I1H7Y6_BRADI/58-227--------------------------------------------------------------------------RGM---
K5WCX1_PHACS/70-244--------------------------------------------------------------------------IQK---
G3JTA5_CORMM/75-243--------------------------------------------------------------------------KHQ---
H6BSL1_EXODN/85-253--------------------------------------------------------------------------QHQ---
PXG3_ARATH/57-226--------------------------------------------------------------------------KGM---
D8QH68_SCHCM/4-176--------------------------------------------------------------------------GEK---
N4V954_COLOR/75-245--------------------------------------------------------------------------SEY---
A8HVK1_CHLRE/24-187--------------------------------------------------------------------------..Y---
D8U9T4_VOLCA/1289-1463--------------------------------------------------------------------------..L---
G4MNQ2_MAGO7/84-252--------------------------------------------------------------------------SDQ---
H1V486_COLHI/87-256--------------------------------------------------------------------------KNY---
I1Q199_ORYGL/36-205--------------------------------------------------------------------------ANM---
K4ASA7_SOLLC/17-186--------------------------------------------------------------------------EEP---
B8LTU3_TALSN/62-232--------------------------------------------------------------------------KEY---
Q6Z2H7_ORYSJ/195-363--------------------------------------------------------------------------.GV---
Q8H813_ORYSJ/96-265--------------------------------------------------------------------------RGM---
W5HJG6_WHEAT/30-200--------------------------------------------------------------------------.EL---
K1WV35_MARBU/115-286--------------------------------------------------------------------------RRK---
D8S185_SELML/60-228--------------------------------------------------------------------------SGL---
D7MKF7_ARALL/61-230--------------------------------------------------------------------------NGL---
M7SQ47_EUTLA/66-234--------------------------------------------------------------------------EDK---
M7X9U8_RHOT1/104-273--------------------------------------------------------------------------END---
I1JRR6_SOYBN/60-229--------------------------------------------------------------------------NDM---
E1ZMG0_CHLVA/1-167--------------------------------------------------------------------------...---
T0K8D8_COLGC/77-245--------------------------------------------------------------------------RHQ---
N1JIF2_BLUG1/65-234--------------------------------------------------------------------------RHQ---
A9SGT1_PHYPA/66-235--------------------------------------------------------------------------NGY---
W5AQ78_WHEAT/122-291--------------------------------------------------------------------------HNM---
K3YZS5_SETIT/43-212--------------------------------------------------------------------------.GM---
M3D239_SPHMS/91-258--------------------------------------------------------------------------QHQ---

PF14658

KASH5_MOUSE/108-175--------------------------------------------------------------------------N-----
Q4CNH0_TRYCC/14-77--------------------------------------------------------------------------K-----
B3SBZ9_TRIAD/28-95--------------------------------------------------------------------------E-----
C3YNF3_BRAFL/170-239--------------------------------------------------------------------------D-----
B4JT32_DROGR/32-94--------------------------------------------------------------------------E-----
G1M6G8_AILME/38-105--------------------------------------------------------------------------N-----
W5LGH7_ASTMX/234-299--------------------------------------------------------------------------D-----

PF09068

G4LZH2_SCHMA/859-1166CDLMKSM..KQFNTVR..FSDYRTGLKLRRLQKEL..................................CFDSIS-ISIV
F6VUQ0_XENTR/3078-3196TELFQSL..GDLNNVR..FSAYRTAMKIRRLQKTL..................................CLDLLE-LSTT
H2MTI0_ORYLA/24-148RQIFVELGDQNFDSIC..LSTYRTACKLRFIQKRC..................................NLHLID-IYNV
E7ES64_HUMAN/16-140RQLFIEMRAQNFDVIR..LSTYRTACKLRFVQKRC..................................NLHLVD-IWNM
F4WQ21_ACREC/20-144LQLLQEMRQQNFDTIR..FASYRTACKLRFIQKKV..................................HLHNVD-IWNV
U1NS43_ASCSU/3208-3327VEIMEKL..ANFNQVK..FSAYRTAMKLRAIQKRL..................................CLDLLS-LQEL
A8QB20_BRUMA/2997-3116VEIMEEL..TTFNQVK..FSAYRTAMKLRAIQKRL..................................CLDLLT-LEDI
V6CLV8_CAEEL/3071-3190VEIVKEL..SQFNRVK..FLAYRTAMKLRALQKRL..................................CLDLVD-LTLL
B3MR84_DROAN/47-170.SIIDELQ.MKYGNYK..YTVYRCASKFVALQKIF..................................HTGKVP-YKLV
T1KPK1_TETUR/326-448IDLMNSL..VEFNEIR..YSAYRTAMKLRTIQRSL..................................NIDYIH-LGSL
W5JYZ3_ASTMX/396-514TQLFQSM..ADLEHVR..FSAYRTSMKSRRVQKAL..................................CLDLLE-LAMA
W4YT69_STRPU/407-526TELFHSL..SDLNAVK..FSAYRTGMKLRRLQKSL..................................CLYLLN-LASA
B3S724_TRIAD/427-546TEIYDLL..VNNNFIK..YAAYRTAMKLRKLQKCL..................................FLNFIE-LNSL
H3DP81_TETNG/17-141RQLFVELGEQDFDAIR..LSTYRTACKLRFIQKRC..................................NLHLID-IYNV
A4QNP9_XENTR/357-475TELYQAL..GDLNNIK..FSAYRTAMKLRRVQKAL..................................RLDLVT-LPLL
H3BBK9_LATCH/301-419TELYHTL..ADLNNVK..FSAYRTAMKLRRVQKAL..................................RLDLVT-LTSA
H2XWJ0_CIOIN/5-129AELMESM..LDLNDVR..FTAYRTSMKLQRLQKAL..................................CLDLLN-LDTA
B4MYA9_DROWI/9-131..ILQDLRLQTFDSIR..FASYRTASKLRYIQKST..................................NLHLVD-IWNV
T1IRG4_STRMM/3028-3147TELIQSL..AELNDVR..FSAYRTAMKLRTLQKKL..................................CLDLLN-MNNA
I1G265_AMPQE/2-122NTLLGEL..ATYNDIR..FPRYRLCFKLRRLQTCF..................................LLHRLE-LSNL
H9J473_BOMMO/544-669SQLLQEMREQNFDLIR..FASYRTACKLRFVQKKC..................................NLHVID-IWNV
H2WIC0_CAEJA/49-173QQLIDDMRLQDFDSIR..FATYRAACKLRFIQQNT..................................KIHLVD-IWNM
A7T3M8_NEMVE/40-160IQLMQDL..AELNNIK..YAAYRTAMKLRAIHKKT..................................QLYLVE-IPIL
D6WMD4_TRICA/16-140.ALIHEMSAHNFDLIR..FASYRTATKLRFIQKKV..................................SLHAVD-IWNV
W4X438_ATTCE/2-122ENIMRSM..QECNAIR..YPSYRTAAKMQILHREL..................................NMTHVQ-LELI
K1R5C0_CRAGI/40-163.TLLTEMRAQNFDVIR..FATYRTACKLRFIQKKT..................................NLSLVD-IWNI
F8W2P0_DANRE/15-139KQLFMDMKTQNYDTIR..LSTYRTACKLRFVQKKC..................................NLHLVD-VWNM
E9GLP4_DAPPU/11-134..LANDIHTQNFNVIR..LASYRTAVKFRFIQRRT..................................HLHLID-VWNL
T1HS05_RHOPR/9-135KQILEDV..QSCNCIR..YAAYRTAAKLDILQKNL..................................GLDRVG-LTLI
A0A068Y3J2_ECHMU/107-238RRLLAELKAKKFDQIR..FAAYRTASKLRYIQKRT..................................LLSSIE-LWRL
A7S5C8_NEMVE/343-462TELYHQI..AELNDIK..YSAYRTAMKLRCIQKAT..................................KLDLVT-LNNL
Q24175_DROME/44-168STIMDDLQ.RDYGNYK..YTVYRCASKFVALQKIF..................................HTGKIP-YKLV
H2VBW2_TAKRU/4-122TELYQTL..ADLNNVR..FSAYRTAMKIRRLQKAL..................................CLDLLD-LNVA
Q7QHZ2_ANOGA/39-157.........EKYAGAR..YSTYRCAGKLHALQKAL..................................HTSYIP-FEMV
D6WPN9_TRICA/33-153IELKHTI..DDWNYVK..YSKYRVGLKFRALQKAL..................................FMEEVT-LSTV
G6D4U9_DANPL/34-152SKILKTL..DEYNDIK..YSAYRIAFKIFALQRSL..................................KVPPLR-ISS.
F1KWZ8_ASCSU/20-144QALIDEMRLQDFDSIR..FATYRAACKLRFIQKKT..................................SVHLVD-IWNM
E9H0W1_DAPPU/6-127RELLAAL..NQFANIR..YVAYRTAAKLKFIQSQT..................................KLDCIK-LTQI
B0WQW4_CULQU/32-156..ILNKIN.EKFATSK..YSTYRCACKLFALQKAL..................................FTNYIP-FQTI
H0ZKJ9_TAEGU/14-132TDLFQSL..ADLNNVR..FSAYRTAIKIRRLQKAL..................................CLDLLD-LNTT
K1P9S0_CRAGI/40-170.KVMEEL..DEYRDIR..YAAYRTAFKIRHIQKRL......................KCKYPEHAHAGQKVHHVK-LEAM
K1S5H9_CRAGI/1252-1371TDLMDTL..ADLNNVR..FAAYRTAMKLRMLQKKL..................................RLDLVA-MTLA
E9FTM1_DAPPU/561-680EELMNSL..SEFNDVR..FSAYRMALKLRRVQKFL..................................CLDKLE-LNTA
J9K968_ACYPI/1839-1958MELMSSL..SEFNDVR..FSAYRTAMKLRTVQKRM..................................SLDLLT-LEAA
H2N287_ORYLA/21-139AELYQSL..ADLNNVR..FSAYRTAMKLRRLQKAL..................................CLDLLS-MQAA
A2CJ02_DANRE/16-140RQLFAEMRALDLDSIR..LSTYRTACKLRFIQKRC..................................NLHLVD-IWNI
M3XQ41_MUSPF/16-140RQLFAEMRAQDLDRIR..LSTYRTACKLRFVQKKC..................................NLHLVD-IWNV
C3Y1B5_BRAFL/354-478RQLMTEMRTQNFDVIR..LGTYRTACKLRFVQKKT..................................NLHLVD-IWNM
E9J516_SOLIN/156-275IELMSSL..ADLNEVR..FSAYRTAMKLRTVQKRL..................................CLDMLS-LSTA
H9J3Q2_BOMMO/34-162IKLWQSL..SVYDDIK..YAVYRIAFKIHALQKQI..................................RVPPLR-ISS.
B7PND6_IXOSC/52-205VAIMDKL..TSFNDIK..YAAYRTGAKLICLQKELLREQHCSTKGLSSSPGVHPVPTDDYHAFRGALSPAVSNVH-VSML
H2YGZ2_CIOSA/280-404VELMESM..LDLNDVR..FAAYRTAMKLQRLQKAL..................................CLDLLT-LDTA
I1F8U3_AMPQE/47-168TELFKEL..RTLDVIRPAYGAYRVASKLRTLQVIT..................................NLHKVS-KENV
G7YU45_CLOSI/641-909SDLMQSM..KQMNAFR..FAEYRTALKLRKLQKTL..................................CLDSLS-ISIL
H3CSW5_TETNG/23-146RQLFVEMRAHDLDSIR..LSTYRTACKLRFVQKKC..................................NMHLVD-IWNV
T1HBK6_RHOPR/21-145LQLMQEMRSQNFDLIR..FASYRTACKLRFLQRKL..................................NLHLVD-IWNV
M3XL49_LATCH/21-139TELYQSL..ADLNNVR..FSAYRTAMKLRRLQKAL..................................CLDLLS-LSAA
T1J1M8_STRMM/34-154NTVMEEL..SDYKIVK..YSTYRLALKLRALQNVF..................................KLHLVS-TEIL
A0A068XI90_HYMMI/87-218RRLLAELKAKKFDQIR..FAAYRTASKLRYIQKRT..................................LLSLIE-LWRL
I3J386_ORENI/308-426TELYQAL..ADLNNIK..FSAYRTAMKLRRVQKAL..................................RLDLVA-LSSL
G7Y732_CLOSI/88-223.RLLAEMKLRQFDTIR..FAAYRTASKLRYIQQRT..................................LFRFME-LGRV
Q175I9_AEDAE/173-287IELMKSL..ADLNEVR..FSAYRTALKLRTVQKRL..................................AFDRIA-MNVA
D6WLG0_TRICA/462-581LELATSL..LQLNEVR..FSAYRTALKLRAIQKKL..................................CLDLVS-INGA
E0VJZ9_PEDHC/394-512LELMTSL..SELNEIR..FSAYRTAMKLRAVQKRL..................................CLDMIP-LSAA
B4GVZ3_DROPE/35-163SAIMEKLQ.VDYGKYK..YTVYRCASKFVALQKIF..................................HTSKIP-YKLV
T1K642_TETUR/2001-2122TEIINNL..NEFSEVK..FAAYRTAMKLRSIQRHL..................................CLDLIH-LTSL
J9JV60_ACYPI/13-138LQLLQEMRCQNYDMIR..FASYRTACKLRYVQKKV..................................YLHMID-IWNV
B3S1D5_TRIAD/20-144TDILREI..DQLNYIK..FAAYRTAIKMRIIQQRF....................................DKVE-FLRL

PF00404

GUNC_CLOCE/439-459--------------------------------------------------------------------------------
GUNC_CLOCE/406-426--------------------------------------------------------------------------------
GUNG_CLOCE/696-716--------------------------------------------------------------------------------
NAGH_CLOPE/1579-1599--------------------------------------------------------------------------------
Q7UQ89_RHOBA/1857-1877--------------------------------------------------------------------------------
GUNA_CLOCE/415-435--------------------------------------------------------------------------------
Q7UVW2_RHOBA/78-98--------------------------------------------------------------------------------
Q7UQX3_RHOBA/91-111--------------------------------------------------------------------------------
Q97KK3_CLOAB/669-689--------------------------------------------------------------------------------
Q7UJQ5_RHOBA/112-132--------------------------------------------------------------------------------
XYNZ_CLOTH/430-450--------------------------------------------------------------------------------
Q7UJQ3_RHOBA/298-318--------------------------------------------------------------------------------
Q97KK1_CLOAB/403-423--------------------------------------------------------------------------------
Q7NPJ6_GLOVI/26-46--------------------------------------------------------------------------------
Q7NPL8_GLOVI/39-59--------------------------------------------------------------------------------
Q7UI70_RHOBA/1743-1763--------------------------------------------------------------------------------
GUNB_CLOC7/387-407--------------------------------------------------------------------------------
Q8XKX6_CLOPE/1300-1320--------------------------------------------------------------------------------
Q7UY66_RHOBA/134-154--------------------------------------------------------------------------------
Q97KK6_CLOAB/459-479--------------------------------------------------------------------------------
Q97DK6_CLOAB/957-977--------------------------------------------------------------------------------
Q7UWM1_RHOBA/1723-1743--------------------------------------------------------------------------------
Q7UJQ5_RHOBA/144-164--------------------------------------------------------------------------------
GUNB_CLOC7/419-439--------------------------------------------------------------------------------
Q7ULP1_RHOBA/1765-1785--------------------------------------------------------------------------------
Q97DK6_CLOAB/989-1009--------------------------------------------------------------------------------
GUNH_CLOTH/872-892--------------------------------------------------------------------------------
Q97KK0_CLOAB/809-829--------------------------------------------------------------------------------
Q7UY66_RHOBA/95-115--------------------------------------------------------------------------------
Q97KK2_CLOAB/482-502--------------------------------------------------------------------------------
Q9HNT7_HALSA/533-553--------------------------------------------------------------------------------
Q7UFE7_RHOBA/629-649--------------------------------------------------------------------------------
Q7UYG2_RHOBA/96-116--------------------------------------------------------------------------------
Q97KK7_CLOAB/705-725--------------------------------------------------------------------------------
Q7NPJ5_GLOVI/58-78--------------------------------------------------------------------------------
Q7UUS9_RHOBA/5863-5883--------------------------------------------------------------------------------
Q7UF11_RHOBA/73-93--------------------------------------------------------------------------------
Q7NPJ7_GLOVI/30-50--------------------------------------------------------------------------------
Q7UNV4_RHOBA/5954-5974--------------------------------------------------------------------------------
Q97KK0_CLOAB/777-797--------------------------------------------------------------------------------
Q7UF08_RHOBA/1987-2007--------------------------------------------------------------------------------
Q977Y3_CLOAB/584-604--------------------------------------------------------------------------------
Q7UF12_RHOBA/1289-1309--------------------------------------------------------------------------------
Q7UVU1_RHOBA/870-890--------------------------------------------------------------------------------
Q977Y3_CLOAB/552-572--------------------------------------------------------------------------------
GUNH_CLOTH/833-853--------------------------------------------------------------------------------
Q7UI80_RHOBA/1559-1579--------------------------------------------------------------------------------
Q8ESB0_OCEIH/16-36--------------------------------------------------------------------------------
GUNF_CLOTH/670-690--------------------------------------------------------------------------------
GUNB_CLOTH/534-554--------------------------------------------------------------------------------
GUNG_CLOTH/503-523--------------------------------------------------------------------------------
Q7UF11_RHOBA/111-131--------------------------------------------------------------------------------
Q7UKT7_RHOBA/597-617--------------------------------------------------------------------------------
GUNF_CLOTH/709-729--------------------------------------------------------------------------------
Q7UUS9_RHOBA/5821-5841--------------------------------------------------------------------------------
Q97KK2_CLOAB/515-535--------------------------------------------------------------------------------
GUND_CLOCE/530-550--------------------------------------------------------------------------------
GUNF_CLOCE/699-719--------------------------------------------------------------------------------
Q7UUT0_RHOBA/783-803--------------------------------------------------------------------------------
Q7UI80_RHOBA/1600-1620--------------------------------------------------------------------------------
Q7UNV3_RHOBA/7352-7372--------------------------------------------------------------------------------
Q7UF08_RHOBA/2027-2047--------------------------------------------------------------------------------
GUNA_CLOCE/446-466--------------------------------------------------------------------------------
GUNF_CLOCE/667-687--------------------------------------------------------------------------------
XYNZ_CLOTH/464-484--------------------------------------------------------------------------------
GUND_CLOCE/562-582--------------------------------------------------------------------------------
Q7UF12_RHOBA/1249-1269--------------------------------------------------------------------------------
A3DBF5_CLOTH/714-734--------------------------------------------------------------------------------
A3DBF6_CLOTH/507-526--------------------------------------------------------------------------------
GUB_CLOTH/308-327--------------------------------------------------------------------------------
A3DC30_CLOTH/418-438--------------------------------------------------------------------------------
CELK_CLOTH/834-854--------------------------------------------------------------------------------
A3DCH2_CLOTH/1195-1214--------------------------------------------------------------------------------
A3DD30_CLOTH/1292-1312--------------------------------------------------------------------------------
A3DD31_CLOTH/646-665--------------------------------------------------------------------------------
A3DDK3_CLOTH/415-435--------------------------------------------------------------------------------
A3DDK4_CLOTH/506-526--------------------------------------------------------------------------------
GUND_CLOTH/621-640--------------------------------------------------------------------------------
A3DDW7_CLOTH/768-788--------------------------------------------------------------------------------
A3DGI0_CLOTH/560-580--------------------------------------------------------------------------------
A3DHC1_CLOTH/590-610--------------------------------------------------------------------------------
A3DJ81_CLOTH/560-579--------------------------------------------------------------------------------
A3DJ82_CLOTH/549-569--------------------------------------------------------------------------------
B8I2F6_CLOCE/406-426--------------------------------------------------------------------------------
B8I7V4_CLOCE/827-847--------------------------------------------------------------------------------
B8I7V7_CLOCE/736-756--------------------------------------------------------------------------------
B8I7V8_CLOCE/33-53--------------------------------------------------------------------------------
B8I7V9_CLOCE/505-525--------------------------------------------------------------------------------
B8I7W0_CLOCE/623-643--------------------------------------------------------------------------------
B8I7W1_CLOCE/480-500--------------------------------------------------------------------------------
D9SP57_CLOC7/281-301--------------------------------------------------------------------------------
D9SS67_CLOC7/65-85--------------------------------------------------------------------------------
D9SS71_CLOC7/661-681--------------------------------------------------------------------------------
D9SS72_CLOC7/674-694--------------------------------------------------------------------------------
D9SV64_CLOC7/1016-1036--------------------------------------------------------------------------------
D9SX08_CLOC7/1284-1304--------------------------------------------------------------------------------
D9SX09_CLOC7/800-820--------------------------------------------------------------------------------
E6UCK3_RUMA7/387-407--------------------------------------------------------------------------------
CIPA_CLOTH/1824-1842--------------------------------------------------------------------------------

PF08976

EFCB6_HUMAN/1160-1260----------------------------------------------------------ATADRDILARLHKAVTSHYHAI
EFCB6_MOUSE/1177-1281----------------------------------------------------------ETAHRDIVARVQKAVASHYHTI

PF05517

Q22LY3_TETTS/4-144-----------------------------------------------SAAFKKFTNQ.............RSTMD-SKTF
F7A9H5_CIOIN/10-157-----------------------------------------------EAAYKKFMVMG....NSKA.....TKMT-GKNF
D6WGQ8_TRICA/41-188-----------------------------------------------EENFKAFAKFG....DPKS...DGKLIT-LSNS
W5MNL1_LEPOC/11-166-----------------------------------------------QEAFRKFAIHG....DTKA...TGKEMN-GKNW
D8LL72_ECTSI/5-152-----------------------------------------------EQIFLDFTSFG....AGQS...GSSEMD-SAKF
H2KPC6_CLOSI/2-158-----------------------------------------------EDVFRAFCDAS......KK...GSTTAT-DKTV
G5E6W0_LOXAF/11-167-----------------------------------------------GKTFQRFVLFG....DSST...SGTEMN-NKNF
I1G6R5_AMPQE/9-173-----------------------------------------------EDVFQSFCSFG....EGLK...GSAAMD-NAKF
H3CL48_TETNG/12-167-----------------------------------------------KIAFEKFAVHG....DTKA...TGKEMN-GKNF
H2KRM5_CLOSI/2-161-----------------------------------------------EEIFLAFCDAA......KK...GSKTCT-DKTL
U6GY43_EIMAC/4-148-----------------------------------------------KDAFNAYTKG.............ADEMD-GRTF
M9NFZ9_DROME/38-184-----------------------------------------------SDQFKAFSKFG....DSKS...DGKLIT-LSQS
U3I6W5_ANAPL/16-171-----------------------------------------------EDAFHKFAVYG....DTAA...SGNEMT-GKNF
H3FV66_PRIPA/19-174-----------------------------------------------KAKWEAFSKFG......AA...TATEMT-GKNF
Q4CVJ1_TRYCC/4-149-----------------------------------------------ESAFYAFASFG....GAP.....TKEMD-NAHF
A4H7S2_LEIBR/5-150-----------------------------------------------QATFEAFASFG....SGP.....SKEMD-NSHF
TPPP3_BOVIN/11-166-----------------------------------------------EESFRKFAIHG....DPKA...SGHEMN-GKNW
G6CLN4_DANPL/48-197-----------------------------------------------KDAFKMFSKFG....DPKS...DGKQIT-LSQS
T1FX30_HELRO/6-158-----------------------------------------------AEAFKQFATKA...........DGKEQT-TADF
U6HDT8_HYMMI/2-147-----------------------------------------------EDTFNDFCSSV......KK...GSSTCT-DKTL
E2BTF0_HARSA/55-204-----------------------------------------------LTSFKAFSKFG....DPKS...DGKLIT-LSQS
A0CF04_PARTE/6-146-----------------------------------------------QQVFLQFTAN.............KPEMD-GKTF
A0A068Y0H8_ECHMU/16-175-----------------------------------------------EKSFYAFCDSV......KK...GSTTCT-DKTL
H9GHI6_ANOCA/5-160-----------------------------------------------ESTFRKFATYG....DTAA...SGNDMT-SKNF
A7RHK7_NEMVE/7-164-----------------------------------------------HEIFKSFCAFGA...GCKD...AQPLMD-NAKF
D6XFL0_TRYB2/2-147-----------------------------------------------EAVFYAFASFG....TAP.....TKEMD-NAHF
H0WVY9_OTOGA/7-166-----------------------------------------------EKTFKKFAVFE....DSSS...NGTEIN-NKNF
E4XY40_OIKDI/6-164-----------------------------------------------KSTFQAFAVQG....TTATQAKSTNEIN-NKNF
G0QSX0_ICHMG/7-148-----------------------------------------------ETCFKAFTSG.............KAEMD-GKTF
M3XKY5_LATCH/10-165-----------------------------------------------QETFRKFASYG....DTKA...TGKEMT-GKNW
B9PV11_TOXGO/5-144-----------------------------------------------DAVFKSFTHD.............APAMD-GRTF
H9KVM3_CALJA/52-207-----------------------------------------------EEAFWHFAVHG....DTRA...TGREMH-GKNW
J9EXN0_WUCBA/17-172-----------------------------------------------KHRWEGFVKFG......NA...SAVEMT-GKNF
Q244Y3_TETTS/6-149-----------------------------------------------EGVFKKFTGG.............KIEMD-GKTF
A8J0Z0_CHLRE/6-151-----------------------------------------------KNAFIAFASYG....KGQM...MKQDMD-NKNF
E5STC2_TRISP/24-181-----------------------------------------------RRRWELFSKFG......NQ...AAVEIT-GKNF
U6GZJ1_EIMAC/4-143-----------------------------------------------QSVFDAFTHG.............AAAMD-GRTF
G5BFW3_HETGA/6-161-----------------------------------------------EKTFHRFVAFG....DTAS...SGTEMN-NKNF
H3DM30_TETNG/57-212-----------------------------------------------EEAFRRFAIHG....DTRA...TGKEMH-GKNW
T1EI86_HELRO/1-158-----------------------------------------------EDLFKSFCAFGADKHSSQS...AAAMLD-GAKF
Q22LY5_TETTS/4-144-----------------------------------------------AAAFKKFTNE.............KSSMD-VKIY
A7SHU5_NEMVE/7-164-----------------------------------------------QAKFESFCAFGA...GAKG...AQPLMD-NAKF
G4LUA3_SCHMA/5-165-----------------------------------------------EKIFYDFCDAV......KK...GSRTAT-DKTI
M3ZWD1_XIPMA/12-167-----------------------------------------------ETSFQKFAVHG....DTKA...TGKEMN-GKNF
C3Z131_BRAFL/11-164-----------------------------------------------AESFKAFAIQG....DTKA...TGKDMT-NKNW
H2Z4T4_CIOSA/7-154-----------------------------------------------EAVYKKFMVMG....DSKA.....TKMN-SRNF
T1J2B3_STRMM/130-279-----------------------------------------------EEEFKLFAKFG....DAKS...TGEGIT-LSNS
E9GKV1_DAPPU/13-160-----------------------------------------------TELFRAFAKFG....DSKA...DGKAIS-LSQS
H0XJQ0_OTOGA/6-158-----------------------------------------------EKTFKKFAAFE....DSSS...NGTEIN-NKNF
A7URV3_ANOGA/71-217-----------------------------------------------KEQFKAFSKFG....DTKS...DGKHLT-LSQS
F6WLJ7_MONDO/51-206-----------------------------------------------EEAFRKFAIHG....DTRA...TGKEMH-GKNW
H0XXQ3_OTOGA/6-162-----------------------------------------------EKTFQRFAVLG....DSSS...SGTEIN-NKNF
H2VL30_CAEJA/15-170-----------------------------------------------KKKWDAFTKFG......AA...TATEMT-GKNF
G3VDA5_SARHA/6-159-----------------------------------------------EKTFHLFAAFG....DSSS...SGSNLN-NQNF
A5K8M9_PLAVS/2-146-----------------------------------------------ENAFYIYTKN.............EADMD-SRTF
A0A068YF49_ECHMU/5-161-----------------------------------------------QCAFLAFCDFC......HR...GSSTCS-DKTL
W4Y3F2_STRPU/7-164-----------------------------------------------QDVFKSFCAFGA...GSKD...AAPVMD-NSKW
H2XUF7_CIOIN/13-171-----------------------------------------------HNAFFRFARYG....EVNS...EGREMN-NKNW
H0XB38_OTOGA/6-160-----------------------------------------------DKTFQWFAVLG....DFSS...SGAEIN-NKNF
F7FF94_MONDO/6-161-----------------------------------------------EKTFHHFAAYG....ESSS...SGNEIH-NKNF
C3ZAW1_BRAFL/11-176-----------------------------------------------ADAFRAYATQD....NTEG...TGKEMT-RENF
A0A068YM88_ECHMU/5-161-----------------------------------------------KAAFLAFCDFT......KK...GSTTCN-DKTL
W5QEK4_SHEEP/6-161-----------------------------------------------ERTFQRFAVFG....ESSS...SGTEMN-NKNF
E1ZBC5_CHLVA/14-160-----------------------------------------------RVVFTAFAAFGSGRDSGI.....SSGLE-GRAF
Q244Y1_TETTS/6-149-----------------------------------------------EGVFKKFTAN.............KADMD-GKTF
W5MIZ3_LEPOC/12-166-----------------------------------------------ESTFKKFAVHG....DTKA...TGNEMT-GKNF
TPPP3_XENTR/11-166-----------------------------------------------EESFRKFAIYG....DTKA...TGQEMT-GKNW
Q8I557_PLAF7/2-146-----------------------------------------------ENAFYVYTKN.............LPDMD-SRTF
W4XA53_STRPU/13-167-----------------------------------------------KGVFQKYAVFG........RPGQTKDIT-SKNF
I3J5F5_ORENI/11-166-----------------------------------------------LTAFRKFAVHG....DTKA...TGKDLT-GKNW
H0WRT5_OTOGA/7-160-----------------------------------------------EKTFQRFAVLG....DSSS...SGAEIN-NKNF
K1P202_CRAGI/13-169-----------------------------------------------VEKMKAFALTQ......TK...NASKMD-SKTV
D6WGQ9_TRICA/9-155-----------------------------------------------EQQFVNFSKFG....DTKA...DGRTIT-LTQI

PF08726

ACTN2_MOUSE/824-890--------------------------------------------------------------------------D-TDTA
ACTN1_HUMAN/822-888--------------------------------------------------------------------------D-TDTA
Q21408_CAEEL/2361-2431--------------------------------------------------------------------------N-IQSS
SPTA1_HUMAN/2350-2418--------------------------------------------------------------------------N-IKSS
ACTN3_HUMAN/831-897--------------------------------------------------------------------------E-TDTT
Q5AVH3_EMENI/605-676--------------------------------------------------------------------------D-QNTA
A8Y3R8_CAEBR/827-893--------------------------------------------------------------------------D-QDTV
A0A0D1DXH0_USTMA/566-633--------------------------------------------------------------------------D-TTSP
Q2U7P8_ASPOR/559-630--------------------------------------------------------------------------D-QNTA
Q29EZ8_DROPS/2344-2414--------------------------------------------------------------------------N-VQSY
Q5KJM5_CRYNJ/626-704--------------------------------------------------------------------------D-ASSP
Q0UG56_PHANO/635-706--------------------------------------------------------------------------D-QNTA
Q0CDG2_ASPTN/559-630--------------------------------------------------------------------------D-QNTA
A8DV03_NEMVE/329-399--------------------------------------------------------------------------N-VGSS
C4QKY6_SCHMA/335-403--------------------------------------------------------------------------N-VQSR
F7B6H7_XENTR/829-895--------------------------------------------------------------------------E-TDTS
H9GE13_ANOCA/826-892--------------------------------------------------------------------------E-TDTA
W5NV97_SHEEP/169-237--------------------------------------------------------------------------N-VKSS

PF01023

F7B1J7_CALJA/5-47------------------------------------------------------------------------LETAMDTM
H9GTJ3_ANOCA/4-46------------------------------------------------------------------------LLNSICTI
G3W673_SARHA/5-47------------------------------------------------------------------------LEQALSVM
F6S8H1_HORSE/5-47------------------------------------------------------------------------LEKAMDSL
G3U1S6_LOXAF/4-46------------------------------------------------------------------------LLENITAI
I3IZ76_ORENI/24-63------------------------------------------------------------------------LEEAMEEV
H2RLM4_TAKRU/5-47------------------------------------------------------------------------LQSAMENL
G1RQ12_NOMLE/5-47------------------------------------------------------------------------LKMAVDTM
H9H0S2_MELGA/14-56------------------------------------------------------------------------LEQALAVM
S10AC_HUMAN/4-46------------------------------------------------------------------------LEEHLEGI
F1ST21_PIG/4-46------------------------------------------------------------------------LLQSIVTV
F6SK92_MONDO/5-47------------------------------------------------------------------------LECAINCL
H2N5S9_PONAB/4-46------------------------------------------------------------------------LLENIFAI
H3DJK9_TETNG/9-51------------------------------------------------------------------------MEAAICTL
L9KHS5_TUPCH/4-46------------------------------------------------------------------------LETAMGMI
F6SL70_MONDO/45-87------------------------------------------------------------------------LEIAIETV
G3W262_SARHA/5-47------------------------------------------------------------------------LEGAVNCL
H9L051_CHICK/9-51------------------------------------------------------------------------VEMAIETI
W5NQH6_SHEEP/8-50------------------------------------------------------------------------MESSIETI
H3A3I9_LATCH/5-44------------------------------------------------------------------------TEIAMETL
G5BER0_HETGA/18-59------------------------------------------------------------------------VERAIETL
V8NB04_OPHHA/9-51------------------------------------------------------------------------LELAIEKV
RPTN_MOUSE/4-46------------------------------------------------------------------------LLNSILNV
G1SAS4_NOMLE/10-52------------------------------------------------------------------------TERCIESL
H0WV54_OTOGA/5-47------------------------------------------------------------------------LEKALDAM
Q1LUV5_DANRE/8-48------------------------------------------------------------------------LEKAINTL
W5KR67_ASTMX/5-47------------------------------------------------------------------------LEKAMESL
S10A7_BOVIN/6-45------------------------------------------------------------------------LEQAITDL
F1ST30_PIG/4-46------------------------------------------------------------------------LLRDVLCV
G1SQV2_RABIT/4-43------------------------------------------------------------------------LETAMGMI
W5LHL3_ASTMX/5-47------------------------------------------------------------------------LENAMDSL
H0UWS1_CAVPO/8-50------------------------------------------------------------------------LEKALDTI
H2T287_TAKRU/29-71------------------------------------------------------------------------LEKCMESL
M3XQH5_MUSPF/4-46------------------------------------------------------------------------LEKAMVSL
J3QPE5_MOUSE/4-46------------------------------------------------------------------------MEQAMENI
G3UWB8_MOUSE/8-48------------------------------------------------------------------------SEHKIMML
H2N5P8_PONAB/8-50------------------------------------------------------------------------LERNIETI
G3TZS9_LOXAF/5-46------------------------------------------------------------------------LERAIDSL
H2M1B8_ORYLA/10-52------------------------------------------------------------------------LENAMQLM
G1RH71_NOMLE/4-46------------------------------------------------------------------------LLRNVLCV
V8NST6_OPHHA/5-47------------------------------------------------------------------------LEEALGVM
G1QFV3_MYOLU/4-46------------------------------------------------------------------------LLQGIVTV
F7G3H7_ORNAN/5-47------------------------------------------------------------------------LETAMDTL
W5MVL0_LEPOC/4-46------------------------------------------------------------------------LENAMAMI
F7A2F5_MONDO/6-45------------------------------------------------------------------------MEHDMETR
S10A9_MOUSE/9-51------------------------------------------------------------------------MERSITTI
G3PE20_GASAC/4-46------------------------------------------------------------------------LEKCMESL
W5MF75_LEPOC/8-48------------------------------------------------------------------------LENAINTL
G1SXG6_RABIT/5-47------------------------------------------------------------------------LENSLNSI
W5LAN5_ASTMX/4-46------------------------------------------------------------------------LQQAMAML
I3LG91_PIG/4-46------------------------------------------------------------------------LLRSVVTV
H9H249_MELGA/9-51------------------------------------------------------------------------LEKALESI
F6Q7S6_ORNAN/5-47------------------------------------------------------------------------LEEAMMAV
H9H071_MELGA/4-46------------------------------------------------------------------------FLDSVSTI
I3MVD9_SPETR/8-50------------------------------------------------------------------------MESSIETV
W5MJL4_LEPOC/1-43------------------------------------------------------------------------MEAAINTL
H3A562_LATCH/5-47------------------------------------------------------------------------LELAMQTL
W5NR21_SHEEP/6-45------------------------------------------------------------------------LEQAISAL
H0X9K4_OTOGA/4-46------------------------------------------------------------------------LEEHMKEI
H2TTX5_TAKRU/6-48------------------------------------------------------------------------VCTAMSLL
H2M1Y6_ORYLA/10-52------------------------------------------------------------------------LEKSMESM
G3W2L6_SARHA/6-48------------------------------------------------------------------------VENSIFHI
G1M0L5_AILME/9-51------------------------------------------------------------------------LEDHMEGI
H0Z0V8_TAEGU/5-47------------------------------------------------------------------------LEDAMDTL
F7E9V1_CALJA/9-51------------------------------------------------------------------------LELAIETV
E2R805_CANFA/4-46------------------------------------------------------------------------LLRDVLCI
H2MLR9_ORYLA/5-47------------------------------------------------------------------------LQGAMEDL
G3GWD0_CRIGR/4-46------------------------------------------------------------------------LETAIGPI
F6SL13_MONDO/5-47------------------------------------------------------------------------LENAVAAI
F7F9Z9_MONDO/4-46------------------------------------------------------------------------LLQSIVNI
H0XY71_OTOGA/8-50------------------------------------------------------------------------LERSIETI
L5JU87_PTEAL/64-106------------------------------------------------------------------------LVENILAI
G3WVS2_SARHA/4-46------------------------------------------------------------------------LLQSVIYI
G3WW94_SARHA/4-46------------------------------------------------------------------------LLNSIITI
H0ZIJ7_TAEGU/4-46------------------------------------------------------------------------LETAMGMT
W5QIV2_SHEEP/5-47------------------------------------------------------------------------LLRSIISI
L5JS91_PTEAL/23-65------------------------------------------------------------------------MERCIESL
Q4SS39_TETNG/11-50------------------------------------------------------------------------LEKGMVSI
J9P8R6_CANFA/4-46------------------------------------------------------------------------LLRNIHGI
G3VQV2_SARHA/4-46------------------------------------------------------------------------LLSSILTI
S10A9_RAT/9-51------------------------------------------------------------------------LERSISTI
H0V5V5_CAVPO/5-47------------------------------------------------------------------------LEQALSTV
G3I8A9_CRIGR/9-51------------------------------------------------------------------------LEQSITTI
V8NEZ7_OPHHA/348-387------------------------------------------------------------------------LEHAMETV
F7F9N6_MONDO/4-46------------------------------------------------------------------------LLGNIDGI
W5MEL8_LEPOC/5-47------------------------------------------------------------------------LERAMDAL
G3UBX1_LOXAF/5-47------------------------------------------------------------------------LEQAVATI
H2ZZH2_LATCH/9-51------------------------------------------------------------------------LEAAVGTL
L9J9X1_TUPCH/5-47------------------------------------------------------------------------LEQAICAI
H0XNW8_OTOGA/5-47------------------------------------------------------------------------LEMAMDTL
S10AC_RABIT/4-46------------------------------------------------------------------------LEDHLEGI
M4A7L2_XIPMA/4-46------------------------------------------------------------------------LETSIATI
H2Q028_PANTR/5-47------------------------------------------------------------------------LEKALNSI
H9G3V9_ANOCA/12-54------------------------------------------------------------------------TERCIESL
U3KBY8_FICAL/8-50------------------------------------------------------------------------LEQALAVV
K7GPL5_PIG/5-47------------------------------------------------------------------------LEQGLAAV
W5QIV5_SHEEP/4-46------------------------------------------------------------------------LLRSIFNI
D3ZSW4_RAT/4-46------------------------------------------------------------------------LLRNIHGI
F7GK08_MONDO/10-54------------------------------------------------------------------------IERCIESL
I3JGI1_ORENI/5-47------------------------------------------------------------------------LEKSMESM
I3NDP4_SPETR/4-46------------------------------------------------------------------------LEEHLEGI
G3R010_GORGO/5-44------------------------------------------------------------------------MEHTMETV
TCHL1_MOUSE/4-47------------------------------------------------------------------------LLRGVFCV
G5B8K2_HETGA/4-46------------------------------------------------------------------------LLRSIFDI
M3WT77_FELCA/4-46------------------------------------------------------------------------LLGNIIAI
L5MD08_MYODS/74-116------------------------------------------------------------------------LLENVIAI
H2M4U6_ORYLA/4-46------------------------------------------------------------------------LETAMAML
M3VW16_FELCA/21-63------------------------------------------------------------------------LEIAMNIM
S10A8_BOVIN/5-47------------------------------------------------------------------------LECAINSL
G3SM10_LOXAF/9-51------------------------------------------------------------------------LEEYMEGV
G5BEQ9_HETGA/8-51------------------------------------------------------------------------LEKAIVVL
G3I8A7_CRIGR/4-46------------------------------------------------------------------------MEQGMETI
I3KUM8_ORENI/17-59------------------------------------------------------------------------IQTAMALL
F7AJJ0_MONDO/6-48------------------------------------------------------------------------MEKALDII
U3IKT7_ANAPL/4-46------------------------------------------------------------------------LQENINGI
H0Z1L6_TAEGU/4-46------------------------------------------------------------------------FLDSIATI
G5BEQ8_HETGA/21-63------------------------------------------------------------------------LEQALAAI
L9JAM5_TUPCH/51-93------------------------------------------------------------------------LECALNTV
M126_CHICK/14-56------------------------------------------------------------------------LEKAIDVI
G3NAC2_GASAC/5-47------------------------------------------------------------------------LQTAMEGL
G3WVB3_SARHA/10-54------------------------------------------------------------------------TERCIESM
V8NEZ7_OPHHA/66-108------------------------------------------------------------------------TERCIESL
G3W0M1_SARHA/9-51------------------------------------------------------------------------LKDCLKII
E9PTQ1_RAT/4-46------------------------------------------------------------------------LLESITSM
I3LX36_SPETR/6-48------------------------------------------------------------------------LEQALEVM
Q4RLA4_TETNG/4-46------------------------------------------------------------------------LFTAVAIL
G1NWG9_MYOLU/9-51------------------------------------------------------------------------VETAIDTL
G1SNF3_RABIT/4-46------------------------------------------------------------------------LLKSIIDI
F6TJM4_MONDO/2-44------------------------------------------------------------------------LLKSIVNI
F6R2K0_HORSE/4-46------------------------------------------------------------------------ILENIISI
H0W7W0_CAVPO/4-46------------------------------------------------------------------------LLQGIVTV
G3VKN0_SARHA/4-46------------------------------------------------------------------------LLKSIVTV
G3VRV7_SARHA/22-64------------------------------------------------------------------------LEKAMLAI
F7FV87_ORNAN/4-46------------------------------------------------------------------------LEKSIDSL
G3NGI8_GASAC/4-46------------------------------------------------------------------------IQKAMALL
H0XIU7_OTOGA/5-47------------------------------------------------------------------------TQRCIEFL
L5JX40_PTEAL/5-47------------------------------------------------------------------------LESAMNNF
F6SKU1_MONDO/5-47------------------------------------------------------------------------LEKCLEVM
G3UIG4_LOXAF/6-48------------------------------------------------------------------------VEESLFQI
F7DMV8_XENTR/7-49------------------------------------------------------------------------LETAIAMI
J9JIL5_PIG/7-49------------------------------------------------------------------------TERCIESL
H9GKD3_ANOCA/9-51------------------------------------------------------------------------MESCMETV
F6QF97_ORNAN/4-46------------------------------------------------------------------------LVRSILRV
G1TIX1_RABIT/6-48------------------------------------------------------------------------MEDSLFQI
F6T046_HORSE/3-45------------------------------------------------------------------------MERDLETI
V8N1F0_OPHHA/6-48------------------------------------------------------------------------LEKCLECI
W5MWM7_LEPOC/5-47------------------------------------------------------------------------LENSLATI
A5WW28_DANRE/1-43------------------------------------------------------------------------MESAINVL
L9J9Y0_TUPCH/22-64------------------------------------------------------------------------MENSINTI
G3T7T2_LOXAF/4-46------------------------------------------------------------------------LLRSVLCV
W5LAM8_ASTMX/17-57------------------------------------------------------------------------LEAAIDAI
I3JHV0_ORENI/5-47------------------------------------------------------------------------LKGAMVDL
G1PBJ1_MYOLU/4-46------------------------------------------------------------------------LLRNINGI
M4AK45_XIPMA/1-43------------------------------------------------------------------------MEAAITTI
L8Y375_TUPCH/4-46------------------------------------------------------------------------LLRSIYAI
W5LL26_ASTMX/1-43------------------------------------------------------------------------MESAINVL
M4AAE1_XIPMA/4-46------------------------------------------------------------------------LEMAMATL
M3WK02_FELCA/4-46------------------------------------------------------------------------LEEHLEGI
I3IZ83_ORENI/4-46------------------------------------------------------------------------LETSVACM
H0WH38_OTOGA/4-46------------------------------------------------------------------------LEEHLEGI
I3MT07_SPETR/5-47------------------------------------------------------------------------LEKALDSL
G1M0L8_AILME/8-50------------------------------------------------------------------------LECSIETI
F6RMH6_ORNAN/8-50------------------------------------------------------------------------AEKEMFVI
H0UWS6_CAVPO/8-50------------------------------------------------------------------------LERSLETI
H3BAP4_LATCH/17-59------------------------------------------------------------------------LETAMFAI
G3HUU3_CRIGR/4-46------------------------------------------------------------------------LLQGIVTV
M3ZN15_XIPMA/4-43------------------------------------------------------------------------LESGMASI
H3DR68_TETNG/7-49------------------------------------------------------------------------LEGAMMLL
A5WW33_DANRE/9-51------------------------------------------------------------------------LESAMQML
G3HUU7_CRIGR/5-44------------------------------------------------------------------------MEHAMETM
I3IZ81_ORENI/4-46------------------------------------------------------------------------LQVSMCLM
G5BIG3_HETGA/5-47------------------------------------------------------------------------MEKALNQV
U3KBZ3_FICAL/7-52------------------------------------------------------------------------LEWAVQVL
F7C5Y6_MONDO/4-46------------------------------------------------------------------------LLNSILTV
E2QTP3_CANFA/4-46------------------------------------------------------------------------LEKAALAL
G1Q439_MYOLU/4-46------------------------------------------------------------------------LLNSILTV
L5MCF4_MYODS/5-47------------------------------------------------------------------------MENTLNNF
H9GT13_ANOCA/4-46------------------------------------------------------------------------MENAIDII
F7HI59_CALJA/4-46------------------------------------------------------------------------LLNSILNV
L5JUY8_PTEAL/6-48------------------------------------------------------------------------VEESLVQL
G3VQW8_SARHA/4-46------------------------------------------------------------------------LETAMAML
HORN_MOUSE/4-46------------------------------------------------------------------------LLESIVTV
G5B5Z0_HETGA/5-44------------------------------------------------------------------------TEHAMETM
G3TRT9_LOXAF/9-51------------------------------------------------------------------------LETAIETV
H0VP20_CAVPO/10-52------------------------------------------------------------------------LLRAVFCV
G5B8K1_HETGA/4-46------------------------------------------------------------------------LLNSILSV
S10A9_RABIT/8-50------------------------------------------------------------------------LERSIDTI
H3DJK5_TETNG/6-48------------------------------------------------------------------------LEHAMESL
G1PAG3_MYOLU/43-85------------------------------------------------------------------------LKAAIIMI
Q5T7Y4_HUMAN/5-47------------------------------------------------------------------------LETAMETL
H0XUJ3_OTOGA/5-44------------------------------------------------------------------------MQHAMKTM
S10AC_BOVIN/4-46------------------------------------------------------------------------LEDHLEGI
Q28J00_XENTR/119-161------------------------------------------------------------------------METAMESI
G3Q9D9_GASAC/4-46------------------------------------------------------------------------LETAMAML
W5MJW5_LEPOC/14-56------------------------------------------------------------------------IQQAMALL
G3W1A3_SARHA/8-50------------------------------------------------------------------------LENSCETI
G1TLH6_RABIT/12-52------------------------------------------------------------------------LLRGVLCV
Q7ZVA4_DANRE/5-47------------------------------------------------------------------------LERAMETL
F1M053_RAT/24-66------------------------------------------------------------------------TERCIEFL
Q28J00_XENTR/12-54------------------------------------------------------------------------TERSMEKI
W5QIV3_SHEEP/4-46------------------------------------------------------------------------LLRDILCV
W5MJT4_LEPOC/29-71------------------------------------------------------------------------LERTMETL
S10A8_MOUSE/5-47------------------------------------------------------------------------LEKALSNL
G1PYZ6_MYOLU/2-41------------------------------------------------------------------------MEHAMETM
G5ALL3_HETGA/8-50------------------------------------------------------------------------LERSLDTT
G1RM73_NOMLE/4-46------------------------------------------------------------------------LETAMGMI
V8N500_OPHHA/66-108------------------------------------------------------------------------MEKHLEGI
M4AWV1_XIPMA/5-47------------------------------------------------------------------------LEGAMGAL
F7DLP7_XENTR/4-43------------------------------------------------------------------------LENSMVNI
F6SK72_MONDO/8-50------------------------------------------------------------------------LENAMEKL
W5KP80_ASTMX/4-46------------------------------------------------------------------------LENCLATI
F7EU24_MONDO/4-46------------------------------------------------------------------------LLQSVICV
W5MMW1_LEPOC/5-47------------------------------------------------------------------------LESAMENL
G3HUU5_CRIGR/4-47------------------------------------------------------------------------LLRGIFCV

PF09069

DMD_MOUSE/3204-3295----------------------------------------------------------------------------LEDK
DTNA_HUMAN/144-232----------------------------------------------------------------------------IMDK
DMDA_DROME/3001-3101----------------------------------------------------------------------------LEEK
A2CJ03_DANRE/144-232----------------------------------------------------------------------------ILDK
DTN1_CAEEL/165-253----------------------------------------------------------------------------LVDK
Q7Q0M7_ANOGA/698-797----------------------------------------------------------------------------LEEK
Q8K0N0_MOUSE/144-232----------------------------------------------------------------------------MLDK
DMD_CAEEL/3205-3295----------------------------------------------------------------------------LEEK
A2CI99_DANRE/430-521----------------------------------------------------------------------------IQEK
A7RKW6_NEMVE/120-213----------------------------------------------------------------------------LVDK
DYTN_DANRE/122-217----------------------------------------------------------------------------LSAK
Q1RL59_CIOIN/141-229----------------------------------------------------------------------------LVKK
A7S5C8_NEMVE/466-557----------------------------------------------------------------------------LDDK
A4QNP9_XENTR/479-570----------------------------------------------------------------------------VKGK
A7RTQ0_NEMVE/138-234----------------------------------------------------------------------------LQDK
C3YXT6_BRAFL/1286-1377----------------------------------------------------------------------------LEDK
F6VUQ0_XENTR/3200-3291----------------------------------------------------------------------------LEEK
F8W2P0_DANRE/143-230----------------------------------------------------------------------------LVDK
G4LZH2_SCHMA/1170-1277----------------------------------------------------------------------------LDEK
H0WG43_OTOGA/434-523----------------------------------------------------------------------------.KEK
H2XWJ0_CIOIN/133-223----------------------------------------------------------------------------IEEK
H3C7H8_TETNG/23-109----------------------------------------------------------------------------LVDK
K1S5H9_CRAGI/1375-1466----------------------------------------------------------------------------LDDK
Q0E9B2_DROME/135-223----------------------------------------------------------------------------LVDK

PF09279

F1Q876_DANRE/191-276------------------------------------------------------------------------FYKMLTQR
W5NRL0_SHEEP/229-314------------------------------------------------------------------------FYKILTQR
G1KDV8_ANOCA/226-311------------------------------------------------------------------------FYKILMER
G1MWH7_MELGA/230-314------------------------------------------------------------------------FYKILTER
H2MJ50_ORYLA/198-283------------------------------------------------------------------------FYKILTQR
PLCD4_MOUSE/198-283------------------------------------------------------------------------FYKALTKR
H3BWJ1_TETNG/194-279------------------------------------------------------------------------FYKMLTQR
G5AZI5_HETGA/222-307------------------------------------------------------------------------FYKALTKR
U3I8G1_ANAPL/181-266------------------------------------------------------------------------FYKALTER
G3WSY3_SARHA/199-284------------------------------------------------------------------------FYRALTQR
I3KEU9_ORENI/224-308------------------------------------------------------------------------FYDLLTQR
H3BDF5_LATCH/223-308------------------------------------------------------------------------FYKMLTQR
W5L2U5_ASTMX/209-294------------------------------------------------------------------------FYKMLTQR
E7F646_DANRE/198-283------------------------------------------------------------------------FYKMLTER
W5MR93_LEPOC/213-298------------------------------------------------------------------------FYKMLTQR
F6V4E2_XENTR/202-286------------------------------------------------------------------------FYKILTER
F6QRY0_ORNAN/196-280------------------------------------------------------------------------FYKMLTKR
H3B651_LATCH/225-309------------------------------------------------------------------------FYKELTKQ
W5K063_ASTMX/226-310------------------------------------------------------------------------FYEILTQR
M3ZWC2_XIPMA/197-282------------------------------------------------------------------------FYQMLTQR
G3W0U2_SARHA/202-287------------------------------------------------------------------------FYRKLTQR
H2M8R0_ORYLA/224-308------------------------------------------------------------------------LYDLLSQR
G1KB08_ANOCA/61-146------------------------------------------------------------------------FYKALTQR
H2N2E4_ORYLA/198-283------------------------------------------------------------------------FYKMLTQR
W5KFE6_ASTMX/204-289------------------------------------------------------------------------FYKMLTQR
G3NDC5_GASAC/191-276------------------------------------------------------------------------FYKILTQR

PF14513

H0WRZ7_OTOGA/5-174--------------------------------------------------------------------------Q-WISL
I3K800_ORENI/6-152--------------------------------------------------------------------------S-WVCL
U3JL51_FICAL/5-234--------------------------------------------------------------------------M-WISL
I3JHD4_ORENI/6-145--------------------------------------------------------------------------K-WVTL
H2UVA5_TAKRU/6-147--------------------------------------------------------------------------S-WVCL
H2Z7Y7_CIOSA/8-229--------------------------------------------------------------------------E-FVTL
F6ZFB7_CALJA/6-141--------------------------------------------------------------------------K-WAHL
G3N5L2_GASAC/7-146--------------------------------------------------------------------------T-EGSL
H3B0Y1_LATCH/8-204--------------------------------------------------------------------------E-WATL
A4III1_XENTR/6-142--------------------------------------------------------------------------K-WVNL
E1B9E4_BOVIN/5-175--------------------------------------------------------------------------R-WVSL
F1QRM7_DANRE/3-226--------------------------------------------------------------------------D-WVCL
G1L8T2_AILME/5-139--------------------------------------------------------------------------E-RGLI
U3II99_ANAPL/6-148--------------------------------------------------------------------------K-WVNL
G1P0J0_MYOLU/10-149--------------------------------------------------------------------------E-RGLM
G3RAX1_GORGO/6-176--------------------------------------------------------------------------R-WVSL
F7DBT3_XENTR/7-143--------------------------------------------------------------------------E-WAIL
G1MWU5_MELGA/5-169--------------------------------------------------------------------------G-WITL
G1KN57_ANOCA/6-147--------------------------------------------------------------------------K-WANL
W5MZM3_LEPOC/6-149--------------------------------------------------------------------------K-WVTL
E7F6P3_DANRE/11-146--------------------------------------------------------------------------.-..EI
I3KSY7_ORENI/8-175--------------------------------------------------------------------------.-EGSL
W5KUB5_ASTMX/5-257--------------------------------------------------------------------------S-WVCL
H2Z7Y5_CIOSA/5-166--------------------------------------------------------------------------E-FVTL
F7ED12_MONDO/6-214--------------------------------------------------------------------------.-WNSL
F6YSP6_CALJA/4-151--------------------------------------------------------------------------E-RGLI
F2Z409_MOUSE/5-172--------------------------------------------------------------------------Q-WVSL
G3W1Q3_SARHA/9-144--------------------------------------------------------------------------.-..PL
H2MKP7_ORYLA/6-151--------------------------------------------------------------------------.-VKEL
F6YZZ7_CIOIN/5-138--------------------------------------------------------------------------E-FVTL
H2UR48_TAKRU/6-145--------------------------------------------------------------------------.-VKEL
H9GAH1_ANOCA/6-144--------------------------------------------------------------------------E-WATL
G1KHJ2_ANOCA/5-267--------------------------------------------------------------------------T-WITL
H2MQ62_ORYLA/6-174--------------------------------------------------------------------------K-WVTL
H2ML94_ORYLA/6-174--------------------------------------------------------------------------.-.GSL
H2U3N1_TAKRU/8-142--------------------------------------------------------------------------.-EETL
Q28YA6_DROPS/9-157--------------------------------------------------------------------------K-WDKL
L8XZH6_TUPCH/5-175--------------------------------------------------------------------------L-WVSL
G0MJW5_CAEBE/2-168--------------------------------------------------------------------------.-..LL
W5KDQ2_ASTMX/10-143--------------------------------------------------------------------------.-.KEL
M3ZSU8_XIPMA/6-148--------------------------------------------------------------------------S-WVSL
G3P9R0_GASAC/6-148--------------------------------------------------------------------------E-VKEL

PF02761

G4VQX3_SCHMA/130-213--------------------------------------------------------FRITKPNAARWWLSNFGDSVV.VS
G1KFF7_ANOCA/171-254--------------------------------------------------------FRITKADAAEFWKKFFGEKTI.VP
E4WW32_OIKDI/150-234--------------------------------------------------------FKITKADAKAFWEQHFGAQAI.VN
F6YDP2_CIOIN/175-258--------------------------------------------------------YRITKSEAANFWKTTFGTRTI.VQ
D6WF02_TRICA/163-246--------------------------------------------------------FRITKADAAEFWKTNFGNSTL.VP
C3Y0Y7_BRAFL/117-200--------------------------------------------------------FRITKSEASDFWKKSFGARTV.VP
F2UL73_SALR5/161-243--------------------------------------------------------FTIVKIDAREFWHRQFGKRLV.VP
H3AWW8_LATCH/130-213--------------------------------------------------------YRVTKVEAADFWNRAFGNESI.VR
M3ZWT5_XIPMA/156-239--------------------------------------------------------YKVSKVEADQFWRKYFGTMCI.VP
Q6ABG8_CAEEL/170-254--------------------------------------------------------FRMTKKEAESFWSHHFTKKNI.VP
D3B844_POLPA/283-361--------------------------------------------------------.QLLSAEAQEMWKKRFGKNIIFIQ
A0A068YJL3_ECHMU/143-220--------------------------------------------------------....RKDAQNWWERNFNSRVA.VA
K1Q5V0_CRAGI/164-247--------------------------------------------------------FRITKSDAAEWWRKSFGDRTI.VS
A0A0D2WMR8_CAPO3/199-281--------------------------------------------------------.KIAKKEAADFWKANFDLRCI.VP
I3JZS6_ORENI/156-239--------------------------------------------------------YRVALSAAEDFWRESFGDKCI.VQ
A0A068Y1R3_ECHMU/177-260--------------------------------------------------------FRITKREAAEWWHENFGESSI.VS
E1FY59_LOALO/171-254--------------------------------------------------------FRITKKEADAFWRESFGIKTT.VP
H3FMQ3_PRIPA/211-293--------------------------------------------------------FRLTKREADAFWKTSFKARIC.VP
W5M9V8_LEPOC/138-221--------------------------------------------------------YRLTKSDAAEFWRRAFGSRCV.VP
T1I3T8_RHOPR/164-245--------------------------------------------------------FRITKSDAAEFWRNNFGNSTA.DP
W5K157_ASTMX/160-243--------------------------------------------------------YKLTKTEAQEFWKKTFGYRCI.VQ
B3RTT8_TRIAD/175-258--------------------------------------------------------YRIVDEGACQFWKESFRSRAI.IP
T1ELS4_HELRO/107-190--------------------------------------------------------FRVTKNDADEWWKSAFQDKII.IQ
G3NGI5_GASAC/156-239--------------------------------------------------------YRVTKADAHEFWISSFGNKCI.VQ
T1FD14_HELRO/187-270--------------------------------------------------------FRITKSDAADWWKKSFPDKTV.VP
H2W705_CAEJA/171-255--------------------------------------------------------FRITKKEAESFWSHHFPKKNI.VP
G1PX47_MYOLU/76-159--------------------------------------------------------YQLTKTEAHAFWREHCGARCV.LP
G3VNM8_SARHA/32-115--------------------------------------------------------YQLSKPQAQDFWRTACGTRCV.VP
E5SBG4_TRISP/162-245--------------------------------------------------------FRVTKKDAAEFWRNCFNNRTL.VS
H2KVK0_CLOSI/153-236--------------------------------------------------------YRITKPDAAKWWLDNFGSDSI.IH
T1FF20_HELRO/19-102--------------------------------------------------------YRITKNDASDWWKSVFKKRTL.VT

PF15157

F1SJL9_PIG/4-153-----------------------------------EELKRLQNPLKQANDGKYLLENHQLAMDVENNIEKYHLNLQPLES
H2RDW3_PANTR/4-158-----------------------------------EELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLES
W5NW45_SHEEP/4-156-----------------------------------EELKRLQNPLKQVNDGKYLLENHQLAMDVENNIQKCHLNLQPLDS
J9P1M2_CANFA/4-155-----------------------------------EEMKRLQNPLEQVNDGKYLLENHQLAMDMENNIEKYHLNLQPLES
M3WPF4_FELCA/4-153-----------------------------------EEMKRLQNPLEQVNDGKYLLENHQMAMDMENNIEKYHLNLQPLES

PF00612

Q9VGW4_DROME/2659-2679------------------------------------------------------------------------------VS
Q9VGW4_DROME/2711-2731------------------------------------------------------------------------------EE
MYO8_ARATH/759-779------------------------------------------------------------------------------RI
MYO8_ARATH/784-804------------------------------------------------------------------------------EA
MYO8_ARATH/807-827------------------------------------------------------------------------------FS
MYO8_ARATH/832-852------------------------------------------------------------------------------TK
MYO8_ARATH/855-875------------------------------------------------------------------------------KK
MYO4_ARATH/833-853------------------------------------------------------------------------------LR
MYO4_ARATH/856-876------------------------------------------------------------------------------RN
MYO4_ARATH/892-912------------------------------------------------------------------------------LD
MYO2_ARATH/882-902------------------------------------------------------------------------------LQ
MYO2_ARATH/905-925------------------------------------------------------------------------------RK
MYO2_ARATH/943-963------------------------------------------------------------------------------LS
MYO6_ARATH/806-826------------------------------------------------------------------------------YS
MYO16_ARATH/756-776------------------------------------------------------------------------------RR
MYO16_ARATH/781-801------------------------------------------------------------------------------EE
MYO16_ARATH/804-824------------------------------------------------------------------------------KS
MYO16_ARATH/829-849------------------------------------------------------------------------------TR
MYO13_ARATH/745-765------------------------------------------------------------------------------GR
MYO13_ARATH/768-788------------------------------------------------------------------------------RN
MYO13_ARATH/793-813------------------------------------------------------------------------------EA
MYO13_ARATH/814-834------------------------------------------------------------------------------IE
MYO13_ARATH/837-857------------------------------------------------------------------------------TK
MYO13_ARATH/860-880------------------------------------------------------------------------------KK
MYO12_ARATH/735-755------------------------------------------------------------------------------AG
MYO12_ARATH/758-778------------------------------------------------------------------------------KR
MYO12_ARATH/783-803------------------------------------------------------------------------------EA
MYO12_ARATH/806-826------------------------------------------------------------------------------QA
MYO12_ARATH/831-851------------------------------------------------------------------------------TK
MYO12_ARATH/854-874------------------------------------------------------------------------------KK
MYO15_ARATH/764-784------------------------------------------------------------------------------RA
MYO15_ARATH/789-809------------------------------------------------------------------------------AA
MYO15_ARATH/837-857------------------------------------------------------------------------------HR
MYO15_ARATH/860-880------------------------------------------------------------------------------QS
MYO1_ARATH/840-860------------------------------------------------------------------------------LH
MYO1_ARATH/863-883------------------------------------------------------------------------------KR
MYO1_ARATH/889-909------------------------------------------------------------------------------HK
MYO1_ARATH/912-932------------------------------------------------------------------------------AD
MYO14_ARATH/742-762------------------------------------------------------------------------------GR
MYO14_ARATH/765-785------------------------------------------------------------------------------RK
MYO14_ARATH/790-810------------------------------------------------------------------------------DA
MYO14_ARATH/838-858------------------------------------------------------------------------------DK
MYO3_ARATH/855-875------------------------------------------------------------------------------KT
MYO11_ARATH/835-855------------------------------------------------------------------------------TK
MYS9_DROME/809-829------------------------------------------------------------------------------NK
ASPM_MOUSE/2562-2582------------------------------------------------------------------------------HG
ASPM_MOUSE/2603-2623------------------------------------------------------------------------------VE
ASPM_MOUSE/2649-2669------------------------------------------------------------------------------RA
ASPM_MOUSE/2675-2695------------------------------------------------------------------------------HR
ASPM_MOUSE/2698-2718------------------------------------------------------------------------------RS
ASPM_MOUSE/2725-2745------------------------------------------------------------------------------KK
ASPM_MOUSE/2763-2783------------------------------------------------------------------------------HM
ASPM_MOUSE/2786-2806------------------------------------------------------------------------------MD
MYO7A_MOUSE/745-765------------------------------------------------------------------------------TD
MYO7A_MOUSE/768-788------------------------------------------------------------------------------KS
MYO7A_MOUSE/814-834------------------------------------------------------------------------------RQ
MYO7A_MOUSE/837-857------------------------------------------------------------------------------LW
MYO5A_MOUSE/767-787------------------------------------------------------------------------------RA
MYO5A_MOUSE/790-810------------------------------------------------------------------------------QR
MYO5A_MOUSE/815-835------------------------------------------------------------------------------TK
MYO5A_MOUSE/838-858------------------------------------------------------------------------------RA
MYO5A_MOUSE/863-883------------------------------------------------------------------------------EY
MYO5A_MOUSE/886-906------------------------------------------------------------------------------MK
MYO1C_HUMAN/735-755------------------------------------------------------------------------------QS
MYO1C_HUMAN/758-778------------------------------------------------------------------------------KR
MYH6_HUMAN/784-804------------------------------------------------------------------------------SR
Q20456_CAEEL/663-683------------------------------------------------------------------------------GD
Q20456_CAEEL/686-706------------------------------------------------------------------------------RA
MYO9B_HUMAN/957-977------------------------------------------------------------------------------VR
MYO9B_HUMAN/980-1000------------------------------------------------------------------------------KR
MYO9B_HUMAN/1002-1022------------------------------------------------------------------------------TQ
MYO9B_HUMAN/1025-1045------------------------------------------------------------------------------KQ
MYH13_HUMAN/786-806------------------------------------------------------------------------------VT
MYO9A_HUMAN/1020-1040------------------------------------------------------------------------------LR
MYO9A_HUMAN/1043-1063------------------------------------------------------------------------------RQ
MYO9A_HUMAN/1075-1095------------------------------------------------------------------------------AS
MYO9A_HUMAN/1116-1136------------------------------------------------------------------------------HM
MYO9A_HUMAN/1139-1159------------------------------------------------------------------------------RK
IQGA2_HUMAN/691-711------------------------------------------------------------------------------EE
IQGA2_HUMAN/721-741------------------------------------------------------------------------------TD
IQGA2_HUMAN/751-771------------------------------------------------------------------------------NN
MYO5B_HUMAN/788-808------------------------------------------------------------------------------KG
MYO5B_HUMAN/813-833------------------------------------------------------------------------------IR
MYO5B_HUMAN/836-856------------------------------------------------------------------------------RR
SCN4A_HUMAN/1728-1748------------------------------------------------------------------------------EV
SCN7A_HUMAN/1626-1646------------------------------------------------------------------------------AV
PPE2_HUMAN/20-40------------------------------------------------------------------------------FK
MYOA_DICDI/724-744------------------------------------------------------------------------------ND
MYOA_DICDI/746-766------------------------------------------------------------------------------TL
MYOJ_DICDI/825-845------------------------------------------------------------------------------DR
MYOJ_DICDI/873-893------------------------------------------------------------------------------TH
MYOJ_DICDI/944-964------------------------------------------------------------------------------LR
MYOE_DICDI/697-717------------------------------------------------------------------------------PR
MYOE_DICDI/719-739------------------------------------------------------------------------------RK
SCN5A_HUMAN/1902-1922------------------------------------------------------------------------------EV
MYO15_MOUSE/1887-1907------------------------------------------------------------------------------NR
MYO15_MOUSE/1910-1930------------------------------------------------------------------------------RR
Q9VHB4_DROME/226-246------------------------------------------------------------------------------LL
IQD14_ARATH/322-342------------------------------------------------------------------------------HA
PPE1_MOUSE/17-37------------------------------------------------------------------------------IK
MYO1A_MOUSE/744-764------------------------------------------------------------------------------RS
NEUM_BOVIN/32-52------------------------------------------------------------------------------HK
MYS2_DICDI/763-783------------------------------------------------------------------------------SE
MYO16_RAT/1147-1167------------------------------------------------------------------------------QR
IQCE_HUMAN/543-563------------------------------------------------------------------------------DE
IQCE_HUMAN/602-622------------------------------------------------------------------------------EE
MYH11_CHICK/793-813------------------------------------------------------------------------------TD
Q9VEZ0_DROME/1321-1341------------------------------------------------------------------------------SD
Q9VQV7_DROME/581-601------------------------------------------------------------------------------ES
CMTA3_ARATH/853-873------------------------------------------------------------------------------QA
CMTA3_ARATH/876-896------------------------------------------------------------------------------RQ
ASP_DROME/973-993------------------------------------------------------------------------------HA
ASP_DROME/1005-1025------------------------------------------------------------------------------HR
ASP_DROME/1032-1052------------------------------------------------------------------------------TQ
ASP_DROME/1055-1075------------------------------------------------------------------------------YH
ASP_DROME/1082-1102------------------------------------------------------------------------------RE
ASP_DROME/1171-1191------------------------------------------------------------------------------KR
ASP_DROME/1279-1299------------------------------------------------------------------------------RK
ASP_DROME/1387-1407------------------------------------------------------------------------------QA
ASP_DROME/1468-1488------------------------------------------------------------------------------RE
ASP_DROME/1495-1515------------------------------------------------------------------------------RQ
ASP_DROME/1657-1677------------------------------------------------------------------------------RC
ASP_DROME/1691-1711------------------------------------------------------------------------------KR
MYSN_DROME/871-891------------------------------------------------------------------------------SD
NEUG_BOVIN/27-47------------------------------------------------------------------------------NA
MY61F_DROME/707-727------------------------------------------------------------------------------HE
MY61F_DROME/730-750------------------------------------------------------------------------------RA
SCN9A_RAT/1888-1908------------------------------------------------------------------------------EV
RNG2_SCHPO/330-350------------------------------------------------------------------------------EK
RNG2_SCHPO/360-380------------------------------------------------------------------------------SS
RNG2_SCHPO/390-410------------------------------------------------------------------------------VN
RNG2_SCHPO/419-439------------------------------------------------------------------------------TK
RNG2_SCHPO/449-469------------------------------------------------------------------------------TP
RNG2_SCHPO/536-556------------------------------------------------------------------------------LD
RNG2_SCHPO/566-586------------------------------------------------------------------------------TS
RNG2_SCHPO/596-616------------------------------------------------------------------------------HL
RNG2_SCHPO/656-676------------------------------------------------------------------------------IP
PPE1_HUMAN/17-37------------------------------------------------------------------------------LR
O17666_CAEEL/558-578------------------------------------------------------------------------------NE
O17666_CAEEL/960-980------------------------------------------------------------------------------KK
SP17_MONDO/144-164------------------------------------------------------------------------------QD
O64852_ARATH/84-104------------------------------------------------------------------------------EW
O64852_ARATH/106-126------------------------------------------------------------------------------LK
BAG5_ARATH/51-71------------------------------------------------------------------------------TA
MYO51_SCHPO/753-773------------------------------------------------------------------------------SK
MYO51_SCHPO/776-796------------------------------------------------------------------------------VK
MYO51_SCHPO/801-821------------------------------------------------------------------------------ER
MYO51_SCHPO/824-844------------------------------------------------------------------------------IK
MYO51_SCHPO/849-869------------------------------------------------------------------------------ES
MYO51_SCHPO/872-892------------------------------------------------------------------------------KK
O84165_CHLTR/116-136------------------------------------------------------------------------------EE
SCN8A_RAT/1894-1914------------------------------------------------------------------------------EV
INVS_MOUSE/556-576------------------------------------------------------------------------------DI
INVS_MOUSE/915-935------------------------------------------------------------------------------NK
MYO52_SCHPO/818-838------------------------------------------------------------------------------SS
MYO52_SCHPO/841-861------------------------------------------------------------------------------KN
MYO52_SCHPO/866-886------------------------------------------------------------------------------HD
MYO52_SCHPO/889-909------------------------------------------------------------------------------QY
MYO1D_HUMAN/699-719------------------------------------------------------------------------------IR
MYO1D_HUMAN/721-741------------------------------------------------------------------------------TK
MYH3_CHICK/787-807------------------------------------------------------------------------------AQ
SCN2A_RAT/1906-1926------------------------------------------------------------------------------EV
MYSA_DROME/781-801------------------------------------------------------------------------------GK
SCN3A_RAT/1852-1872------------------------------------------------------------------------------EV
MYO3_CAEEL/795-815------------------------------------------------------------------------------SR
MYH7_HUMAN/782-802------------------------------------------------------------------------------SR
RGRF1_MOUSE/207-227------------------------------------------------------------------------------IK
MYO4_YEAST/804-824------------------------------------------------------------------------------ME
MYO4_YEAST/829-849------------------------------------------------------------------------------TR
MYO4_YEAST/877-897------------------------------------------------------------------------------LM
MYO4_YEAST/900-920------------------------------------------------------------------------------KR
SCN1A_HUMAN/1916-1936------------------------------------------------------------------------------EV
RDGC_DROME/6-26------------------------------------------------------------------------------IR
IQGA1_HUMAN/746-766------------------------------------------------------------------------------EG
IQGA1_HUMAN/776-796------------------------------------------------------------------------------IP
IQGA1_HUMAN/806-826------------------------------------------------------------------------------KD
IQGA1_HUMAN/836-856------------------------------------------------------------------------------IN
MYO5B_RAT/767-787------------------------------------------------------------------------------RE
MYO5B_RAT/790-810------------------------------------------------------------------------------RA
MYO5B_RAT/815-835------------------------------------------------------------------------------TR
MYO5B_RAT/838-858------------------------------------------------------------------------------RR
MYO5B_RAT/863-883------------------------------------------------------------------------------EH
MYO5B_RAT/886-906------------------------------------------------------------------------------RD
MYO10_BOVIN/743-763------------------------------------------------------------------------------TR
MYO10_BOVIN/766-786------------------------------------------------------------------------------LD
MYO10_BOVIN/789-809------------------------------------------------------------------------------KK
HUM6_CAEEL/736-756------------------------------------------------------------------------------KD
HUM6_CAEEL/759-779------------------------------------------------------------------------------RQ
HUM6_CAEEL/805-825------------------------------------------------------------------------------RK
MYO5A_CHICK/816-836------------------------------------------------------------------------------TR
MYO5A_CHICK/839-859------------------------------------------------------------------------------RD
MYO5A_CHICK/864-884------------------------------------------------------------------------------EH
IQG1_YEAST/569-589------------------------------------------------------------------------------RE
IQG1_YEAST/718-738------------------------------------------------------------------------------VR
IQCB1_HUMAN/295-315------------------------------------------------------------------------------HQ
IQCB1_HUMAN/388-408------------------------------------------------------------------------------EK
Q17383_CAEEL/808-828------------------------------------------------------------------------------AA
Q17383_CAEEL/831-851------------------------------------------------------------------------------RR
Q17383_CAEEL/856-876------------------------------------------------------------------------------HR
Q17383_CAEEL/879-899------------------------------------------------------------------------------RD
Q17383_CAEEL/904-924------------------------------------------------------------------------------EK
Q17383_CAEEL/927-947------------------------------------------------------------------------------RK
Q20199_CAEEL/82-102------------------------------------------------------------------------------DT
Q20199_CAEEL/142-162------------------------------------------------------------------------------DR
Q20641_CAEEL/786-806------------------------------------------------------------------------------TA
Q21000_CAEEL/792-812------------------------------------------------------------------------------GK
Q23673_CAEEL/297-317------------------------------------------------------------------------------TQ
MY31D_DROME/694-714------------------------------------------------------------------------------PH
MY31D_DROME/716-736------------------------------------------------------------------------------MK
MYO6_PIG/815-835------------------------------------------------------------------------------AE
MYO5_ARATH/733-753------------------------------------------------------------------------------GN
MYO5_ARATH/756-776------------------------------------------------------------------------------RN
MYO5_ARATH/781-801------------------------------------------------------------------------------EA
MYO5_ARATH/804-824------------------------------------------------------------------------------RS
MYO5_ARATH/829-849------------------------------------------------------------------------------RK
MYO5_ARATH/852-872------------------------------------------------------------------------------QK
MYO9B_RAT/1003-1023------------------------------------------------------------------------------TR
MY18A_HUMAN/1189-1209------------------------------------------------------------------------------SR
MYO9B_MOUSE/957-977------------------------------------------------------------------------------LR
Q9SD11_ARATH/37-57------------------------------------------------------------------------------EI
Q9SD11_ARATH/59-79------------------------------------------------------------------------------LK
IQD1_ARATH/108-128------------------------------------------------------------------------------EA
Q9SG11_ARATH/110-130------------------------------------------------------------------------------HV
Q9SG11_ARATH/132-152------------------------------------------------------------------------------LK
MYOM_DICDI/890-910------------------------------------------------------------------------------VD
MYOI_DICDI/692-712------------------------------------------------------------------------------LK
MYO2_SCHPO/759-779------------------------------------------------------------------------------QR
MYO7A_DROME/737-757------------------------------------------------------------------------------TR
MYO7A_DROME/760-780------------------------------------------------------------------------------RA
MYO7A_DROME/806-826------------------------------------------------------------------------------RG
MYO7A_DROME/829-849------------------------------------------------------------------------------MW
Q9VB28_DROME/412-432------------------------------------------------------------------------------IQ
Q9VGC1_DROME/191-211------------------------------------------------------------------------------NQ
Q9VGC1_DROME/233-253------------------------------------------------------------------------------EQ
Q9VGW5_DROME/18-38------------------------------------------------------------------------------ES
Q9VGW5_DROME/89-109------------------------------------------------------------------------------DR
Q9VGW5_DROME/112-132------------------------------------------------------------------------------TD
Q9VLZ3_DROME/741-761------------------------------------------------------------------------------LK
Q9VLZ3_DROME/764-784------------------------------------------------------------------------------RE
Q9VLZ3_DROME/810-830------------------------------------------------------------------------------RC
Q9VSS9_DROME/28-48------------------------------------------------------------------------------EQ
Q9W1U2_DROME/81-101------------------------------------------------------------------------------RK
Q9W1U2_DROME/117-137------------------------------------------------------------------------------HR
MYO9A_RAT/1117-1137------------------------------------------------------------------------------HR
Q9ZU28_ARATH/100-120------------------------------------------------------------------------------RW
A8J8K0_CHLRE/834-853------------------------------------------------------------------------------.R
B4QEB4_DROSI/785-803------------------------------------------------------------------------------.K
C3Z0F9_BRAFL/36-55------------------------------------------------------------------------------.S
C5XPD8_SORBI/787-805------------------------------------------------------------------------------.R
C5XVW4_SORBI/618-636------------------------------------------------------------------------------.A
D7MEN8_ARALL/735-753------------------------------------------------------------------------------..
F1MI43_BOVIN/112-130------------------------------------------------------------------------------.N
G3PD79_GASAC/815-834------------------------------------------------------------------------------.S
K4BSS5_SOLLC/848-867------------------------------------------------------------------------------HA
L5LUC3_MYODS/860-879------------------------------------------------------------------------------.K
Q7XA83_ARATH/123-141------------------------------------------------------------------------------.K

PF13405

F5HLN4_ANOGA/622-651.KR-FET---I-------------------.D.KE--------------..---.K-KG.-.Y-VS.ITD----------
B9PZD1_TOXGO/10-39.QA-FQA---L-------------------.D.SG--------------..---.H-RG.-.A-LG.RDE----------
Q7QH58_ANOGA/21-50.EK-FEE---I-------------------.D.TN--------------..---.K-DG.-.F-IE.LKE----------
B9PML0_TOXGO/103-132.VC-FDV---F-------------------.D.PE--------------..---.G-RG.-.V-CS.VKD----------
C4Q5J4_SCHMA/2655-2684.DL-FHR---K-------------------.D.RD--------------..---.R-DG.-.R-LT.RAE----------
B9PRI1_TOXGO/15-44.GA-FDE---F-------------------.D.TK--------------..---.K-TG.-.Y-LS.LNR----------
Q001X5_TOXGO/73-102.EL-FKA---A-------------------.D.IG--------------..---.G-SG.-.K-IG.RTA----------
Q95UJ7_TOXGO/149-178.EA-FAY---F-------------------.D.VS--------------..---.K-HG.-.Y-LT.RKQ----------
CAN8_HUMAN/536-564.RL-FEK---L-------------------...AG--------------..---.K-DS.-.E-IT.ANA----------
A9V4Q3_MONBE/290-319.VA-FDK---I-------------------.D.KD--------------..---.H-DH.-.R-ID.FGE----------
A9V4Q3_MONBE/492-521.DV-FEQ---L-------------------.D.TS--------------..---.G-DK.-.Q-LS.QEE----------
A0BQH1_PARTE/99-128.QV-FDY---Y-------------------.D.SE--------------..---.Q-AG.-.I-LS.PND----------
A0BQH1_PARTE/172-202.RV-YRK---Y-------------------.D.KN--------------..---.N-KG.-.F-VT.LQD----------
B3DGM2_DANRE/12-41.EC-FSL---Y-------------------.D.KK--------------..---.R-KG.-.K-IE.AKD----------
B3DGM2_DANRE/85-114.EA-MRM---T-------------------.D.KH--------------..---.K-KG.-.Y-IQ.ASE----------
B4G986_DROPE/40-69.KA-FDL---F-------------------.D.TE--------------..---.C-TG.-.F-IE.VKE----------
B4G986_DROPE/113-142.KA-FAF---F-------------------.D.DD--------------..---.R-TN.-.R-CT.FDN----------
EFCB6_PONAB/24-53.KA-FKL---I-------------------.D.VN--------------..---.K-TG.-.L-VR.PQE----------
EFCB6_PONAB/255-284.KA-LLI---I-------------------.N.TK--------------..---.P-DG.-.P-IT.REE----------
EFCB6_PONAB/699-728.KN-FLE---T-------------------.D.NE--------------..---.G-NG.-.I-LR.RRD----------
EFCB6_PONAB/816-845.KA-FTK---I-------------------.D.KS--------------..---.K-TN.-.Y-IS.ICK----------
B4GVA6_DROPE/51-80.RI-VDR---I-------------------.D.ED--------------..---.N-NG.-.Y-LT.LVE----------
B4GVA6_DROPE/139-169.RR-WAV---A-------------------.D.ND--------------..---.L-DD.-.S-LT.LEE----------
B4GVA6_DROPE/217-247.KV-FAK---F-------------------LD.HN--------------..---.G-DG.-.Y-LS.EAE----------
C5KAW4_PERM5/19-48.EA-FEI---F-------------------.D.KQ--------------..---.K-LG.-.V-IN.YSQ----------
C5KAW4_PERM5/93-122.EA-FRA---F-------------------.D.PD--------------..---.G-RG.-.L-IR.VEE----------
A0E4G3_PARTE/299-328.EQ-FSK---Y-------------------.D.LD--------------..---.K-EG.-.N-LD.FNE----------
B4K4U2_DROMO/29-58.LA-FSL---F-------------------.D.TN--------------..---.N-TG.-.I-IP.MKQ----------
B4K4U2_DROMO/102-131.LA-FKV---F-------------------.D.RE--------------..---.G-NG.-.W-IH.ENE----------
A0BG74_PARTE/108-137.RA-FHL---F-------------------.S.QG--------------..---.N-DN.-.F-IT.FEN----------
B5Y3F8_PHATC/258-286.KV-FKK---F-------------------.D.VS--------------..---.Q-NG.-.E-IS.LSE----------
Q7Y0H2_CHLRE/18-47.RA-FNT---I-------------------.D.SK--------------..---.G-DK.-.K-ID.AEE----------
C5Z5N8_SORBI/67-96.DM-FAF---F-------------------.D.TE--------------..---.G-RG.-.Q-LD.YAQ----------
C5Z5N8_SORBI/134-163.RI-FQA---I-------------------.D.VE--------------..---.H-NG.-.C-IL.PEE----------
A7SG62_NEMVE/12-41.ES-FEL---Y-------------------.D.KQ--------------..---.G-DE.-.K-ID.SSQ----------
A7SG62_NEMVE/87-116.DS-LRV---F-------------------.D.ND--------------..---.G-SG.-.M-IN.EGE----------
Q240R2_TETTS/29-58.KS-FKF---F-------------------.D.LQ--------------..---.N-NG.-.L-LS.KNE----------
B5DYP3_DROPS/28-57.TV-FDM---F-------------------.D.PE--------------..---.N-TG.-.V-LP.LKQ----------
A7RGK2_NEMVE/11-40.EA-FSL---F-------------------.D.RV--------------..---.G-DG.-.K-IE.CDQ----------
A7RGK2_NEMVE/86-115.EG-LRV---F-------------------.D.RD--------------..---.G-TG.-.T-VL.AAE----------
Q4DGX2_TRYCC/326-357.RA-FVS---C-------------------.N.VN--------------..---.G-SG.-.F-LS.REE----------
A9V7J3_MONBE/330-359.SL-WKQ---A-------------------.D.YN--------------..---.G-NG.-.G-CS.LAE----------
A9V7J3_MONBE/402-431.DV-FED---L-------------------.D.TG--------------..---.D-DR.-.R-ID.LPE----------
Q4Y2X6_PLACH/19-48.EC-FSL---F-------------------.D.TS--------------..---.K-SG.-.Y-ID.IRE----------
B3LYL3_DROAN/28-57.EA-FAL---F-------------------.D.NE--------------..---.D-TK.-.V-IS.IKY----------
A0E0C2_PARTE/300-329.EL-FAE---L-------------------.D.MT--------------..---.K-DK.-.A-LN.VNE----------
C3YDW3_BRAFL/85-114.DA-LKY---T-------------------.D.RQ--------------..---.G-RG.-.F-VM.ATE----------
Q0IEY6_AEDAE/74-103.II-VDK---I-------------------.D.TD--------------..---.K-DS.-.F-VN.LAE----------
Q0IEY6_AEDAE/240-270.ET-FNN---F-------------------RD.KD--------------..---.K-DG.-.F-MN.NQE----------
A9VBL4_MONBE/184-215.CI-FEL---F-------------------.D.QD--------------..---.R-SG.-.K-FE.YEE----------
A0E3X2_PARTE/219-248.EV-FEI---F-------------------.D.YN--------------..---.K-DG.-.H-IE.FNE----------
MYL6B_HUMAN/145-174.EG-FRV---F-------------------.D.KE--------------..---.G-NG.-.K-VM.GAE----------
Q7QCU7_ANOGA/79-109.EA-FAK---A-------------------.D.TN--------------..---.G-DK.-.H-LT.VQE----------
Q7QCU7_ANOGA/211-241.DI-LRQ---F-------------------.D.VD--------------..---.G-DD.-.H-LT.VEE----------
D0NI99_PHYIT/995-1024.RR-LQA---L-------------------.D.TE--------------..---.R-RG.-.S-VT.PSS----------
D0NZK1_PHYIT/776-806.SA-FNE---L-------------------.D.AN--------------..---.G-FG.-.R-VT.KLE----------
C1FGB5_MICSR/2004-2033.EA-FHF---V-------------------.D.AD--------------..---.H-GG.-.D-ID.ENE----------
C1FGB5_MICSR/2077-2106.VG-FDC---F-------------------.D.LA--------------..---.R-KG.-.F-IV.LED----------
C1FGB5_MICSR/2208-2238.DL-IGA---L-------------------.K.RD--------------..---.S-DG.-.D-GS.LSE----------
D3AYI6_POLPA/6-35.EC-FAI---Y-------------------.D.KD--------------..---.N-DG.-.K-VI.IDE----------
D3AYI6_POLPA/79-108.DA-FKA---L-------------------.D.KE--------------..---.G-HG.-.S-IQ.EAE----------
A2ERW3_TRIVA/9-39.AR-FDA---L-------------------.D.EG--------------..---.R-DG.-.K-MK.PAE----------
A2ERW3_TRIVA/82-111.MI-FRA---F-------------------.D.KD--------------..---.R-SR.-.S-ID.VNE----------
A7RV39_NEMVE/88-117.EC-FKV---F-------------------.D.RN--------------..---.G-NG.-.L-IG.AAE----------
A2DT12_TRIVA/7-37.QL-FDK---A-------------------.D.KG--------------..---.K-DG.-.L-LK.FEE----------
A2DT12_TRIVA/80-109.VL-FRA---H-------------------.D.KD--------------..---.R-SG.-.T-LE.TAE----------
A4UNW1_CHICK/97-126.NA-FKI---F-------------------.D.PE--------------..---.G-KG.-.H-IK.ADY----------
A2DIY5_TRIVA/14-43.MA-FDG---F-------------------.D.TN--------------..---.H-TG.-.R-VD.KAY----------
A2DIY5_TRIVA/85-114.DI-FKT---L-------------------.D.KN--------------..---.G-SG.-.R-IP.ADL----------
A8N2E2_COPC7/129-158.EA-FES---F-------------------.D.EN--------------..---.D-TG.-.M-VK.VEE----------
A0CCH5_PARTE/297-326.EL-FSF---F-------------------.D.QD--------------..---.K-TG.-.K-LA.PGD----------
A0BPZ4_PARTE/198-233.RI-FTM---I-------------------.D.SD--------------..---.Q-SG.-.Y-IT.ETE----------
B6K7R4_SCHJY/10-39.EA-FNL---Y-------------------.D.ID--------------..---.N-DG.-.L-IP.TSH----------
B6K7R4_SCHJY/79-108.KA-FAV---F-------------------.D.RD--------------..---.N-TG.-.M-IE.TSR----------
C3YGP7_BRAFL/22-51.EA-FDI---F-------------------.D.HE--------------..---.S-NK.-.T-VD.VRE----------
Q240Z1_TETTS/371-400.VQ-FKK---I-------------------.D.KD--------------..---.Q-TG.-.L-IR.VDE----------
Q240Z1_TETTS/445-474.SI-FKY---F-------------------.D.PS--------------..---.N-TN.-.Y-IS.IAD----------
C3ZWG8_BRAFL/29-59.EF-FKD---F-------------------.D.RL--------------..---.R-SG.-.F-IT.ASQ----------
Q7T2F7_DANRE/113-143.FA-FRL---Y-------------------.D.LD--------------..---.R-DD.-.K-IS.RDE----------
B4LIU4_DROVI/12-41.RV-FDK---Y-------------------.D.ED--------------..---.R-NG.-.S-IE.ARD----------
B4LIU4_DROVI/85-114.KA-FEV---F-------------------.D.RQ--------------..---.G-DG.-.Y-FN.ALD----------
A0C7B9_PARTE/44-73.EF-FTD---F-------------------.D.RL--------------..---.R-KG.-.W-VT.EDK----------
A0C7B9_PARTE/522-551.EF-LRD---F-------------------.D.KL--------------..---.R-SG.-.T-IT.VTQ----------
D0NQW3_PHYIT/447-476.VL-FSE---V-------------------.S.RD--------------..---.G-SE.-.R-VG.LEE----------
B4KPB2_DROMO/13-42.LI-YDK---H-------------------.D.VN--------------..---.R-TG.-.K-ID.IRQ----------
A7SK46_NEMVE/37-66.EA-FNI---I-------------------.D.QD--------------..---.R-NG.-.I-IT.RDD----------
A7SK46_NEMVE/105-134.RA-FSC---L-------------------.D.DG--------------..---.G-DG.-.K-LS.AKM----------
A7S7W7_NEMVE/508-546.SK-FKE---F-------------------.F.DN--------------LS---GR-DG.-.E-ID.AKE----------
A7S7W7_NEMVE/583-612.KI-FQV---F-------------------.D.ED--------------..---.K-SG.-.E-MD.TYE----------
A9SC48_PHYPA/64-94.EL-FMK---I-------------------.S.HS--------------V.---ID-DG.-.L-IH.KEE----------
A9SC48_PHYPA/138-175.FA-FKL---Y-------------------.D.LH--------------..---.Q-TG.-.Y-IE.REE----------
Q4N995_THEPA/859-892.RA-FSH---Y-------------------.D.KE--------------..---.H-VG.-.K-VY.VNE----------
B8PFW7_POSPM/47-76.EA-FSL---I-------------------.D.HD--------------..---.G-NG.-.V-VS.EQD----------
B8CDF2_THAPS/17-48.RI-FNH---I-------------------.D.AE--------------..---.K-EY.-.E-VN.TQQ----------
A2EWU3_TRIVA/26-55.QA-FNL---F-------------------.D.TD--------------..---.G-AG.-.I-IK.AEE----------
A2EWU3_TRIVA/99-128.RA-FRK---L-------------------.D.AD--------------..---.G-ND.-.A-IS.LQD----------
B9S960_RICCO/440-471.SL-FAE---F-------------------.D.KD--------------..---.D-NK.-.K-MT.ARE----------
D0N3P0_PHYIT/23-52.AA-FDM---F-------------------.D.KE--------------..---.K-KG.-.R-VI.QEE----------
D0N3P0_PHYIT/102-131.AA-FRV---I-------------------.D.TE--------------..---.K-KG.-.Y-IE.AEV----------
D0NIV0_PHYIT/360-387.EV-FHS---M-------------------.D.SN--------------..---.K-KG.-.S-LS.RDE----------
C4R6X4_PICPG/24-55.QL-FER---L-------------------.D.IQ--------------..---.H-SG.-.A-IS.LSG----------
B7PVC0_IXOSC/891-929.II-FDM---C-------------------.D.KN--------------..---.G-NG.-.M-IQ.KQE----------
A2F2K1_TRIVA/16-45.KA-FNH---Y-------------------.S.RQ--------------..---.N-NG.-.I-LK.PED----------
A2F2K1_TRIVA/87-116.NA-FKI---F-------------------.D.KK--------------..---.K-QG.-.K-LP.TAT----------
B3MTC1_DROAN/109-140.TA-FQL---F-------------------.D.RQ--------------..---.G-NG.-.T-VS.YAD----------
B3DFQ1_DANRE/118-147.AI-YKK---Y-------------------.D.AD--------------..---.Q-SG.-.V-IG.SDE----------
Q4DBB8_TRYCC/35-64.EA-FDL---F-------------------.D.SE--------------..---.G-TG.-.R-IK.ALD----------
Q4DBB8_TRYCC/108-137.RA-FRL---I-------------------.D.VA--------------..---.E-KG.-.Y-IS.VDD----------
B6AAA3_CRYMR/149-179.LG-FRL---L-------------------.D.RN--------------..---.N-SE.-.Y-IT.ALE----------
B6KGE8_TOXGO/199-230.EA-FAL---M-------------------.D.VD--------------..---.S-SG.-.I-VD.VAR----------
B8CB62_THAPS/13-42.DL-FKI---I-------------------.D.LT--------------..---.G-DG.-.L-IS.LLE----------
Q6CKI4_KLULA/78-107.KA-FQV---F-------------------.D.KD--------------..---.N-TG.-.K-VS.PGD----------
C5DMF9_LACTC/14-45.TL-FST---I-------------------.D.IN--------------..---.G-TG.-.K-VS.LED----------
A8J3S1_CHLRE/300-329.DA-FKF---I-------------------.D.RD--------------..---.A-SG.-.A-LS.LEE----------
A5DJ68_PICGU/64-95.YL-FRV---F-------------------.D.VD--------------..---.N-SK.-.Y-ID.FKE----------
A0CPY1_PARTE/103-143.VI-FSL---Y-------------------.D.FD--------------..---.H-NK.-.T-IT.RNE----------
A8XS91_CAEBR/6-35.EV-FAY---F-------------------.D.SK--------------..---.G-DE.-.R-IS.VQQ----------
A2DQT8_TRIVA/13-42.NA-FDA---F-------------------.D.ED--------------..---.R-DD.-.M-IT.KDV----------
A2DQT8_TRIVA/83-112.DA-FRV---F-------------------.D.KE--------------..---.G-TG.-.K-LP.KDQ----------
A0DCA4_PARTE/23-52.EA-FVA---F-------------------.D.KN--------------..---.V-SG.-.Y-IE.KDE----------
Q5KN37_CRYNJ/88-117.KG-FQV---F-------------------.D.KA--------------..---.G-NG.-.F-IG.AGE----------
A0BDG8_PARTE/301-330.KV-FNK---Y-------------------.D.KS--------------..---.G-DK.-.S-LD.MKE----------
Q66HU4_DANRE/630-659.EI-FKR---Y-------------------.D.FD--------------..---.H-ND.-.T-IS.SYE----------
C5LCN0_PERM5/396-425.KK-FMA---V-------------------.D.RD--------------..---.G-DG.-.F-ID.ANE----------
A9UUF1_MONBE/6-34.DL-FRE---L-------------------.D.N.--------------..---.G-HD.-.K-IR.CKD----------
C1EI49_MICSR/48-79.EV-FKT---Y-------------------.D.KD--------------..---.G-TG.-.T-LG.ENQ----------
B7PJB2_IXOSC/18-48.SV-FRS---V-------------------.V.RD--------------..---.R-TT.-.T-IT.ASE----------
B3M2P5_DROAN/85-114.EV-FSL---F-------------------.D.TD--------------..---.C-DG.-.L-IS.KED----------
A8BSJ2_GIAIC/8-37.EV-FET---F-------------------.D.TS--------------..---.N-TG.-.T-VD.MWR----------
A8J2K6_CHLRE/48-77.EV-FQL---F-------------------.D.TE--------------..---.D-KG.-.Y-FT.KDD----------
A8XSA6_CAEBR/77-106.TL-LSH---F-------------------.D.RD--------------..---.G-NG.-.Q-IP.IVE----------
CBPF_DICDI/13-45.KF-VKN---Y-------------------.D.LN--------------..---.K-DG.-.S-VT.SFD----------
C8JQR9_CAEEL/144-173.EM-FAD---M-------------------.D.RN--------------..---.H-DG.-.L-VD.VVE----------
Q6FSJ6_CANGA/19-48.DA-FQL---I-------------------.D.ED--------------..---.G-DG.-.N-IG.RSD----------
A0BKS7_PARTE/17-46.DA-FEA---Y-------------------.D.KM--------------..---.G-YG.-.T-LE.VEE----------
Q4DSH4_TRYCC/48-77.QW-FRA---V-------------------.S.SS--------------..---.S-GG.-.Y-IS.VPQ----------
Q4Y7U7_PLACH/93-122.SL-FEM---L-------------------.D.EN--------------..---.K-KG.-.F-IT.SKD----------
A9U253_PHYPA/229-258.EV-FTD---M-------------------.D.SY--------------..---.N-DG.-.A-IS.FEE----------
B0WB65_CULQU/256-285.EF-KKI---I-------------------.D.KN--------------..---.K-DG.-.K-AD.RGE----------
A4I3F5_LEIIN/12-41.KH-FDL---F-------------------.D.RD--------------..---.K-IG.-.R-AR.NED----------
A4I3F5_LEIIN/85-114.EA-FQG---F-------------------.D.PD--------------..---.K-RG.-.L-IT.PHE----------
A0BU82_PARTE/29-57.RR-FQR---M-------------------...TN--------------..---.G-SN.-.F-LT.KNQ----------
Q755U9_ASHGO/14-45.QL-FRR---L-------------------.D.LD--------------..---.G-TG.-.R-VD.LAT----------
A8I1S7_CHLRE/186-215.KL-FKM---Y-------------------.D.ND--------------..---.G-SG.-.R-VH.FED----------
A4HZA9_LEIIN/84-113.AA-LKV---L-------------------.D.DD--------------..---.A-DG.-.Y-LT.TTQ----------
A0D306_PARTE/59-88.KV-FQF---F-------------------.D.IS--------------..---.N-DG.-.R-ID.SHE----------
Q4Q2P9_LEIMA/35-64.RS-LGI---A-------------------.D.DL--------------..---.G-ST.-.Q-VT.AEE----------
A0E3G8_PARTE/176-205.KI-FTL---W-------------------.D.EE--------------..---.G-KG.-.K-VT.VKN----------
A9V0G9_MONBE/68-97.SA-FKV---F-------------------.D.HQ--------------..---.S-DN.-.S-ID.VRE----------
A7AQR4_BABBO/777-815.QK-FQD---Y-------------------.D.KV--------------..---.G-GG.-.L-LS.YND----------
A7AQR4_BABBO/875-908.QA-FHS---Y-------------------.D.RS--------------..---.H-NG.-.S-IY.IHE----------
A4HBM1_LEIBR/11-40.LQ-FLL---L-------------------.D.QD--------------..---.S-DG.-.F-IR.SHE----------
A0CNQ7_PARTE/356-385.FK-FEE---F-------------------.D.RD--------------..---.N-SG.-.T-IS.VKE----------
A0CNQ7_PARTE/435-464.GL-FKQ---F-------------------.D.ID--------------..---.N-KN.-.Y-IT.TMD----------
B3L806_PLAKH/94-123.SL-FDL---L-------------------.D.TS--------------..---.K-RG.-.Y-IS.TRS----------
C3Y3X5_BRAFL/109-138.EC-FML---C-------------------.D.VD--------------..---.H-NG.-.F-LE.KSD----------
C3Y3X5_BRAFL/178-207.EA-FEN---L-------------------.D.AA--------------..---.G-TG.-..-IH.KDG----------
C5E2K8_LACTC/5-34.DI-FTL---F-------------------.D.RQ--------------..---.A-KG.-.T-IS.KQQ----------
D0NMF2_PHYIT/62-91.HI-FCQ---I-------------------.D.TD--------------..---.N-SG.-.I-ML.RSE----------
B9RGV3_RICCO/45-74.SL-FNF---F-------------------.D.GA--------------..---.N-SG.-.F-ID.YTQ----------
A0DZF8_PARTE/406-435.KL-FKQ---F-------------------.D.TD--------------..---.V-NQ.-.V-LD.LVE----------
D0NPC8_PHYIT/30-59.EA-FAR---V-------------------.D.TD--------------..---.M-DG.-.K-VN.AID----------
D3B753_POLPA/41-70.EK-FML---Y-------------------.D.VN--------------..---.N-SG.-.D-ID.LYE----------
A7RJ54_NEMVE/73-101.TA-FDV---F-------------------.D.SD--------------..---.H-KE.-.F-IE.SGD----------
C3ZK54_BRAFL/145-176.RR-WET---A-------------------.D.SD--------------..---.D-DK.-.H-LT.KEE----------
Q23CU0_TETTS/69-99.QV-FDL---Y-------------------.D.QT--------------..---.G-EG.-.Y-LN.PGK----------
EFCB7_HUMAN/106-135.KS-FKQ---L-------------------.D.VN--------------..---.D-DG.-.C-IL.HTD----------
A0A0D1DU76_USTMA/58-87.EA-FNM---I-------------------.D.AD--------------..---.S-DG.-.L-IT.TND----------
A0BMA1_PARTE/125-154.EA-FNF---L-------------------.D.MN--------------..---.K-DG.-.G-IT.SED----------
A7RI54_NEMVE/73-102.TT-FMQ---Y-------------------.D.SD--------------..---.R-SG.-.T-ME.PHE----------
Q7RNY5_PLAYO/47-76.RV-FKM---M-------------------.D.KD--------------..---.N-TG.-.K-IS.ACN----------
A8QGG8_BRUMA/91-120.AA-FEL---F-------------------.D.SD--------------..---.F-KG.-.Y-IT.VDD----------
A0NGM4_ANOGA/720-749.AV-FKL---Y-------------------.D.TE--------------..---.G-SG.-.R-LS.PFQ----------
A0CQY7_PARTE/181-210.KI-FNS---W-------------------.D.ED--------------..---.A-NG.-.A-IS.VKN----------
A2FZQ0_TRIVA/11-40.QS-FEE---F-------------------.D.ND--------------..---.K-DG.-.F-IE.TSM----------
A2FZQ0_TRIVA/82-111.KA-FTL---F-------------------.D.RD--------------..---.G-TG.-.K-VH.KDV----------
PLSI_BOVIN/15-46.EA-FNK---I-------------------.D.ID--------------..---.N-SG.-.Y-VS.DYE----------
A0BVC0_PARTE/355-384.FI-FKK---I-------------------.D.LN--------------..---.N-SG.-.I-IT.VQE----------
A0BVC0_PARTE/444-473.SI-FKY---F-------------------.D.TR--------------..---.N-EN.-.H-LS.REA----------
A8J258_CHLRE/12-41.FA-FET---L-------------------.D.AE--------------..---.R-TG.-.S-VS.RKQ----------
A8J258_CHLRE/85-114.RA-FQL---F-------------------.D.VL--------------..---.G-QG.-.A-ID.FVT----------
A0BLQ1_PARTE/56-85.EN-FQL---F-------------------.D.RD--------------..---.G-DE.-.R-IS.FTE----------
A0BLQ1_PARTE/129-158.EA-FKS---V-------------------.D.LE--------------..---.N-TG.-.Y-IQ.SEY----------
D3B3V9_POLPA/20-49.HI-FDH---F-------------------.D.KD--------------..---.K-DG.-.S-LS.RYE----------
C6WP87_ACTMD/55-86.VL-ADH---L-------------------.D.VD--------------..---.R-DG.-.R-IT.LDE----------
B0CEP3_ACAM1/69-106.FA-FQL---H-------------------.D.GN--------------..---.D-DG.-.C-ID.KQE----------
B4JQZ6_DROGR/12-41.QI-FLQ---F-------------------.D.QC--------------..---.G-DC.-.N-IS.HSQ----------
B4JQZ6_DROGR/95-124.SG-LRF---F-------------------.D.EH--------------..---.K-TG.-.Y-IS.ADR----------
B3RJS5_TRIAD/515-551.EI-FDR---V-------------------...AG--------------..---.T-DE.-.E-VD.AFE----------
B3RJS5_TRIAD/588-617.DN-FQK---F-------------------.D.TD--------------..---.K-SG.-.S-FS.SYE----------
B4LWK2_DROVI/652-680.EC-FYL---F-------------------....A--------------..---.R-SG.-.Q-INNLDE----------
B4LWK2_DROVI/720-749.AA-FKA---A-------------------.D.PQ--------------..---.N-KG.-.T-IS.AKQ----------
Q236L3_TETTS/181-210.KI-FNA---W-------------------.D.DN--------------..---.C-TG.-.A-ID.PKN----------
A9UU69_MONBE/7-36.LC-FEL---F-------------------.D.KT--------------..---.N-SG.-.T-IT.AED----------
A9UU69_MONBE/73-102.DA-FST---F-------------------.D.SH--------------..---.S-AG.-.Y-MS.LTE----------
B3SAM3_TRIAD/385-414.DF-FFA---L-------------------.D.KD--------------..---.K-SM.-.S-IT.RDE----------
D0N7S9_PHYIT/33-62.RW-FDS---L-------------------.D.AD--------------..---.G-SG.-.E-VG.LDE----------
B4J628_DROGR/30-59.RL-FDS---I-------------------...AG--------------..---.K-DM.-.E-VD.WME----------
C5DUR9_ZYGRC/19-48.DA-FQT---I-------------------.D.DD--------------..---.G-DG.-.A-IS.QKD----------
B8CFT6_THAPS/84-113.MY-FRI---Y-------------------.D.HG--------------..---.N-KG.-.Y-ID.LQD----------
C3YER0_BRAFL/167-196.EV-FDL---F-------------------.D.RT--------------..---.G-GG.-.T-FD.AEE----------
A8X3X6_CAEBR/106-135.KV-FED---F-------------------.D.ED--------------..---.F-NM.-.A-LS.RDE----------
A0BXL7_PARTE/42-71.KI-FRK---M-------------------.D.TM--------------..---.G-TG.-.Y-IS.QQN----------
A0BXL7_PARTE/114-145.YV-FQM---L-------------------.D.SD--------------..---.H-DN.-.F-IS.KKD----------
A0DNH6_PARTE/2304-2334.EV-FKT---I-------------------.D.QD--------------..---.Y-SG.-.S-VS.KDE----------
A8XVF9_CAEBR/36-65.DV-FKM---F-------------------.D.ED--------------..---.C-DG.-.L-IE.TEE----------
A0D1H3_PARTE/66-95.KL-FEF---F-------------------.D.VN--------------..---.G-DR.-.K-LQ.LDD----------
A0D1H3_PARTE/181-210.NF-FRK---L-------------------.D.QK--------------..---.Q-KG.-.Y-LV.FND----------
B7PU66_IXOSC/252-281.AT-WRK---L-------------------.N.VG--------------..---.R-NG.-.Y-LQ.VQE----------
A9UV27_MONBE/2126-2155.EV-FEK---L-------------------.D.ID--------------..---.H-DR.-.R-IE.RAE----------
B4L3F1_DROMO/11-40.NT-FAI---L-------------------.D.VD--------------..---.G-SG.-.L-LT.ARE----------
B3RIN1_TRIAD/205-233.EL-FAS---V-------------------.D.KD--------------..---.K-NW.-.Q-IS.ADE----------
A5WWC4_DANRE/533-569.RL-FSQ---V-------------------...AG--------------..---.S-DS.-.E-VS.VLE----------
A5WWC4_DANRE/606-635.EI-FKH---R-------------------.D.TD--------------..---.N-SG.-.T-MS.SLE----------
A0D218_PARTE/76-105.KV-FQM---L-------------------.K.KK--------------..---.D-VD.-.Y-FD.AKD----------
C5LZ40_PERM5/40-69.DC-FAL---L-------------------.D.QD--------------..---.E-DG.-.L-IG.PEE----------
C1E207_MICSR/45-75.KI-FKA---W-------------------.D.KN--------------..---.Q-DK.-.T-VD.LKE----------
Q6FMX6_CANGA/187-217.QL-FHN---H-------------------.D.VR--------------..---.G-KE.-.R-LT.AEE----------
A7AP31_BABBO/33-62.DA-FNL---F-------------------.D.RD--------------..---.G-DG.-.H-LT.VFE----------
A2ETB6_TRIVA/14-43.SV-FKE---L-------------------.D.TD--------------..---.N-TG.-.K-LE.IQL----------
Q6C7R0_YARLI/24-53.VL-FEV---A-------------------.D.RK--------------..---.K-TG.-.K-VT.EAD----------
Q6C7R0_YARLI/130-160.QA-FGH---Y-------------------.D.PN--------------..---.G-TG.-.F-ID.RLQ----------
A7EII8_SCLS1/126-155.SA-WKE---F-------------------.D.HS--------------..---.L-NG.-.S-IT.AAQ----------
B7Q3R8_IXOSC/111-140.KA-FRA---S-------------------.D.KS--------------..---.G-SG.-.Q-IS.GWE----------
Q8SS75_ENCCU/23-52.EA-FNF---M-------------------.D.VN--------------..---.S-DT.-.F-VD.RGD----------
Q8SS75_ENCCU/92-121.NA-LKE---F-------------------.D.DN--------------..---.G-DG.-.T-ID.EKV----------
Q7RGT1_PLAYO/1340-1369.DI-FLK---T-------------------.D.TN--------------..---.H-NG.-.S-LS.HRE----------
D0MWK2_PHYIT/425-454.PF-FHA---Y-------------------.D.KN--------------..---.R-DH.-.R-MD.ADE----------
A0DI75_PARTE/65-94.RI-FRI---F-------------------.D.LS--------------..---.S-SG.-.K-IE.TLE----------
Q2R1L7_ORYSJ/123-154.QA-FLV---F-------------------.D.ED--------------..---.N-DG.-.Y-ID.ALD----------
C5LG68_PERM5/14-43.EA-FSM---F-------------------.D.RE--------------..---.S-EG.-.E-IP.VEE----------
A2DMA5_TRIVA/14-43.NA-FDT---F-------------------.D.SN--------------..---.S-DN.-.C-LE.PNE----------
C4QYA1_PICPG/220-250.NR-FKE---A-------------------.D.YR--------------..---.R-KG.-.F-LT.ESE----------
C4QYA1_PICPG/287-316.EV-FFI---Y-------------------.D.RD--------------..---.H-SY.-.S-IS.FNE----------
A7SIU0_NEMVE/415-444.DL-FRR---L-------------------.D.KD--------------..---.Q-SM.-.Q-VS.VRE----------
A2EU49_TRIVA/304-333.TM-FKP---Y-------------------.D.RS--------------..---.G-NG.-.L-VP.KTI----------
A8HPL4_CHLRE/259-288.YV-FSC---Y-------------------.D.KN--------------..---.E-DY.-.R-LE.LSE----------
CPNS2_HUMAN/153-182.CV-YKQ---Y-------------------.D.RD--------------..---.H-SG.-.S-LG.SSQ----------
Q4E300_TRYCC/191-222.EA-FKI---Y-------------------.D.PQ--------------..---.G-RG.-.V-VD.VEV----------
D0MRM4_PHYIT/32-61.QQ-FTD---F-------------------.D.TS--------------..---.G-DG.-.S-IA.ASE----------
Q6DG81_DANRE/12-43.EA-FGK---V-------------------.D.LN--------------..---.G-NG.-.F-IC.DHE----------
B4I7K3_DROSE/14-43.EA-FCI---F-------------------.D.TH--------------..---.G-DK.-.Y-ID.SRN----------
C5DUA6_ZYGRC/18-49.KL-FRR---L-------------------.D.CE--------------..---.D-RG.-.Y-LD.FEG----------
A0CDJ6_PARTE/157-186.QA-FQM---I-------------------.D.HY--------------..---.Q-LG.-.Y-FT.AQH----------
A0CRT3_PARTE/42-71.DM-FVY---F-------------------.D.KS--------------..---.G-NK.-.T-IQ.RED----------
A0CRT3_PARTE/115-144.NA-LKI---F-------------------.E.KN--------------..---.K-SG.-.Y-ID.VKE----------
C5KE42_PERM5/17-46.AT-FRL---C-------------------.D.GD--------------..---.G-DG.-.H-IT.KKE----------
A7RPN5_NEMVE/525-553.IA-FEM---Y-------------------.C.R.--------------..---.K-DY.-.K-IP.TKA----------
A7RPN5_NEMVE/596-627.DA-FHV---F-------------------.D.RD--------------..---.K-MG.-.Y-FD.LDK----------
C5KKB0_PERM5/33-64.EY-FNK---Y-------------------.D.LS--------------..---.R-DG.-.C-LD.RDE----------
A7RMQ1_NEMVE/11-40.DA-FSL---F-------------------.D.KT--------------..---.G-KG.-.Y-ID.ADI----------
A7RMQ1_NEMVE/82-111.EG-LRA---F-------------------.D.NN--------------..---.S-DG.-.T-MS.SAQ----------
Q5CZ29_CRYPI/514-545.NV-FYK---L-------------------.D.TR--------------..---.Q-IG.-.K-IN.LYD----------
Q2A943_DANRE/33-62.CL-FDK---Y-------------------.D.PE--------------..---.N-SG.-.F-IS.TER----------
A7S688_NEMVE/8-37.DI-FDL---Y-------------------.D.TT--------------..---.G-SE.-.K-ID.VGY----------
A7S688_NEMVE/84-113.DC-FKH---F-------------------.D.RS--------------..---.D-SG.-.Y-IS.SSM----------
D0NHY4_PHYIT/209-239.QL-LIE---G-------------------.D.TD--------------..---.S-TG.-.F-VS.LEQ----------
Q4U8S4_THEAN/16-45.DQ-FKL---V-------------------.D.SD--------------..---.G-DR.-.L-IN.EDE----------
C1FIV9_MICSR/85-114.RA-YNS---L-------------------.G.LS--------------..---.R-SG.-.R-MT.QED----------
EFC13_HUMAN/456-485.NF-CEA---I-------------------.S.KL--------------..---.Q-EN.-.Y-IA.AEE----------
Q4SJD6_TETNG/29-56.KR-FKQ---L-------------------.S.HN--------------..---..-EE.-.T-LR.REH----------
E8RNE1_ASTEC/46-76.RI-FAE---F-------------------.D.RN--------------..---.R-DG.-.S-IT.EDE----------
A0DCS1_PARTE/72-101.KY-FSS---L-------------------.D.GD--------------..---.G-SG.-.A-IG.IEE----------
Q9EMH8_AMEPV/24-53.YI-FDL---I-------------------.N.TS--------------..---.G-NG.-.E-IT.AEE----------
A0CH88_PARTE/390-419.RV-GKI---L-------------------.D.AD--------------..---.H-DG.-.M-LN.LTE----------
A0CH88_PARTE/696-725.YR-FQL---Y-------------------.D.KS--------------..---.H-LN.-.A-LS.YQE----------
C4R1V0_PICPG/25-54.AI-FEI---M-------------------.D.QD--------------..---.S-DG.-.K-IS.IND----------
A7SHW4_NEMVE/108-138.YA-FKI---F-------------------.D.FD--------------..---.G-DQ.-.K-LG.PTD----------
D0MWI5_PHYIT/661-691.DR-LNI---L-------------------.D.RD--------------..---.S-DG.-.V-LS.AEE----------
C3YCK9_BRAFL/241-275.DK-FDE---Y-------------------.D.SD--------------..---.Q-ST.-.Q-IT.VEE----------
B3MPK2_DROAN/57-86.EI-FLM---H-------------------.D.HR--------------..---.G-DN.-.K-IS.IID----------
A9RFM6_PHYPA/328-362.KL-FGH---F-------------------.D..D--------------..---.G-DG.-.L-LT.RAE----------
Q4Z5E3_PLABA/655-693.QK-FKN---F-------------------.D.KF--------------..---.G-DG.-.Y-LD.YSD----------
D2VTY7_NAEGR/97-134.YI-FEY---Y-------------------.D.GD--------------..---.G-SG.-.V-IE.RDE----------
Q6BFU2_PARTE/195-224.RV-FNK---F-------------------.Q.K.--------------..---..-NG.-.F-IT.QNE----------
Q5ZLW0_CHICK/14-43.EA-FSK---V-------------------.D.VS--------------..---.G-NG.-.F-ID.AND----------
B5Y4Q9_PHATC/8-42.DA-FRL---F-------------------.D.KE--------------..---.N-TQ.-.S-IL.LKD----------
B5Y4Q9_PHATC/86-115.KV-FDL---F-------------------.D.EG--------------..---.R-KG.-.H-IN.VQD----------
B7QKE4_IXOSC/612-641.QK-FQA---I-------------------.D.KD--------------..---.R-KG.-.Y-IS.VVD----------
Q0V5Q9_PHANO/214-243.EC-FSV---M-------------------.D.RD--------------..---.N-DG.-.H-VN.SAD----------
Q4DIV1_TRYCC/166-195.EA-FCV---L-------------------.D.LS--------------..---.R-RG.-.Y-LE.AEE----------
Q7Q4L8_ANOGA/103-139.HA-FRI---Y-------------------.D.FD--------------..---.G-DD.-.M-IG.RND----------
A8XE93_CAEBR/628-657.ER-FNQ---L-------------------.D.KD--------------..---.R-KG.-.H-IT.VND----------
A7RJ83_NEMVE/514-548.DV-FHQ---M-------------------...AG--------------..---.E-DG.-.E-VD.QYE----------
A7RJ83_NEMVE/585-614.NH-FHK---Y-------------------.D.RD--------------..---.H-SG.-.D-MN.AYE----------
A4HWJ1_LEIIN/25-54.ST-WNL---F-------------------.D.ER--------------..---.H-TG.-.S-VS.HID----------
A2EBQ1_TRIVA/14-43.EA-FDT---F-------------------.D.KD--------------..---.G-DG.-.Y-IE.PDL----------
A2EBQ1_TRIVA/84-113.DA-FHV---F-------------------.D.EK--------------..---.E-TG.-.Y-IP.TKD----------
Q4D662_TRYCC/188-217.SL-FMV---F-------------------.D.TE--------------..---.N-KG.-.F-LT.RSQ----------
Q4D662_TRYCC/269-298.LQ-FRG---Y-------------------.D.LE--------------..---.G-RG.-.F-LD.WKD----------
A0EFA3_PARTE/319-348.KV-FLE---M-------------------.D.QN--------------..---.N-NG.-.V-VE.YDD----------
A9RGD0_PHYPA/476-506.QM-FTL---F-------------------.D.RN--------------..---.T-DG.-.V-IS.MDE----------
Q8SRF8_ENCCU/100-129.YL-FDI---F-------------------.D.LN--------------..---.G-DG.-.R-LC.RNV----------
B8BV66_THAPS/328-359.EE-FEK---L-------------------.D.EN--------------..---.G-NG.-.E-IS.LEG----------
A7SIU1_NEMVE/364-393.DL-FNC---L-------------------.D.KD--------------..---.K-SR.-.S-VS.PEE----------
D0NLH6_PHYIT/779-808.EV-FDH---F-------------------.D.LD--------------..---.N-DG.-.V-LA.RDE----------
C1MVN8_MICPC/105-141.SV-FDK---C-------------------.D.AD--------------..---.K-NG.-.V-VS.LEE----------
B5DN90_DROPS/53-82.LL-VDL---M-------------------.D.GD--------------..---.S-NG.-.M-VT.LTE----------
A0BWN9_PARTE/584-613.DL-FRK---Y-------------------.D.KT--------------..---.E-SQ.-.S-LD.MKE----------
A0DZH6_PARTE/32-61.RL-FNL---Y-------------------.C.NP--------------..---.R-TR.-.R-ID.LKD----------
Q5CTT5_CRYPI/66-93.DI-VSK---Y-------------------.G.KR--------------..---.K-NG.-.Y-LT.QDE----------
A0C693_PARTE/354-383.QK-FKE---L-------------------.D.KD--------------..---.E-DG.-.F-IT.PQE----------
A7SZ62_NEMVE/480-509.DL-FNQ---F-------------------.D.KD--------------..---.N-SL.-.S-VT.RDE----------
C1MZG1_MICPC/117-146.EV-FRL---L-------------------.D.DD--------------..---.D-SG.-.A-LD.AEE----------
Q4DZ37_TRYCC/328-358.VA-FRK---I-------------------.D.ID--------------..---.G-YG.-.R-IT.RDE----------
B3RKL5_TRIAD/438-467.DL-FNR---F-------------------.D.RD--------------..---.N-SR.-.T-VD.KRE----------
A2Q7S2_ASPNC/15-46.AL-FQQ---A-------------------.D.KS--------------..---.G-EG.-.K-LA.LPE----------
C1E2H7_MICSR/61-97.KL-FES---V-------------------.D.VD--------------..---.G-SG.-.G-VD.YLE----------
A9SRE6_PHYPA/269-299.TQ-FSL---L-------------------.E.PN--------------..---.K-SG.-.R-IS.YDN----------
C1FI51_MICSR/18-54.KI-FDQ---C-------------------.D.DD--------------..---.K-SG.-.T-VS.LDE----------
B8MY97_ASPFN/34-63.EA-FQV---L-------------------.D.RD--------------..---.N-DG.-.S-VN.KDD----------
B3S580_TRIAD/58-91.HY-FKL---H-------------------.D.TD--------------..---.N-NG.-.K-LD.GLE----------
C5KSZ3_PERM5/370-399.RV-FAW---I-------------------.D.TK--------------..---.K-DD.-.I-LD.YEE----------
D0N582_PHYIT/1409-1438.IR-LAR---L-------------------.D.ED--------------..---.G-SG.-.D-LD.QHE----------
B7G8H4_PHATC/377-408.AE-FAR---I-------------------.D.KD--------------..---.N-GG.-.T-IE.KAE----------
A0E9E9_PARTE/44-75.ET-FHL---I-------------------.D.RD--------------..---.H-SN.-.S-IE.LDE----------
A7RMQ2_NEMVE/10-39.DG-FML---F-------------------.D.QI--------------..---.G-DG.-.N-IN.YDQ----------
A7RMQ2_NEMVE/82-111.EG-LKV---F-------------------.D.RE--------------..---.A-NG.-.K-ID.SGT----------
B6AAT1_CRYMR/92-121.NA-FNI---L-------------------.D.RS--------------..---.G-NG.-.K-VL.VSD----------
Q1DGU0_AEDAE/85-114.RI-FAA---L-------------------.D.KG--------------..---.A-TS.-.Y-VT.MET----------
C4VC48_NOSCE/64-95.RL-FNT---I-------------------.N.IS--------------..---.Q-SN.-.H-ID.FHE----------
B4M210_DROVI/76-106.EI-FDK---H-------------------.D.SD--------------..---.R-DG.-.L-IN.THE----------
D0N398_PHYIT/276-305.EV-FAS---G-------------------.D.SE--------------..---.N-TG.-.L-LT.VAE----------
A0A0D1CVJ0_USTMA/739-769.AK-FKL---L-------------------.D.VN--------------..---.R-DG.-.K-LD.SKD----------
EFCB9_HUMAN/28-56.EY-FHI---L-------------------.D.VH--------------..---.G-KN.-.T-LN.DVL----------
A4HY14_LEIIN/110-138.HL-FRG---Y-------------------.D.IN--------------..---.N-EG.-.V-IT.FKK----------
A0BNY1_PARTE/42-71.AV-FKS---I-------------------.D.RD--------------..---.K-SK.-.F-LD.RSE----------
A9RBC3_PHYPA/187-216.EA-FDL---I-------------------.D.TD--------------..---.A-SG.-.A-VD.SKD----------
A8P593_BRUMA/121-151.YA-FRI---Y-------------------.D.FD--------------..---.G-DD.-.Q-LG.HDD----------
CEX1_CAEEL/29-68.RI-FSL---F-------------------FD.RN--------------..---.A-SH.-.Q-VD.WGD----------
A7SPN7_NEMVE/582-611.KV-FSW---F-------------------.D.TQ--------------..---.G-RG.-.F-IT.VHD----------
A4FU16_HUMAN/38-67.VL-FDQ---F-------------------.D.PG--------------..---.N-TG.-.Y-IS.TGK----------
C3YAW3_BRAFL/215-244.DF-FMR---F-------------------.D.KN--------------..---.K-QW.-.L-VS.RED----------
D2V6N0_NAEGR/12-41.HS-FSL---L-------------------.D.TD--------------..---.R-KG.-.F-VT.IDD----------
D2V6N0_NAEGR/215-245.EL-FSI---F-------------------ED.VN--------------..---.D-KG.-.Y-IT.KAS----------
Q5CUC1_CRYPI/325-356.RF-FNA---L-------------------.D.ED--------------..---.G-NG.-.Q-IN.QDE----------
D2VL69_NAEGR/86-115.RA-FEI---L-------------------.D.PE--------------..---.R-NG.-.L-IP.SEK----------
B8BVX2_THAPS/190-219.SA-FQK---N-------------------.D.AN--------------..---.G-DG.-.I-LE.QFE----------
A2FS38_TRIVA/86-115.EL-FET---I-------------------.D.AG--------------..---.H-DN.-.F-ID.PQD----------
A9V750_MONBE/19-48.SE-FAR---T-------------------.D.KD--------------..---.G-SG.-.D-ID.LQE----------
C5LX97_PERM5/270-303.EV-FDA---M-------------------.D.VD--------------..---.G-SG.-.T-LT.ENE----------
A2FHL4_TRIVA/83-112.II-FRS---F-------------------.D.KD--------------..---.R-NG.-.A-LT.TDS----------
A9FD96_SORC5/187-216.RR-FEE---I-------------------.D.RD--------------..---.H-DR.-.K-LS.EDE----------
Q6BG59_PARTE/363-394.SV-FRS---L-------------------.D.LD--------------..---.N-DG.-.Y-FS.ISE----------
A0DQE8_PARTE/49-78.KI-FIN---F-------------------.D.RD--------------..---.K-SK.-.N-ID.ISE----------
A2DGG1_TRIVA/1002-1031.ET-FNH---F-------------------.D.KD--------------..---.H-TN.-.F-LQ.YFE----------
A8IAC5_CHLRE/27-56.KW-FEL---V-------------------.D.DD--------------..---.G-SR.-.T-LS.HSE----------
C3YFC2_BRAFL/86-117.DV-FRR---F-------------------.D.KK--------------..---.Q-NM.-.V-IT.VEE----------
A9VC94_MONBE/198-229.VI-FRR---A-------------------.E.TK--------------..---.G-NG.-.L-LE.PWE----------
C5KSU3_PERM5/80-110.EA-FKL---Y-------------------.D.PN--------------..---.D-TG.-.Y-VD.MKT----------
C5L8H3_PERM5/62-92.RW-FNT---Y-------------------.D.VN--------------..---.K-DG.-.Y-LN.FTE----------
Q4UF53_THEAN/443-471.RS-FFS---I-------------------.N.TS--------------..---.K-SG.-.T-IS.FSE----------
A8XPA0_CAEBR/61-90.KI-FQL---M-------------------.D.DD--------------..---.G-SG.-.T-IS.SSE----------
A2FQM2_TRIVA/14-43.NY-FTD---F-------------------.D.DD--------------..---.G-DG.-.E-IE.VQC----------
A7RTI1_NEMVE/216-246.MQ-FKV---F-------------------.D.TN--------------..---.D-DF.-.H-LD.TQE----------
C5LI98_PERM5/493-523.ET-FIT---L-------------------.D.KD--------------..---.N-SG.-.G-LS.PQE----------
B6AJS6_CRYMR/55-84.NL-IKL---I-------------------.D.KD--------------..---.S-NN.-.I-LD.ESE----------
A0D0W9_PARTE/274-302.EL-IKL---Y-------------------.Q.TN--------------..---..-...-.E-LR.FEN----------
A2E466_TRIVA/79-108.SA-FKV---F-------------------.D.RD--------------..---.G-TG.-.K-IK.QAT----------
C1N3J2_MICPC/18-47.LA-FDH---L-------------------.D.LD--------------..---.G-SG.-.D-LA.RHE----------
D2VIE2_NAEGR/8-38.EI-FEL---Y-------------------.D.TD--------------..---.R-KG.-.Y-LT.KIE----------
Q7QIB4_ANOGA/279-317.FM-FRL---Y-------------------.D.TD--------------..---.G-NG.-.V-LD.TTE----------
Q8T5H8_ANOGA/12-41.FV-FSV---Y-------------------.D.WE--------------..---.G-SG.-.Q-MD.AMD----------
D0N994_PHYIT/33-63.ET-FKG---L-------------------.A.NG--------------..---.K-DG.-IS-VD.KET----------
C1MU07_MICPC/540-583.AL-FRA---L-------------------.D.KS--------------..---.G-DG.-.F-VT.IRE----------
B0XJB8_CULQU/36-75.DV-WSH---Y-------------------.D.GD--------------..---.G-NG.-.Y-IE.GTE----------
A8J3A0_CHLRE/99-128.RA-FRA---F-------------------.D.PD--------------..---.G-RG.-.F-ID.AES----------
D0MVE6_PHYIT/210-253.SA-YLL---F-------------------.D.ND--------------..---.A-SG.-.T-IQ.TSE----------
Q5CPW8_CRYPI/89-118.NI-FSC---L-------------------.D.IK--------------..---.K-TG.-.T-ID.LED----------
Q6NYK0_DANRE/29-57.SR-FQY---L-------------------.T.QD--------------..---.E-D..-.T-LR.REH----------
D4AID5_ARTBC/715-746.RL-FRK---W-------------------.D.VD--------------..---.G-NG.-.G-LS.LQN----------
O97201_LEIMA/270-300.GI-FMM---F-------------------.D.G.--------------..---.G-TG.-.R-LS.RGR----------
B3M0N0_DROAN/117-151.LL-FNM---F-------------------.D.HN--------------..---.K-DG.-.R-IT.KVD----------
A9UXC0_MONBE/17-46.QV-FDA---I-------------------.D.HE--------------..---.Q-DG.-.D-LQ.ASE----------
A2F622_TRIVA/94-129.DA-YKK---L-------------------.D.TD--------------..---.G-DD.-.V-VD.IDE----------
CAN11_RAT/548-584.EL-FET---L-------------------...AN--------------..---.R-DS.-.Q-VD.MYD----------
B4QEJ5_DROSI/103-132.QA-FKI---L-------------------.D.PE--------------..---.N-KG.-.Y-LT.KES----------
A8JI98_CHLRE/149-179.SA-FQQ---Y-------------------.D.SS--------------..---.G-DG.-.Y-LD.VGE----------
D3ZRP1_RAT/120-151.KY-FQR---L-------------------.D.KE--------------..---.G-NG.-.L-LE.KTD----------
B4MVV8_DROWI/30-59.RI-FLT---H-------------------.A.MR--------------..---.S-DK.-.K-IS.TAQ----------
C4IYW7_MAIZE/57-84.TI-FEQ---F-------------------.D.SN--------------..---..-.G.-.E-ID.KEE----------
A2FJN7_TRIVA/18-47.DA-FNI---F-------------------.D.RN--------------..---.S-HV.-.K-VS.ENE----------
B6AIK9_CRYMR/17-46.ET-FNL---A-------------------.D.DD--------------..---.S-DG.-.K-IT.FDQ----------
A9UQV7_MONBE/115-144.KS-FSE---A-------------------.D.IN--------------..---.S-DG.-.L-ID.VAE----------
A9SXN2_PHYPA/278-307.AL-FPI---F-------------------.D.DR--------------..---.G-RG.-.R-LT.VND----------
Q4YSX9_PLABA/63-94.IS-FKQ---L-------------------.D.KN--------------..---.N-NN.-.F-VD.FNE----------
B9R7E2_RICCO/18-47.NW-LKG---F-------------------.D.TD--------------..---.Q-DG.-.K-IS.RVE----------
A0E9R2_PARTE/21-50.ET-FNL---F-------------------.A.QD--------------..---.K-KG.-.Y-VD.KKE----------
D0N6S6_PHYIT/203-232.QL-FRM---F-------------------.D.QD--------------..---.K-SD.-.S-ID.FEE----------
Q4Q156_LEIMA/33-65.DL-FDS---L-------------------.D.VD--------------..---.H-SG.-.T-VS.VEV----------
A7RPN6_NEMVE/2-31.DA-FSV---Y-------------------.N.KD--------------..---.G-SD.-.N-IK.TTL----------
A4H5I7_LEIBR/177-206.VV-FSE---F-------------------.D.NK--------------..---.G-TR.-.M-ID.VDD----------
C1ECT5_MICSR/271-300.EI-FDR---F-------------------.D.VD--------------..---.E-DE.-.H-VT.EPE----------
A9V6X3_MONBE/1141-1170.AI-FKT---Y-------------------.D.KD--------------..---.N-SG.-.N-IN.EKE----------
C3ZP66_BRAFL/54-83.KT-FME---M-------------------.D.EN--------------..---.N-NG.-.E-LG.MME----------
C0H4A2_PLAF7/13-41.SI-FKE---Y-------------------.D.TN--------------..---.K-DG.-..-VS.GEK----------
A9VBY6_MONBE/239-268.DM-FNQ---S-------------------.D.LN--------------..---.N-DK.-.Q-LN.LEE----------
D2UXJ1_NAEGR/416-444.AV-FGY---I-------------------.DGQT--------------..---.K-DN.-.V-LD.IHE----------
B4MM19_DROWI/36-65.KS-FDI---Y-------------------.D.FQ--------------..---.Q-VG.-.S-IE.VNK----------
Q4DRI4_TRYCC/49-79.EL-FKK---F-------------------.D.KN--------------..---.E-TG.-.K-LC.YDE----------
B3S1G2_TRIAD/152-183.YA-FRV---Y-------------------.D.FN--------------..---.D-DD.-.L-ID.IAD----------
CIB4_MOUSE/101-132.YA-FRI---Y-------------------.D.FN--------------..---.E-NG.-.F-ID.EED----------
C1EBS6_MICSR/387-416.RA-FAT---Y-------------------.D.RD--------------..---.E-DG.-.K-MA.RGE----------
B4N916_DROWI/114-145.FA-FEV---Y-------------------.N.TK--------------..---.G-TG.-.Y-ID.REQ----------
Q8IE29_PLAF7/251-282.MV-FKK---L-------------------.D.IN--------------..---.K-NK.-.Y-ID.YIE----------
CAN8_MOUSE/536-572.SL-SEE---F-------------------...AD--------------..---.K-DS.-.E-IS.AHQ----------
A0BF71_PARTE/385-419.EI-FNG---L-------------------.D.LD--------------..---.K-NG.-.R-LT.KPE----------
B0WSM1_CULQU/659-688.AV-FNL---Y-------------------.D.LD--------------..---.A-SG.-.H-LD.RKE----------
Q32KM4_BOVIN/68-99.RV-FFA---F-------------------.D.KD--------------..---.N-DN.-.Y-IN.VKE----------
D2V5I4_NAEGR/35-64.MI-YYQ---Y-------------------.D.KD--------------..---.H-SG.-.T-LN.KKE----------
CAN11_MOUSE/547-583.QL-FKI---M-------------------...AN--------------..---.E-DG.-.E-VD.MYA----------
A7RK77_NEMVE/68-97.DT-FNE---W-------------------.D.TN--------------..---.S-DG.-.F-ID.IDE----------
A0C4R5_PARTE/23-53.ST-FDS---I-------------------.D.SN--------------..---.K-NG.-.T-IE.LNE----------
Q4QBQ5_LEIMA/330-359.QL-FHW---V-------------------.D.LN--------------..---.G-NN.-.F-IG.YAE----------
B4LJI0_DROVI/124-155.FV-FSI---Y-------------------.D.EN--------------..---.D-RG.-.Y-LE.RED----------
C3YQL6_BRAFL/328-359.TA-LRE---S-------------------.N.LD--------------..---.K-ND.-.T-ID.KTE----------
A0C1C8_PARTE/336-372.HI-FNN---I-------------------.Q.KA--------------..---.N-NQ.-.Y-LT.LQE----------
D0NH53_PHYIT/26-55.VI-FRY---F-------------------.D.TD--------------..---.G-DG.-.A-VS.ADQ----------
RFIP3_DANRE/710-739.AV-FQA---L-------------------.D.QD--------------..---.G-DG.-.F-VH.IEE----------
A0DZK5_PARTE/70-97.EE-FLS---Y-------------------.D.LD--------------..---.E-DG.-.I-LR.IDE----------
EFCB3_BOVIN/51-80.DA-YNF---F-------------------.N.KD--------------..---.K-TG.-.C-ID.LHG----------
C1EDZ9_MICSR/29-59.DL-FNR---L-------------------.D.RD--------------..---.R-DG.-.R-IT.VYE----------
C1N631_MICPC/47-78.RL-FSE---F-------------------.D.VD--------------..---.E-SG.-.G-LG.REQ----------
C1MXG3_MICPC/631-660.AV-FDE---F-------------------.D.ED--------------..---.G-SG.-.T-LT.IEE----------
Q6DFZ8_DANRE/606-635.DV-YSK---N-------------------.D.KD--------------..---.Q-SG.-.T-MS.SME----------
C5LJH8_PERM5/404-433.EA-FRS---F-------------------.D.RD--------------..---.G-RG.-.K-LD.AAD----------
B9RD69_RICCO/210-239.LH-FFQ---F-------------------.D.EE--------------..---.G-SG.-.L-LT.VRD----------
Q4DDH8_TRYCC/10-40.DV-FNV---F-------------------.D.EE--------------..---.G-TG.-.S-IS.MQE----------
A0CSU8_PARTE/30-61.PI-MHR---L-------------------.D.SN--------------..---.N-QG.-.H-IT.SYD----------
C5KYQ1_PERM5/23-54.EV-FKE---A-------------------.D.KE--------------..---.G-RG.-.W-IS.EEE----------
A2CE70_DANRE/30-58.SR-FHS---L-------------------.D.KG--------------..---.E-NG.-.G-LS.RED----------
C5L8Y2_PERM5/254-290.ML-FEE---L-------------------.D.ED--------------..---.G-SG.-.E-LS.SQE----------
A7SHJ6_NEMVE/330-359.EM-FSR---Y-------------------.D.PE--------------..---.N-TG.-.K-VS.KHE----------
A0C9U0_PARTE/401-432.EL-FEQ---F-------------------.A.TT--------------..---.K-QD.-.T-LE.RHQ----------
A9RZV6_PHYPA/322-351.AA-YDA---C-------------------.N.LQ--------------..---.N-SD.-.C-IS.QLE----------
A0CIN3_PARTE/412-441.GI-FDI---I-------------------.D.SR--------------..---.C-SG.-.F-LD.WSQ----------
A7RLF8_NEMVE/106-135.AF-FDV---L-------------------.D.ED--------------..---.N-LG.-.Y-VT.QDE----------
C3ZDD3_BRAFL/389-419.QH-FKQ---Y-------------------.D.RN--------------..---.N-DF.-.H-LD.LAE----------
A8X343_CAEBR/192-230.VV-FHV---Y-------------------.D.SD--------------..---.G-NG.-.F-LD.KSE----------
C5L7A7_PERM5/27-55.KD-FDG---F-------------------.D.QD--------------..---.A-DG.-.V-ID.AQE----------
B3RJJ4_TRIAD/113-142.KK-FME---A-------------------.D.KD--------------..---.G-NG.-.E-ID.EKE----------
A7T7P5_NEMVE/35-64.EA-FRT---F-------------------.D.GD--------------..---.D-KG.-.Y-IF.SNE----------
A8IMX5_CHLRE/147-180.KS-FMF---F-------------------.D.SS--------------..---.A-DG.-.C-IE.RKE----------
Q8STQ3_ENCCU/76-105.NS-FRR---L-------------------.D.VD--------------..---.N-TS.-.Y-ID.AGR----------
Q6FSU4_CANGA/603-632.RL-FNR---W-------------------.D.SA--------------..---.K-VG.-.E-LT.LND----------
D0NT24_PHYIT/227-256.AI-FNL---F-------------------.D.VQ--------------..---.G-NG.-.C-IS.EDD----------
Q5ZJB5_CHICK/68-103LHY-FKM---H-------------------.D.YD--------------..---.G-NN.-.L-LD.GLE----------
Q4CS95_TRYCC/33-65.EL-FDS---L-------------------.D.TE--------------..---.H-NG.-.Y-LA.IED----------
Q00WG8_OSTTA/33-61.AR-FRS---L-------------------.D.KR--------------..---.H-KG.-.F-LT.EDE----------
RASEF_XENTR/9-38.AL-FHT---F-------------------.D.SK--------------..---.S-SG.-.R-LE.KGQ----------
Q6TXM2_STRPU/582-611.EA-FLQ---Y-------------------.D.RD--------------..---.R-SG.-.N-ID.VNE----------
D2VGQ0_NAEGR/231-261.EI-FNL---L-------------------.D.AN--------------..---.Q-SG.-.T-IG.KAE----------
D0MVJ8_PHYIT/2641-2670.DL-FEL---L-------------------.D.DA--------------..---.G-SG.-.E-LS.RER----------
A9V7D4_MONBE/231-262.RW-FHL---L-------------------.D.SD--------------..---.G-NG.-.D-LS.FRE----------
C5LFC0_PERM5/84-113.GA-FQT---L-------------------.D.PS--------------..---.R-TG.-.V-MA.GDI----------
B7G332_PHATC/130-165.CA-GKH---L-------------------.D.HN--------------..---.K-NG.-.K-LD.RDE----------
B3S581_TRIAD/59-96.HF-FKL---H-------------------.D.YD--------------..---.D-NS.-.K-LD.GLE----------
Q4XYU2_PLACH/524-554.EI-FKH---L-------------------.D.ND--------------..---.K-DS.-.Y-IT.KED----------
B0CNF8_LACBS/51-83.SF-FQL---H-------------------.D.LD--------------..---.R-NG.-.F-WD.RDE----------
A0E1J3_PARTE/38-73.RL-FDT---Y-------------------.D.RD--------------..---.R-NG.-.Q-ID.NVE----------
D3BGC9_POLPA/56-86.EI-FSR---Y-------------------.D.AD--------------..---.N-DG.-.M-LT.IDE----------
C1N8S9_MICPC/55-85.RL-FAA---V-------------------.D.GD--------------..---.D-DG.-.S-VD.VIE----------
B3RSL0_TRIAD/112-148.YA-FRI---Y-------------------.D.YN--------------..---.D-SN.-.Y-LE.DDD----------
C1MSB0_MICPC/627-658.YA-FVV---L-------------------.D.AD--------------..---.R-DG.-.R-VH.VDE----------
C3YY99_BRAFL/15-44.RC-FDM---L-------------------.D.KD--------------..---.K-DG.-.F-LL.SRE----------
B8C8A3_THAPS/287-317.KK-FAI---A-------------------.D.KS--------------..---.N-CG.-.S-LS.IEE----------
D7AV60_NOCDD/14-45.DL-FTR---L-------------------.D.TD--------------..---.Q-DG.-.S-IN.IHE----------
Q94LH2_ORYSJ/29-58.KW-FMK---F-------------------.N.TN--------------..---.N-DG.-.R-IS.GVE----------
A8Q891_MALGO/17-46.RV-FYA---L-------------------.D.KN--------------..---.A-NG.-.R-VS.DSD----------
C5LPQ5_PERM5/9-38.RM-FDL---F-------------------.D.TD--------------..---.G-SG.-.I-IE.LRK----------
A8IJ90_CHLRE/3-32.SA-FNA---L-------------------.D.AD--------------..---.G-SS.-.T-VT.TDE----------
B7G8B5_PHATC/86-115.ST-FDL---I-------------------.D.SG--------------..---.G-KG.-.Y-LT.KDD----------
A4I9Q9_LEIIN/181-211.EA-FRI---Y-------------------.D.PH--------------..---.N-TH.-.Y-VE.EEV----------
C5LIS6_PERM5/226-255.YV-FLL---L-------------------.D.TD--------------..---.N-TG.-.Y-IK.VDD----------
C6KTA8_PLAF7/77-106.DI-FHF---Y-------------------.D.TN--------------..---.K-TG.-.K-IS.KEK----------
A0CSB1_PARTE/153-182.LL-FDF---F-------------------.D.SK--------------..---.K-NG.-.T-ID.YNE----------
B9PLU7_TOXGO/4-33.SI-FKV---F-------------------.D.SD--------------..---.G-DG.-.K-LT.CIE----------
Q4DPM5_TRYCC/184-213.TV-FDA---L-------------------.D.AQ--------------..---.Q-KG.-.Y-LL.FTD----------
B8LD33_THAPS/828-857.AV-FDK---I-------------------.D.SD--------------..---.G-GG.-.E-ID.KDE----------
C1MUU0_MICPC/12-42.LK-FDA---A-------------------.D.ED--------------..---.G-SD.-.G-IE.MDE----------
C3YUG8_BRAFL/425-454.RV-FGE---H-------------------.D.VD--------------..---.K-DT.-.K-LS.QEE----------
Q4U8G1_THEAN/76-105.EL-FRF---Y-------------------.D.PN--------------..---.N-TG.-.R-IS.KKQ----------
A7SXZ3_NEMVE/9-37.DV-FRR---A-------------------.D.KN--------------..---.D-DG.-.A-LS.WEE----------
Q8IJ97_PLAF7/12-41.KN-FNL---I-------------------.D.NN--------------..---.N-DK.-.K-IS.PEE----------
A0BF28_PARTE/345-376.AS-FIS---L-------------------.D.SN--------------..---.D-VG.-.Y-LT.ESQ----------
Q4E2K6_TRYCC/617-646.SI-FCR---H-------------------.D.AD--------------..---.R-NG.-.I-VN.AQE----------
Q4E1U1_TRYCC/7-40.QI-FDL---Y-------------------.D.TD--------------..---.R-AG.-.W-IP.TKR----------
A0C5R3_PARTE/309-338.QA-FQF---F-------------------.D.LD--------------..---.V-DG.-.S-IG.LQD----------
A0ED28_PARTE/72-103.DC-FNF---Y-------------------.D.PQ--------------..---.K-SG.-.Y-IN.RQN----------
D2VR29_NAEGR/607-636.KL-FRE---I-------------------.D.IN--------------..---.R-DG.-.I-LN.QVE----------
B8BSH1_THAPS/111-142.KA-FRL---L-------------------.D.HD--------------..---.G-TN.-.S-IS.RDS----------
Q5KAJ1_CRYNJ/665-697.RM-FFA---W-------------------.D.TQ--------------..---.G-QG.-.S-LS.LQD----------
C3YDH3_BRAFL/26-58WHF-FKS---H-------------------.D.SD--------------..---.K-NM.-.K-LD.GLE----------
B3S2Z7_TRIAD/64-96.YY-FKL---H-------------------.D.TN--------------..---.K-DN.-.K-LD.GLE----------
A2DPY5_TRIVA/83-112.RA-FQF---F-------------------.D.KT--------------..---.K-SG.-.L-IS.FDT----------
C5KLK8_PERM5/99-128.QK-FDR---H-------------------.D.VE--------------..---.G-SG.-.R-IR.VSQ----------
A0D7T4_PARTE/77-106.LL-FEK---F-------------------.D.ND--------------..---.G-SK.-.A-LD.FIE----------
A0DSQ2_PARTE/47-76.QF-YAF---F-------------------.D.TF--------------..---.N-QR.-.K-IT.RLD----------
C1FHF3_MICSR/35-68.AA-FIA---G-------------------.D.TD--------------..---.R-NG.-.V-LD.AQE----------
A0BCE1_PARTE/120-149.SA-FSV---F-------------------.D.FD--------------..---.K-NG.-.T-ID.SKK----------
B7FPG8_PHATC/98-128.RA-FDL---L-------------------.D.EA--------------..---.G-KG.-.M-IV.LED----------
C3XQZ6_BRAFL/437-468.DF-FKS---F-------------------.D.KE--------------..---.G-DL.-.L-VT.VEE----------
Q22DM3_TETTS/41-68.EK-FRL---L-------------------...SD--------------..---.N-KP.-.T-LT.LNG----------
C7YTC4_NECH7/525-554.AM-LRQ---Y-------------------.D.AD--------------..---.E-SG.-.Q-IS.RIE----------
D3BH77_POLPA/977-1008.AC-LAN---C-------------------.D.LN--------------..---.R-DN.-.N-ID.KNE----------
B7PAY1_IXOSC/102-130.NA-FSM---F-------------------.D.Q.--------------..---.G-NG.-.F-CT.EER----------
A8WRH5_CAEBR/109-138.LV-FRN---I-------------------.D.QA--------------..---.R-NG.-.S-VT.FLD----------
C5KU24_PERM5/19-48.SV-FYL---F-------------------.D.AD--------------..---.A-DG.-.R-LT.SDE----------
CAN11_HUMAN/571-609.HL-FKI---V-------------------.A.GE--------------..---..-GK.-.E-IG.VYE----------
D0MUI2_PHYIT/445-475.LM-FSL---M-------------------.D.TD--------------..---.G-SL.-.E-LS.STK----------
A0BTT3_PARTE/62-91.QI-FNV---F-------------------.D.YN--------------..---.D-SK.-.T-LD.IAE----------
A0DVD9_PARTE/23-52.GA-FSD---L-------------------.D.VN--------------..---.N-SG.-.E-IE.IDD----------
C3ZDD2_BRAFL/477-508.DM-FVK---Y-------------------.D.KS--------------..---.R-DF.-.N-LD.MGE----------
B8BTK8_THAPS/174-205.DE-FKQ---P-------------------.D.VD--------------..---.G-DD.-.R-IS.RTE----------
B8CFD8_THAPS/313-348.ME-FEK---Y-------------------.D.KE--------------..---.G-TG.-.E-IT.LDT----------
A2AB62_MOUSE/109-138.DI-FKL---F-------------------.S.CS--------------..---.P-TG.-.T-VD.MQS----------
C3Y3L2_BRAFL/18-48.NI-FSL---C-------------------.D.VD--------------..---.E-KG.-.F-IT.MRD----------
A0EAZ9_PARTE/45-80.RI-FKM---L-------------------.D.SE--------------..---.N-NG.-.F-IT.EKH----------
C5LYE4_PERM5/81-110.EA-FRV---L-------------------.D.VT--------------..---.G-SG.-.K-VS.VKD----------
D3BHC5_POLPA/246-276.SI-FDR---F-------------------.D.LN--------------..---.K-DN.-.S-LS.VKE----------
CDPKP_ARATH/437-466.ET-FKT---I-------------------.D.SG--------------..---.K-SG.-.R-VT.YKE----------
B9R7D2_RICCO/19-48.GL-LKR---Y-------------------.D.SN--------------..---.G-DG.-.K-LS.RKD----------
B3RQP5_TRIAD/251-279.KV-LAE---S-------------------.N.ID--------------..---.E-DA.-.I-ID.KTE----------
C3YEV6_BRAFL/628-656.KR-FNK---V-------------------...AG--------------..---.A-KG.-.F-IT.HVD----------
A1CBB6_ASPCL/49-87SSF-FGL---H-------------------.D.FD--------------..---.A-SG.-.A-WT.PDE----------
C3Z5Z5_BRAFL/533-562.KA-LAA---A-------------------.D.VN--------------..---.R-DK.-.Q-VD.FEE----------
D0NH29_PHYIT/57-87.KL-FSL---F-------------------.N.PG--------------..---.E-DG.-.M-VS.YEG----------
B7XIJ8_ENTBH/72-101.EA-FKI---L-------------------.D.TE--------------..---.N-TG.-.Y-VK.AKD----------
A0DMG4_PARTE/351-381.MK-FEE---L-------------------.D.RD--------------..---.N-SG.-.T-IN.EVE----------
C3YV00_BRAFL/85-114.RG-FGD---H-------------------.D.TD--------------..---.Q-DM.-.K-LS.KQE----------
B7FUB0_PHATC/1084-1115.GI-FDA---F-------------------.D.RL--------------..---.G-SG.-.T-PS.AVE----------
C3ZH49_BRAFL/1174-1204.TI-LKA---Q-------------------.N.KD--------------..---.H-TS.-.T-VS.REE----------
A7RK79_NEMVE/188-218.ET-YRE---W-------------------.D.YD--------------..---.G-DG.-.V-IS.VTE----------
B3S1A6_TRIAD/67-96..A-FAI---Y-------------------.D.FD--------------..---.G-DN.-.S-IG.RSD----------
Q29IA0_DROPS/39-68.EI-YNM---F-------------------.D.PS--------------..---.N-ST.-.G-IS.EAD----------
A4S9A6_OSTLU/2128-2162.HD-FDE---T-------------------.D.TD--------------..---.G-SG.-.G-ID.KSE----------
A0CCU0_PARTE/82-111.MI-FQI---M-------------------.D.TT--------------..---.N-SG.-.K-IS.KDE----------
B7Q350_IXOSC/1399-1442NTF-FAM---H-------------------.D.LN--------------..---.G-DG.-.Q-LD.QDE----------
C1MT69_MICPC/45-75.SF-FRA---L-------------------.D.KD--------------..---.D-DG.-.Q-IE.RAE----------
A9URG6_MONBE/582-611.DV-LNR---I-------------------.D.ST--------------..---.R-EG.-.K-LT.RKD----------
B7PQS4_IXOSC/34-61.EL-FTL---C-------------------.D.KE--------------..---.D-KG.-.F-IN.KRD----------
A0BSR5_PARTE/180-209.QC-FRQ---I-------------------.D.KD--------------..---.D-MG.-.V-IS.YEE----------
A0BM15_PARTE/63-92.QI-FRT---L-------------------.D.CN--------------..---.N-EG.-.V-LT.LAH----------
Q29GA6_DROPS/127-159.TL-HRI---M-------------------.D.VN--------------..---.H-DG.-.V-IS.YDD----------
Q4E142_TRYCC/257-286.AL-FQR---L-------------------.D.KH--------------..---.G-NG.-.Y-LE.LKE----------
B3L1G0_PLAKH/13-41.SI-FNE---F-------------------.D.KN--------------..---.K-NG.-..-LD.GKQ----------
B8C031_THAPS/320-349.CI-FAW---H-------------------.D.TK--------------..---.G-YG.-.V-IN.NSD----------
A8XF67_CAEBR/57-86.YY-FKV---G-------------------.D.QN--------------..---.L-DH.-.F-LD.GIE----------
Q38C77_TRYB2/16-45.EA-FRL---F-------------------.D.SA--------------..---.D-EG.-.V-IA.MSR----------
Q4U910_THEAN/477-506.YA-FRL---Y-------------------.D.KD--------------..---.Y-DG.-.K-LS.FNT----------
B7PG89_IXOSC/60-90.EL-TEH---A-------------------.D.FN--------------..---.K-DR.-.I-VE.FDE----------
B8NHB5_ASPFN/61-89.AD-FYK---A-------------------.D.FD--------------..---.R-DG.-.H-IT.LQE----------
C3ZYS2_BRAFL/1605-1634.AL-FAM---A-------------------.D.VD--------------..---.S-DG.-.T-VT.SSE----------
A9VCA0_MONBE/80-109.AA-FKA---Y-------------------.D.QA--------------..---.G-TG.-.T-IS.KAD----------
A7SIS2_NEMVE/98-139.YF-FKL---H-------------------.D.YD--------------..---.N-NQ.-.K-LD.GLE----------
B0DIL9_LACBS/626-655.RL-FFF---W-------------------.D.TS--------------..---.C-KG.-.A-LS.FQD----------
C7G032_DICDI/508-537.RM-FKL---M-------------------.D.KD--------------..---.D-DN.-.L-LN.FKE----------
D2A071_TRICA/143-179FYY-FQV---H-------------------.D.TD--------------..---.K-NS.-.K-LD.GLE----------
A0EAP2_PARTE/324-354.AS-FIS---L-------------------.D.FD--------------..---.D-QG.-.Y-IS.ETQ----------
A8P2X2_COPC7/487-516.QY-LKQ---Y-------------------.D.TD--------------..---.D-TN.-.T-MS.HLE----------
A0DU71_PARTE/549-578.QM-FQQ---I-------------------.D.YN--------------..---.F-SG.-.Y-LN.WRE----------
Q8LKK4_CHLRE/572-601.SS-VIA---A-------------------.D.KS--------------..---.G-SG.-.A-LT.GDD----------
Q54E45_DICDI/138-166.MI-FRL---F-------------------.S.RN--------------..---.G-.K.-.T-IG.ADE----------
A0ECX0_PARTE/269-298.EM-FIF---I-------------------.D.KN--------------..---.N-DG.-.F-ID.VNE----------
Q4DLY4_TRYCC/95-128.GI-FND---Y-------------------.D.VN--------------..---.G-NG.-.R-LS.KET----------
B7Q8D4_IXOSC/82-118.YF-FRM---H-------------------.D.FD--------------..---.N-NN.-.K-LD.GLE----------
D0N3C9_PHYIT/174-204.AA-LNQ---I-------------------.D.RN--------------..---.N-DG.-.R-ID.EEE----------
C5KYD8_PERM5/173-202.EC-FEV---W-------------------.D.SD--------------..---.G-DG.-.K-LN.PSE----------
A9V4G2_MONBE/147-180.QT-FDQ---F-------------------.D.TD--------------..---.S-DG.-.Q-LS.KAE----------
A9UU76_MONBE/93-122.AA-FRV---F-------------------.D.KL--------------..---.G-NG.-.T-VP.AKE----------
CGRE1_MOUSE/75-112.SL-FAL---H-------------------.D.YD--------------..---.Q-NG.-.Q-LD.GLE----------
D0NLT0_PHYIT/68-97.AL-FTA---L-------------------.D.TD--------------..---.E-NG.-.L-VD.ALE----------
A5KCC4_PLAVS/562-593.YL-FNQ---Y-------------------AH.TE--------------..---.Y-PN.-.C-IS.FKR----------
Q54EU2_DICDI/187-217.EI-FDR---F-------------------.D.RN--------------..---.K-DN.-.C-LN.KAE----------
A8WXW8_CAEBR/591-622.SI-FKK---I-------------------.D.KE--------------..---.G-RG.-.T-FS.SSD----------
Q5Z905_ORYSJ/274-303.QA-FRY---F-------------------.D.QN--------------..---.R-AG.-.Y-LK.VDD----------
A0A0D1DQL2_USTMA/20-49.SR-FRT---L-------------------.D.VE--------------..---.E-KG.-.S-IP.KQD----------
A2EYC2_TRIVA/29-61.AA-FHD---V-------------------.D.KS--------------..---.N-TG.-.R-IT.KDQ----------
A0DQ90_PARTE/27-67.KK-FQQ---L-------------------.D.TN--------------..---.N-KG.-.F-VS.AAD----------
B4NGA9_DROWI/115-153.FA-FKV---Y-------------------.D.VM--------------..---.G-VG.-.S-LD.GDV----------
D0NB87_PHYIT/1035-1065.AL-FEK---Y-------------------.D.VD--------------..---.G-DG.-.H-LA.EPE----------
B6K3A4_SCHJY/20-48.EQ-FGR---L-------------------.D.VD--------------..---.G-KG.-.Y-ID.QPS----------
C4Y9V5_CLAL4/13-44.NA-FTL---I-------------------.D.SD--------------..---SK-DG.-.K-IT.LSD----------
Q2H4R6_CHAGB/754-784.RL-FQK---W-------------------.D.TD--------------..---.S-SS.-.A-LT.LQK----------
A7SHV8_NEMVE/147-177.SI-FSG---W-------------------.D.TN--------------..---.N-DG.-.F-IT.VDE----------
A4I027_LEIIN/173-200.QV-WMM---Y-------------------.D.KD--------------..---.N-SG.-.D-LS.YAE----------
B3MG51_DROAN/125-154.FA-FSV---Y-------------------.D.RG--------------..---.D-RG.-.Q-LN.SEE----------
EFCB8_MOUSE/115-143.KV-FEK---E-------------------...AD--------------..---.E-NG.-.A-LK.KEG----------
A5K8W6_PLAVS/148-177.KM-FSH---F-------------------.D.NN--------------..---.A-SG.-.F-LT.KNQ----------
A8P5P9_BRUMA/6-33.EI-FLL---Y-------------------.D.EE--------------..---.L-DG.-.K-ID.GTQ----------
B8LWL3_TALSN/221-250.RA-FEL---F-------------------.D.EG--------------..---.G-KG.-.Y-ID.LED----------
C4LT56_ENTHI/7-35.DY-FAI---L-------------------.D.ID--------------..---.H-DK.-.K-IS.RDQ----------
C4LUQ9_ENTHI/16-43.DA-FDM---F-------------------.D.SS--------------..---.K-KG.-.Y-LD.KDD----------
F1R647_DANRE/83-111.TM-FKR---F-------------------.D.SG--------------..---.K-DG.-.F-ID.LME----------
F7GNT1_CALJA/685-713.AS-FNH---F-------------------.D.RK--------------..---.K-TG.-.M-MD.TDD----------
G3HZP5_CRIGR/33-62.EA-SNM---I-------------------.D.QN--------------..---.R-DG.-.F-ID.KED----------
H0ZMF4_TAEGU/54-83.EA-FLL---F-------------------.D.RT--------------..---.G-DA.-.K-IT.LSQ----------
H2VC11_TAKRU/55-86.DA-FTL---F-------------------.D.ET--------------..---.P-TGE-LK-IT.FAQ----------
H3CP38_TETNG/179-208.LA-FKM---F-------------------.E.AE--------------..---.E-DG.-.A-IT.QLE----------
I1LLG5_SOYBN/78-108.EA-FEM---Y-------------------ND.TE--------------..---.M-FG.-.F-IT.PKS----------
M9MSK2_DROME/7-36.TA-FDL---L-------------------.D.RN--------------..---.R-DG.-.R-VT.ANE----------
Q236J2_TETTS/59-87.QA-FKI---I-------------------.D.YR--------------..---.N-TG.-.Q-IT.SEQ----------
Q38AA2_TRYB2/25-54.EV-FSI---L-------------------.D.VD--------------..---.G-TE.-.T-IT.PND----------
Q38EV6_TRYB2/74-103.TA-LRA---F-------------------.D.GN--------------..---.D-SG.-.Q-LK.LSE----------
CML9_ORYSJ/91-119.AC-LDV---F-------------------.D.DA--------------..---.R-SG.-.V-IP.AEQ----------
Q8LHQ5_ORYSJ/28-57.AW-LMH---F-------------------.D.GD--------------..---.G-DE.-.H-IS.RRE----------

PF00036

S10AC_RABIT/53-81-RI-FRD---L--------------------D-ED--------------------G-DH---Q-VD-FKE----------
UCP8_SCHPO/337-365-RI-WDT---V--------------------D-TQ--------------------D-RG---Y-ID-KDE----------
RPTN_MOUSE/53-81-TI-LEH---L--------------------D-RD--------------------R-NG---Y-VD-FHE----------
2AB2E_ARATH/385-413-YW-FKC---V--------------------D-LD--------------------G-NG---V-IT-SNE----------
RBOHE_ARATH/272-300-IF-FDM---A--------------------D-SN--------------------E-DG---K-IT-REE----------
CALM4_ARATH/48-76-DM-INE---V--------------------D-AD--------------------G-NG---T-ID-FPE----------
CALM4_ARATH/85-113-EA-FRV---F--------------------D-KD--------------------Q-NG---F-IS-AAE----------
CALM4_ARATH/121-149-EM-IRE---A--------------------D-VD--------------------G-DG---Q-IN-YEE----------
YLJ5_CAEEL/51-79-KI-FQL---M--------------------D-DD--------------------G-SG---T-IS-SSE----------
YLJ5_CAEEL/87-115-AV-MRS---S--------------------D-VS--------------------G-DG---Q-ID-FEE----------
DGK3_CAEEL/174-202-VV-FHV---Y--------------------D-SD--------------------G-NG---F-LD-KSE----------
DGK3_CAEEL/219-247-QM-MVD---I--------------------D-YD--------------------N-DG---I-VS-FDE----------
Q21408_CAEEL/2329-2357-RI-LDI---V--------------------D-PN--------------------R-DG---Y-VT-LQE----------
END3_EMENI/46-74-KV-WDL---A--------------------D-LD--------------------G-DG---E-LD-FEE----------
EP15R_MOUSE/276-304-EI-FLK---T--------------------D-LD--------------------L-DG---Y-VS-GQE----------
Q94288_CAEEL/100-128-EA-FLL---F--------------------D-KD--------------------G-NG---T-IS-IKE----------
Q94288_CAEEL/136-164-EI-IHD---V--------------------D-LD--------------------G-NG---Q-VE-FPE----------
Q94288_CAEEL/172-200-EA-FKI---F--------------------D-RD--------------------G-NG---V-IT-ANE----------
CAN9_MOUSE/595-623-DL-FLQ---F--------------------D-VD--------------------K-SG---T-MS-SYE----------
CABP1_HUMAN/343-370-EI-IRD---V--------------------D-LN--------------------G-DG---R-VD-FEE----------
O16343_CAEEL/114-142-FA-FKM---Y--------------------D-LN--------------------K-NN---Y-IT-REE----------
O16343_CAEEL/155-183-KT-LEE---A--------------------D-QD--------------------R-DG---K-IS-FED----------
PLSL_HUMAN/13-41-EA-FAK---V--------------------D-TD--------------------G-NG---Y-IS-FNE----------
PLSL_HUMAN/53-81-NL-MAT---G--------------------D-LD--------------------Q-DG---R-IS-FDE----------
DGKG_HUMAN/179-207-FM-FRL---Y--------------------D-SD--------------------E-NG---L-LD-QAE----------
DGKG_HUMAN/224-252-EM-LQG---M--------------------D-YD--------------------R-DG---F-VS-LQE----------
RYR2_HUMAN/4027-4055-DT-FKE---Y--------------------D-PD--------------------G-KG---V-IS-KRD----------
GPDM_HUMAN/627-655-KR-FHK---F--------------------D-AD--------------------Q-KG---F-IT-IVD----------
GPDM_HUMAN/663-691-EI-LNE---V--------------------D-LN--------------------K-NG---Q-VE-LNE----------
DGKA_HUMAN/114-142-FT-FKL---Y--------------------D-TD--------------------R-NG---I-LD-SSE----------
DGKA_HUMAN/159-187-EM-MKE---I--------------------D-YD--------------------G-SG---S-VS-QAE----------
Q93640_CAEEL/121-149-YA-FRI---Y--------------------D-YD--------------------G-DE---L-LG-HDD----------
Q93640_CAEEL/162-190-RI-IEE---A--------------------D-LD--------------------G-DS---S-IN-FAE----------
ITSN2_MOUSE/58-86-EI-WAL---S--------------------D-LN--------------------K-DG---K-MD-QQE----------
ITSN2_MOUSE/282-310-TI-WTL---A--------------------D-ID--------------------G-DG---Q-LK-AEE----------
CALML_DICDI/10-38-EA-FNL---F--------------------D-KD--------------------K-DG---K-IT-IQE----------
CALML_DICDI/46-73-DI-AKE---I--------------------D-.D--------------------G-SG---L-VD-FSK----------
CALML_DICDI/82-110-QA-FKV---F--------------------D-KK--------------------G-NG---Y-AN-IQD----------
CAM2_SCHPO/10-38-EA-FVL---Y--------------------D-ID--------------------K-DG---L-IP-TSH----------
CAM2_SCHPO/79-107-KA-FRV---F--------------------D-KD--------------------N-SG---Y-IE-TAK----------
CAN9_HUMAN/565-593-NI-ISL---M--------------------D-TS--------------------G-NG---K-LE-FDE----------
CAN9_HUMAN/595-623-NL-FLR---F--------------------D-AD--------------------K-SG---T-MS-TYE----------
PPE1_HUMAN/570-598-II-FNA---I--------------------D-TD--------------------H-SG---L-IS-VEE----------
PPE1_HUMAN/610-638-KL-ANI---M--------------------D-LN--------------------K-DG---S-ID-FNE----------
PPE2_HUMAN/572-600-SE-FKK---H--------------------D-AD--------------------K-VG---L-IT-LSD----------
PPE2_HUMAN/656-684-TI-FRI---I--------------------D-SD--------------------H-SG---F-IS-LDE----------
O16158_DROME/11-39-LF-NVF---F--------------------D-VN--------------------Q-SG---E-ID-VKD----------
O16158_DROME/62-90-GL-RSK---A--------------------D-KD--------------------N-DG---Q-VS-VDE----------
O16158_DROME/104-132-FM-FDL---E--------------------D-AS--------------------H-DG---G-ID-VTE----------
O18058_CAEEL/24-52-QA-FKL---F--------------------D-KD--------------------G-NN---T-MN-IKE----------
O18058_CAEEL/60-88-NM-VNE---Y--------------------D-VD--------------------G-NG---K-ID-FGE----------
O18058_CAEEL/96-124-LA-FKV---F--------------------D-KD--------------------G-NG---Y-IT-AQE----------
O18058_CAEEL/132-160-EI-IRE---V--------------------D-KD--------------------G-DE---Q-ID-LDE----------
SCMC1_RABIT/23-51-TL-FQA---L--------------------D-RN--------------------G-DG---V-VD-IRE----------
SCMC1_RABIT/59-87-KI-FTT---G--------------------D-VN--------------------K-DG---K-LD-FEE----------
SCMC1_RABIT/90-118-LA-FKS---L--------------------D-KN--------------------N-DG---K-IE-ASE----------
CML5_ARATH/65-93-RV-FQM---F--------------------D-KN--------------------G-DG---R-IT-KEE----------
CML5_ARATH/101-129-QM-IHK---I--------------------D-AN--------------------G-DG---C-VD-IDE----------
CML5_ARATH/143-171-DA-FNV---F--------------------D-QD--------------------G-DG---F-IT-VEE----------
CML5_ARATH/181-209-KM-IMQ---V--------------------D-AD--------------------G-DG---R-VN-YKE----------
Y1515_ARATH/10-38-RI-FQQ---F--------------------D-GN--------------------H-DG---G-LN-REE----------
CML19_ARATH/27-55-EI-FDL---F--------------------D-ID--------------------G-SG---S-ID-ASE----------
CML19_ARATH/63-91-EL-MAE---V--------------------D-KN--------------------Q-SG---A-ID-FDE----------
CML19_ARATH/100-128-KA-FKI---I--------------------D-HD--------------------N-NG---K-IS-PRD----------
CML19_ARATH/136-164-EM-IEE---A--------------------D-RD--------------------K-DG---E-VN-LEE----------
CML8_ARATH/49-77-DI-ITE---I--------------------D-SD--------------------S-NG---T-IE-FAE----------
PPE2_MOUSE/576-604-VE-FRK---R--------------------D-PD--------------------E-SG---V-IT-LSD----------
PPE2_MOUSE/700-728-DL-ARS---I--------------------D-FN--------------------K-DG---H-ID-INE----------
ONCO_CAVPO/43-71-DV-FRF---I--------------------D-ND--------------------Q-SG---Y-LD-EEE----------
ONCO_CAVPO/82-109-SL-MAA---A--------------------D-ND--------------------G-DG---K-IG-ADE----------
CALU_RAT/72-100-MI-VDK---I--------------------D-TD--------------------K-DG---F-VT-EGE----------
CALU_RAT/108-136-NQ-WQE---F--------------------D-MN--------------------Q-DG---L-IS-WDE----------
CHP2_HUMAN/115-143-YA-FQL---Y--------------------D-LD--------------------R-DG---K-IS-RHE----------
CHP2_HUMAN/156-184-RT-VQE---A--------------------D-ED--------------------G-DG---A-VS-FVE----------
CALU_HUMAN/72-100-KI-VSK---I--------------------D-GD--------------------K-DG---F-VT-VDE----------
CALU_HUMAN/192-220-ET-MED---I--------------------D-KN--------------------A-DG---F-ID-LEE----------
O45313_CAEEL/236-262-KI-FAE---L--------------------D-CD--------------------R-DG---L-VT-YDD----------
GEM1_SCHPO/188-216-RI-FFL---I--------------------D-KN--------------------N-DD---L-LS-VDE----------
GEM1_SCHPO/308-336-DL-FYQ---F--------------------D-RD--------------------N-DG---A-LN-NEE----------
FIMB_SCHPO/55-83-EA-IRE---V--------------------N-VD--------------------S-SG---R-VE-PED----------
CALM_KLULA/12-40-EA-FAL---F--------------------D-KD--------------------N-SG---S-IS-ASE----------
CALM_KLULA/48-76-DL-MNE---I--------------------D-VD--------------------G-NH---A-IE-FSE----------
CALM_KLULA/85-113-EA-FKV---F--------------------D-KN--------------------G-DG---L-IS-AAE----------
CALM_KLULA/121-147-EM-LRE---V--------------------.-SD--------------------G-SG---E-IN-IKQ----------
O61604_DROME/18-46-EK-FIE---L--------------------D-AN--------------------K-DG---F-ID-LHE----------
O64866_ARATH/24-52-ER-FAA---L--------------------D-LN--------------------K-DG---V-LS-RSE----------
O64866_ARATH/73-101-SI-FEK---F--------------------D-TD--------------------Q-SG---S-VD-LEE----------
CDC31_SCHPO/38-66-EA-FKL---F--------------------D-SD--------------------K-DN---A-ID-YHE----------
CDC31_SCHPO/74-102-KI-LRD---F--------------------D-KT--------------------G-KG---Y-LQ-MED----------
CDC31_SCHPO/147-175-AM-IEE---F--------------------D-LD--------------------Q-DG---E-IN-EQE----------
CMC1_HUMAN/90-118-VA-FQL---F--------------------D-KS--------------------G-NG---E-VT-FEN----------
CMC1_HUMAN/161-189-QA-FAL---K--------------------D-KS--------------------K-SG---M-IS-GLD----------
CIB2_HUMAN/107-135-YA-FKI---Y--------------------D-FN--------------------T-DN---F-IC-KED----------
CIB2_HUMAN/148-176-KV-IEE---A--------------------D-LD--------------------G-DG---K-LG-FAD----------
SEGN_HUMAN/16-44-QV-WQR---F--------------------D-AD--------------------E-KG---Y-IE-EKE----------
SEGN_HUMAN/109-137-QI-WRK---Y--------------------D-AD--------------------S-SG---F-IS-AAE----------
SEGN_HUMAN/201-229-KI-FAY---Y--------------------D-VS--------------------K-TG---A-LE-GPE----------
SEGN_HUMAN/245-273-IL-LRH---C--------------------D-VN--------------------K-DG---K-IQ-KSE----------
O76670_CAEEL/18-46-DS-FDL---V--------------------D-AN--------------------N-DG---K-LS-EKE----------
O76670_CAEEL/50-78-EY-FQR---F--------------------D-LD--------------------R-NG---H-LD-ISE----------
O76670_CAEEL/117-145-GI-LSI---A--------------------D-TN--------------------R-DG---Q-LT-YAE----------
O76670_CAEEL/158-186-QL-LSF---I--------------------D-AN--------------------G-DN---K-LD-QLE----------
O76670_CAEEL/195-223-QI-FAM---L--------------------D-KN--------------------Q-DG---Y-LT-ENE----------
RBOHA_ARATH/225-253-TF-FAM---V--------------------D-KD--------------------S-DG---R-LN-EAE----------
CNBL4_ARATH/75-103-RI-FDV---F--------------------D-VK--------------------R-NG---V-IE-FGE----------
CNBL4_ARATH/112-140-FA-FKL---Y--------------------D-LR--------------------Q-TG---F-IE-REE----------
CNBL4_ARATH/156-184-KA-FVQ---A--------------------D-RK--------------------N-DG---K-ID-IDE----------
CNBL1_ARATH/71-99-RI-FDM---F--------------------D-VK--------------------R-KG---V-ID-FGD----------
CNBL1_ARATH/108-136-FT-FRL---Y--------------------D-MD--------------------C-TG---Y-IE-RQE----------
YC22_ARATH/388-416-EL-WVR---A--------------------D-LD--------------------G-NG---V-FD-YEE----------
CML20_ARATH/100-128-KA-FQI---I--------------------D-LD--------------------K-NG---K-IS-PDD----------
CML20_ARATH/136-164-EM-VEE---A--------------------D-RD--------------------R-DG---E-VN-MDE----------
CABP1_RAT/157-185-EA-FRE---F--------------------D-KD--------------------K-DG---Y-IN-CRD----------
CABP1_RAT/234-262-DA-FRE---F--------------------D-TN--------------------G-DG---E-IS-TSE----------
O93409_DANRE/30-58-EA-FTI---I--------------------D-QN--------------------R-DG---I-IS-KDD----------
RCN1_TAKRU/74-102-KI-VDR---I--------------------D-GD--------------------G-NS---Y-IT-TDE----------
RCN1_TAKRU/110-138-KV-WAD---Y--------------------D-LN--------------------K-DN---K-IS-WEE----------
RCN1_TAKRU/198-226-ET-LED---I--------------------D-KN--------------------S-DG---H-VD-EDE----------
YFFE_SCHPO/13-41-EA-FDL---F--------------------D-VT--------------------H-KG---Y-ID-FED----------
FKBP9_HUMAN/492-520-NL-FEE---I--------------------D-KD--------------------G-NG---E-VL-LEE----------
FKBP9_HUMAN/537-563-NM-FTN---Q--------------------D-RN--------------------G-DG---K-VT-AEE----------
GUC1C_HUMAN/56-84-QV-YNT---F--------------------D-TN--------------------K-DG---F-VD-FLE----------
GUC1C_HUMAN/92-120-WY-FKL---Y--------------------D-AD--------------------G-NG---S-ID-KNE----------
GUC1C_HUMAN/134-162-LV-FHK---I--------------------D-IN--------------------N-DG---E-LT-LEE----------
O96676_DROME/127-155-TL-HRI---L--------------------D-VN--------------------H-DG---V-VS-FDD----------
O96676_DROME/249-277-VS-FAV---I--------------------D-KN--------------------G-DG---Q-LS-LKE----------
TNNC2_PIG/94-122-EC-FRI---F--------------------D-RN--------------------M-DG---Y-ID-AEE----------
TNNC2_CHICK/98-126-NC-FRI---F--------------------D-KN--------------------A-DG---F-ID-IEE----------
CALMS_CHICK/121-149-EM-IKE---A--------------------D-CN--------------------N-DG---Q-VN-YEE----------
CALM_DICDI/87-115-EA-FKV---F--------------------D-KD--------------------G-NG---Y-IS-AAE----------
CALM_DICDI/123-151-EM-IRE---A--------------------D-LD--------------------G-DG---Q-VN-YDE----------
MLE1_CHICK/52-80-EA-FLL---F--------------------D-RT--------------------G-DA---K-IT-LSQ----------
MLE1_CHICK/129-157-EG-LRV---F--------------------D-KE--------------------G-NG---T-VM-GAE----------
MYL6_CHICK/11-39-EA-FQL---F--------------------D-RT--------------------G-DG---K-IL-YSQ----------
MLRS_CHICK/28-56-EA-FTV---I--------------------D-QN--------------------R-DG---I-ID-KDD----------
MLRA_CHICK/133-161-QM-FAA---F--------------------P-PD--------------------V-SG---N-LD-YKN----------
MLRB_CHICK/97-125-NA-FKI---F--------------------D-PE--------------------G-KG---H-IK-ADY----------
MLRM_CHICK/138-166-EM-YRE---A--------------------P-ID--------------------K-KG---N-FN-YVE----------
PRVB_LATCH/42-70-AI-FKI---L--------------------D-QD--------------------K-SG---F-IE-DEE----------
PRVA_LATCH/44-72-EV-FGI---L--------------------D-QD--------------------K-SG---Y-IE-EEE----------
PRVA_LATCH/83-111-AL-LKA---G--------------------D-QD--------------------G-DD---K-IG-VDE----------
S100G_BOVIN/49-77-EL-FEE---L--------------------D-KN--------------------G-DG---E-VS-FEE----------
S100B_BOVIN/53-81-KV-MET---L--------------------D-SD--------------------G-DG---E-CD-FQE----------
S10A1_BOVIN/54-82-KV-MKE---L--------------------D-EN--------------------G-DG---E-VD-FQE----------
SPE1A_STRPU/14-42-RR-FKN---K--------------------D-TD--------------------K-SK---S-IT-AEE----------
SPE1A_STRPU/50-78-KM-ISD---V--------------------D-TD--------------------E-SG---T-ID-FSE----------
SPE1A_STRPU/88-116-KA-FDD---M--------------------D-KD--------------------G-NG---S-LS-PQE----------
SPE2A_STRPU/14-42-SS-FKS---E--------------------D-TD--------------------G-DG---K-IT-SEE----------
SPE2A_STRPU/50-78-EM-MGM---V--------------------D-KD--------------------G-SK---D-MD-FSE----------
SPE2A_STRPU/122-150-AI-IEK---A--------------------D-CN--------------------G-DG---K-IC-LEE----------
SPE2C_STRPU/50-76-EM-MSM---V--------------------D-KD--------------------G-SR---P-VD-FSE----------
SPE2C_STRPU/85-113-KA-FDA---L--------------------D-TD--------------------K-SG---S-LS-PEE----------
SPE2C_STRPU/122-150-AI-IKK---A--------------------D-GN--------------------N-DG---E-IR-RAE----------
CALB1_CHICK/16-44-EI-WHH---Y--------------------D-SD--------------------G-NG---Y-MD-GKE----------
CALB1_CHICK/103-131-QT-WRK---Y--------------------D-SD--------------------H-SG---F-ID-SEE----------
CALB1_BOVIN/15-43-EI-WLH---F--------------------D-AD--------------------G-SG---Y-LE-GKE----------
CALB1_BOVIN/102-130-KT-WRK---Y--------------------D-TD--------------------H-SG---F-IE-TEE----------
CALB1_BOVIN/146-174-LM-LKL---F--------------------D-SN--------------------N-DG---K-LE-LTE----------
CALB1_BOVIN/190-218-KA-FEL---Y--------------------D-QD--------------------G-NG---Y-ID-ENE----------
CALL_CAEEL/25-53-EA-FMM---F--------------------D-KD--------------------G-NG---T-IS-TKE----------
CALL_CAEEL/61-89-EM-INE---V--------------------D-ID--------------------G-NG---Q-IE-FPE----------
CALL_CAEEL/97-125-EA-FRV---F--------------------D-KD--------------------G-NG---V-IT-AQE----------
CALL_CAEEL/133-161-EM-IKE---V--------------------D-VD--------------------G-DG---E-ID-YEE----------
ACTNA_DICDI/733-761-AC-FSH---F--------------------D-KD--------------------N-DN---K-LN-RLE----------
ACTNA_DICDI/769-797-QV-ISK---I--------------------D-TD--------------------G-NG---T-IS-FEE----------
S10A8_HUMAN/50-78-VW-FKE---L--------------------D-IN--------------------T-DG---A-VN-FQE----------
CALM_SCHPO/13-41-EA-FSL---F--------------------D-RD--------------------Q-DG---N-IT-SNE----------
CALM_SCHPO/86-114-EA-FKV---F--------------------D-KD--------------------G-NG---Y-IT-VEE----------
CALM_SCHPO/122-150-DM-IRE---A--------------------D-TD--------------------G-DG---V-IN-YEE----------
CDC31_YEAST/24-52-EA-FSL---F--------------------D-MN--------------------N-DG---F-LD-YHE----------
CDC31_YEAST/97-125-RA-FQL---F--------------------D-DD--------------------H-TG---K-IS-IKN----------
CDC31_YEAST/133-161-AM-IEE---F--------------------D-LD--------------------G-DG---E-IN-ENE----------
SPTA1_MOUSE/2271-2299-TT-YKH---F--------------------D-EN--------------------L-TG---R-LT-HKE----------
SPTA1_MOUSE/2314-2342-KF-LNA---V--------------------D-PG--------------------R-KG---Y-VS-LED----------
MLE_DICDI/7-35-EC-FSI---F--------------------D-KD--------------------N-DG---K-VS-VED----------
MLE_DICDI/79-107-DA-FKA---L--------------------D-KE--------------------G-HG---T-IQ-GAE----------
S10A2_BOVIN/54-82-KL-MGD---L--------------------D-EN--------------------S-DQ---Q-VD-FQE----------
CAYP1_CANFA/25-53-RF-FRR---L--------------------D-RD--------------------R-SR---S-LD-SRE----------
CAYP1_CANFA/61-89-GV-CRR---W--------------------D-RD--------------------G-SG---T-LD-LEE----------
CAYP1_CANFA/97-125-AA-FAK---L--------------------D-RS--------------------G-DG---V-VT-VDD----------
PLCD1_BOVIN/144-172-SC-LRK---A--------------------D-KN--------------------K-DN---K-MS-FKE----------
MLRV_HUMAN/98-126-NA-FKV---F--------------------D-PE--------------------G-KG---V-LK-ADY----------
ACTN1_HUMAN/750-778-AS-FNH---F--------------------D-RD--------------------H-SG---T-LG-PEE----------
ACTN1_HUMAN/791-819-RI-MSI---V--------------------D-PN--------------------R-LG---V-VT-FQA----------
PDCD6_MOUSE/27-55-NV-FQR---V--------------------D-KD--------------------R-SG---V-IS-DNE----------
PDCD6_MOUSE/94-122-NV-FRT---Y--------------------D-RD--------------------N-SG---M-ID-KNE----------
CPNS1_BOVIN/138-166-SM-VAV---M--------------------D-SD--------------------T-TG---K-LG-FEE----------
CPNS1_BOVIN/168-196-AV-YKQ---F--------------------D-VD--------------------R-SG---T-IG-SSE----------
MRLCA_RAT/33-61-EA-FNM---I--------------------D-QN--------------------R-DG---F-ID-KED----------
MRLCA_RAT/102-130-NA-FAC---F--------------------D-EE--------------------A-IG---T-IQ-EDY----------
MLR_DICDI/24-52-EA-FEL---F--------------------D-KD--------------------R-TG---F-IK-KDA----------
MLR_DICDI/60-88-AM-FAE---A--------------------D-TT--------------------K-SG---A-IG-FPE----------
MLR_DICDI/97-125-NA-FKT---F--------------------D-PE--------------------G-NG---Y-IL-TKD----------
SPE2D_STRPU/112-140-EM-IEK---A--------------------D-FP--------------------N-DG---K-CS-LEE----------
SPTN1_RAT/2327-2355-MM-FKH---F--------------------D-KD--------------------K-SG---R-LN-HQE----------
SPTN1_RAT/2370-2398-AI-LDT---V--------------------D-PN--------------------R-DG---H-VS-LQE----------
ACTN_DROME/782-810-SS-FNH---F--------------------D-KN--------------------R-TG---R-LS-PEE----------
ACTN_DROME/823-851-RI-LAV---V--------------------D-PN--------------------N-TG---Y-VH-FDA----------
MLR_DROME/79-107-EA-FQL---M--------------------D-AD--------------------K-DG---I-IG-KND----------
PLSI_CHICK/15-43-EA-FNK---I--------------------D-ID--------------------N-SG---Y-VS-DYE----------
PLSI_CHICK/55-83-KI-FAV---T--------------------D-SN--------------------K-DG---K-IN-FEE----------