Sequence alignment for CL0220

PF13405

A5WWC4_DANRE/529-558-----------------------------------------------------------------------------H-F
A5WWC4_DANRE/603-632-----------------------------------------------------------------------------K-Y
F7GNT1_CALJA/609-638-----------------------------------------------------------------------------E-F
D2A071_TRICA/161-193-----------------------------------------------------------------------------E-L
B3MTC1_DROAN/96-125-----------------------------------------------------------------------------L-Y
Q5KN37_CRYNJ/78-107-----------------------------------------------------------------------------E-F
B5DN90_DROPS/53-82-----------------------------------------------------------------------------R-L
B4M210_DROVI/76-105-----------------------------------------------------------------------------K-M
Q29GA6_DROPS/127-159-----------------------------------------------------------------------------K-M
F5HLN4_ANOGA/622-651-----------------------------------------------------------------------------M-Y
B9PZD1_TOXGV/10-39-----------------------------------------------------------------------------K-C
Q7QH58_ANOGA/21-50-----------------------------------------------------------------------------E-M
B9PML0_TOXGV/103-132-----------------------------------------------------------------------------E-L
B9PRI1_TOXGV/15-44-----------------------------------------------------------------------------E-L
A0A0F7V4L4_TOXGV/73-102-----------------------------------------------------------------------------D-L
A0A0F7V1A1_TOXGV/149-178-----------------------------------------------------------------------------D-L
CAN8_HUMAN/536-564-----------------------------------------------------------------------------Q-F
A9V4Q3_MONBE/290-319-----------------------------------------------------------------------------K-L
A9V4Q3_MONBE/492-521-----------------------------------------------------------------------------Q-I
A0BQH1_PARTE/99-128-----------------------------------------------------------------------------D-I
A0BQH1_PARTE/172-202-----------------------------------------------------------------------------T-I
B3DGM2_DANRE/12-41-----------------------------------------------------------------------------E-F
B3DGM2_DANRE/85-114-----------------------------------------------------------------------------E-I
B4G986_DROPE/40-69-----------------------------------------------------------------------------D-I
B4G986_DROPE/113-142-----------------------------------------------------------------------------D-M
EFCB6_PONAB/24-53-----------------------------------------------------------------------------T-V
EFCB6_PONAB/255-284-----------------------------------------------------------------------------S-L
EFCB6_PONAB/699-728-----------------------------------------------------------------------------D-L
EFCB6_PONAB/816-845-----------------------------------------------------------------------------D-I
B4GVA6_DROPE/51-80-----------------------------------------------------------------------------R-L
B4GVA6_DROPE/139-169-----------------------------------------------------------------------------R-D
B4GVA6_DROPE/217-247-----------------------------------------------------------------------------R-E
A0E4G3_PARTE/299-328-----------------------------------------------------------------------------K-I
B4K4U2_DROMO/29-58-----------------------------------------------------------------------------D-L
B4K4U2_DROMO/102-131-----------------------------------------------------------------------------E-V
A0BG74_PARTE/108-137-----------------------------------------------------------------------------E-I
B5Y3F8_PHATC/258-286-----------------------------------------------------------------------------F-L
Q7Y0H2_CHLRE/18-47-----------------------------------------------------------------------------E-L
C5Z5N8_SORBI/67-96-----------------------------------------------------------------------------R-I
C5Z5N8_SORBI/134-163-----------------------------------------------------------------------------E-L
A7SG62_NEMVE/12-41-----------------------------------------------------------------------------Q-L
A7SG62_NEMVE/87-116-----------------------------------------------------------------------------D-F
Q240R2_TETTS/29-58-----------------------------------------------------------------------------T-L
A7RGK2_NEMVE/11-40-----------------------------------------------------------------------------E-Y
A7RGK2_NEMVE/86-115-----------------------------------------------------------------------------E-F
Q4DGX2_TRYCC/326-357-----------------------------------------------------------------------------E-I
A9V7J3_MONBE/330-359-----------------------------------------------------------------------------A-L
A9V7J3_MONBE/402-431-----------------------------------------------------------------------------R-L
B3LYL3_DROAN/28-57-----------------------------------------------------------------------------D-L
A0E0C2_PARTE/300-329-----------------------------------------------------------------------------D-I
C3YDW3_BRAFL/85-114-----------------------------------------------------------------------------E-I
Q0IEY6_AEDAE/74-103-----------------------------------------------------------------------------R-L
Q0IEY6_AEDAE/240-270-----------------------------------------------------------------------------H-E
A9VBL4_MONBE/184-215-----------------------------------------------------------------------------L-V
A0E3X2_PARTE/219-248-----------------------------------------------------------------------------S-L
MYL6B_HUMAN/145-174-----------------------------------------------------------------------------D-Y
Q7QCU7_ANOGA/79-109-----------------------------------------------------------------------------E-L
Q7QCU7_ANOGA/211-241-----------------------------------------------------------------------------L-V
D0NI99_PHYIT/995-1024-----------------------------------------------------------------------------L-L
D0NZK1_PHYIT/776-806-----------------------------------------------------------------------------V-L
C1FGB5_MICCC/2004-2033-----------------------------------------------------------------------------E-L
C1FGB5_MICCC/2077-2106-----------------------------------------------------------------------------A-L
C1FGB5_MICCC/2208-2238-----------------------------------------------------------------------------D-V
D3AYI6_POLPP/6-35-----------------------------------------------------------------------------Q-I
D3AYI6_POLPP/79-108-----------------------------------------------------------------------------E-M
A2ERW3_TRIVA/9-39-----------------------------------------------------------------------------A-I
A2ERW3_TRIVA/82-111-----------------------------------------------------------------------------Q-Y
A7RV39_NEMVE/88-117-----------------------------------------------------------------------------Y-F
A2DT12_TRIVA/7-37-----------------------------------------------------------------------------E-F
A2DT12_TRIVA/80-109-----------------------------------------------------------------------------L-T
A4UNW1_CHICK/97-126-----------------------------------------------------------------------------T-I
A2DIY5_TRIVA/14-43-----------------------------------------------------------------------------L-Y
A2DIY5_TRIVA/85-114-----------------------------------------------------------------------------E-L
A8N2E2_COPC7/129-158-----------------------------------------------------------------------------E-L
A0CCH5_PARTE/297-326-----------------------------------------------------------------------------D-F
A0BPZ4_PARTE/198-233-----------------------------------------------------------------------------V-A
B6K7R4_SCHJY/10-39-----------------------------------------------------------------------------E-M
B6K7R4_SCHJY/79-108-----------------------------------------------------------------------------E-F
C3YGP7_BRAFL/22-51-----------------------------------------------------------------------------K-I
Q240Z1_TETTS/371-400-----------------------------------------------------------------------------S-L
Q240Z1_TETTS/445-474-----------------------------------------------------------------------------K-I
C3ZWG8_BRAFL/29-59-----------------------------------------------------------------------------R-V
Q7T2F7_DANRE/113-143-----------------------------------------------------------------------------K-L
B4LIU4_DROVI/12-41-----------------------------------------------------------------------------E-L
B4LIU4_DROVI/85-114-----------------------------------------------------------------------------N-L
A0C7B9_PARTE/44-73-----------------------------------------------------------------------------R-V
A0C7B9_PARTE/522-551-----------------------------------------------------------------------------R-I
D0NQW3_PHYIT/447-476-----------------------------------------------------------------------------D-A
B4KPB2_DROMO/13-42-----------------------------------------------------------------------------E-L
A7SK46_NEMVE/37-66-----------------------------------------------------------------------------L-F
A7SK46_NEMVE/105-134-----------------------------------------------------------------------------I-I
A7S7W7_NEMVE/508-546-----------------------------------------------------------------------------T-L
A7S7W7_NEMVE/583-612-----------------------------------------------------------------------------K-W
A9SC48_PHYPA/64-94-----------------------------------------------------------------------------A-L
A9SC48_PHYPA/138-175-----------------------------------------------------------------------------K-I
Q4N995_THEPA/859-892-----------------------------------------------------------------------------S-L
B8PFW7_POSPM/47-76-----------------------------------------------------------------------------Q-F
B8CDF2_THAPS/17-48-----------------------------------------------------------------------------S-Y
A2EWU3_TRIVA/26-55-----------------------------------------------------------------------------E-L
A2EWU3_TRIVA/99-128-----------------------------------------------------------------------------D-L
B9S960_RICCO/440-471-----------------------------------------------------------------------------K-I
D0N3P0_PHYIT/23-52-----------------------------------------------------------------------------R-I
D0N3P0_PHYIT/102-131-----------------------------------------------------------------------------T-L
D0NIV0_PHYIT/360-387-----------------------------------------------------------------------------M-A
C4R6X4_KOMPG/24-55-----------------------------------------------------------------------------R-Y
B7PVC0_IXOSC/891-929-----------------------------------------------------------------------------K-F
A2F2K1_TRIVA/16-45-----------------------------------------------------------------------------S-F
A2F2K1_TRIVA/87-116-----------------------------------------------------------------------------E-L
B3DFQ1_DANRE/118-147-----------------------------------------------------------------------------R-W
Q4DBB8_TRYCC/35-64-----------------------------------------------------------------------------Q-L
Q4DBB8_TRYCC/108-137-----------------------------------------------------------------------------E-A
B6AAA3_CRYMR/149-179-----------------------------------------------------------------------------E-I
B8CB62_THAPS/13-42-----------------------------------------------------------------------------E-F
Q6CKI4_KLULA/78-107-----------------------------------------------------------------------------D-F
C5DMF9_LACTC/14-45-----------------------------------------------------------------------------R-F
A5DJ68_PICGU/64-95-----------------------------------------------------------------------------Y-C
A0CPY1_PARTE/103-143-----------------------------------------------------------------------------K-A
A8XS91_CAEBR/6-35-----------------------------------------------------------------------------D-C
A2DQT8_TRIVA/13-42-----------------------------------------------------------------------------N-Y
A2DQT8_TRIVA/83-112-----------------------------------------------------------------------------E-L
A0DCA4_PARTE/23-52-----------------------------------------------------------------------------K-C
A0BDG8_PARTE/301-330-----------------------------------------------------------------------------D-L
Q66HU4_DANRE/630-659-----------------------------------------------------------------------------Q-W
A9UUF1_MONBE/6-34-----------------------------------------------------------------------------R-L
C1EI49_MICCC/48-79-----------------------------------------------------------------------------F-L
B7PJB2_IXOSC/18-48-----------------------------------------------------------------------------F-L
B3M2P5_DROAN/85-114-----------------------------------------------------------------------------E-L
A8BSJ2_GIAIC/8-37-----------------------------------------------------------------------------R-C
A8XSA6_CAEBR/77-106-----------------------------------------------------------------------------E-F
CBPF_DICDI/13-45-----------------------------------------------------------------------------E-V
C8JQR9_CAEEL/144-173-----------------------------------------------------------------------------K-L
Q6FSJ6_CANGA/19-48-----------------------------------------------------------------------------K-L
A0BKS7_PARTE/17-46-----------------------------------------------------------------------------A-A
Q4DSH4_TRYCC/48-77-----------------------------------------------------------------------------E-A
B0WB65_CULQU/256-285-----------------------------------------------------------------------------R-K
A4I3F5_LEIIN/12-41-----------------------------------------------------------------------------F-F
A4I3F5_LEIIN/85-114-----------------------------------------------------------------------------E-V
A0BU82_PARTE/29-57-----------------------------------------------------------------------------E-L
Q755U9_ASHGO/14-45-----------------------------------------------------------------------------R-H
A8I1S7_CHLRE/186-215-----------------------------------------------------------------------------R-M
A4HZA9_LEIIN/84-113-----------------------------------------------------------------------------E-L
A0D306_PARTE/59-88-----------------------------------------------------------------------------E-V
Q4Q2P9_LEIMA/35-64-----------------------------------------------------------------------------S-F
A0E3G8_PARTE/176-205-----------------------------------------------------------------------------N-F
A9V0G9_MONBE/68-97-----------------------------------------------------------------------------A-I
A7AQR4_BABBO/777-815-----------------------------------------------------------------------------A-L
A7AQR4_BABBO/875-908-----------------------------------------------------------------------------S-L
A4HBM1_LEIBR/11-40-----------------------------------------------------------------------------R-A
A0CNQ7_PARTE/356-385-----------------------------------------------------------------------------S-L
A0CNQ7_PARTE/435-464-----------------------------------------------------------------------------R-I
A0A384KM72_PLAKH/94-123-----------------------------------------------------------------------------K-I
C3Y3X5_BRAFL/109-138-----------------------------------------------------------------------------E-F
C3Y3X5_BRAFL/178-207-----------------------------------------------------------------------------V-L
C5E2K8_LACTC/5-34-----------------------------------------------------------------------------T-Q
D0NMF2_PHYIT/62-91-----------------------------------------------------------------------------F-F
B9RGV3_RICCO/45-74-----------------------------------------------------------------------------R-I
A0DZF8_PARTE/406-435-----------------------------------------------------------------------------S-L
D0NPC8_PHYIT/30-59-----------------------------------------------------------------------------L-L
D3B753_POLPP/41-70-----------------------------------------------------------------------------K-Y
A7RJ54_NEMVE/73-101-----------------------------------------------------------------------------E-I
C3ZK54_BRAFL/145-176-----------------------------------------------------------------------------R-D
Q23CU0_TETTS/69-99-----------------------------------------------------------------------------I-Y
EFCB7_HUMAN/106-135-----------------------------------------------------------------------------E-L
A0A0D1DU76_USTMA/58-87-----------------------------------------------------------------------------G-F
A0BMA1_PARTE/125-154-----------------------------------------------------------------------------E-I
A7RI54_NEMVE/73-102-----------------------------------------------------------------------------Q-W
Q7RNY5_PLAYO/47-76-----------------------------------------------------------------------------N-L
A0A0K0JIC8_BRUMA/91-120-----------------------------------------------------------------------------E-M
A0NGM4_ANOGA/720-749-----------------------------------------------------------------------------K-W
A0CQY7_PARTE/181-210-----------------------------------------------------------------------------N-F
A2FZQ0_TRIVA/11-40-----------------------------------------------------------------------------K-Y
A2FZQ0_TRIVA/82-111-----------------------------------------------------------------------------Q-L
PLSI_BOVIN/15-46-----------------------------------------------------------------------------E-L
A0BVC0_PARTE/355-384-----------------------------------------------------------------------------K-L
A0BVC0_PARTE/444-473-----------------------------------------------------------------------------K-L
A0BLQ1_PARTE/56-85-----------------------------------------------------------------------------K-Y
A0BLQ1_PARTE/129-158-----------------------------------------------------------------------------Q-L
D3B3V9_POLPP/20-49-----------------------------------------------------------------------------K-L
C6WP87_ACTMD/55-86-----------------------------------------------------------------------------W-W
B0CEP3_ACAM1/69-106-----------------------------------------------------------------------------P-L
B4JQZ6_DROGR/12-41-----------------------------------------------------------------------------K-M
B4JQZ6_DROGR/95-124-----------------------------------------------------------------------------Q-F
B3RJS5_TRIAD/515-551-----------------------------------------------------------------------------A-F
B3RJS5_TRIAD/588-617-----------------------------------------------------------------------------S-W
Q236L3_TETTS/181-210-----------------------------------------------------------------------------N-F
A9UU69_MONBE/7-36-----------------------------------------------------------------------------D-I
A9UU69_MONBE/73-102-----------------------------------------------------------------------------E-T
B3SAM3_TRIAD/385-414-----------------------------------------------------------------------------R-L
D0N7S9_PHYIT/33-62-----------------------------------------------------------------------------L-M
B4J628_DROGR/30-59-----------------------------------------------------------------------------S-L
C5DUR9_ZYGRC/19-48-----------------------------------------------------------------------------R-L
B8CFT6_THAPS/84-113-----------------------------------------------------------------------------E-I
C3YER0_BRAFL/167-196-----------------------------------------------------------------------------S-F
A8X3X6_CAEBR/106-135-----------------------------------------------------------------------------Y-F
A0BXL7_PARTE/42-71-----------------------------------------------------------------------------N-L
A0BXL7_PARTE/114-145-----------------------------------------------------------------------------V-V
A0DNH6_PARTE/2304-2334-----------------------------------------------------------------------------D-L
A8XVF9_CAEBR/36-65-----------------------------------------------------------------------------R-L
A0D1H3_PARTE/66-95-----------------------------------------------------------------------------S-L
A0D1H3_PARTE/181-210-----------------------------------------------------------------------------Q-L
B7PU66_IXOSC/252-281-----------------------------------------------------------------------------Y-L
A9UV27_MONBE/2126-2155-----------------------------------------------------------------------------Q-I
B4L3F1_DROMO/11-40-----------------------------------------------------------------------------E-I
B3RIN1_TRIAD/205-233-----------------------------------------------------------------------------P-L
A0D218_PARTE/76-105-----------------------------------------------------------------------------Q-L
C1E207_MICCC/45-75-----------------------------------------------------------------------------R-L
Q6FMX6_CANGA/187-217-----------------------------------------------------------------------------I-A
A7AP31_BABBO/33-62-----------------------------------------------------------------------------E-V
A2ETB6_TRIVA/14-43-----------------------------------------------------------------------------E-L
Q6C7R0_YARLI/24-53-----------------------------------------------------------------------------S-Y
Q6C7R0_YARLI/130-160-----------------------------------------------------------------------------R-V
A7EII8_SCLS1/126-155-----------------------------------------------------------------------------E-W
B7Q3R8_IXOSC/111-140-----------------------------------------------------------------------------E-I
Q8SS75_ENCCU/23-52-----------------------------------------------------------------------------E-L
Q8SS75_ENCCU/92-121-----------------------------------------------------------------------------S-I
Q7RGT1_PLAYO/1340-1369-----------------------------------------------------------------------------Y-I
D0MWK2_PHYIT/425-454-----------------------------------------------------------------------------V-I
A0DI75_PARTE/65-94-----------------------------------------------------------------------------E-T
Q2R1L7_ORYSJ/123-154-----------------------------------------------------------------------------E-V
A2DMA5_TRIVA/14-43-----------------------------------------------------------------------------S-L
C4QYA1_KOMPG/220-250-----------------------------------------------------------------------------I-M
C4QYA1_KOMPG/287-316-----------------------------------------------------------------------------Y-W
A7SIU0_NEMVE/415-444-----------------------------------------------------------------------------R-V
A2EU49_TRIVA/304-333-----------------------------------------------------------------------------N-I
CPNS2_HUMAN/153-182-----------------------------------------------------------------------------K-W
Q4E300_TRYCC/191-222-----------------------------------------------------------------------------P-V
D0MRM4_PHYIT/32-61-----------------------------------------------------------------------------Q-M
Q6DG81_DANRE/12-43-----------------------------------------------------------------------------E-L
B4I7K3_DROSE/14-43-----------------------------------------------------------------------------K-I
C5DUA6_ZYGRC/18-49-----------------------------------------------------------------------------R-Y
A0CDJ6_PARTE/157-186-----------------------------------------------------------------------------S-V
A0CRT3_PARTE/42-71-----------------------------------------------------------------------------Q-I
A0CRT3_PARTE/115-144-----------------------------------------------------------------------------V-I
A7RPN5_NEMVE/525-553-----------------------------------------------------------------------------E-F
A7RPN5_NEMVE/596-627-----------------------------------------------------------------------------D-I
A7RMQ1_NEMVE/11-40-----------------------------------------------------------------------------E-L
A7RMQ1_NEMVE/82-111-----------------------------------------------------------------------------E-F
Q5CZ29_CRYPI/514-545-----------------------------------------------------------------------------N-L
Q2A943_DANRE/33-62-----------------------------------------------------------------------------Q-W
A7S688_NEMVE/8-37-----------------------------------------------------------------------------L-L
A7S688_NEMVE/84-113-----------------------------------------------------------------------------S-V
D0NHY4_PHYIT/209-239-----------------------------------------------------------------------------R-L
Q4U8S4_THEAN/16-45-----------------------------------------------------------------------------L-I
C1FIV9_MICCC/85-114-----------------------------------------------------------------------------T-M
EFC13_HUMAN/456-485-----------------------------------------------------------------------------T-L
Q4SJD6_TETNG/29-56-----------------------------------------------------------------------------V-L
E8RNE1_ASTEC/46-76-----------------------------------------------------------------------------E-I
A0DCS1_PARTE/72-101-----------------------------------------------------------------------------E-L
Q9EMH8_AMEPV/24-53-----------------------------------------------------------------------------N-I
A0CH88_PARTE/390-419-----------------------------------------------------------------------------S-L
A0CH88_PARTE/696-725-----------------------------------------------------------------------------N-I
C4R1V0_KOMPG/25-54-----------------------------------------------------------------------------K-L
A7SHW4_NEMVE/108-138-----------------------------------------------------------------------------K-V
D0MWI5_PHYIT/661-691-----------------------------------------------------------------------------H-V
C3YCK9_BRAFL/241-275-----------------------------------------------------------------------------M-L
B3MPK2_DROAN/57-86-----------------------------------------------------------------------------E-L
D2VTY7_NAEGR/97-134-----------------------------------------------------------------------------L-L
Q6BFU2_PARTE/195-224-----------------------------------------------------------------------------L-A
B5Y4Q9_PHATC/8-42-----------------------------------------------------------------------------D-L
B5Y4Q9_PHATC/86-115-----------------------------------------------------------------------------E-I
B7QKE4_IXOSC/612-641-----------------------------------------------------------------------------Q-Y
Q0V5Q9_PHANO/214-243-----------------------------------------------------------------------------S-M
Q4DIV1_TRYCC/166-195-----------------------------------------------------------------------------A-I
Q7Q4L8_ANOGA/103-139-----------------------------------------------------------------------------K-A
A8XE93_CAEBR/628-657-----------------------------------------------------------------------------K-A
A7RJ83_NEMVE/514-548-----------------------------------------------------------------------------E-F
A7RJ83_NEMVE/585-614-----------------------------------------------------------------------------K-W
A4HWJ1_LEIIN/25-54-----------------------------------------------------------------------------E-W
A2EBQ1_TRIVA/14-43-----------------------------------------------------------------------------T-L
A2EBQ1_TRIVA/84-113-----------------------------------------------------------------------------E-L
Q4D662_TRYCC/188-217-----------------------------------------------------------------------------Q-I
Q4D662_TRYCC/269-298-----------------------------------------------------------------------------E-A
A0EFA3_PARTE/319-348-----------------------------------------------------------------------------G-L
Q8SRF8_ENCCU/100-129-----------------------------------------------------------------------------R-I
B8BV66_THAPS/328-359-----------------------------------------------------------------------------G-L
A7SIU1_NEMVE/364-393-----------------------------------------------------------------------------R-A
D0NLH6_PHYIT/779-808-----------------------------------------------------------------------------E-I
C1MVN8_MICPC/105-141-----------------------------------------------------------------------------K-I
A0BWN9_PARTE/584-613-----------------------------------------------------------------------------N-I
A0DZH6_PARTE/32-61-----------------------------------------------------------------------------E-L
Q5CTT5_CRYPI/66-93-----------------------------------------------------------------------------I-L
A0C693_PARTE/354-383-----------------------------------------------------------------------------K-L
A7SZ62_NEMVE/480-509-----------------------------------------------------------------------------R-L
C1MZG1_MICPC/117-146-----------------------------------------------------------------------------E-I
Q4DZ37_TRYCC/328-358-----------------------------------------------------------------------------V-L
B3RKL5_TRIAD/438-467-----------------------------------------------------------------------------R-I
A2Q7S2_ASPNC/15-46-----------------------------------------------------------------------------E-L
C1E2H7_MICCC/61-97-----------------------------------------------------------------------------G-L
C1FI51_MICCC/18-54-----------------------------------------------------------------------------K-I
B8MY97_ASPFN/34-63-----------------------------------------------------------------------------H-R
B3S580_TRIAD/58-91-----------------------------------------------------------------------------M-V
D0N582_PHYIT/1409-1438-----------------------------------------------------------------------------Q-L
B7G8H4_PHATC/377-408-----------------------------------------------------------------------------N-L
A0E9E9_PARTE/44-75-----------------------------------------------------------------------------I-V
A7RMQ2_NEMVE/10-39-----------------------------------------------------------------------------E-F
A7RMQ2_NEMVE/82-111-----------------------------------------------------------------------------D-F
B6AAT1_CRYMR/92-121-----------------------------------------------------------------------------E-L
Q1DGU0_AEDAE/85-114-----------------------------------------------------------------------------M-L
C4VC48_NOSCE/64-95-----------------------------------------------------------------------------F-V
D0N398_PHYIT/276-305-----------------------------------------------------------------------------Y-L
A0A0D1CVJ0_USTMA/739-769-----------------------------------------------------------------------------E-L
EFCB9_HUMAN/28-56-----------------------------------------------------------------------------A-L
A4HY14_LEIIN/110-138-----------------------------------------------------------------------------Y-Y
A0BNY1_PARTE/42-71-----------------------------------------------------------------------------M-M
A0A0J9Y6X5_BRUMA/121-151-----------------------------------------------------------------------------K-L
CEX1_CAEEL/29-68-----------------------------------------------------------------------------K-W
A7SPN7_NEMVE/582-611-----------------------------------------------------------------------------Y-Y
A4FU16_HUMAN/38-67-----------------------------------------------------------------------------H-W
C3YAW3_BRAFL/215-244-----------------------------------------------------------------------------R-L
D2V6N0_NAEGR/12-41-----------------------------------------------------------------------------Q-F
D2V6N0_NAEGR/215-245-----------------------------------------------------------------------------N-M
Q5CUC1_CRYPI/325-356-----------------------------------------------------------------------------K-I
D2VL69_NAEGR/86-115-----------------------------------------------------------------------------Q-L
B8BVX2_THAPS/190-219-----------------------------------------------------------------------------A-I
A2FS38_TRIVA/86-115-----------------------------------------------------------------------------E-I
A9V750_MONBE/19-48-----------------------------------------------------------------------------Q-I
A2FHL4_TRIVA/83-112-----------------------------------------------------------------------------Q-Y
A9FD96_SORC5/187-216-----------------------------------------------------------------------------F-A
Q6BG59_PARTE/363-394-----------------------------------------------------------------------------E-I
A0DQE8_PARTE/49-78-----------------------------------------------------------------------------V-I
A2DGG1_TRIVA/1002-1031-----------------------------------------------------------------------------E-F
C3YFC2_BRAFL/86-117-----------------------------------------------------------------------------R-I
A9VC94_MONBE/198-229-----------------------------------------------------------------------------F-A
Q4UF53_THEAN/443-471-----------------------------------------------------------------------------E-V
A8XPA0_CAEBR/61-90-----------------------------------------------------------------------------E-V
A2FQM2_TRIVA/14-43-----------------------------------------------------------------------------E-V
A7RTI1_NEMVE/216-246-----------------------------------------------------------------------------D-M
B6AJS6_CRYMR/55-84-----------------------------------------------------------------------------R-F
A0D0W9_PARTE/274-302-----------------------------------------------------------------------------N-L
A2E466_TRIVA/79-108-----------------------------------------------------------------------------E-L
C1N3J2_MICPC/18-47-----------------------------------------------------------------------------M-L
D2VIE2_NAEGR/8-38-----------------------------------------------------------------------------D-I
Q7QIB4_ANOGA/279-317-----------------------------------------------------------------------------K-L
Q8T5H8_ANOGA/12-41-----------------------------------------------------------------------------K-A
D0N994_PHYIT/33-63-----------------------------------------------------------------------------L-L
C1MU07_MICPC/540-583-----------------------------------------------------------------------------E-M
B0XJB8_CULQU/36-75-----------------------------------------------------------------------------Q-F
D0MVE6_PHYIT/210-253-----------------------------------------------------------------------------L-M
Q5CPW8_CRYPI/89-118-----------------------------------------------------------------------------D-A
Q6NYK0_DANRE/29-57-----------------------------------------------------------------------------K-L
D4AID5_ARTBC/715-746-----------------------------------------------------------------------------F-L
O97201_LEIMA/270-300-----------------------------------------------------------------------------Q-L
B3M0N0_DROAN/117-151-----------------------------------------------------------------------------K-L
A9UXC0_MONBE/17-46-----------------------------------------------------------------------------L-L
A2F622_TRIVA/94-129-----------------------------------------------------------------------------F-I
CAN11_RAT/548-584-----------------------------------------------------------------------------N-S
B4QEJ5_DROSI/103-132-----------------------------------------------------------------------------K-I
D3ZRP1_RAT/120-151-----------------------------------------------------------------------------G-L
B4MVV8_DROWI/30-59-----------------------------------------------------------------------------R-I
A2FJN7_TRIVA/18-47-----------------------------------------------------------------------------E-A
B6AIK9_CRYMR/17-46-----------------------------------------------------------------------------A-V
A9UQV7_MONBE/115-144-----------------------------------------------------------------------------R-A
B9R7E2_RICCO/18-47-----------------------------------------------------------------------------E-F
A0E9R2_PARTE/21-50-----------------------------------------------------------------------------K-I
D0N6S6_PHYIT/203-232-----------------------------------------------------------------------------N-A
Q4Q156_LEIMA/33-65-----------------------------------------------------------------------------R-I
A7RPN6_NEMVE/2-31-----------------------------------------------------------------------------E-F
A4H5I7_LEIBR/177-206-----------------------------------------------------------------------------K-L
C1ECT5_MICCC/271-300-----------------------------------------------------------------------------T-P
A9V6X3_MONBE/1141-1170-----------------------------------------------------------------------------E-M
C3ZP66_BRAFL/54-83-----------------------------------------------------------------------------S-S
C0H4A2_PLAF7/13-41-----------------------------------------------------------------------------E-I
A9VBY6_MONBE/239-268-----------------------------------------------------------------------------W-L
D2UXJ1_NAEGR/416-444-----------------------------------------------------------------------------Y-F
B4MM19_DROWI/36-65-----------------------------------------------------------------------------T-I
Q4DRI4_TRYCC/49-79-----------------------------------------------------------------------------R-R
B3S1G2_TRIAD/152-183-----------------------------------------------------------------------------K-I
CIB4_MOUSE/101-132-----------------------------------------------------------------------------K-I
C1EBS6_MICCC/387-416-----------------------------------------------------------------------------E-L
B4N916_DROWI/114-145-----------------------------------------------------------------------------K-M
Q8IE29_PLAF7/251-282-----------------------------------------------------------------------------K-A
CAN8_MOUSE/536-572-----------------------------------------------------------------------------H-F
A0BF71_PARTE/385-419-----------------------------------------------------------------------------Q-I
B0WSM1_CULQU/659-688-----------------------------------------------------------------------------Q-W
D2V5I4_NAEGR/35-64-----------------------------------------------------------------------------Q-A
CAN11_MOUSE/547-583-----------------------------------------------------------------------------D-S
A7RK77_NEMVE/68-97-----------------------------------------------------------------------------T-T
A0C4R5_PARTE/23-53-----------------------------------------------------------------------------D-L
Q4QBQ5_LEIMA/330-359-----------------------------------------------------------------------------R-F
B4LJI0_DROVI/124-155-----------------------------------------------------------------------------R-M
C3YQL6_BRAFL/328-359-----------------------------------------------------------------------------K-F
A0C1C8_PARTE/336-372-----------------------------------------------------------------------------Q-I
D0NH53_PHYIT/26-55-----------------------------------------------------------------------------D-L
RFIP3_DANRE/710-739-----------------------------------------------------------------------------A-L
A0DZK5_PARTE/70-97-----------------------------------------------------------------------------Q-I
EFCB3_BOVIN/51-80-----------------------------------------------------------------------------A-F
C1EDZ9_MICCC/29-59-----------------------------------------------------------------------------S-T
C1N631_MICPC/47-78-----------------------------------------------------------------------------F-L
C1MXG3_MICPC/631-660-----------------------------------------------------------------------------Q-V
Q6DFZ8_DANRE/606-635-----------------------------------------------------------------------------L-F
B9RD69_RICCO/210-239-----------------------------------------------------------------------------E-L
Q4DDH8_TRYCC/10-40-----------------------------------------------------------------------------D-I
A0CSU8_PARTE/30-61-----------------------------------------------------------------------------S-L
A2CE70_DANRE/30-58-----------------------------------------------------------------------------R-L
A7SHJ6_NEMVE/330-359-----------------------------------------------------------------------------G-I
A0C9U0_PARTE/401-432-----------------------------------------------------------------------------N-I
A0CIN3_PARTE/412-441-----------------------------------------------------------------------------M-A
A7RLF8_NEMVE/106-135-----------------------------------------------------------------------------M-M
C3ZDD3_BRAFL/389-419-----------------------------------------------------------------------------E-H
A8X343_CAEBR/192-230-----------------------------------------------------------------------------K-L
B3RJJ4_TRIAD/113-142-----------------------------------------------------------------------------A-A
A7T7P5_NEMVE/35-64-----------------------------------------------------------------------------E-L
Q8STQ3_ENCCU/76-105-----------------------------------------------------------------------------E-L
Q6FSU4_CANGA/603-632-----------------------------------------------------------------------------F-L
D0NT24_PHYIT/227-256-----------------------------------------------------------------------------R-M
Q5ZJB5_CHICK/68-103-----------------------------------------------------------------------------E-L
Q4CS95_TRYCC/33-65-----------------------------------------------------------------------------K-L
Q00WG8_OSTTA/33-61-----------------------------------------------------------------------------A-L
RASEF_XENTR/9-38-----------------------------------------------------------------------------R-L
Q6TXM2_STRPU/582-611-----------------------------------------------------------------------------S-L
D2VGQ0_NAEGR/231-261-----------------------------------------------------------------------------Y-L
D0MVJ8_PHYIT/2641-2670-----------------------------------------------------------------------------D-V
A9V7D4_MONBE/231-262-----------------------------------------------------------------------------L-A
B7G332_PHATC/130-165-----------------------------------------------------------------------------L-M
B3S581_TRIAD/59-96-----------------------------------------------------------------------------M-N
B0CNF8_LACBS/51-83-----------------------------------------------------------------------------D-I
A0E1J3_PARTE/38-73-----------------------------------------------------------------------------V-A
D3BGC9_POLPP/56-86-----------------------------------------------------------------------------A-L
C1N8S9_MICPC/55-85-----------------------------------------------------------------------------G-I
B3RSL0_TRIAD/112-148-----------------------------------------------------------------------------K-A
C1MSB0_MICPC/627-658-----------------------------------------------------------------------------A-A
C3YY99_BRAFL/15-44-----------------------------------------------------------------------------L-F
B8C8A3_THAPS/287-317-----------------------------------------------------------------------------L-L
D7AV60_NOCDD/14-45-----------------------------------------------------------------------------E-A
A8Q891_MALGO/17-46-----------------------------------------------------------------------------Q-L
B7G8B5_PHATC/86-115-----------------------------------------------------------------------------N-M
A4I9Q9_LEIIN/181-211-----------------------------------------------------------------------------A-V
C6KTA8_PLAF7/77-106-----------------------------------------------------------------------------G-L
A0CSB1_PARTE/153-182-----------------------------------------------------------------------------N-V
B9PLU7_TOXGV/4-33-----------------------------------------------------------------------------N-L
Q4DPM5_TRYCC/184-213-----------------------------------------------------------------------------R-I
B8LD33_THAPS/828-857-----------------------------------------------------------------------------I-F
C1MUU0_MICPC/12-42-----------------------------------------------------------------------------Q-M
C3YUG8_BRAFL/425-454-----------------------------------------------------------------------------M-H
Q4U8G1_THEAN/76-105-----------------------------------------------------------------------------N-L
A7SXZ3_NEMVE/9-37-----------------------------------------------------------------------------I-F
Q8IJ97_PLAF7/12-41-----------------------------------------------------------------------------L-F
A0BF28_PARTE/345-376-----------------------------------------------------------------------------A-M
Q4E2K6_TRYCC/617-646-----------------------------------------------------------------------------R-F
Q4E1U1_TRYCC/7-40-----------------------------------------------------------------------------A-L
A0C5R3_PARTE/309-338-----------------------------------------------------------------------------S-I
A0ED28_PARTE/72-103-----------------------------------------------------------------------------E-I
D2VR29_NAEGR/607-636-----------------------------------------------------------------------------K-F
B8BSH1_THAPS/111-142-----------------------------------------------------------------------------L-L
Q5KAJ1_CRYNJ/665-697-----------------------------------------------------------------------------L-I
C3YDH3_BRAFL/26-58-----------------------------------------------------------------------------E-L
B3S2Z7_TRIAD/64-96-----------------------------------------------------------------------------E-K
A2DPY5_TRIVA/83-112-----------------------------------------------------------------------------E-L
A0D7T4_PARTE/77-106-----------------------------------------------------------------------------E-L
A0DSQ2_PARTE/47-76-----------------------------------------------------------------------------D-L
C1FHF3_MICCC/35-68-----------------------------------------------------------------------------Q-A
A0BCE1_PARTE/120-149-----------------------------------------------------------------------------L-L
B7FPG8_PHATC/98-128-----------------------------------------------------------------------------R-A
C3XQZ6_BRAFL/437-468-----------------------------------------------------------------------------R-L
Q22DM3_TETTS/41-68-----------------------------------------------------------------------------R-L
C7YTC4_NECH7/525-554-----------------------------------------------------------------------------F-W
D3BH77_POLPP/977-1008-----------------------------------------------------------------------------Q-Y
B7PAY1_IXOSC/102-130-----------------------------------------------------------------------------V-I
A8WRH5_CAEBR/109-138-----------------------------------------------------------------------------Y-A
CAN11_HUMAN/571-609-----------------------------------------------------------------------------D-F
D0MUI2_PHYIT/445-475-----------------------------------------------------------------------------T-I
A0BTT3_PARTE/62-91-----------------------------------------------------------------------------E-L
A0DVD9_PARTE/23-52-----------------------------------------------------------------------------D-I
C3ZDD2_BRAFL/477-508-----------------------------------------------------------------------------H-H
B8BTK8_THAPS/174-205-----------------------------------------------------------------------------R-E
B8CFD8_THAPS/313-348-----------------------------------------------------------------------------D-L
A2AB62_MOUSE/109-138-----------------------------------------------------------------------------A-F
C3Y3L2_BRAFL/18-48-----------------------------------------------------------------------------M-A
A0EAZ9_PARTE/45-80-----------------------------------------------------------------------------V-A
D3BHC5_POLPP/246-276-----------------------------------------------------------------------------T-L
CDPKP_ARATH/437-466-----------------------------------------------------------------------------E-L
B9R7D2_RICCO/19-48-----------------------------------------------------------------------------Q-M
B3RQP5_TRIAD/251-279-----------------------------------------------------------------------------R-F
C3YEV6_BRAFL/628-656-----------------------------------------------------------------------------R-Y
A1CBB6_ASPCL/49-87-----------------------------------------------------------------------------S-F
C3Z5Z5_BRAFL/533-562-----------------------------------------------------------------------------D-I
D0NH29_PHYIT/57-87-----------------------------------------------------------------------------R-M
B7XIJ8_ENTBH/72-101-----------------------------------------------------------------------------N-I
A0DMG4_PARTE/351-381-----------------------------------------------------------------------------Y-L
C3YV00_BRAFL/85-114-----------------------------------------------------------------------------L-A
B7FUB0_PHATC/1084-1115-----------------------------------------------------------------------------L-L
C3ZH49_BRAFL/1174-1204-----------------------------------------------------------------------------K-F
A7RK79_NEMVE/188-218-----------------------------------------------------------------------------T-T
B3S1A6_TRIAD/67-96-----------------------------------------------------------------------------E-L
Q29IA0_DROPS/39-68-----------------------------------------------------------------------------N-L
A4S9A6_OSTLU/2128-2162-----------------------------------------------------------------------------P--
A0CCU0_PARTE/82-111-----------------------------------------------------------------------------N-F
B7Q350_IXOSC/1399-1442-----------------------------------------------------------------------------D-F
C1MT69_MICPC/45-75-----------------------------------------------------------------------------S-F
A9URG6_MONBE/582-611-----------------------------------------------------------------------------R-A
B7PQS4_IXOSC/34-61-----------------------------------------------------------------------------K-A
A0BSR5_PARTE/180-209-----------------------------------------------------------------------------L-L
A0BM15_PARTE/63-92-----------------------------------------------------------------------------E-L
Q4E142_TRYCC/257-286-----------------------------------------------------------------------------A-D
A0A384KRL6_PLAKH/13-41-----------------------------------------------------------------------------E-I
B8C031_THAPS/320-349-----------------------------------------------------------------------------L-L
A8XF67_CAEBR/57-86-----------------------------------------------------------------------------K-F
Q38C77_TRYB2/16-45-----------------------------------------------------------------------------D-L
Q4U910_THEAN/477-506-----------------------------------------------------------------------------E-L
B7PG89_IXOSC/60-90-----------------------------------------------------------------------------W-W
B8NHB5_ASPFN/61-89-----------------------------------------------------------------------------D-F
C3ZYS2_BRAFL/1605-1634-----------------------------------------------------------------------------K-S
A9VCA0_MONBE/80-109-----------------------------------------------------------------------------D-V
A7SIS2_NEMVE/98-139-----------------------------------------------------------------------------G-I
B0DIL9_LACBS/626-655-----------------------------------------------------------------------------F-I
C7G032_DICDI/508-537-----------------------------------------------------------------------------L-L
A0EAP2_PARTE/324-354-----------------------------------------------------------------------------S-M
A8P2X2_COPC7/487-516-----------------------------------------------------------------------------F-W
A0DU71_PARTE/549-578-----------------------------------------------------------------------------L-A
Q8LKK4_CHLRE/572-601-----------------------------------------------------------------------------A-V
Q54E45_DICDI/138-166-----------------------------------------------------------------------------Q-L
A0ECX0_PARTE/269-298-----------------------------------------------------------------------------D-L
Q4DLY4_TRYCC/95-128-----------------------------------------------------------------------------V-I
B7Q8D4_IXOSC/82-118-----------------------------------------------------------------------------T-V
D0N3C9_PHYIT/174-204-----------------------------------------------------------------------------E-I
A9V4G2_MONBE/147-180-----------------------------------------------------------------------------W-I
A9UU76_MONBE/93-122-----------------------------------------------------------------------------T-L
CGRE1_MOUSE/75-112-----------------------------------------------------------------------------V-L
D0NLT0_PHYIT/68-97-----------------------------------------------------------------------------L-S
A5KCC4_PLAVS/562-593-----------------------------------------------------------------------------F-L
Q54EU2_DICDI/187-217-----------------------------------------------------------------------------V-L
A8WXW8_CAEBR/591-622-----------------------------------------------------------------------------Q-I
A0A0D1DQL2_USTMA/20-49-----------------------------------------------------------------------------G-L
A2EYC2_TRIVA/29-61-----------------------------------------------------------------------------K-L
A0DQ90_PARTE/27-67-----------------------------------------------------------------------------R-I
D0NB87_PHYIT/1035-1065-----------------------------------------------------------------------------R-L
B6K3A4_SCHJY/20-48-----------------------------------------------------------------------------T-L
C4Y9V5_CLAL4/13-44-----------------------------------------------------------------------------Q-V
Q2H4R6_CHAGB/754-784-----------------------------------------------------------------------------F-L
A7SHV8_NEMVE/147-177-----------------------------------------------------------------------------G-I
A4I027_LEIIN/173-200-----------------------------------------------------------------------------K-I
B3MG51_DROAN/125-154-----------------------------------------------------------------------------K-M
EFCB8_MOUSE/115-143-----------------------------------------------------------------------------D-L
A5K8W6_PLAVS/148-177-----------------------------------------------------------------------------E-L
B8LWL3_TALSN/221-250-----------------------------------------------------------------------------E-I
C4LT56_ENTHI/7-35-------------------------------------------------------------------------------I
C4LUQ9_ENTHI/16-43-----------------------------------------------------------------------------E-L
F1R647_DANRE/83-111-------------------------------------------------------------------------------M
G3HZP5_CRIGR/33-62-----------------------------------------------------------------------------E-F
H0ZMF4_TAEGU/54-83-----------------------------------------------------------------------------D-F
H3CP38_TETNG/179-208-------------------------------------------------------------------------------M
I1LLG5_SOYBN/78-108-----------------------------------------------------------------------------D-L
M9MSK2_DROME/7-36-----------------------------------------------------------------------------Y-L
Q236J2_TETTS/59-87-----------------------------------------------------------------------------E-I
Q38AA2_TRYB2/25-54-----------------------------------------------------------------------------D-I
Q38EV6_TRYB2/74-103-----------------------------------------------------------------------------D-L
CML9_ORYSJ/91-119-------------------------------------------------------------------------------L
Q8LHQ5_ORYSJ/28-57-----------------------------------------------------------------------------R-F

PF00036

CAYP1_HUMAN/111-139-----------------------------------------------------------------------------G-L
S10AC_RABIT/53-81-----------------------------------------------------------------------------T-V
UCP8_SCHPO/337-365-----------------------------------------------------------------------------E-L
RPTN_MOUSE/53-81-----------------------------------------------------------------------------T-V
2AB2E_ARATH/385-413-----------------------------------------------------------------------------S-L
RBOHE_ARATH/272-300-----------------------------------------------------------------------------R-L
CALM4_ARATH/48-76-----------------------------------------------------------------------------E-L
CALM4_ARATH/85-113-----------------------------------------------------------------------------E-L
CALM4_ARATH/121-149-----------------------------------------------------------------------------E-V
YLJ5_CAEEL/51-79-----------------------------------------------------------------------------K-V
YLJ5_CAEEL/87-115-----------------------------------------------------------------------------V-V
DGK3_CAEEL/174-202-----------------------------------------------------------------------------K-L
DGK3_CAEEL/219-247-----------------------------------------------------------------------------V-I
Q21408_CAEEL/2329-2357-----------------------------------------------------------------------------E-F
END3_EMENI/46-74-----------------------------------------------------------------------------Q-L
EP15R_MOUSE/276-304-----------------------------------------------------------------------------R-F
Q94288_CAEEL/100-128-----------------------------------------------------------------------------E-F
Q94288_CAEEL/136-164-----------------------------------------------------------------------------Q-M
Q94288_CAEEL/172-200-----------------------------------------------------------------------------M-I
CAN9_MOUSE/595-623-----------------------------------------------------------------------------H-W
CABP1_HUMAN/343-370-----------------------------------------------------------------------------D-I
O16343_CAEEL/114-142-----------------------------------------------------------------------------K-L
O16343_CAEEL/155-183-----------------------------------------------------------------------------I-A
PLSL_HUMAN/13-41-----------------------------------------------------------------------------E-L
PLSL_HUMAN/53-81-----------------------------------------------------------------------------I-T
DGKG_HUMAN/179-207-----------------------------------------------------------------------------K-L
DGKG_HUMAN/224-252-----------------------------------------------------------------------------I-L
RYR2_HUMAN/4027-4055-----------------------------------------------------------------------------T-S
GPDM_HUMAN/627-655-----------------------------------------------------------------------------R-Y
GPDM_HUMAN/663-691-----------------------------------------------------------------------------T-L
DGKA_HUMAN/114-142-----------------------------------------------------------------------------K-L
DGKA_HUMAN/159-187-----------------------------------------------------------------------------I-L
Q93640_CAEEL/121-149-----------------------------------------------------------------------------K-L
Q93640_CAEEL/162-190-----------------------------------------------------------------------------I-I
ITSN2_MOUSE/58-86-----------------------------------------------------------------------------V-L
ITSN2_MOUSE/282-310-----------------------------------------------------------------------------Q-L
CALML_DICDI/10-38-----------------------------------------------------------------------------L-Y
CALML_DICDI/46-73-----------------------------------------------------------------------------E-L
CALML_DICDI/82-110-----------------------------------------------------------------------------D-I
CAM2_SCHPO/10-38-----------------------------------------------------------------------------E-M
CAM2_SCHPO/79-107-----------------------------------------------------------------------------E-Y
CAN9_HUMAN/565-593-----------------------------------------------------------------------------S-C
CAN9_HUMAN/595-623-----------------------------------------------------------------------------Q-W
PPE1_HUMAN/570-598-----------------------------------------------------------------------------D-L
PPE1_HUMAN/610-638-----------------------------------------------------------------------------Q-V
PPE2_HUMAN/572-600-----------------------------------------------------------------------------D-L
PPE2_HUMAN/656-684-----------------------------------------------------------------------------N-L
O16158_DROME/11-39-----------------------------------------------------------------------------L-L
O16158_DROME/62-90-----------------------------------------------------------------------------I-W
O16158_DROME/104-132-----------------------------------------------------------------------------Y-M
O18058_CAEEL/24-52-----------------------------------------------------------------------------E-F
O18058_CAEEL/60-88-----------------------------------------------------------------------------E-L
O18058_CAEEL/96-124-----------------------------------------------------------------------------L-I
O18058_CAEEL/132-160-----------------------------------------------------------------------------E-V
SCMC1_RABIT/23-51-----------------------------------------------------------------------------R-Y
SCMC1_RABIT/59-87-----------------------------------------------------------------------------A-E
SCMC1_RABIT/90-118-----------------------------------------------------------------------------K-M
CML5_ARATH/65-93-----------------------------------------------------------------------------E-L
CML5_ARATH/101-129-----------------------------------------------------------------------------D-L
CML5_ARATH/143-171-----------------------------------------------------------------------------D-M
CML5_ARATH/181-209-----------------------------------------------------------------------------G-C
Y1515_ARATH/10-38-----------------------------------------------------------------------------K-V
CML19_ARATH/27-55-----------------------------------------------------------------------------E-I
CML19_ARATH/63-91-----------------------------------------------------------------------------Q-I
CML19_ARATH/100-128-----------------------------------------------------------------------------E-L
CML19_ARATH/136-164-----------------------------------------------------------------------------D-I
CML8_ARATH/49-77-----------------------------------------------------------------------------E-L
PPE2_MOUSE/576-604-----------------------------------------------------------------------------D-L
PPE2_MOUSE/700-728-----------------------------------------------------------------------------G-I
ONCO_CAVPO/43-71-----------------------------------------------------------------------------Q-V
ONCO_CAVPO/82-109-----------------------------------------------------------------------------E-T
CALU_RAT/72-100-----------------------------------------------------------------------------K-L
CALU_RAT/108-136-----------------------------------------------------------------------------N-V
CHP2_HUMAN/115-143-----------------------------------------------------------------------------K-L
CHP2_HUMAN/156-184-----------------------------------------------------------------------------I-A
CALU_HUMAN/72-100-----------------------------------------------------------------------------R-L
CALU_HUMAN/192-220-----------------------------------------------------------------------------V-V
O45313_CAEEL/236-262-----------------------------------------------------------------------------R-A
GEM1_SCHPO/188-216-----------------------------------------------------------------------------A-L
GEM1_SCHPO/308-336-----------------------------------------------------------------------------F-L
FIMB_SCHPO/55-83-----------------------------------------------------------------------------E-V
CALM_KLULA/12-40-----------------------------------------------------------------------------E-F
CALM_KLULA/48-76-----------------------------------------------------------------------------E-V
CALM_KLULA/85-113-----------------------------------------------------------------------------E-L
CALM_KLULA/121-147-----------------------------------------------------------------------------E-V
O61604_DROME/18-46-----------------------------------------------------------------------------E-I
O64866_ARATH/24-52-----------------------------------------------------------------------------S-V
O64866_ARATH/73-101-----------------------------------------------------------------------------L-Y
CDC31_SCHPO/38-66-----------------------------------------------------------------------------D-I
CDC31_SCHPO/74-102-----------------------------------------------------------------------------E-V
CDC31_SCHPO/147-175-----------------------------------------------------------------------------E-L
CMC1_HUMAN/90-118-----------------------------------------------------------------------------M-F
CMC1_HUMAN/161-189-----------------------------------------------------------------------------H-A
CIB2_HUMAN/107-135-----------------------------------------------------------------------------K-A
CIB2_HUMAN/148-176-----------------------------------------------------------------------------V-C
SEGN_HUMAN/16-44-----------------------------------------------------------------------------G-F
SEGN_HUMAN/109-137-----------------------------------------------------------------------------E-F
SEGN_HUMAN/201-229-----------------------------------------------------------------------------D-F
SEGN_HUMAN/245-273-----------------------------------------------------------------------------F-R
O76670_CAEEL/18-46-----------------------------------------------------------------------------A-Q
O76670_CAEEL/50-78-----------------------------------------------------------------------------D-G
O76670_CAEEL/117-145-----------------------------------------------------------------------------I-I
O76670_CAEEL/158-186-----------------------------------------------------------------------------Q-A
O76670_CAEEL/195-223-----------------------------------------------------------------------------D-V
RBOHA_ARATH/225-253-----------------------------------------------------------------------------R-L
CNBL4_ARATH/75-103-----------------------------------------------------------------------------F-A
CNBL4_ARATH/112-140-----------------------------------------------------------------------------K-V
CNBL4_ARATH/156-184-----------------------------------------------------------------------------M-V
CNBL1_ARATH/71-99-----------------------------------------------------------------------------F-A
CNBL1_ARATH/108-136-----------------------------------------------------------------------------K-I
YC22_ARATH/388-416-----------------------------------------------------------------------------E-T
CML20_ARATH/100-128-----------------------------------------------------------------------------E-L
CML20_ARATH/136-164-----------------------------------------------------------------------------E-I
CABP1_RAT/157-185-----------------------------------------------------------------------------E-L
CABP1_RAT/234-262-----------------------------------------------------------------------------E-L
O93409_DANRE/30-58-----------------------------------------------------------------------------E-Y
RCN1_TAKRU/74-102-----------------------------------------------------------------------------R-L
RCN1_TAKRU/110-138-----------------------------------------------------------------------------N-V
RCN1_TAKRU/198-226-----------------------------------------------------------------------------V-V
YFFE_SCHPO/13-41-----------------------------------------------------------------------------E-A
FKBP9_HUMAN/492-520-----------------------------------------------------------------------------V-S
FKBP9_HUMAN/537-563-----------------------------------------------------------------------------I-V
GUC1C_HUMAN/56-84-----------------------------------------------------------------------------H-I
GUC1C_HUMAN/92-120-----------------------------------------------------------------------------K-L
GUC1C_HUMAN/134-162-----------------------------------------------------------------------------F-I
O96676_DROME/127-155-----------------------------------------------------------------------------K-M
O96676_DROME/249-277-----------------------------------------------------------------------------D-A
TNNC2_PIG/94-122-----------------------------------------------------------------------------E-L
TNNC2_CHICK/98-126-----------------------------------------------------------------------------E-L
CALMS_CHICK/121-149-----------------------------------------------------------------------------E-V
CALM_DICDI/87-115-----------------------------------------------------------------------------E-I
CALM_DICDI/123-151-----------------------------------------------------------------------------E-V
MLE1_CHICK/52-80-----------------------------------------------------------------------------D-F
MLE1_CHICK/129-157-----------------------------------------------------------------------------D-F
MYL6_CHICK/11-39-----------------------------------------------------------------------------E-F
MLRS_CHICK/28-56-----------------------------------------------------------------------------E-F
MLRA_CHICK/133-161-----------------------------------------------------------------------------E-I
MLRB_CHICK/97-125-----------------------------------------------------------------------------T-I
MLRM_CHICK/138-166-----------------------------------------------------------------------------E-V
PRVB_LATCH/42-70-----------------------------------------------------------------------------E-L
PRVA_LATCH/44-72-----------------------------------------------------------------------------T-L
PRVA_LATCH/83-111-----------------------------------------------------------------------------E-T
S100G_BOVIN/49-77-----------------------------------------------------------------------------T-L
S100B_BOVIN/53-81-----------------------------------------------------------------------------V-V
S10A1_BOVIN/54-82-----------------------------------------------------------------------------A-V
SPE1A_STRPU/14-42-----------------------------------------------------------------------------E-F
SPE1A_STRPU/50-78-----------------------------------------------------------------------------Q-I
SPE1A_STRPU/88-116-----------------------------------------------------------------------------H-Y
SPE2A_STRPU/14-42-----------------------------------------------------------------------------L-F
SPE2A_STRPU/50-78-----------------------------------------------------------------------------K-I
SPE2A_STRPU/122-150-----------------------------------------------------------------------------E-I
SPE2C_STRPU/50-76-----------------------------------------------------------------------------K-I
SPE2C_STRPU/85-113-----------------------------------------------------------------------------Q-Y
SPE2C_STRPU/122-150-----------------------------------------------------------------------------E-I
CALB1_CHICK/16-44-----------------------------------------------------------------------------Q-F
CALB1_CHICK/103-131-----------------------------------------------------------------------------D-F
CALB1_BOVIN/15-43-----------------------------------------------------------------------------Q-F
CALB1_BOVIN/102-130-----------------------------------------------------------------------------E-F
CALB1_BOVIN/146-174-----------------------------------------------------------------------------Y-T
CALB1_BOVIN/190-218-----------------------------------------------------------------------------E-F
CALL_CAEEL/25-53-----------------------------------------------------------------------------E-F
CALL_CAEEL/61-89-----------------------------------------------------------------------------E-I
CALL_CAEEL/97-125-----------------------------------------------------------------------------M-I
CALL_CAEEL/133-161-----------------------------------------------------------------------------E-V
ACTNA_DICDI/733-761-----------------------------------------------------------------------------E-F
ACTNA_DICDI/769-797-----------------------------------------------------------------------------Q-L
S10A8_HUMAN/50-78-----------------------------------------------------------------------------G-A
CALM_SCHPO/13-41-----------------------------------------------------------------------------E-F
CALM_SCHPO/86-114-----------------------------------------------------------------------------E-V
CALM_SCHPO/122-150-----------------------------------------------------------------------------E-V
CDC31_YEAST/24-52-----------------------------------------------------------------------------E-I
CDC31_YEAST/97-125-----------------------------------------------------------------------------E-I
CDC31_YEAST/133-161-----------------------------------------------------------------------------E-L
SPTA1_MOUSE/2271-2299-----------------------------------------------------------------------------E-F
SPTA1_MOUSE/2314-2342-----------------------------------------------------------------------------K-F
MLE_DICDI/7-35-----------------------------------------------------------------------------Q-I
MLE_DICDI/79-107-----------------------------------------------------------------------------E-M
S10A2_BOVIN/54-82-----------------------------------------------------------------------------G-L
CAYP1_CANLF/25-53-----------------------------------------------------------------------------G-L
CAYP1_CANLF/61-89-----------------------------------------------------------------------------E-A
CAYP1_CANLF/97-125-----------------------------------------------------------------------------V-I
PLCD1_BOVIN/144-172-----------------------------------------------------------------------------W-I
MLRV_HUMAN/98-126-----------------------------------------------------------------------------T-I
ACTN1_HUMAN/750-778-----------------------------------------------------------------------------E-F
ACTN1_HUMAN/791-819-----------------------------------------------------------------------------E-F
PDCD6_MOUSE/27-55-----------------------------------------------------------------------------F-L
PDCD6_MOUSE/94-122-----------------------------------------------------------------------------D-W
CPNS1_BOVIN/138-166-----------------------------------------------------------------------------T-C
CPNS1_BOVIN/168-196-----------------------------------------------------------------------------K-W
MRLCA_RAT/33-61-----------------------------------------------------------------------------E-F
MRLCA_RAT/102-130-----------------------------------------------------------------------------V-I
MLR_DICDI/24-52-----------------------------------------------------------------------------E-L
MLR_DICDI/60-88-----------------------------------------------------------------------------Q-L
MLR_DICDI/97-125-----------------------------------------------------------------------------I-L
SPE2D_STRPU/112-140-----------------------------------------------------------------------------K-I
SPTN1_RAT/2327-2355-----------------------------------------------------------------------------E-F
SPTN1_RAT/2370-2398-----------------------------------------------------------------------------E-F
ACTN_DROME/782-810-----------------------------------------------------------------------------E-F
ACTN_DROME/823-851-----------------------------------------------------------------------------D-F
MLR_DROME/79-107-----------------------------------------------------------------------------E-F
PLSI_CHICK/15-43-----------------------------------------------------------------------------E-L
PLSI_CHICK/55-83-----------------------------------------------------------------------------I-I
MLR1_CAEEL/28-56-----------------------------------------------------------------------------E-F
PRVT_CHICK/82-109-----------------------------------------------------------------------------E-T
CAN3_HUMAN/696-724-----------------------------------------------------------------------------S-C
FILA_HUMAN/53-81-----------------------------------------------------------------------------M-V
RECO_BOVIN/65-93-----------------------------------------------------------------------------Y-A
RECO_BOVIN/101-129-----------------------------------------------------------------------------K-L
TRHY_SHEEP/53-81-----------------------------------------------------------------------------T-V
S10AB_CHICK/58-86-----------------------------------------------------------------------------V-V
CML24_ARATH/17-45-----------------------------------------------------------------------------D-I
CML24_ARATH/53-81-----------------------------------------------------------------------------E-T
CML24_ARATH/94-122-----------------------------------------------------------------------------D-L
CML24_ARATH/130-158-----------------------------------------------------------------------------D-C
CML12_ARATH/12-40-----------------------------------------------------------------------------E-Y
CML12_ARATH/48-76-----------------------------------------------------------------------------D-L
CML12_ARATH/191-219-----------------------------------------------------------------------------E-F
CML12_ARATH/227-255-----------------------------------------------------------------------------E-L
CANB_YEAST/25-53-----------------------------------------------------------------------------R-L
CANB_YEAST/57-85-----------------------------------------------------------------------------L-A
CANB_YEAST/94-122-----------------------------------------------------------------------------K-L
CANB_YEAST/135-163-----------------------------------------------------------------------------I-V
S10AA_CHICK/51-79-----------------------------------------------------------------------------A-L
S10A8_MOUSE/50-78-----------------------------------------------------------------------------N-I
CALL3_HUMAN/48-76-----------------------------------------------------------------------------E-L
CALL3_HUMAN/121-149-----------------------------------------------------------------------------E-V
M126_CHICK/63-91-----------------------------------------------------------------------------S-I
CANB2_RAT/22-50-----------------------------------------------------------------------------R-L
CANB2_RAT/132-160-----------------------------------------------------------------------------L-V
CDPK_SOYBN/339-367-----------------------------------------------------------------------------G-L
CDPK_SOYBN/375-403-----------------------------------------------------------------------------E-I
CDPK_SOYBN/411-439-----------------------------------------------------------------------------N-L
CDPK_SOYBN/445-473-----------------------------------------------------------------------------H-I
GRAN_HUMAN/93-121-----------------------------------------------------------------------------T-C
GRAN_HUMAN/123-151-----------------------------------------------------------------------------A-W
S10A9_BOVIN/58-86-----------------------------------------------------------------------------A-I
CML10_ARATH/12-40-----------------------------------------------------------------------------E-F
CML10_ARATH/48-76-----------------------------------------------------------------------------E-L
CML10_ARATH/82-110-----------------------------------------------------------------------------D-L
CML10_ARATH/118-146-----------------------------------------------------------------------------E-I
CML35_ARATH/70-98-----------------------------------------------------------------------------E-L
CML35_ARATH/145-173-----------------------------------------------------------------------------E-L
CML35_ARATH/182-210-----------------------------------------------------------------------------E-C
YNE5_CAEEL/81-109-----------------------------------------------------------------------------E-M
YNE5_CAEEL/117-145-----------------------------------------------------------------------------D-F
S10A7_HUMAN/54-82-----------------------------------------------------------------------------Y-L
S10A9_MOUSE/59-87-----------------------------------------------------------------------------L-I
PLC1_YEAST/273-301-----------------------------------------------------------------------------Q-L
PAN1_YEAST/603-631-----------------------------------------------------------------------------L-F
PAN1_YEAST/637-665-----------------------------------------------------------------------------D-L
S10A5_HUMAN/51-79-----------------------------------------------------------------------------S-I
EDE1_YEAST/51-79-----------------------------------------------------------------------------L-L
EDE1_YEAST/171-199-----------------------------------------------------------------------------T-L
CBPP_DICDI/403-431-----------------------------------------------------------------------------A-A
CBPP_DICDI/439-467-----------------------------------------------------------------------------Q-T
S10A4_BOVIN/54-82-----------------------------------------------------------------------------A-F
ACTN2_HUMAN/757-785-----------------------------------------------------------------------------E-F
ACTN2_HUMAN/793-821-----------------------------------------------------------------------------E-F
NCS1_CAEEL/64-92-----------------------------------------------------------------------------F-A
NCS1_CAEEL/100-128-----------------------------------------------------------------------------K-L
NCS1_CAEEL/148-176-----------------------------------------------------------------------------R-V
NCS2_CAEEL/66-94-----------------------------------------------------------------------------F-C
NCS2_CAEEL/102-130-----------------------------------------------------------------------------K-L
NCS2_CAEEL/149-177-----------------------------------------------------------------------------R-A
FREQ_DROME/100-128-----------------------------------------------------------------------------K-L
FREQ_DROME/147-175-----------------------------------------------------------------------------R-V
TRHY_RABIT/53-81-----------------------------------------------------------------------------T-V
GEM1_YEAST/205-233-----------------------------------------------------------------------------A-L
GEM1_YEAST/334-362-----------------------------------------------------------------------------F-L
RDGC_DROME/445-473-----------------------------------------------------------------------------E-L
RDGC_DROME/530-558-----------------------------------------------------------------------------S-L
RDGC_DROME/570-598-----------------------------------------------------------------------------E-M
PLC1_SCHPO/334-362-----------------------------------------------------------------------------F-L
CAB32_DROME/39-67-----------------------------------------------------------------------------Q-F
CAB32_DROME/89-117-----------------------------------------------------------------------------L-K
CAB32_DROME/135-163-----------------------------------------------------------------------------E-F
CAB32_DROME/228-256-----------------------------------------------------------------------------D-I
MYL5_FELCA/34-62-----------------------------------------------------------------------------E-F
MYL5_FELCA/104-132-----------------------------------------------------------------------------T-I
CBPA_DICDI/8-36-----------------------------------------------------------------------------D-V
CBPA_DICDI/44-72-----------------------------------------------------------------------------A-A
CBPA_DICDI/84-112-----------------------------------------------------------------------------I-C
CBPA_DICDI/122-150-----------------------------------------------------------------------------I-V
EPS15_HUMAN/52-80-----------------------------------------------------------------------------I-L
EPS15_HUMAN/164-192-----------------------------------------------------------------------------I-L
EPS15_HUMAN/227-255-----------------------------------------------------------------------------K-Y
PRVU_CHICK/43-71-----------------------------------------------------------------------------Q-L
GUC1A_BOVIN/55-83-----------------------------------------------------------------------------Y-V
GUC1A_BOVIN/91-119-----------------------------------------------------------------------------K-L
GUC1A_BOVIN/135-163-----------------------------------------------------------------------------F-T
TNNC1_DROME/12-40-----------------------------------------------------------------------------L-L
TNNC1_DROME/48-76-----------------------------------------------------------------------------T-L
TNNC2_DROME/51-79-----------------------------------------------------------------------------I-L
TNNC2_DROME/91-119-----------------------------------------------------------------------------E-L
CANB1_DROME/22-50-----------------------------------------------------------------------------R-L
CANB1_DROME/54-82-----------------------------------------------------------------------------L-V
CANB1_DROME/91-119-----------------------------------------------------------------------------K-L
CANB1_DROME/132-160-----------------------------------------------------------------------------I-V
E631_DROME/39-67-----------------------------------------------------------------------------D-L
E631_DROME/131-159-----------------------------------------------------------------------------D-L
E631_DROME/167-193-----------------------------------------------------------------------------Q-L
CDPK2_MAIZE/370-398-----------------------------------------------------------------------------G-L
CDPK2_MAIZE/406-434-----------------------------------------------------------------------------E-V
CDPK2_MAIZE/442-470-----------------------------------------------------------------------------H-L
CDPK2_MAIZE/477-505-----------------------------------------------------------------------------T-I
CALL_DROME/11-39-----------------------------------------------------------------------------E-F
CALL_DROME/47-75-----------------------------------------------------------------------------E-L
CALL_DROME/84-112-----------------------------------------------------------------------------E-M
CALL_DROME/120-148-----------------------------------------------------------------------------E-I
DGKB_RAT/152-180-----------------------------------------------------------------------------K-L
DGKB_RAT/197-225-----------------------------------------------------------------------------I-L
CCH1_YEAST/1791-1819-----------------------------------------------------------------------------K-Y
S10A8_RAT/50-78-----------------------------------------------------------------------------N-T
GUC1B_BOVIN/60-88-----------------------------------------------------------------------------Y-V
GUC1B_BOVIN/96-124-----------------------------------------------------------------------------K-L
GUC1B_BOVIN/149-177-----------------------------------------------------------------------------V-V
PRVA_CAVPO/38-66-----------------------------------------------------------------------------E-V
ONCO_MOUSE/43-71-----------------------------------------------------------------------------Q-L
MLC1_YEAST/85-113-----------------------------------------------------------------------------D-F
GYP2_YEAST/642-670-----------------------------------------------------------------------------A-I
CDPKN_ORYSJ/413-440-----------------------------------------------------------------------------E-I
CDPKN_ORYSJ/448-476-----------------------------------------------------------------------------H-L
CDPKN_ORYSJ/482-510-----------------------------------------------------------------------------F-L
CDPK7_ORYSJ/384-412-----------------------------------------------------------------------------G-L
CDPK7_ORYSJ/490-518-----------------------------------------------------------------------------L-L
MLC2_DROME/11-39-----------------------------------------------------------------------------E-F
MLC2_DROME/84-112-----------------------------------------------------------------------------D-F
CBP2_DICDI/17-45-----------------------------------------------------------------------------D-L
CBP2_DICDI/92-120-----------------------------------------------------------------------------D-V
CBP2_DICDI/128-156-----------------------------------------------------------------------------I-T
CAF1_DICDI/10-38-----------------------------------------------------------------------------E-V
CAF1_DICDI/133-161-----------------------------------------------------------------------------S-A
FIMB_DICDI/11-39-----------------------------------------------------------------------------E-F
FIMB_DICDI/47-75-----------------------------------------------------------------------------E-V
CALM_EMENI/121-149-----------------------------------------------------------------------------E-V
NCS1_RAT/148-176-----------------------------------------------------------------------------R-V
VISL1_RAT/150-178-----------------------------------------------------------------------------R-V
CANB1_RAT/132-160-----------------------------------------------------------------------------I-V
TAL_SYNY3/356-384-----------------------------------------------------------------------------G-T
S10AC_BOVIN/53-81-----------------------------------------------------------------------------T-I
PRVA_FELCA/43-71-----------------------------------------------------------------------------D-I
PRVA_FELCA/82-110-----------------------------------------------------------------------------E-T
S10AC_PIG/53-81-----------------------------------------------------------------------------T-I
S10AC_HUMAN/53-81-----------------------------------------------------------------------------V-I
NUCB2_MOUSE/245-273-----------------------------------------------------------------------------D-P
NUCB2_MOUSE/297-325-----------------------------------------------------------------------------M-R
HPCA_RAT/64-92-----------------------------------------------------------------------------F-A
HPCA_RAT/100-128-----------------------------------------------------------------------------K-L
HPCA_RAT/148-176-----------------------------------------------------------------------------R-T
CANB_NEUCR/25-53-----------------------------------------------------------------------------R-L
CANB_NEUCR/57-85-----------------------------------------------------------------------------L-A
CANB_NEUCR/135-163-----------------------------------------------------------------------------I-V
GPDM_CAEEL/628-656-----------------------------------------------------------------------------R-A
GPDM_CAEEL/664-692-----------------------------------------------------------------------------V-L
P90802_CAEEL/57-85-----------------------------------------------------------------------------E-Y
P90802_CAEEL/93-121-----------------------------------------------------------------------------E-L
P90802_CAEEL/167-195-----------------------------------------------------------------------------I-I
P91423_CAEEL/51-79-----------------------------------------------------------------------------F-L
LETM1_DROME/691-719-----------------------------------------------------------------------------V-V
LETM1_DROME/774-802-----------------------------------------------------------------------------H-I
CDPKE_ARATH/359-387-----------------------------------------------------------------------------C-I
CDPKE_ARATH/395-423-----------------------------------------------------------------------------D-I
CDPKE_ARATH/431-459-----------------------------------------------------------------------------H-L
CDPKE_ARATH/467-495-----------------------------------------------------------------------------V-V
S100G_MOUSE/49-77-----------------------------------------------------------------------------T-L
MLRA_HUMAN/36-64-----------------------------------------------------------------------------E-F
MLRA_HUMAN/106-134-----------------------------------------------------------------------------A-I
NCS1_YEAST/64-92-----------------------------------------------------------------------------F-A
NCS1_YEAST/100-128-----------------------------------------------------------------------------K-L
NCS1_YEAST/148-176-----------------------------------------------------------------------------R-V
MLC2_YEAST/19-47-----------------------------------------------------------------------------K-L
CDPK1_ARATH/455-483-----------------------------------------------------------------------------G-L
CDPK1_ARATH/491-519-----------------------------------------------------------------------------E-I
CDPK1_ARATH/527-555-----------------------------------------------------------------------------H-L
CDPK1_ARATH/561-589-----------------------------------------------------------------------------R-I
TRHY_HUMAN/53-81-----------------------------------------------------------------------------T-V
ACTN3_HUMAN/764-792-----------------------------------------------------------------------------E-F
CAST_SOLTU/40-68-----------------------------------------------------------------------------R-L
CAST_SOLTU/129-157-----------------------------------------------------------------------------D-L
CAST_SOLTU/167-195-----------------------------------------------------------------------------R-V
MLR4_SCHPO/78-106-----------------------------------------------------------------------------E-F
MLRH_CAEEL/102-130-----------------------------------------------------------------------------V-I
NCS1_SCHPO/64-92-----------------------------------------------------------------------------F-A
NCS1_SCHPO/100-128-----------------------------------------------------------------------------K-L
NCS1_SCHPO/148-176-----------------------------------------------------------------------------R-V
Q09980_CAEEL/8-36-----------------------------------------------------------------------------E-I
Q09980_CAEEL/44-72-----------------------------------------------------------------------------K-I
Q09980_CAEEL/81-109-----------------------------------------------------------------------------E-L
Q09980_CAEEL/117-145-----------------------------------------------------------------------------E-A
CANA_DROME/703-731-----------------------------------------------------------------------------V-C
CANA_DROME/733-761-----------------------------------------------------------------------------K-W
YT67_CAEEL/52-80-----------------------------------------------------------------------------E-Y
YT67_CAEEL/88-116-----------------------------------------------------------------------------E-I
YT67_CAEEL/127-155-----------------------------------------------------------------------------L-I
YT67_CAEEL/162-190-----------------------------------------------------------------------------L-A
PKD2_HUMAN/754-782-----------------------------------------------------------------------------E-I
PLSI_HUMAN/55-83-----------------------------------------------------------------------------I-V
RCN1_HUMAN/83-111-----------------------------------------------------------------------------R-L
Q18136_CAEEL/22-50-----------------------------------------------------------------------------D-L
Q18136_CAEEL/58-86-----------------------------------------------------------------------------E-L
Q18136_CAEEL/91-119-----------------------------------------------------------------------------S-L
Q18874_CAEEL/420-448-----------------------------------------------------------------------------V-V
Q18887_CAEEL/66-94-----------------------------------------------------------------------------S-I
Q18887_CAEEL/193-221-----------------------------------------------------------------------------I-V
Q18887_CAEEL/276-304-----------------------------------------------------------------------------E-V
CMC3_CAEEL/74-102-----------------------------------------------------------------------------K-I
CMC3_CAEEL/140-168-----------------------------------------------------------------------------R-L
Q19770_CAEEL/423-451-----------------------------------------------------------------------------M-V
Q19770_CAEEL/452-480-----------------------------------------------------------------------------P-F
CDPKI_ARATH/457-485-----------------------------------------------------------------------------R-S
CDPKI_ARATH/487-515-----------------------------------------------------------------------------S-I
CDPKJ_ARATH/440-468-----------------------------------------------------------------------------E-V
CDPKJ_ARATH/476-504-----------------------------------------------------------------------------N-L
CDPKJ_ARATH/511-539-----------------------------------------------------------------------------M-I
Q20358_CAEEL/23-51-----------------------------------------------------------------------------Q-L
Q20358_CAEEL/59-87-----------------------------------------------------------------------------E-L
Q20358_CAEEL/96-124-----------------------------------------------------------------------------E-L
CMC2_CAEEL/77-105-----------------------------------------------------------------------------Q-I
CMC2_CAEEL/144-172-----------------------------------------------------------------------------K-L
Q21201_CAEEL/82-110-----------------------------------------------------------------------------D-F
RASEF_CAEEL/37-65-----------------------------------------------------------------------------D-L
Q26572_SCHMA/11-39-----------------------------------------------------------------------------D-V
Q26572_SCHMA/84-112-----------------------------------------------------------------------------T-F
CATR1_PARTE/41-69-----------------------------------------------------------------------------E-I
CATR1_PARTE/77-105-----------------------------------------------------------------------------T-I
CATR1_PARTE/114-142-----------------------------------------------------------------------------D-I
CATR1_PARTE/150-178-----------------------------------------------------------------------------E-L
S10A7_BOVIN/54-82-----------------------------------------------------------------------------Y-L
CDPK9_ARATH/468-496-----------------------------------------------------------------------------N-L
CDPK9_ARATH/503-531-----------------------------------------------------------------------------T-I
CDPK4_ARATH/436-464-----------------------------------------------------------------------------P-L
CDPK5_ARATH/508-536-----------------------------------------------------------------------------F-L
CDPK6_ARATH/462-490-----------------------------------------------------------------------------H-L
CDPK7_ARATH/364-392-----------------------------------------------------------------------------G-I
CDPK7_ARATH/400-428-----------------------------------------------------------------------------D-L
CDPK7_ARATH/436-464-----------------------------------------------------------------------------H-L
CDPK7_ARATH/473-501-----------------------------------------------------------------------------V-I
Q39890_SOYBN/121-149-----------------------------------------------------------------------------E-V
CDPKC_ARATH/363-391-----------------------------------------------------------------------------E-I
CDPKC_ARATH/399-427-----------------------------------------------------------------------------N-L
CDPK8_ARATH/362-390-----------------------------------------------------------------------------G-I
CDPK3_ARATH/383-411-----------------------------------------------------------------------------G-L
CDPK3_ARATH/419-447-----------------------------------------------------------------------------E-I
CDPK3_ARATH/455-483-----------------------------------------------------------------------------H-L
CDPK3_ARATH/490-518-----------------------------------------------------------------------------S-I
CML21_ARATH/58-86-----------------------------------------------------------------------------N-C
CML21_ARATH/149-177-----------------------------------------------------------------------------T-L
CBPC_DICDI/10-38-----------------------------------------------------------------------------E-V
CBPC_DICDI/93-121-----------------------------------------------------------------------------D-V
CBPC_DICDI/128-156-----------------------------------------------------------------------------D-R
CBPB_DICDI/42-70-----------------------------------------------------------------------------K-Y
CBPB_DICDI/78-106-----------------------------------------------------------------------------E-L
CAB45_MOUSE/101-129-----------------------------------------------------------------------------K-L
CAB45_MOUSE/236-264-----------------------------------------------------------------------------M-V
CAB45_MOUSE/317-345-----------------------------------------------------------------------------E-A
RCN2_RAT/104-132-----------------------------------------------------------------------------E-A
PLCD4_RAT/174-202-----------------------------------------------------------------------------Y-A
TBCD9_HUMAN/890-918-----------------------------------------------------------------------------L-A
CAN8_RAT/579-607-----------------------------------------------------------------------------T-C
CAN8_RAT/609-637-----------------------------------------------------------------------------T-Y
CNBLA_ARATH/117-145-----------------------------------------------------------------------------F-L
CNBLA_ARATH/154-182-----------------------------------------------------------------------------K-T
CNBLA_ARATH/198-226-----------------------------------------------------------------------------I-I
CNBL5_ARATH/70-98-----------------------------------------------------------------------------S-A
CNBL5_ARATH/107-135-----------------------------------------------------------------------------K-A
CNBL5_ARATH/151-179-----------------------------------------------------------------------------I-V
GRP2_HUMAN/430-458-----------------------------------------------------------------------------M-V
RCN2_MOUSE/68-96-----------------------------------------------------------------------------R-L
RCN2_MOUSE/193-221-----------------------------------------------------------------------------V-I
RCN2_MOUSE/234-262-----------------------------------------------------------------------------E-K
GRP3_HUMAN/424-452-----------------------------------------------------------------------------L-V
GRP3_HUMAN/453-481-----------------------------------------------------------------------------P-F
CNBL2_ARATH/86-114-----------------------------------------------------------------------------F-A
CNBL2_ARATH/123-151-----------------------------------------------------------------------------K-I
CDPKD_ARATH/359-387-----------------------------------------------------------------------------D-I
CDPKD_ARATH/395-423-----------------------------------------------------------------------------E-V
CDPKD_ARATH/467-495-----------------------------------------------------------------------------V-A
CAN3_CHICK/685-713-----------------------------------------------------------------------------S-S
CAN3_CHICK/715-743-----------------------------------------------------------------------------S-W
CAN2_CHICK/576-604-----------------------------------------------------------------------------T-C
CAN2_CHICK/606-634-----------------------------------------------------------------------------K-Y
MIRO1_CAEEL/192-220-----------------------------------------------------------------------------A-L
MIRO1_CAEEL/312-340-----------------------------------------------------------------------------F-V
CML13_ARATH/13-41-----------------------------------------------------------------------------S-M
TPC1_ARATH/326-354-----------------------------------------------------------------------------M-L
TPC1_ARATH/367-395-----------------------------------------------------------------------------E-F
S10A6_CHICK/52-80-----------------------------------------------------------------------------E-I
CHP1_HUMAN/114-142-----------------------------------------------------------------------------K-L
CHP1_HUMAN/155-183-----------------------------------------------------------------------------I-A
CIB1_HUMAN/107-135-----------------------------------------------------------------------------K-S
CIB1_HUMAN/152-180-----------------------------------------------------------------------------L-I
MICU1_HUMAN/412-440-----------------------------------------------------------------------------V-C
CNBL6_ARATH/161-189-----------------------------------------------------------------------------I-I
CML43_ARATH/111-139-----------------------------------------------------------------------------D-L
RBOHD_ARATH/257-285-----------------------------------------------------------------------------K-L
CDPKN_ARATH/373-401-----------------------------------------------------------------------------G-L
CDPKN_ARATH/445-473-----------------------------------------------------------------------------H-V
CDPKN_ARATH/480-508-----------------------------------------------------------------------------S-I
CDPKA_ARATH/368-396-----------------------------------------------------------------------------V-I
CDPKA_ARATH/404-432-----------------------------------------------------------------------------E-I
CDPKA_ARATH/440-468-----------------------------------------------------------------------------L-F
CDPKA_ARATH/476-504-----------------------------------------------------------------------------V-L
CDPK3_PLAF7/422-450-----------------------------------------------------------------------------K-L
CDPK3_PLAF7/457-485-----------------------------------------------------------------------------N-F
GRP1_RAT/474-502-----------------------------------------------------------------------------M-V
RBOHB_ARATH/175-203-----------------------------------------------------------------------------R-L
CANB_DROME/800-828-----------------------------------------------------------------------------A-V
KIC_ARATH/78-106-----------------------------------------------------------------------------D-A
CML30_ARATH/50-78-----------------------------------------------------------------------------E-M
CML30_ARATH/86-114-----------------------------------------------------------------------------D-V
CML30_ARATH/121-149-----------------------------------------------------------------------------D-I
CML30_ARATH/157-185-----------------------------------------------------------------------------D-C
CML48_ARATH/56-84-----------------------------------------------------------------------------E-I
CML48_ARATH/125-153-----------------------------------------------------------------------------Q-W
CML6_ARATH/5-33-----------------------------------------------------------------------------E-L
CML6_ARATH/41-69-----------------------------------------------------------------------------E-L
CML6_ARATH/81-109-----------------------------------------------------------------------------D-M
CML6_ARATH/119-147-----------------------------------------------------------------------------E-C
CDPKM_ARATH/350-378-----------------------------------------------------------------------------G-L
CDPKM_ARATH/422-450-----------------------------------------------------------------------------H-L
CDPKM_ARATH/457-485-----------------------------------------------------------------------------N-A
CDPKK_ARATH/439-467-----------------------------------------------------------------------------G-L
CDPKK_ARATH/511-539-----------------------------------------------------------------------------H-L
CDPKK_ARATH/545-573-----------------------------------------------------------------------------H-L
A0DAT1_PARTE/456-482-------------------------------------------------------------------------------W
A2DKH3_TRIVA/802-830-----------------------------------------------------------------------------E-F
A2DXW5_TRIVA/52-79-----------------------------------------------------------------------------E-L
A5KBU9_PLAVS/422-448-----------------------------------------------------------------------------E-V
A7X9M1_PHYPA/417-443-------------------------------------------------------------------------------L
A8HNF8_CHLRE/23-50-------------------------------------------------------------------------------C
A8JC40_CHLRE/65-92-----------------------------------------------------------------------------E-I
B2RYZ0_XENTR/43-70-----------------------------------------------------------------------------D-V
B4HBA9_DROPE/62-88-------------------------------------------------------------------------------W
B4J6G6_DROGR/50-76-------------------------------------------------------------------------------V
C3YK83_BRAFL/11-38-----------------------------------------------------------------------------E-M
C3YYW0_BRAFL/109-136-----------------------------------------------------------------------------E-I
C3ZY23_BRAFL/55-82-----------------------------------------------------------------------------E-L
C5MCF3_CANTT/85-112-----------------------------------------------------------------------------D-V
C5WY52_SORBI/565-591-------------------------------------------------------------------------------L
C5Y427_SORBI/388-414-------------------------------------------------------------------------------L
D2UYG7_NAEGR/127-154-----------------------------------------------------------------------------E-V
D2V5Z7_NAEGR/140-166-------------------------------------------------------------------------------V
D2VXQ7_NAEGR/141-168-----------------------------------------------------------------------------E-L
A8BQU2_GIAIC/144-171-----------------------------------------------------------------------------E-L
E2RU85_GIAIC/130-157-----------------------------------------------------------------------------E-I
A0A183HAI3_9BILA/10-37-----------------------------------------------------------------------------E-C
F6RDI4_XENTR/92-118-------------------------------------------------------------------------------L
F6WJV7_XENTR/97-124-----------------------------------------------------------------------------E-L
F6X6F2_XENTR/50-78-----------------------------------------------------------------------------D-F
I1KY83_SOYBN/402-429-------------------------------------------------------------------------------L
I1MDY1_SOYBN/29-57-----------------------------------------------------------------------------E-I
M0SNQ3_MUSAM/466-492-------------------------------------------------------------------------------I
M4CA48_BRARP/11-37--------------------------------------------------------------------------------
M4E4B8_BRARP/7-33--------------------------------------------------------------------------------
Q4CS04_TRYCC/28-55-----------------------------------------------------------------------------E-L
Q4CSZ0_TRYCC/139-167-----------------------------------------------------------------------------E-L
Q4DUP6_TRYCC/100-126-------------------------------------------------------------------------------F
TEGU_SCHMA/12-39-----------------------------------------------------------------------------E-F
GNPTA_MOUSE/989-1015-------------------------------------------------------------------------------I
Q6YYX3_ORYSJ/9-36-------------------------------------------------------------------------------M
Q7R9F4_PLAYO/85-113-----------------------------------------------------------------------------E-L
CDPK2_PLAF7/375-401-------------------------------------------------------------------------------L
CML1_ORYSJ/48-75-----------------------------------------------------------------------------E-L
CDPKD_ARATH/432-458-------------------------------------------------------------------------------L
A0A3B1K0Y5_ASTMX/43-70-----------------------------------------------------------------------------D-I
W5MGE4_LEPOC/20-48-----------------------------------------------------------------------------E-F

PF13202

A0A0F7V4V1_TOXGV/470-493-----------------------------------------------------------------------------L-A
C4P7X0_CHLVA/167-192-----------------------------------------------------------------------------I-V
MICU1_XENTR/220-244-----------------------------------------------------------------------------F-E
O26668_METTH/8-31-----------------------------------------------------------------------------I-E
D3E367_METRM/266-289-----------------------------------------------------------------------------I-N
C3ZQ19_BRAFL/1361-1385-----------------------------------------------------------------------------F-D
B5YG07_THEYD/135-158-----------------------------------------------------------------------------T-D
A9T5H9_PHYPA/22-46-----------------------------------------------------------------------------L-S
A9T5H9_PHYPA/107-131-----------------------------------------------------------------------------L-A
C4P7Y4_SORBI/152-177-----------------------------------------------------------------------------I-V
B9RDE4_RICCO/35-59-----------------------------------------------------------------------------F-K
A0BVC5_PARTE/382-405-----------------------------------------------------------------------------M-V
C1N2Y6_MICPC/9-33-----------------------------------------------------------------------------L-R
B6TKT3_MAIZE/153-178-----------------------------------------------------------------------------I-V
A0DDA5_PARTE/353-376-----------------------------------------------------------------------------M-D
Q4UIH6_THEAN/479-503-----------------------------------------------------------------------------F-N
B7QHF1_IXOSC/149-174-----------------------------------------------------------------------------L-A
CML38_ARATH/44-69-----------------------------------------------------------------------------L-E
A0DVR4_PARTE/154-178-----------------------------------------------------------------------------V-Q
D2VRB9_NAEGR/331-355-----------------------------------------------------------------------------L-K
B6KJ69_TOXGV/232-256-----------------------------------------------------------------------------L-E
D2VB88_NAEGR/225-250-----------------------------------------------------------------------------L-Q
D2VA25_NAEGR/11-35-----------------------------------------------------------------------------L-R
C5XIH5_SORBI/22-46-----------------------------------------------------------------------------L-G
B4HTW1_DROSE/40-64-----------------------------------------------------------------------------L-R
A4ZKI6_POPTR/152-177-----------------------------------------------------------------------------I-V
A0C5A2_PARTE/441-468-----------------------------------------------------------------------------L-N
C3ZF66_BRAFL/98-123-----------------------------------------------------------------------------I-V
A0DA67_PARTE/343-367-----------------------------------------------------------------------------M-K
CANB_KLULA/26-50-----------------------------------------------------------------------------L-K
A4HVS3_LEIIN/72-97-----------------------------------------------------------------------------L-M
CNBL2_ARATH/167-192-----------------------------------------------------------------------------I-I
B0XGS0_CULQU/246-272-----------------------------------------------------------------------------V-D
B8DL48_DESVM/259-282-----------------------------------------------------------------------------Q-N
C5Z8P2_SORBI/58-82-----------------------------------------------------------------------------A-R
Y2130_DICDI/94-119-----------------------------------------------------------------------------V-V
Y2130_DICDI/154-178-----------------------------------------------------------------------------A-D
Q4QG09_LEIMA/54-79-----------------------------------------------------------------------------L-V
C9SFB3_VERA1/63-87-----------------------------------------------------------------------------M-R
Q4D2E0_TRYCC/138-163-----------------------------------------------------------------------------I-V
A2FET7_TRIVA/16-40-----------------------------------------------------------------------------F-K
C3YD91_BRAFL/134-159-----------------------------------------------------------------------------V-R
A4YRX7_BRASO/88-113-----------------------------------------------------------------------------L-Q
A0DSC5_PARTE/21-44-----------------------------------------------------------------------------L-E
A7APE2_BABBO/16-41-----------------------------------------------------------------------------M-L
A7T743_NEMVE/31-54-----------------------------------------------------------------------------L-K
B4KQ48_DROMO/52-76-----------------------------------------------------------------------------L-Y
D3B5T3_POLPP/148-172-----------------------------------------------------------------------------I-D
B9SPR6_RICCO/147-171-----------------------------------------------------------------------------I-E
A9UX06_MONBE/90-113-----------------------------------------------------------------------------I-A
A3LTX1_PICST/205-231-----------------------------------------------------------------------------L-R
A7S611_NEMVE/41-67-----------------------------------------------------------------------------L-G
B0W1J6_CULQU/268-292-----------------------------------------------------------------------------F-E
Q0UM05_PHANO/88-113-----------------------------------------------------------------------------L-L
A0A3N7E8H4_POPTR/156-181-----------------------------------------------------------------------------I-V
Q15VG6_PSEA6/81-104-----------------------------------------------------------------------------L-E
B8CE53_THAPS/330-354-----------------------------------------------------------------------------L-R
Q47I72_DECAR/140-163-----------------------------------------------------------------------------V-Q
A8XVB7_CAEBR/473-497-----------------------------------------------------------------------------I-D
Q3A3S2_PELCD/55-78-----------------------------------------------------------------------------L-I
A0C9M2_PARTE/19-43-----------------------------------------------------------------------------I-K
Q4N591_THEPA/813-837-----------------------------------------------------------------------------V-E
Q3JEE9_NITOC/75-99-----------------------------------------------------------------------------L-A
C1FF66_MICCC/33-57-----------------------------------------------------------------------------V-Q
A0A3N7FRP7_POPTR/143-167-----------------------------------------------------------------------------I-K
CML50_ARATH/188-213-----------------------------------------------------------------------------I-V
A4RU14_OSTLU/441-466-----------------------------------------------------------------------------L-H
D3BNS7_POLPP/96-121-----------------------------------------------------------------------------V-I
A0DMF3_PARTE/401-425-----------------------------------------------------------------------------I-Q
A4RZI0_OSTLU/14-38-----------------------------------------------------------------------------L-Q
Q804W1_DANRE/83-107-----------------------------------------------------------------------------T-K
B7G459_PHATC/14-38-----------------------------------------------------------------------------F-R
A8IXR0_CHLRE/4-29-----------------------------------------------------------------------------I-Q
D3EQM6_ATETH/729-752-----------------------------------------------------------------------------L-Q
A9UZJ7_MONBE/82-106-----------------------------------------------------------------------------I-Q
A0CIV5_PARTE/365-389-----------------------------------------------------------------------------I-E
A9VD02_MONBE/88-111-----------------------------------------------------------------------------I-E
B7GBA5_PHATC/485-509-----------------------------------------------------------------------------F-I
A0DK50_PARTE/458-483-----------------------------------------------------------------------------I-I
A5K4A9_PLAVS/215-237-----------------------------------------------------------------------------L-D
D7SNZ6_VITVI/403-425-----------------------------------------------------------------------------L-R
F1QUS0_DANRE/67-89-------------------------------------------------------------------------------K
F4HZU8_ARATH/290-313-----------------------------------------------------------------------------L-K
F6HHF9_VITVI/59-82-----------------------------------------------------------------------------I-R
H2LE63_ORYLA/44-67-----------------------------------------------------------------------------I-K
I1Q944_ORYGL/86-110-----------------------------------------------------------------------------L-K
K3XLQ6_SETIT/156-179-------------------------------------------------------------------------------V
K7UU06_MAIZE/38-61-----------------------------------------------------------------------------M-Q
Q22RP4_TETTS/886-908-------------------------------------------------------------------------------D
Q57W92_TRYB2/288-312-----------------------------------------------------------------------------I-N
Q6N380_RHOPA/95-117-----------------------------------------------------------------------------L-K

PF13833

W5KKQ5_ASTMX/541-595---------------------------------------------DMEISVTELQTILNRIISKRE----FSD---SL-Y
D4A938_RAT/94-146--------------------------------------------PTGTVDMHSMKVAL-RNVGIQ-----LGP---QE-M
EFCB3_RAT/61-113--------------------------------------------RTGCIDSHGLMSTV-AKLGMN-----LNA---YD-I
A5ARZ8_VITVI/40-93--------------------------------------------DKGVITFESLKRNS-ATLGLQN----LSD---DE-L
B9INT1_POPTR/41-94--------------------------------------------DRGVITMESLKKNA-AFLGLQD----LSE---DE-L
PBP1_ARATH/50-104--------------------------------------------DKGVITFESLRRNASTVLGLGD----LTD---DD-V
B9RPS2_RICCO/36-90--------------------------------------------EKGVITVESLRRNSCSVLGIKD----LEE---DE-I
B9I910_POPTR/47-100--------------------------------------------EKGLITSESLRRNS-ALLGMEG----MSK---ED-A
Q6Z727_ORYSJ/59-117--------------------------------------------ARGAITAESLRRSAASVLGLGGGGGEMTV---EE-A
D0NVB9_PHYIT/85-137--------------------------------------------TSGVITAADLSSCM-RSLNRI-----PTK---GE-V
D0P2Y1_PHYIT/101-153--------------------------------------------HSRVIKNEDLYEAI-KALGKV-----CSK---KE-V
Q54HB8_DICDI/91-143--------------------------------------------KGGSMTFDDLLS------GLAVCGKSTEK---DK-V
A0CF79_PARTE/166-215--------------------------------------------QKGYITTDDLLMAMKND---------FGS---NE-I
D0MVE6_PHYIT/108-160--------------------------------------------EKDGLDFEGLKAALNAM-GAH-----IKE---SD-V
A0DTQ9_PARTE/83-135--------------------------------------------GQGQISTEDMRLFL-SKVRLG-----LNN---TQ-L
B4MB62_DROVI/283-336--------------------------------------------AGADISRGALKHISDVLVGVP-----LSA---HV-I
PCAT1_MOUSE/432-483--------------------------------------------EDGSIDEANLSCILKTAL-------GVSE---LT-V
PCAT1_HUMAN/432-483--------------------------------------------EDGSVGEGDLSCILKTAL-------GVAE---LT-V
B4JIX5_DROGR/476-528--------------------------------------------STQQIDRDSFTR------LLRHAGSKLNE---QK-A
PCAT_DROME/455-507--------------------------------------------SSQQIDRESFVR------LMRHAGGKLNE---QK-A
B4L1J4_DROMO/476-528--------------------------------------------SSEKISRENFTR------LMKHGGSKMTE---QK-T
B7G2K7_PHATC/364-418--------------------------------------------QGQILDKDTFRRIL----KKSRQDGHISN---AE-V
C3Z2D7_BRAFL/396-448--------------------------------------------DRDKVTREAFKR------GLKGAKIPLSA---YE-I
C3Z612_BRAFL/548-601--------------------------------------------GTDLITQQEFRAAIESRFGIE-----VSD---QD-F
C3Z612_BRAFL/788-840--------------------------------------------HTGFVTREEFHD------VLTELCVQLSE---YE-K
Q69Z12_CAEEL/55-111--------------------------------------------SGARITVEEFIPIYKK--VEAACGRSTTL---KE-F
B0WLJ4_CULQU/72-125--------------------------------------------PNGKLTPAKFVD------MYKMFFPSGNA---EEFC
A2FHL4_TRIVA/21-75--------------------------------------------KKDKIGRDEFYKLY----KQLQKKDDIPK---SN-S
C3Y1D3_BRAFL/16-70--------------------------------------------GGGGLDPDEFRQAIKRTMGNKT----VDD---HE-L
C3YJD8_BRAFL/199-252--------------------------------------------EAGNMTLDEFKEAVSSTLGTP-----AWN---DQ-I
A0A3N7FW51_POPTR/94-147--------------------------------------------EKGVITFDSLKKNS-ALLGLQD----LSD---DD-L
I1LRV1_SOYBN/37-90--------------------------------------------EKGVITLESLRRNA-ALLGLQD----LKE---DE-L
I1M2E4_SOYBN/41-94--------------------------------------------EKKVITFESLKKNS-ALLGLEG----MND---DE-L
Q57WF9_TRYB2/87-140--------------------------------------------PDGIFTRATLQETAGKVGSTQD---TLSV---EE-V

PF13499

F7H9X0_CALJA/14-82-----------------------------------------------------------------------------L-D
B0S5T5_DANRE/253-355-----------------------------------------------------------------------------F-Y
B4K5H6_DROMO/74-157-----------------------------------------------------------------------------E-E
B0W4V1_CULQU/107-174-----------------------------------------------------------------------------D-I
A0CA88_PARTE/343-408-----------------------------------------------------------------------------K-S
E9AEY5_LEIMA/91-155-----------------------------------------------------------------------------R-S
B4KQ53_DROMO/120-192-----------------------------------------------------------------------------E-E
Q9VDI5_DROME/166-252-----------------------------------------------------------------------------E-A
C1FGJ2_MICCC/15-91-----------------------------------------------------------------------------P-E
Q22Y73_TETTS/418-482-----------------------------------------------------------------------------D-F
Q7XUK2_ORYSJ/675-739-----------------------------------------------------------------------------D-A
Q179P5_AEDAE/119-191-----------------------------------------------------------------------------E-E
Q03ZC4_LEUMM/205-292-----------------------------------------------------------------------------S-S
Q384M5_TRYB2/10-74-----------------------------------------------------------------------------R-E
A0A0D1DYS1_USTMA/669-733-----------------------------------------------------------------------------D-R
D2W3R3_NAEGR/27-89-----------------------------------------------------------------------------I-S
A7T5T7_NEMVE/484-551-----------------------------------------------------------------------------F-S
C1MJG0_MICPC/4-66-----------------------------------------------------------------------------E-S
A9TA03_PHYPA/319-420-----------------------------------------------------------------------------F-Y
Q8ILL9_PLAF7/780-853-----------------------------------------------------------------------------S-V
A0C6I2_PARTE/147-212-----------------------------------------------------------------------------F-D
A2FGB1_TRIVA/30-97-----------------------------------------------------------------------------V-D
Q4UGG2_THEAN/877-948-----------------------------------------------------------------------------K-N
Q4QI25_LEIMA/175-239-----------------------------------------------------------------------------E-E
Q4QF91_LEIMA/93-157-----------------------------------------------------------------------------E-E
Q4DBK1_TRYCC/324-390-----------------------------------------------------------------------------F-D
EFCB9_HUMAN/104-166-----------------------------------------------------------------------------Y-R
RHBL3_HUMAN/36-100-----------------------------------------------------------------------------E-D
B0WCB9_CULQU/103-174-----------------------------------------------------------------------------R-V
C4MAF9_ENTHI/45-109-----------------------------------------------------------------------------F-K
Q17J61_AEDAE/75-143-----------------------------------------------------------------------------M-Q
Q383U3_TRYB2/31-98-----------------------------------------------------------------------------D-N
F1QW82_DANRE/246-324-----------------------------------------------------------------------------D-P
B0BNB8_RAT/10-74-----------------------------------------------------------------------------I-N
C5DF93_LACTC/134-200-----------------------------------------------------------------------------D-T
A8Y4B4_CAEBR/161-225-----------------------------------------------------------------------------E-Q
2AB2B_ARATH/316-417-----------------------------------------------------------------------------F-Y
Q9T0I9_ARATH/31-105-----------------------------------------------------------------------------D-K
O77424_DROME/28-137-----------------------------------------------------------------------------L-E
A0E9H8_PARTE/87-164-----------------------------------------------------------------------------T-T
Q5KK44_CRYNJ/679-743-----------------------------------------------------------------------------V-S
Q4UGG2_THEAN/779-852-----------------------------------------------------------------------------A-F
C3YCL0_BRAFL/77-150-----------------------------------------------------------------------------D-T
A0C466_PARTE/34-96-----------------------------------------------------------------------------F-Q
F6HM70_VITVI/148-216-----------------------------------------------------------------------------E-S
B4NST7_DROSI/40-104-----------------------------------------------------------------------------K-C
B5YLV0_THAPS/86-155-----------------------------------------------------------------------------F-K
EFCB7_MOUSE/104-168-----------------------------------------------------------------------------K-A
Q7QDS4_ANOGA/162-227-----------------------------------------------------------------------------M-K
E0CTM8_VITVI/295-363-----------------------------------------------------------------------------T-E
B0WSP5_CULQU/60-140-----------------------------------------------------------------------------E-E
A0D4H2_PARTE/74-138-----------------------------------------------------------------------------K-K
D3Q0B0_STANL/8-87-----------------------------------------------------------------------------R-R
A0CR76_PARTE/21-85-----------------------------------------------------------------------------F-S
C4MAN5_ENTHI/247-312-----------------------------------------------------------------------------T-E
A4S628_OSTLU/4-66-----------------------------------------------------------------------------Q-A
B9GTR6_POPTR/22-99-----------------------------------------------------------------------------N-A
Q4DR78_TRYCC/188-251-----------------------------------------------------------------------------E-E
Q6CTN2_KLULA/14-80-----------------------------------------------------------------------------K-K
A0DXA6_PARTE/78-140-----------------------------------------------------------------------------R-S
A4RWN7_OSTLU/4053-4117-----------------------------------------------------------------------------R-M
D2VAM2_NAEGR/286-352-----------------------------------------------------------------------------L-K
B3M0W6_DROAN/112-184-----------------------------------------------------------------------------E-M
A7T5L6_NEMVE/7-72-----------------------------------------------------------------------------L-E
C1MTV5_MICPC/22-100-----------------------------------------------------------------------------F-D
Q4DJW4_TRYCC/107-180-----------------------------------------------------------------------------R-T
Q22C61_TETTS/120-194-----------------------------------------------------------------------------I-K
Q54K53_DICDI/23-87-----------------------------------------------------------------------------E-E
A0A125YM36_TOXGV/905-976-----------------------------------------------------------------------------K-S
Q7Q2Y5_ANOGA/8166-8230-----------------------------------------------------------------------------K-S
A7SE27_NEMVE/5-68-----------------------------------------------------------------------------S-T
E9AD64_LEIMA/543-607-----------------------------------------------------------------------------T-T
A0C1K7_PARTE/138-207-----------------------------------------------------------------------------R-N
A7EZ28_SCLS1/18-81-----------------------------------------------------------------------------I-F
B7PD77_IXOSC/541-603-----------------------------------------------------------------------------I-V
A0A3B5K950_TAKRU/105-174-----------------------------------------------------------------------------E-L
A5DT65_LODEL/98-175-----------------------------------------------------------------------------Q-Q
C1N9C6_MICPC/137-215-----------------------------------------------------------------------------A-D
A0DXN4_PARTE/410-474-----------------------------------------------------------------------------E-N
H3DPT5_TETNG/9-76-----------------------------------------------------------------------------E-E
PCAT1_RAT/418-481-----------------------------------------------------------------------------L-A
A0D5N6_PARTE/349-412-----------------------------------------------------------------------------Q-N
A4S0C9_OSTLU/316-417-----------------------------------------------------------------------------F-Y
A0D4G3_PARTE/98-175-----------------------------------------------------------------------------E-T
B4M2X5_DROVI/17-85-----------------------------------------------------------------------------K-Q
A4HAL6_LEIBR/159-224-----------------------------------------------------------------------------F-D
A7SF01_NEMVE/188-252-----------------------------------------------------------------------------K-E
A5K537_PLAVS/485-550-----------------------------------------------------------------------------Y-L
A9V1M1_MONBE/549-632-----------------------------------------------------------------------------K-P

PF12763

END3_ASHGO/1-104-----------------------------MP---KLEQFEIKKYWQIFSGLSPSDNKVTHDQVAPILHNSKLE---AGVL
END3_PICST/1-104-----------------------------MP---RLEDWEIKKYWEIFQGLDPVNKKLTGDKVAPVLKNSRLQ---DDQL
END3_PICGU/1-104-----------------------------MP---QLEEWEIKKYWEIFQGLKPQDNKLSGSKVSPVLKNSQLP---QDKL
END3_LODEL/1-104-----------------------------MP---RLEESEIKKYWQIFQGLKPENNKVSGEQVSPVLKNSRLP---QQQL
END3_AJECN/1-106-----------------------------MSE-KKIEQWEVERYWEIFSSLSNGQPHLNNAQAATVLRNSRLR---DDQL
C4R6X1_KOMPG/1-105-----------------------------MP--EKLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKNSQLN---TDQL
C4Y889_CLAL4/1-104-----------------------------MP---RLEEWEIKKYWEIFQGLQPKDNKLTGDRVSPVLKNSRLP---EAQL
C5DUA9_ZYGRC/1-104-----------------------------MP---KLEQFEIKKYWQIFSGLKPENNKVNHDQVLPILFNSKLD---SSVL
END3_CANAL/1-104-----------------------------MP---RLEESEIKKYWQIFQSLKPQNNKLTGDQLSSILKNSQLP---QQQL
END3_DEBHA/1-104-----------------------------MP---RLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKNSRLK---DDQL
END3_YARLI/1-107-----------------------------MSAQGKLEEWEINKYWDIFSGLKPVNNVLTGDQVSPVLKNSNLS---EDKL
END3_SCHPO/1-101-----------------------------MD------PQEKNKYWEIFRGLNPENGYLSGSKAAGVLRSSKLS---SDKL
END3_MAGO7/3-105------------------------------P---RIEAQEIETYWNIFSARTNGSKFLTGEQAAPVLKNSGLR---DDQL

PF10591

H2LN90_ORYLA/163-269-KVCSESELKEVVSRLRDWFRVLHENGNHKRVKI---------------------------QKPEKSKFEVGA---SPIC
B4GYW2_DROPE/165-277PRICDGEDLKEFPRRMRDWLFNVMRDLAERDELT-------------------------EHYMQMELEAETNN---SRRW
Q1HPY3_BOMMO/181-294MPDCTESEMSDFPRRMRDWLFNIMRDMAERRELT-------------------------PHYLKMEREAESNL---TRRW
SPRC_CHICK/147-284IPACLDTELTEFPLRMRDWLKNVLITLYERDEDNNLLTEKQKLKVK-NIHENEKRLEAGDHTVELLARDFEKN---YNMY
A7SG90_NEMVE/110-218VSECARDNLLQFGERYLEWILISRRRLVNRYYQV-----------------------------KESEKGHNLP---PDMR
A7SPL6_NEMVE/109-215MTDCPKWMLEQFPYRFLDWLYLTRELSRDPRFEI-------------------------------AKRGEQLT---GDEI
A7RFR0_NEMVE/170-293QDNCTRFENATLGARLLDWFHVLRAEYIKTESRKAGHPVD------------QPIFPKMDIREAHVPFPCGHS---HQEC
A8Y2J4_CAEBR/138-252LDECTEEHMAQFPERMADWLFQVMKELKKRRELH------------------------KLEWEELLSEAENDD---EKKH
TICN1_HUMAN/195-304RSACTDKELRNLASRLKDWFGALHEDANRVIKPT--------------------------SSNTAQGRFDTSI---LPIC
Q16II0_AEDAE/177-290MPDCSENDLADFPRRMRDWLFNVMRDLAVRNELP-------------------------EAYMELEQEAESNL---TKRW
A0MT19_STRPU/148-261MGSCSAEDLREYPERMTNWFIKSLALIRNRPEEH-------------------------GGLSQKEKETLQQE---WSQS
Q7PRF4_ANOGA/338-442RNECKPQQLTAIGNRLLDWFSVIMADSKKRRQHQ-------------------------------QQKNKVHF---PAAC
TICN3_PONAB/198-308KRACSDLEFREVANRLRDWFKALHESGSQNKKTK-------------------------TLLRPERSRFDTSI---LPIC
B0BM14_XENTR/192-300-ETCTGQDLADLGDRLRDWFQLLHENSKQNNTSN--------------------------PGSKQVNVLDKSL---VAGC
E9QJD8_DANRE/162-269-RECGNAEMTEVVSRLREWITVLHESGNTNKKYK---------------------------FQKPEKKVDMSK---VPLC
F6T3M2_CIOIN/214-350-QPCGEHELSEYPTRMRSWIKNIYLQMYDEAEDMGGLNEKQRFHGRKLVANRDRLQTYEEHHIDLMSREFQKF---YPLY
G3UR35_MELGA/364-501-PHCTDYEVGQFPLRMRDWLKNILMQYYERDQDKPGFLTEKQRNKVKKIYLNEKRLVSGEHPVELLLHDFEKN---YHMY
G3V7X5_RAT/483-620-PACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAGDHPIELLLRDFKKN---YHMY
H3C0L7_TETNG/120-229-TGCTDSELHSLAARLKDWFRVLHLDANRDLKSS-------------------------DNFDSTTGHFDTSI---LPIC
H3CJ51_TETNG/117-225-NSCTGQDLADLGDRLKDWFQLLHGNAKQNNSGR--------------------------PGSGTSSALDRSL---GASC

PF14788

F1RBD7_DANRE/179-228-------------------------------------------------------KMSLKELKHFLRQINIEV---NDSY
E1BJE0_BOVIN/197-246-------------------------------------------------------KMSFKEIKNLLRMVNLDM---NDMY
PLCD4_BOVIN/153-202-------------------------------------------------------RMSFGEVQRLLHLMNVEM---DQEY
G3GVA5_CRIGR/185-234-------------------------------------------------------KMNFKELKDFLKELNIQV---DDSY
G3PRC9_GASAC/150-198-------------------------------------------------------KMSYDEVQTLLQMINIDL---SDQY
H3CR59_TETNG/181-230-------------------------------------------------------KLTQSEMKNFLRLINIEV---DDIY

PF05042

M0ZSZ7_SOLTU/18-187-----------------------------------------------------------------------------HEL
PXG4_ARATH/14-183-----------------------------------------------------------------------------EED
A0A3B6QHJ0_WHEAT/41-208-------------------------------------------------------------------------------T
N1PPK3_DOTSN/103-267-----------------------------------------------------------------------------QDQ
A7F628_SCLS1/71-243-----------------------------------------------------------------------------RHL
B2VUB2_PYRTR/75-243-----------------------------------------------------------------------------AHQ
D8TIC1_VOLCA/23-191------------------------------------------------------------------------------TM
S8ELD9_FOMPI/63-230-----------------------------------------------------------------------------SNQ
G9P0S4_HYPAI/77-245-----------------------------------------------------------------------------QNQ
E4ZR70_LEPMJ/128-296-----------------------------------------------------------------------------TKR
K5X1I2_AGABU/20-182------------------------------------------------------------------------------SN
M2RFF2_CERS8/70-238-----------------------------------------------------------------------------SDQ
D8S798_SELML/1-165--------------------------------------------------------------------------------
B6GVQ0_PENRW/53-222------------------------------------------------------------------------------GY
J3LZI1_ORYBR/63-232-----------------------------------------------------------------------------RQM
M2SX69_COCSN/76-244-----------------------------------------------------------------------------SHQ
M1WCH0_CLAP2/79-251-----------------------------------------------------------------------------QHQ
A0A3Q7E794_SOLLC/11-179-----------------------------------------------------------------------------DEL
W1NF78_AMBTC/26-195-----------------------------------------------------------------------------EEM
D8QM27_SCHCM/3-166--------------------------------------------------------------------------------
W5B7W5_WHEAT/64-233-----------------------------------------------------------------------------QQR
D7T8M1_VITVI/24-191-------------------------------------------------------------------------------L
V5FPI1_BYSSN/68-238-----------------------------------------------------------------------------KDY
H6BKU8_EXODN/53-222-----------------------------------------------------------------------------AQL
G2WXT5_VERDV/79-249-----------------------------------------------------------------------------RHQ
M1CV68_SOLTU/61-230-----------------------------------------------------------------------------HGM
C5WSN8_SORBI/57-226-----------------------------------------------------------------------------RGM
R1H351_BOTPV/148-315-----------------------------------------------------------------------------QDK
B9SQU8_RICCO/58-227-----------------------------------------------------------------------------HGL
E9EBJ4_METAQ/18-186-----------------------------------------------------------------------------SEN
J5JK78_BEAB2/77-245-----------------------------------------------------------------------------KNS
M7ZYZ8_TRIUA/63-232-----------------------------------------------------------------------------GQK
I2G1F4_USTH4/56-233-----------------------------------------------------------------------------KGL
D8S1Z4_SELML/28-200-----------------------------------------------------------------------------AEM
C4JJV1_UNCRE/84-252-----------------------------------------------------------------------------SNQ
N4U5F7_FUSC1/46-215-----------------------------------------------------------------------------EKL
I1BMD1_RHIO9/14-180------------------------------------------------------------------------------KE
G2YVJ3_BOTF4/138-309-----------------------------------------------------------------------------KHL
M4D7A9_BRARP/18-187-----------------------------------------------------------------------------EGY
A8N0P5_COPC7/81-240-----------------------------------------------------------------------------KTN
F2D072_HORVV/38-206-----------------------------------------------------------------------------ANM
M0U3Y1_MUSAM/16-185-----------------------------------------------------------------------------MQM
B0DXN4_LACBS/89-257-----------------------------------------------------------------------------KKN
R7YGA5_CONA1/24-193------------------------------------------------------------------------------KG
I1P3Z8_ORYGL/21-188-------------------------------------------------------------------------------A
Q0CAM3_ASPTN/84-254-----------------------------------------------------------------------------KEY
F8PYI9_SERL3/62-238-----------------------------------------------------------------------------QEY
K1XCK9_MARBU/55-223------------------------------------------------------------------------------DL
I1GZ91_BRADI/42-211-----------------------------------------------------------------------------ANM
D7MF58_ARALL/62-231-----------------------------------------------------------------------------YGL
G0SB95_CHATD/83-254-----------------------------------------------------------------------------ENN
W1PLQ7_AMBTC/57-226-----------------------------------------------------------------------------YNL
M9LJZ6_PSEA3/74-245--------------------------------------------------------------------------------
G2QID9_MYCTT/80-250-----------------------------------------------------------------------------RDH
D7M708_ARALL/59-228-----------------------------------------------------------------------------QDM
K2RRQ6_MACPH/115-282-----------------------------------------------------------------------------QDK
H1UX75_COLHI/78-246-----------------------------------------------------------------------------RHQ
A0A3B6PIG2_WHEAT/39-208-----------------------------------------------------------------------------RNM
PXG7_ARATH/25-194-----------------------------------------------------------------------------EKM
C5Z7Z3_SORBI/47-216-----------------------------------------------------------------------------SNM
Q652U4_ORYSJ/37-206------------------------------------------------------------------------------EL
F9X765_ZYMTI/51-216-----------------------------------------------------------------------------KNQ
N1S4R5_FUSC4/79-247-----------------------------------------------------------------------------RDQ
A0A0C4EDI6_MAGP6/75-243-----------------------------------------------------------------------------SHQ
S2JK15_MUCC1/22-192-----------------------------------------------------------------------------HEE
U4LKU1_PYROM/77-244-----------------------------------------------------------------------------SHQ
C5Z7Z5_SORBI/35-203------------------------------------------------------------------------------NM
A0A096UTL6_WHEAT/41-207--------------------------------------------------------------------------------
I1IEG7_BRADI/42-209-------------------------------------------------------------------------------T
D8UI18_VOLCA/50-224-----------------------------------------------------------------------------TNR
S3E0E9_GLAL2/112-280-----------------------------------------------------------------------------RDQ
E3S5H2_PYRTT/120-288-----------------------------------------------------------------------------HDR
F7W396_SORMK/75-245-----------------------------------------------------------------------------EDY
F8QCR1_SERL3/58-235-----------------------------------------------------------------------------SEY
C6TFE2_SOYBN/28-195-------------------------------------------------------------------------------E
R7YKW5_CONA1/107-275-----------------------------------------------------------------------------EDA
M2N5S0_BAUPA/46-214-----------------------------------------------------------------------------RHL
G7XD39_ASPKW/82-248--------------------------------------------------------------------------------
M0TPW2_MUSAM/57-226-----------------------------------------------------------------------------HHL
B8P3H3_POSPM/64-231-----------------------------------------------------------------------------RRE
I1H7Y6_BRADI/58-227-----------------------------------------------------------------------------RGM
K5WCX1_PHACS/70-244-----------------------------------------------------------------------------IQK
G3JTA5_CORMM/75-243-----------------------------------------------------------------------------KHQ
H6BSL1_EXODN/85-253-----------------------------------------------------------------------------QHQ
PXG3_ARATH/57-226-----------------------------------------------------------------------------KGM
D8QH68_SCHCM/4-176-----------------------------------------------------------------------------GEK
D8U9T4_VOLCA/1289-1463-------------------------------------------------------------------------------L
G4MNQ2_MAGO7/84-252-----------------------------------------------------------------------------SDQ
H1V486_COLHI/87-256-----------------------------------------------------------------------------KNY
I1Q199_ORYGL/36-205-----------------------------------------------------------------------------ANM
A0A3Q7E8F1_SOLLC/17-186-----------------------------------------------------------------------------EEP
B8LTU3_TALSN/62-232-----------------------------------------------------------------------------KEY
Q6Z2H7_ORYSJ/195-363------------------------------------------------------------------------------GV
A0A3B6RGE0_WHEAT/30-200------------------------------------------------------------------------------EL
K1WV35_MARBU/115-286-----------------------------------------------------------------------------RRK
D8S185_SELML/60-228-----------------------------------------------------------------------------SGL
D7MKF7_ARALL/61-230-----------------------------------------------------------------------------NGL
M7SQ47_EUTLA/66-234-----------------------------------------------------------------------------EDK
I1JRR6_SOYBN/60-229-----------------------------------------------------------------------------NDM
E1ZMG0_CHLVA/1-167--------------------------------------------------------------------------------
T0K8D8_COLGC/77-245-----------------------------------------------------------------------------RHQ
N1JIF2_BLUG1/65-234-----------------------------------------------------------------------------RHQ
K3YZS5_SETIT/43-212------------------------------------------------------------------------------GM
M3D239_SPHMS/91-258-----------------------------------------------------------------------------QHQ

PF00404

CIPA_CLOTH/1789-1844-------------------------------------------------------------------VGDIVK---DNSI
Q7UVU1_RHOBA/868-927-------------------------------------------------------------------PHDVNG---DGDV
Q7NPJ5_GLOVI/22-78-------------------------------------------------------------------SGDVNG---DGRV
Q977Y3_CLOAB/550-604-------------------------------------------------------------------KGDVNG---DGVV
Q97KK6_CLOAB/425-479-------------------------------------------------------------------KGDVNG---DGAV
B8I7V7_CLOCE/702-756-------------------------------------------------------------------LGDLNG---DGSV
A3DBF5_CLOTH/679-734-------------------------------------------------------------------YGDLNG---DGNI
A3DDK4_CLOTH/470-526-------------------------------------------------------------------KGDVNL---DGQV
D9SS71_CLOC7/659-713-------------------------------------------------------------------AGDVNN---NGIV
Q97KK7_CLOAB/669-725-------------------------------------------------------------------PGDVNG---DGVV
Q8XKX6_CLOPE/1298-1353-------------------------------------------------------------------SADINE---DGSI
GUNB_CLOTH/500-554-------------------------------------------------------------------YGDVNG---DGRV
GUNG_CLOTH/501-556-------------------------------------------------------------------YGDINS---DGNV
Q7UQX3_RHOBA/46-111-------------------------------------------------------------------ASDVNG---DGEV
D9SX08_CLOC7/1282-1337-------------------------------------------------------------------VGDLSK---DGKV
A3DGI0_CLOTH/558-616-------------------------------------------------------------------PGDVNG---DGRV
Q7UI70_RHOBA/1741-1801-------------------------------------------------------------------AHDVDR---SGSV
Q7UFE7_RHOBA/580-649-------------------------------------------------------------------AFDVTG---SENV
Q7UY66_RHOBA/93-154-------------------------------------------------------------------AYDVDN---NKYV
GUNF_CLOCE/665-719-------------------------------------------------------------------LGDVNG---DETV
GUNH_CLOTH/831-892-------------------------------------------------------------------HGDLNF---DNAV
Q7UNV3_RHOBA/7350-7429-------------------------------------------------------------------NADVND---DGEV
Q7UNV4_RHOBA/5952-6022-------------------------------------------------------------------RFDVTA---DGFV
B8I7W1_CLOCE/478-532-------------------------------------------------------------------VGDVND---DGNV
GUND_CLOCE/528-582-------------------------------------------------------------------IGDVNE---DGNI
GUNA_CLOCE/413-466-------------------------------------------------------------------YGDYNN---DGNV
Q8ESB0_OCEIH/14-63-------------------------------------------------------------------AGDINQ---DSVI
Q97KK3_CLOAB/635-689-------------------------------------------------------------------TGDVNG---DNTV
Q97KK1_CLOAB/369-423-------------------------------------------------------------------KGDVNG---DGVI
Q7UYG2_RHOBA/94-172-------------------------------------------------------------------PEDVNE---DGQV
Q7UF08_RHOBA/1985-2047-------------------------------------------------------------------REDTNA---DGTV
B8I2F6_CLOCE/404-462-------------------------------------------------------------------YGDVDG---SGMI
Q7UF11_RHOBA/71-131-------------------------------------------------------------------HLDVNR---DGTI
D9SS72_CLOC7/672-726-------------------------------------------------------------------KGDVNS---DAKV
XYNZ_CLOTH/428-484-------------------------------------------------------------------LGDLNG---DGNI
Q7UUS9_RHOBA/5819-5883-------------------------------------------------------------------IHDVNN---SGAI
D9SS67_CLOC7/29-85-------------------------------------------------------------------LGDVNV---DGKV
A3DJ82_CLOTH/547-603-------------------------------------------------------------------YGDLNG---DQKV
Q7UF12_RHOBA/1247-1309-------------------------------------------------------------------AMDSNR---DGSI
Q7UWM1_RHOBA/1689-1743-------------------------------------------------------------------QTDVNN---DGQV
B8I7V4_CLOCE/825-880-------------------------------------------------------------------LGDVNG---DGNK
B8I7V9_CLOCE/471-525-------------------------------------------------------------------KGDLNN---DTFI
GUB_CLOTH/271-328-------------------------------------------------------------------KGDVNG---DGHV
A3DC30_CLOTH/416-474-------------------------------------------------------------------YGDLNG---DGKV
D9SV64_CLOC7/1014-1067-------------------------------------------------------------------LGDVDG---NDVV
D9SP57_CLOC7/248-301-------------------------------------------------------------------LGDVDN---NGTV
D9SX09_CLOC7/765-820-------------------------------------------------------------------LGDLNN---DGKI
GUND_CLOTH/583-641-------------------------------------------------------------------YGDVND---DGKV
Q7UVW2_RHOBA/76-136-------------------------------------------------------------------PEDVNE---DDQV
A3DDW7_CLOTH/732-788-------------------------------------------------------------------LGDVNG---DGTI
Q7UUT0_RHOBA/743-803-------------------------------------------------------------------GEDVNG---DGVV
GUNC_CLOCE/404-459-------------------------------------------------------------------KGDVNN---DGAI
Q7UI80_RHOBA/1557-1620-------------------------------------------------------------------PPDVNG---DNLV
Q7UJQ5_RHOBA/110-164-------------------------------------------------------------------AEDVND---DGRV
Q7NPJ7_GLOVI/28-84-------------------------------------------------------------------SGDVNS---DGRV
A3DD30_CLOTH/1290-1344-------------------------------------------------------------------YGDLNN---DSKV
GUNF_CLOTH/668-729-------------------------------------------------------------------LGDVNF---DGRI
B8I7W0_CLOCE/621-675-------------------------------------------------------------------PGDVNN---DGSV
Q97KK0_CLOAB/775-829-------------------------------------------------------------------LGDVND---DGII
GUNB_CLOC7/385-439-------------------------------------------------------------------LGDVNK---DGKV
Q7UQ89_RHOBA/1855-1919-------------------------------------------------------------------SEDVNA---NGEV
CELE_CLOTH/413-471-------------------------------------------------------------------YGDVNG---DGKI
A3DHC1_CLOTH/588-646-------------------------------------------------------------------YGDVNG---DFAV
A3DBF6_CLOTH/471-527-------------------------------------------------------------------KGDINL---DGKI
Q97KK2_CLOAB/480-535-------------------------------------------------------------------LGDLND---DGVV
Q9HNT7_HALSA/531-585-------------------------------------------------------------------YEDVNG---DGVV
A3DD31_CLOTH/644-701-------------------------------------------------------------------VGDLNG---DGVV
GUNG_CLOCE/662-716-------------------------------------------------------------------YGDVNS---DKNV
B8I7V8_CLOCE/31-87-------------------------------------------------------------------LGDVDN---DTLI
A3DCH2_CLOTH/1161-1215-------------------------------------------------------------------YGDCND---DGKV
Q97DK6_CLOAB/955-1009-------------------------------------------------------------------LGDVDG---NGVV
Q7UJQ3_RHOBA/296-355-------------------------------------------------------------------PTDVNE---DDRT
NAGH_CLOPE/1577-1627-------------------------------------------------------------------TGDFNG---NGKI
Q7NPL8_GLOVI/37-93-------------------------------------------------------------------AGDIDG---DGRV
A3DJ81_CLOTH/524-580-------------------------------------------------------------------YGDLNG---DGKV
Q7ULP1_RHOBA/1723-1785-------------------------------------------------------------------RYDVDR---NQSV
CELK_CLOTH/832-886-------------------------------------------------------------------YGDCNG---DGKV
Q7UKT7_RHOBA/554-617-------------------------------------------------------------------PSDVTG---DGEV

PF14658

KASH5_MOUSE/108-175--------------------------------------------------------------------------------
Q4CNH0_TRYCC/14-77--------------------------------------------------------------------------------
B3SBZ9_TRIAD/28-95--------------------------------------------------------------------------------
C3YNF3_BRAFL/170-239--------------------------------------------------------------------------------
B4JT32_DROGR/32-94--------------------------------------------------------------------------------
G1M6G8_AILME/38-105--------------------------------------------------------------------------------

PF09068

H2MTI0_ORYLA/24-148-----------------------------------------------------------------RQIFVELG---DQNF
W5JYZ3_ASTMX/18-136-----------------------------------------------------------------TQLFQSM-----ADL
H2N287_ORYLA/21-139-----------------------------------------------------------------AELYQSL-----ADL
B4MYA9_DROWI/9-131-------------------------------------------------------------------ILQDLR---LQTF
F6VUQ0_XENTR/3078-3196-----------------------------------------------------------------TELFQSL-----GDL
E7ES64_HUMAN/16-140-----------------------------------------------------------------RQLFIEMR---AQNF
F4WQ21_ACREC/20-144-----------------------------------------------------------------LQLLQEMR---QQNF
A0A1P6BXL6_BRUMA/2997-3116-----------------------------------------------------------------VEIMEEL-----TTF
V6CLV8_CAEEL/3071-3190-----------------------------------------------------------------VEIVKEL-----SQF
B3MR84_DROAN/47-170------------------------------------------------------------------SIIDEL----QMKY
T1KPK1_TETUR/326-448-----------------------------------------------------------------IDLMNSL-----VEF
W4YT69_STRPU/407-526-----------------------------------------------------------------TELFHSL-----SDL
B3S724_TRIAD/427-546-----------------------------------------------------------------TEIYDLL-----VNN
H3DP81_TETNG/17-141-----------------------------------------------------------------RQLFVELG---EQDF
A4QNP9_XENTR/357-475-----------------------------------------------------------------TELYQAL-----GDL
H3BBK9_LATCH/301-419-----------------------------------------------------------------TELYHTL-----ADL
H2XWJ0_CIOIN/5-129-----------------------------------------------------------------AELMESM-----LDL
H9J473_BOMMO/544-669-----------------------------------------------------------------SQLLQEMR---EQNF
A0A2H2IIK5_CAEJA/49-173-----------------------------------------------------------------QQLIDDMR---LQDF
A7T3M8_NEMVE/40-160-----------------------------------------------------------------IQLMQDL-----AEL
A0A158NLD0_ATTCE/2-122-----------------------------------------------------------------ENIMRSM-----QEC
K1R5C0_CRAGI/40-163------------------------------------------------------------------TLLTEMR---AQNF
E9GLP4_DAPPU/11-134-------------------------------------------------------------------LANDIH---TQNF
T1HS05_RHOPR/9-135-----------------------------------------------------------------KQILEDV-----QSC
A0A068Y3J2_ECHMU/107-238-----------------------------------------------------------------RRLLAELK---AKKF
A7S5C8_NEMVE/343-462-----------------------------------------------------------------TELYHQI-----AEL
Q24175_DROME/44-168-----------------------------------------------------------------STIMDDL----QRDY
Q7QHZ2_ANOGA/39-157-----------------------------------------------------------------------------EKY
A0A139WEI7_TRICA/33-153-----------------------------------------------------------------IELKHTI-----DDW
A0A212FNM4_DANPL/34-152-----------------------------------------------------------------SKILKTL-----DEY
E9H0W1_DAPPU/6-127-----------------------------------------------------------------RELLAAL-----NQF
B0WQW4_CULQU/32-156-------------------------------------------------------------------ILNKI----NEKF
H0ZKJ9_TAEGU/14-132-----------------------------------------------------------------TDLFQSL-----ADL
K1P9S0_CRAGI/40-170------------------------------------------------------------------KVMEEL-----DEY
K1S5H9_CRAGI/1252-1371-----------------------------------------------------------------TDLMDTL-----ADL
E9FTM1_DAPPU/561-680-----------------------------------------------------------------EELMNSL-----SEF
J9K968_ACYPI/1839-1958-----------------------------------------------------------------MELMSSL-----SEF
A2CJ02_DANRE/16-140-----------------------------------------------------------------RQLFAEMR---ALDL
M3XQ41_MUSPF/16-140-----------------------------------------------------------------RQLFAEMR---AQDL
C3Y1B5_BRAFL/354-478-----------------------------------------------------------------RQLMTEMR---TQNF
H9J3Q2_BOMMO/34-162-----------------------------------------------------------------IKLWQSL-----SVY
B7PND6_IXOSC/52-205-----------------------------------------------------------------VAIMDKL-----TSF
H2YGZ2_CIOSA/280-404-----------------------------------------------------------------VELMESM-----LDL
H3CSW5_TETNG/23-146-----------------------------------------------------------------RQLFVEMR---AHDL
T1HBK6_RHOPR/21-145-----------------------------------------------------------------LQLMQEMR---SQNF
M3XL49_LATCH/21-139-----------------------------------------------------------------TELYQSL-----ADL
I3J386_ORENI/308-426-----------------------------------------------------------------TELYQAL-----ADL
Q175I9_AEDAE/173-287-----------------------------------------------------------------IELMKSL-----ADL
D6WLG0_TRICA/462-581-----------------------------------------------------------------LELATSL-----LQL
E0VJZ9_PEDHC/394-512-----------------------------------------------------------------LELMTSL-----SEL
B4GVZ3_DROPE/35-163-----------------------------------------------------------------SAIMEKL----QVDY
T1K642_TETUR/2001-2122-----------------------------------------------------------------TEIINNL-----NEF
J9JV60_ACYPI/13-138-----------------------------------------------------------------LQLLQEMR---CQNY
B3S1D5_TRIAD/20-144-----------------------------------------------------------------TDILREI-----DQL

PF17959

L5KWU0_PTEAL/69-152-------------------------------------------------------------------------------L
A0A0P8XQ73_DROAN/184-275-------------------------------------------------------------------------------A
A0A077ZEY1_TRITR/46-136-------------------------------------------------------------------------------L
E3NJA1_CAERE/78-165-------------------------------------------------------------------------------A
A0A0N4VGE8_ENTVE/24-117-------------------------------------------------------------------------------T
V3ZLC8_LOTGI/4-92-------------------------------------------------------------------------------I
A0A090KXS1_STRRB/87-181-------------------------------------------------------------------------------V
K1PNS8_CRAGI/18-112-------------------------------------------------------------------------------F
T1K7T8_TETUR/113-201-------------------------------------------------------------------------------T
A0A2H2IFL4_CAEJA/10-99-------------------------------------------------------------------------------Q
A0A0N4Y924_NIPBR/35-124-------------------------------------------------------------------------------L
A0A0N5D9G8_THECL/22-115-------------------------------------------------------------------------------I
T1FWQ9_HELRO/118-205-------------------------------------------------------------------------------L
A0A0N4U682_DRAME/49-150-------------------------------------------------------------------------------V
W0VD73_9BURK/25-106-------------------------------------------------------------------------------I
E9GPV0_DAPPU/87-178-------------------------------------------------------------------------------V
W4Z9P7_STRPU/70-157-------------------------------------------------------------------------------L

PF08726

ACTN2_MOUSE/824-890------------------------------------------------------------------------D---TDTA
ACTN1_HUMAN/822-888------------------------------------------------------------------------D---TDTA
Q21408_CAEEL/2361-2431------------------------------------------------------------------------N---IQSS
SPTA1_HUMAN/2350-2418------------------------------------------------------------------------N---IKSS
ACTN3_HUMAN/831-897------------------------------------------------------------------------E---TDTT
Q5AVH3_EMENI/605-676------------------------------------------------------------------------D---QNTA
A8Y3R8_CAEBR/827-893------------------------------------------------------------------------D---QDTV
A0A0D1DXH0_USTMA/566-633------------------------------------------------------------------------D---TTSP
Q2U7P8_ASPOR/559-630------------------------------------------------------------------------D---QNTA
Q29EZ8_DROPS/2344-2414------------------------------------------------------------------------N---VQSY
Q5KJM5_CRYNJ/626-704------------------------------------------------------------------------D---ASSP
Q0UG56_PHANO/635-706------------------------------------------------------------------------D---QNTA
Q0CDG2_ASPTN/559-630------------------------------------------------------------------------D---QNTA
A8DV03_NEMVE/329-399------------------------------------------------------------------------N---VGSS
F7B6H7_XENTR/829-895------------------------------------------------------------------------E---TDTS
H9GE13_ANOCA/826-892------------------------------------------------------------------------E---TDTA
W5NV97_SHEEP/169-237------------------------------------------------------------------------N---VKSS

PF01023

H2M1B8_ORYLA/12-54-------------------------------------------------------------------------------L
H2TTX5_TAKRU/4-46-------------------------------------------------------------------------------V
M4A7L2_XIPMA/4-46-------------------------------------------------------------------------------L
H2M4U6_ORYLA/4-46-------------------------------------------------------------------------------L
F6R2K0_HORSE/4-46-------------------------------------------------------------------------------I
F6T046_HORSE/7-49-------------------------------------------------------------------------------M
M4AK45_XIPMA/1-43-------------------------------------------------------------------------------M
M3WK02_FELCA/4-46-------------------------------------------------------------------------------L
M3ZN15_XIPMA/15-54-------------------------------------------------------------------------------L
M4AWV1_XIPMA/48-90-------------------------------------------------------------------------------L
F1ST30_PIG/4-46-------------------------------------------------------------------------------L
I3MVD9_ICTTR/8-50-------------------------------------------------------------------------------M
I3LX36_ICTTR/5-47-------------------------------------------------------------------------------L
H0UWS6_CAVPO/8-50-------------------------------------------------------------------------------L
F7B1J7_CALJA/5-47-------------------------------------------------------------------------------L
H9GTJ3_ANOCA/4-46-------------------------------------------------------------------------------L
G3W673_SARHA/5-47-------------------------------------------------------------------------------L
A0A3Q2GYS6_HORSE/5-47-------------------------------------------------------------------------------L
G3U1S6_LOXAF/4-46-------------------------------------------------------------------------------L
I3IZ76_ORENI/24-63-------------------------------------------------------------------------------L
G1RQ12_NOMLE/5-47-------------------------------------------------------------------------------L
H9H0S2_MELGA/14-56-------------------------------------------------------------------------------L
S10AC_HUMAN/4-46-------------------------------------------------------------------------------L
F6SK92_MONDO/5-47-------------------------------------------------------------------------------L
H2N5S9_PONAB/4-46-------------------------------------------------------------------------------L
H3DJK9_TETNG/9-51-------------------------------------------------------------------------------M
L9KHS5_TUPCH/4-46-------------------------------------------------------------------------------L
F6SL70_MONDO/45-87-------------------------------------------------------------------------------L
G3W262_SARHA/5-47-------------------------------------------------------------------------------L
W5NQH6_SHEEP/8-50-------------------------------------------------------------------------------M
H3A3I9_LATCH/5-44-------------------------------------------------------------------------------T
G5BER0_HETGA/18-59-------------------------------------------------------------------------------V
RPTN_MOUSE/4-46-------------------------------------------------------------------------------L
G1SAS4_NOMLE/10-52-------------------------------------------------------------------------------T
H0WV54_OTOGA/5-47-------------------------------------------------------------------------------L
Q1LUV5_DANRE/8-48-------------------------------------------------------------------------------L
W5KR67_ASTMX/5-47-------------------------------------------------------------------------------L
S10A7_BOVIN/6-45-------------------------------------------------------------------------------L
G1SQV2_RABIT/4-43-------------------------------------------------------------------------------L
M3XQH5_MUSPF/4-46-------------------------------------------------------------------------------L
J3QPE5_MOUSE/4-46-------------------------------------------------------------------------------M
G3UWB8_MOUSE/8-48-------------------------------------------------------------------------------S
H2N5P8_PONAB/8-50-------------------------------------------------------------------------------L
G3TZS9_LOXAF/5-46-------------------------------------------------------------------------------L
G1RH71_NOMLE/4-46-------------------------------------------------------------------------------L
G1QFV3_MYOLU/4-46-------------------------------------------------------------------------------L
F7G3H7_ORNAN/5-47-------------------------------------------------------------------------------L
W5MVL0_LEPOC/4-46-------------------------------------------------------------------------------L
F7A2F5_MONDO/6-45-------------------------------------------------------------------------------M
S10A9_MOUSE/9-51-------------------------------------------------------------------------------M
G3PE20_GASAC/4-46-------------------------------------------------------------------------------L
W5MF75_LEPOC/8-48-------------------------------------------------------------------------------L
G1SXG6_RABIT/5-47-------------------------------------------------------------------------------L
I3LG91_PIG/4-46-------------------------------------------------------------------------------L
H9H249_MELGA/9-51-------------------------------------------------------------------------------L
F6Q7S6_ORNAN/5-47-------------------------------------------------------------------------------L
H9H071_MELGA/4-46-------------------------------------------------------------------------------F
W5MJL4_LEPOC/1-43-------------------------------------------------------------------------------M
H3A562_LATCH/5-47-------------------------------------------------------------------------------L
W5NR21_SHEEP/6-45-------------------------------------------------------------------------------L
H0X9K4_OTOGA/4-46-------------------------------------------------------------------------------L
G3W2L6_SARHA/6-48-------------------------------------------------------------------------------V
G1M0L5_AILME/9-51-------------------------------------------------------------------------------L
H0Z0V8_TAEGU/5-47-------------------------------------------------------------------------------L
E2R805_CANLF/4-46-------------------------------------------------------------------------------L
A0A3B3IE84_ORYLA/5-47-------------------------------------------------------------------------------L
G3GWD0_CRIGR/4-46-------------------------------------------------------------------------------L
F6SL13_MONDO/5-47-------------------------------------------------------------------------------L
F7F9Z9_MONDO/4-46-------------------------------------------------------------------------------L
H0XY71_OTOGA/8-50-------------------------------------------------------------------------------L
L5JU87_PTEAL/64-106-------------------------------------------------------------------------------L
G3WVS2_SARHA/4-46-------------------------------------------------------------------------------L
G3WW94_SARHA/4-46-------------------------------------------------------------------------------L
H0ZIJ7_TAEGU/4-46-------------------------------------------------------------------------------L
W5QIV2_SHEEP/5-47-------------------------------------------------------------------------------L
L5JS91_PTEAL/23-65-------------------------------------------------------------------------------M
Q4SS39_TETNG/11-50-------------------------------------------------------------------------------L
J9P8R6_CANLF/4-46-------------------------------------------------------------------------------L
G3VQV2_SARHA/4-46-------------------------------------------------------------------------------L
S10A9_RAT/9-51-------------------------------------------------------------------------------L
A0A286XHB4_CAVPO/5-47-------------------------------------------------------------------------------L
G3I8A9_CRIGR/9-51-------------------------------------------------------------------------------L
F7F9N6_MONDO/4-46-------------------------------------------------------------------------------L
W5MEL8_LEPOC/5-47-------------------------------------------------------------------------------L
G3UBX1_LOXAF/5-47-------------------------------------------------------------------------------L
H2ZZH2_LATCH/9-51-------------------------------------------------------------------------------L
L9J9X1_TUPCH/5-47-------------------------------------------------------------------------------L
H0XNW8_OTOGA/5-47-------------------------------------------------------------------------------L
S10AC_RABIT/4-46-------------------------------------------------------------------------------L
A0A2J8Q3M0_PANTR/5-47-------------------------------------------------------------------------------L
H9G3V9_ANOCA/12-54-------------------------------------------------------------------------------T
U3KBY8_FICAL/8-50-------------------------------------------------------------------------------L
W5QIV5_SHEEP/4-46-------------------------------------------------------------------------------L
D3ZSW4_RAT/4-46-------------------------------------------------------------------------------L
F7GK08_MONDO/10-54-------------------------------------------------------------------------------I
I3JGI1_ORENI/5-47-------------------------------------------------------------------------------L
I3NDP4_ICTTR/4-46-------------------------------------------------------------------------------L
TCHL1_MOUSE/4-47-------------------------------------------------------------------------------L
G5B8K2_HETGA/4-46-------------------------------------------------------------------------------L
S10A8_BOVIN/5-47-------------------------------------------------------------------------------L
G3SM10_LOXAF/9-51-------------------------------------------------------------------------------L
G5BEQ9_HETGA/8-51-------------------------------------------------------------------------------L
G3I8A7_CRIGR/4-46-------------------------------------------------------------------------------M
I3KUM8_ORENI/17-59-------------------------------------------------------------------------------I
F7AJJ0_MONDO/6-48-------------------------------------------------------------------------------M
H0Z1L6_TAEGU/4-46-------------------------------------------------------------------------------F
G5BEQ8_HETGA/21-63-------------------------------------------------------------------------------L
L9JAM5_TUPCH/51-93-------------------------------------------------------------------------------L
M126_CHICK/14-56-------------------------------------------------------------------------------L
G3NAC2_GASAC/5-47-------------------------------------------------------------------------------L
G3WVB3_SARHA/10-54-------------------------------------------------------------------------------T
G3W0M1_SARHA/9-51-------------------------------------------------------------------------------L
Q4RLA4_TETNG/4-46-------------------------------------------------------------------------------L
G1NWG9_MYOLU/9-51-------------------------------------------------------------------------------V
G1SNF3_RABIT/4-46-------------------------------------------------------------------------------L
F6TJM4_MONDO/2-44-------------------------------------------------------------------------------L
H0W7W0_CAVPO/4-46-------------------------------------------------------------------------------L
G3VKN0_SARHA/4-46-------------------------------------------------------------------------------L
G3VRV7_SARHA/22-64-------------------------------------------------------------------------------L
F7FV87_ORNAN/4-46-------------------------------------------------------------------------------L
G3NGI8_GASAC/4-46-------------------------------------------------------------------------------I
H0XIU7_OTOGA/5-47-------------------------------------------------------------------------------T
L5JX40_PTEAL/5-47-------------------------------------------------------------------------------L
F6SKU1_MONDO/5-47-------------------------------------------------------------------------------L
G3UIG4_LOXAF/6-48-------------------------------------------------------------------------------V
F7DMV8_XENTR/7-49-------------------------------------------------------------------------------L
H9GKD3_ANOCA/9-51-------------------------------------------------------------------------------M
F6QF97_ORNAN/4-46-------------------------------------------------------------------------------L
G1TIX1_RABIT/6-48-------------------------------------------------------------------------------M
W5MWM7_LEPOC/5-47-------------------------------------------------------------------------------L
A5WW28_DANRE/1-43-------------------------------------------------------------------------------M
L9J9Y0_TUPCH/22-64-------------------------------------------------------------------------------M
G3T7T2_LOXAF/4-46-------------------------------------------------------------------------------L
I3JHV0_ORENI/5-47-------------------------------------------------------------------------------L
G1PBJ1_MYOLU/4-46-------------------------------------------------------------------------------L
L8Y375_TUPCH/4-46-------------------------------------------------------------------------------L
M4AAE1_XIPMA/4-46-------------------------------------------------------------------------------L
I3IZ83_ORENI/4-46-------------------------------------------------------------------------------L
H0WH38_OTOGA/4-46-------------------------------------------------------------------------------L
I3MT07_ICTTR/5-47-------------------------------------------------------------------------------L
G1M0L8_AILME/8-50-------------------------------------------------------------------------------L
F6RMH6_ORNAN/8-50-------------------------------------------------------------------------------A
H3BAP4_LATCH/17-59-------------------------------------------------------------------------------L
G3HUU3_CRIGR/4-46-------------------------------------------------------------------------------L
H3DR68_TETNG/7-49-------------------------------------------------------------------------------L
A5WW33_DANRE/9-51-------------------------------------------------------------------------------L
G3HUU7_CRIGR/5-44-------------------------------------------------------------------------------M
I3IZ81_ORENI/4-46-------------------------------------------------------------------------------L
G5BIG3_HETGA/5-47-------------------------------------------------------------------------------M
U3KBZ3_FICAL/7-52-------------------------------------------------------------------------------L
F7C5Y6_MONDO/4-46-------------------------------------------------------------------------------L
E2QTP3_CANLF/4-46-------------------------------------------------------------------------------L
G1Q439_MYOLU/4-46-------------------------------------------------------------------------------L
H9GT13_ANOCA/4-46-------------------------------------------------------------------------------M
L5JUY8_PTEAL/6-48-------------------------------------------------------------------------------V
G3VQW8_SARHA/4-46-------------------------------------------------------------------------------L
HORN_MOUSE/4-46-------------------------------------------------------------------------------L
G5B5Z0_HETGA/5-44-------------------------------------------------------------------------------T
G3TRT9_LOXAF/9-51-------------------------------------------------------------------------------L
G5B8K1_HETGA/4-46-------------------------------------------------------------------------------L
S10A9_RABIT/8-50-------------------------------------------------------------------------------L
H3DJK5_TETNG/6-48-------------------------------------------------------------------------------L
G1PAG3_MYOLU/43-85-------------------------------------------------------------------------------L
Q5T7Y4_HUMAN/5-47-------------------------------------------------------------------------------L
H0XUJ3_OTOGA/5-44-------------------------------------------------------------------------------M
S10AC_BOVIN/4-46-------------------------------------------------------------------------------L
Q28J00_XENTR/119-161-------------------------------------------------------------------------------M
G3Q9D9_GASAC/4-46-------------------------------------------------------------------------------L
W5MJW5_LEPOC/14-56-------------------------------------------------------------------------------I
G3W1A3_SARHA/8-50-------------------------------------------------------------------------------L
G1TLH6_RABIT/12-52-------------------------------------------------------------------------------L
Q7ZVA4_DANRE/5-47-------------------------------------------------------------------------------L
F1M053_RAT/24-66-------------------------------------------------------------------------------T
Q28J00_XENTR/12-54-------------------------------------------------------------------------------T
W5QIV3_SHEEP/4-46-------------------------------------------------------------------------------L
W5MJT4_LEPOC/29-71-------------------------------------------------------------------------------L
S10A8_MOUSE/5-47-------------------------------------------------------------------------------L
G1PYZ6_MYOLU/2-41-------------------------------------------------------------------------------M
G5ALL3_HETGA/8-50-------------------------------------------------------------------------------L
G1RM73_NOMLE/4-46-------------------------------------------------------------------------------L
F7DLP7_XENTR/4-43-------------------------------------------------------------------------------L
F6SK72_MONDO/8-50-------------------------------------------------------------------------------L
A0A3B1J4C7_ASTMX/4-46-------------------------------------------------------------------------------L
F7EU24_MONDO/4-46-------------------------------------------------------------------------------L
W5MMW1_LEPOC/5-47-------------------------------------------------------------------------------L
G3HUU5_CRIGR/4-47-------------------------------------------------------------------------------L

PF08976

EFCB6_HUMAN/1160-1260----------------------------------------------------------ATADRDILARLHKAV---TSHY
EFCB6_MOUSE/1177-1281----------------------------------------------------------ETAHRDIVARVQKAV---ASHY

PF17958

C3XU12_BRAFL/205-299-----------------------------------------------------------------------------D--
B7G4I4_PHATC/60-149-----------------------------------------------------------------------------D--
A0A016SS38_9BILA/210-299-----------------------------------------------------------------------------D--
A0A0G4IH42_PLABS/155-247-----------------------------------------------------------------------------D--
B1WBU2_RAT/216-305-----------------------------------------------------------------------------D--
L1J0P4_GUITC/43-132-----------------------------------------------------------------------------E--
A0A0L0DPX1_THETB/199-288-----------------------------------------------------------------------------D--
J9NVG5_CANLF/206-293-----------------------------------------------------------------------------D--
A0A0K9NSL5_ZOSMR/132-221-----------------------------------------------------------------------------D--

PF05517

U3I6W5_ANAPP/52-207------------------------------------------EDAFHKFAVYG----DTAA---SGNEMTGKN---FSKM
H9KVM3_CALJA/52-199------------------------------------------EEAFWHFAVHG----DTRA---TRREMHGKN---WSKL
Q22LY3_TETTS/4-144------------------------------------------SAAFKKFTNQ-------------RSTMDSKT---FVNT
F7A9H5_CIOIN/10-157------------------------------------------EAAYKKFMVMG----NSKA-----TKMTGKN---FAKC
D6WGQ8_TRICA/41-188------------------------------------------EENFKAFAKFG----DPKS---DGKLITLSN---SDKW
W5MNL1_LEPOC/11-166------------------------------------------QEAFRKFAIHG----DTKA---TGKEMNGKN---WAKL
D8LL72_ECTSI/5-152------------------------------------------EQIFLDFTSFG----AGQS---GSSEMDSAK---FVKL
G5E6W0_LOXAF/11-167------------------------------------------GKTFQRFVLFG----DSST---SGTEMNNKN---FSKL
A0A1X7VED0_AMPQE/9-173------------------------------------------EDVFQSFCSFG----EGLK---GSAAMDNAK---FAKL
H3CL48_TETNG/12-167------------------------------------------KIAFEKFAVHG----DTKA---TGKEMNGKN---FAKI
M9NFZ9_DROME/38-184------------------------------------------SDQFKAFSKFG----DSKS---DGKLITLSQ---SDKW
H3FV66_PRIPA/19-174------------------------------------------KAKWEAFSKFG------AA---TATEMTGKN---FDKW
Q4CVJ1_TRYCC/4-149------------------------------------------ESAFYAFASFG----GAP-----TKEMDNAH---FSKM
A4H7S2_LEIBR/5-150------------------------------------------QATFEAFASFG----SGP-----SKEMDNSH---FSKM
TPPP3_BOVIN/11-166------------------------------------------EESFRKFAIHG----DPKA---SGHEMNGKN---WAKL
T1FX30_HELRO/6-158------------------------------------------AEAFKQFATKA-----------DGKEQTTAD---FTKW
E2BTF0_HARSA/55-204------------------------------------------LTSFKAFSKFG----DPKS---DGKLITLSQ---SDKW
A0CF04_PARTE/6-146------------------------------------------QQVFLQFTAN-------------KPEMDGKT---FAKV
A0A068Y0H8_ECHMU/16-175------------------------------------------EKSFYAFCDSV------KK---GSTTCTDKT---LKKI
H9GHI6_ANOCA/5-160------------------------------------------ESTFRKFATYG----DTAA---SGNDMTSKN---FAKM
A7RHK7_NEMVE/7-164------------------------------------------HEIFKSFCAFG---AGCKD---AQPLMDNAK---FAKL
D6XFL0_TRYB2/2-147------------------------------------------EAVFYAFASFG----TAP-----TKEMDNAH---FSKM
H0WVY9_OTOGA/7-166------------------------------------------EKTFKKFAVFE----DSSS---NGTEINNKN---FSKL
G0QSX0_ICHMG/7-148------------------------------------------ETCFKAFTSG-------------KAEMDGKT---FAKV
M3XKY5_LATCH/10-165------------------------------------------QETFRKFASYG----DTKA---TGKEMTGKN---WSKL
B9PV11_TOXGV/5-144------------------------------------------DAVFKSFTHD-------------APAMDGRT---FVKL
J9EXN0_WUCBA/17-172------------------------------------------KHRWEGFVKFG------NA---SAVEMTGKN---FDKW
Q244Y3_TETTS/6-149------------------------------------------EGVFKKFTGG-------------KIEMDGKT---FAKF
A8J0Z0_CHLRE/6-151------------------------------------------KNAFIAFASYG----KGQM---MKQDMDNKN---FSKC
E5STC2_TRISP/24-181------------------------------------------RRRWELFSKFG------NQ---AAVEITGKN---FDKW
G5BFW3_HETGA/6-161------------------------------------------EKTFHRFVAFG----DTAS---SGTEMNNKN---FTKL
H3DM30_TETNG/57-212------------------------------------------EEAFRRFAIHG----DTRA---TGKEMHGKN---WSKL
T1EI86_HELRO/1-158------------------------------------------EDLFKSFCAFGADKHSSQS---AAAMLDGAK---FAKM
Q22LY5_TETTS/4-144------------------------------------------AAAFKKFTNE-------------KSSMDVKI---YLSV
A7SHU5_NEMVE/7-164------------------------------------------QAKFESFCAFG---AGAKG---AQPLMDNAK---FGKM
G4LUA3_SCHMA/5-165------------------------------------------EKIFYDFCDAV------KK---GSRTATDKT---IKKI
M3ZWD1_XIPMA/12-167------------------------------------------ETSFQKFAVHG----DTKA---TGKEMNGKN---FAKM
C3Z131_BRAFL/11-164------------------------------------------AESFKAFAIQG----DTKA---TGKDMTNKN---WAKM
H2Z4T4_CIOSA/7-154------------------------------------------EAVYKKFMVMG----DSKA-----TKMNSRN---FVKC
E9GKV1_DAPPU/13-160------------------------------------------TELFRAFAKFG----DSKA---DGKAISLSQ---SDKW
H0XJQ0_OTOGA/6-158------------------------------------------EKTFKKFAAFE----DSSS---NGTEINNKN---FSKL
A7URV3_ANOGA/71-217------------------------------------------KEQFKAFSKFG----DTKS---DGKHLTLSQ---SDKW
F6WLJ7_MONDO/51-206------------------------------------------EEAFRKFAIHG----DTRA---TGKEMHGKN---WSKL
H0XXQ3_OTOGA/6-162------------------------------------------EKTFQRFAVLG----DSSS---SGTEINNKN---FSKL
A0A2H2HXC5_CAEJA/15-170------------------------------------------KKKWDAFTKFG------AA---TATEMTGKN---FDKW
G3VDA5_SARHA/6-159------------------------------------------EKTFHLFAAFG----DSSS---SGSNLNNQN---FVKL
A5K8M9_PLAVS/2-146------------------------------------------ENAFYIYTKN-------------EADMDSRT---FVKI
A0A068YF49_ECHMU/5-161------------------------------------------QCAFLAFCDFC------HR---GSSTCSDKT---LRKI
W4Y3F2_STRPU/7-164------------------------------------------QDVFKSFCAFG---AGSKD---AAPVMDNSK---WGKM
H2XUF7_CIOIN/13-171------------------------------------------HNAFFRFARYG----EVNS---EGREMNNKN---WAKL
H0XB38_OTOGA/6-160------------------------------------------DKTFQWFAVLG----DFSS---SGAEINNKN---FSKL
F7FF94_MONDO/6-161------------------------------------------EKTFHHFAAYG----ESSS---SGNEIHNKN---FSKM
C3ZAW1_BRAFL/11-176------------------------------------------ADAFRAYATQD----NTEG---TGKEMTREN---FVKM
A0A068YM88_ECHMU/5-161------------------------------------------KAAFLAFCDFT------KK---GSTTCNDKT---LKKI
W5QEK4_SHEEP/6-161------------------------------------------ERTFQRFAVFG----ESSS---SGTEMNNKN---FSKL
E1ZBC5_CHLVA/14-160------------------------------------------RVVFTAFAAFGSGRDSGI-----SSGLEGRA---FSKI
Q244Y1_TETTS/6-149------------------------------------------EGVFKKFTAN-------------KADMDGKT---FAKF
W5MIZ3_LEPOC/12-166------------------------------------------ESTFKKFAVHG----DTKA---TGNEMTGKN---FVKL
TPPP3_XENTR/11-166------------------------------------------EESFRKFAIYG----DTKA---TGQEMTGKN---WAKL
Q8I557_PLAF7/2-146------------------------------------------ENAFYVYTKN-------------LPDMDSRT---FVKI
W4XA53_STRPU/13-167------------------------------------------KGVFQKYAVFG--------RPGQTKDITSKN---FSKM
I3J5F5_ORENI/11-166------------------------------------------LTAFRKFAVHG----DTKA---TGKDLTGKN---WAKL
H0WRT5_OTOGA/7-160------------------------------------------EKTFQRFAVLG----DSSS---SGAEINNKN---FSKL
K1P202_CRAGI/13-169------------------------------------------VEKMKAFALTQ------TK---NASKMDSKT---VGKL
D6WGQ9_TRICA/9-155------------------------------------------EQQFVNFSKFG----DTKA---DGRTITLTQ---IDKW

PF09069

DMD_MOUSE/3204-3295-------------------------------------------------------------------------------L
DTNA_HUMAN/144-232-------------------------------------------------------------------------------I
DMDA_DROME/3001-3101-------------------------------------------------------------------------------L
A2CJ03_DANRE/144-232-------------------------------------------------------------------------------I
DTN1_CAEEL/165-253-------------------------------------------------------------------------------L
Q7Q0M7_ANOGA/698-797-------------------------------------------------------------------------------L
Q8K0N0_MOUSE/144-232-------------------------------------------------------------------------------M
DMD_CAEEL/3205-3295-------------------------------------------------------------------------------L
A2CI99_DANRE/430-521-------------------------------------------------------------------------------I
A7RKW6_NEMVE/120-213-------------------------------------------------------------------------------L
DYTN_DANRE/122-217-------------------------------------------------------------------------------L
Q1RL59_CIOIN/141-229-------------------------------------------------------------------------------L
A7S5C8_NEMVE/466-557-------------------------------------------------------------------------------L
A4QNP9_XENTR/479-570-------------------------------------------------------------------------------V
A7RTQ0_NEMVE/138-234-------------------------------------------------------------------------------L
C3YXT6_BRAFL/1286-1377-------------------------------------------------------------------------------L
F6VUQ0_XENTR/3200-3291-------------------------------------------------------------------------------L
H0WG43_OTOGA/434-523--------------------------------------------------------------------------------
H2XWJ0_CIOIN/133-223-------------------------------------------------------------------------------I
H3C7H8_TETNG/23-109-------------------------------------------------------------------------------L
K1S5H9_CRAGI/1375-1466-------------------------------------------------------------------------------L
Q0E9B2_DROME/135-223-------------------------------------------------------------------------------L

PF09279

H2MJ50_ORYLA/181-266------------------------------------------------------------------------F---YKIL
M3ZWC2_XIPMA/213-298------------------------------------------------------------------------F---YQML
H2M8R0_ORYLA/202-286------------------------------------------------------------------------L---YDLL
W5KFE6_ASTMX/198-283------------------------------------------------------------------------F---YKML
F1Q876_DANRE/191-276------------------------------------------------------------------------F---YKML
W5NRL0_SHEEP/229-314------------------------------------------------------------------------F---YKIL
G1KDV8_ANOCA/226-311------------------------------------------------------------------------F---YKIL
G1MWH7_MELGA/230-314------------------------------------------------------------------------F---YKIL
PLCD4_MOUSE/198-283------------------------------------------------------------------------F---YKAL
H3BWJ1_TETNG/194-279------------------------------------------------------------------------F---YKML
G5AZI5_HETGA/222-307------------------------------------------------------------------------F---YKAL
G3WSY3_SARHA/199-284------------------------------------------------------------------------F---YRAL
I3KEU9_ORENI/224-308------------------------------------------------------------------------F---YDLL
H3BDF5_LATCH/223-308------------------------------------------------------------------------F---YKML
E7F646_DANRE/198-283------------------------------------------------------------------------F---YKML
W5MR93_LEPOC/213-298------------------------------------------------------------------------F---YKML
F6V4E2_XENTR/202-286------------------------------------------------------------------------F---YKIL
F6QRY0_ORNAN/196-280------------------------------------------------------------------------F---YKML
H3B651_LATCH/225-309------------------------------------------------------------------------F---YKEL
G3W0U2_SARHA/202-287------------------------------------------------------------------------F---YRKL
G1KB08_ANOCA/61-146------------------------------------------------------------------------F---YKAL
G3NDC5_GASAC/191-276------------------------------------------------------------------------F---YKIL

PF14513

F6ZFB7_CALJA/6-148-----------------------------------------------------------------------------K-W
E1B9E4_BOVIN/5-175-----------------------------------------------------------------------------R-W
U3II99_ANAPP/6-153-----------------------------------------------------------------------------K-W
F6YSP6_CALJA/4-110-----------------------------------------------------------------------------E-R
H2MKP7_ORYLA/9-113-------------------------------------------------------------------------------V
H2UR48_TAKRU/9-113-------------------------------------------------------------------------------V
H2U3N1_TAKRU/8-112-------------------------------------------------------------------------------E
W5KDQ2_ASTMX/10-113--------------------------------------------------------------------------------
M3ZSU8_XIPMA/5-232-----------------------------------------------------------------------------S-W
G3RAX1_GORGO/5-175-----------------------------------------------------------------------------R-W
H0WRZ7_OTOGA/5-174-----------------------------------------------------------------------------Q-W
I3K800_ORENI/6-152-----------------------------------------------------------------------------S-W
U3JL51_FICAL/5-234-----------------------------------------------------------------------------M-W
I3JHD4_ORENI/6-145-----------------------------------------------------------------------------K-W
H2Z7Y7_CIOSA/8-229-----------------------------------------------------------------------------E-F
G3N5L2_GASAC/7-146-----------------------------------------------------------------------------T-E
H3B0Y1_LATCH/8-204-----------------------------------------------------------------------------E-W
A4III1_XENTR/6-142-----------------------------------------------------------------------------K-W
G1L8T2_AILME/5-139-----------------------------------------------------------------------------E-R
G1P0J0_MYOLU/10-149-----------------------------------------------------------------------------E-R
F7DBT3_XENTR/7-143-----------------------------------------------------------------------------E-W
G1MWU5_MELGA/5-169-----------------------------------------------------------------------------G-W
G1KN57_ANOCA/6-147-----------------------------------------------------------------------------K-W
W5MZM3_LEPOC/6-149-----------------------------------------------------------------------------K-W
I3KSY7_ORENI/8-175-------------------------------------------------------------------------------E
H2Z7Y5_CIOSA/5-166-----------------------------------------------------------------------------E-F
F7ED12_MONDO/6-214-------------------------------------------------------------------------------W
F2Z409_MOUSE/5-172-----------------------------------------------------------------------------Q-W
G3W1Q3_SARHA/9-144--------------------------------------------------------------------------------
F6YZZ7_CIOIN/5-138-----------------------------------------------------------------------------E-F
H9GAH1_ANOCA/6-144-----------------------------------------------------------------------------E-W
G1KHJ2_ANOCA/5-267-----------------------------------------------------------------------------T-W
L8XZH6_TUPCH/5-175-----------------------------------------------------------------------------L-W
G0MJW5_CAEBE/2-168--------------------------------------------------------------------------------
G3P9R0_GASAC/6-148-----------------------------------------------------------------------------E-V

PF02761

H3FMQ3_PRIPA/172-254-----------------------------------------------------------------------------FRL
G4VQX3_SCHMA/130-213-----------------------------------------------------------------------------FRI
G1KFF7_ANOCA/171-254-----------------------------------------------------------------------------FRI
F6YDP2_CIOIN/175-258-----------------------------------------------------------------------------YRI
C3Y0Y7_BRAFL/117-200-----------------------------------------------------------------------------FRI
F2UL73_SALR5/161-243-----------------------------------------------------------------------------FTI
H3AWW8_LATCH/130-213-----------------------------------------------------------------------------YRV
Q6ABG8_CAEEL/170-254-----------------------------------------------------------------------------FRM
D3B844_POLPP/283-361------------------------------------------------------------------------------QL
K1Q5V0_CRAGI/164-247-----------------------------------------------------------------------------FRI
A0A0D2WMR8_CAPO3/199-281------------------------------------------------------------------------------KI
I3JZS6_ORENI/156-239-----------------------------------------------------------------------------YRV
A0A068Y1R3_ECHMU/177-260-----------------------------------------------------------------------------FRI
A0A1I7VGC1_LOALO/171-254-----------------------------------------------------------------------------FRI
W5M9V8_LEPOC/138-221-----------------------------------------------------------------------------YRL
T1I3T8_RHOPR/164-245-----------------------------------------------------------------------------FRI
W5K157_ASTMX/160-243-----------------------------------------------------------------------------YKL
B3RTT8_TRIAD/175-258-----------------------------------------------------------------------------YRI
T1ELS4_HELRO/107-190-----------------------------------------------------------------------------FRV
G3NGI5_GASAC/156-239-----------------------------------------------------------------------------YRV
T1FD14_HELRO/187-270-----------------------------------------------------------------------------FRI
H2W705_CAEJA/171-255-----------------------------------------------------------------------------FRI
G1PX47_MYOLU/76-159-----------------------------------------------------------------------------YQL
G3VNM8_SARHA/32-115-----------------------------------------------------------------------------YQL
T1FF20_HELRO/19-102-----------------------------------------------------------------------------YRI

PF08414

B9N4H8_POPTR/117-215KYDRSKS-GAA--RALKGLK-FMTKN----VGS--EGWSEIEARFHELAV---NGS------------LPKSK---FGQC
F6HUN7_VITVI/163-262QLDRTRS-GAQ--KALRGLR-FISA-----KTNSVDAWNEVQSNFDKLAK---DGF------------LNRSD---FAQC
M0T675_MUSAM/93-191KVDRSRS-AAA--HALKGLK-FITKT----DGA--AGWLAVEKRFDELAA---DGA------------LPRSL---FAQC
RBOHB_SOLTU/103-201KIDRSKS-GAA--RALRGLQ-FMNKN----VGT--EGWSEVESRFDQLAV---NGM------------LTKSL---FGQC
D8RJR0_SELML/139-241-LARSRS-GAE--TALQGLR-YISRAI--ESADQKAVWEAVEMRFQQLAK--PDGM------------LDRGD---FGLC
RBOHI_ARATH/157-258RPNRDGS-GTE--RAIHGLK-FISS-----KENGIVDWNDVQNNFAHLSK---DGY------------LFKSD---FAHC
D7M0I4_ARALL/120-219RLRRSKS-RAE--QALKGLK-FITKT----DGV--TGWPEVEKRFYVITMT-TNGL------------LHRSK---FGEC
I1KP11_SOYBN/126-226-FERTKS-AVG--HALTGLK-FISKT----DGG--AGWVEVEKRFHKLTAT-TDGY------------LPRAL---FAQC
I1JXT0_SOYBN/144-244-YDRNKS-AAS--HALKGLK-FISKT----DAG--AGWVEVERQFDALTAS-TNGY------------LHRSL---FAKC
W1NIQ4_AMBTC/80-182RMVRTKS-RAE--RGLRSLR-FLDKA---SGNKEGEGWNAVQKRFNQFAV---EGR------------VSRDN---FGQC
M4DRP6_BRARP/55-154RLDRSKS-TTG--QALRGLK-FISKA----DGA--DGWTAVEERFETITKT-TEGL------------LIRSK---FGEC
W1PEN5_AMBTC/143-247RLERTRS-GAK--EALKGLR-FISKTATAGGGDSGEMWPQVAARFDKLAK---DDL------------LCRHD---FAAC
RBOHH_ARATH/96-198RVERTTS-SAA--RGLQSLR-FLDRT---VTGRERDAWRSIENRFNQFSV---DGK------------LPKEK---FGVC
D7SKP3_VITVI/70-171-LGRSTS-GAA--RGLNSLR-FLDRT---TTGKEGDAWKPVQKRFKQHAV---EGK------------LYKEK---FGVC
B9RA34_RICCO/132-232RLDRTKS-AAA--HALKGLK-FISKT----DGG--AGWAAVEKRFDDITAS-TDGL------------LPRSR---FCEC
D8S6L0_SELML/29-123----TTS------RAIEGLR-FID------KSNRDTNWETVDARFRKLSAGRPDGR------------LARSD---FGAC
D8SFH9_SELML/97-199RLPRTKS-SAE--TAIKGLR-FISKAT--EKADREQLWQDVATRFDSLAV---DGF------------LSRAD---FGAC
D8RTB2_SELML/132-233RLARSKS-GAE--HALQGLR-FISK-----SNNQKLAWELVSRRFDKLAS--EEGF------------IDKSD---FGLC
M4EQJ9_BRARP/175-279KLQRTRS-SAQ--RALQGLQ-FINKTTKGNSCGCDEMWKKVEKRFETLSK---EGL------------LAREY---FGEC
D8RMU6_SELML/118-222-LSRSKS-GAE--NALHGLR-FITKAG-ANAADRSALWKSVEERFDKLAS--PEGL------------LKRGD---FGQC
RBOHF_ARATH/168-267QLDRTRS-SAQ--RALRGLR-FISN-----KQKNVDGWNDVQSNFEKFEK---NGY------------IYRSD---FAQC
M0TXQ4_MUSAM/85-185QLDRSRS-GAK--KALRGLR-FISGN----KANGVDAWNEVQSNFDKLAR---DGY------------LSRSD---FAQC
T1MKF7_TRIUA/55-151RLDRSMS-SAP-AQALEGLK-FISET----DAS--KGWTSAAGFFDTNSQ---NDL------------LSRSM---FGEC
D8R7W0_SELML/14-117------N-NVN--SALEGLR-FIDKRT--ASAGDEAVWHRVMERFEKLSS--SDGK------------LPPGR---FGAC
I1NT28_ORYGL/72-172RMTRMQS-SAQ--VGLRGLR-FLDK-----TSGGKEGWKSVERRFDEMNR---NGR------------LPKES---FGKC
B9T3J8_RICCO/113-215KVERTAS-SAA--RGLKSLR-FLDRT---VTGKEMDAWRSIEKRFIQFAV---DDR------------LPRDK---FGAC
I1HR95_BRADI/164-262QLDRTRS-GAH--RALRGLR-FIS------SNKANNAWREVQANFDRLAR---DGY------------LSRSD---FAEC
D7TCA4_VITVI/132-234KLQRTRS-SAQ--QALKGLR-FIRKTT--GASDADELWKKVESRFKSLAK---DGL------------LSRED---FGEC
F6HJ86_VITVI/142-244-FDRTKS-AVT--HALKGLK-FITTK----AGGGAAGWPAVEKRFDELTAP-TNGH------------LHFSL---FCEC
I1R0R3_ORYGL/166-263RFDRSKS-AAA--HALKGLK-FISRA----DGG--AGWPAVEKRFDDLAK---DGL------------LPRSK---FGQC
M4EWG7_BRARP/136-239RLNRNGS-CTQ--RAIHGLR-FISS-----KENEIAAWSEVRDKFANLSK---DGY------------LCRSD---FGRC
W1P925_AMBTC/141-239RFDRTKS-AAA--HALKGLK-FISKT----DGA--SGWPAVEKRFDELAV---NGV------------LPKAL---FGQC
M0RF57_MUSAM/85-177-----RT-TAA--SGAKGLR-FLDK-----KAG---GWKAVEKRFDQFAV---DGR------------LPKES---FGRC
M1B9G4_SOLTU/16-111-MVRIES-GAA--RGFKSLH-FLDNT----TGKEADAWKNVEKRFHLNAV---NGI------------LFKNK---FGPS
A0A3Q7H3H8_SOLLC/65-167RMGRMES-GAT--RGLKSLR-FLDRS---TTGKEGDAWRSVEKRFNQNAV---NGR------------IFREK---FGTC
M0T222_MUSAM/95-193RLDRTKS-SAA--QAIKGLQ-FVAKN----VAS--EGWPQVERRFDELAV---DGV------------LLRSR---FGKC
I1MT65_SOYBN/66-167---RSHI-IEN--EAIQGVG-FINGI----DGHSGMEWKDLEKRFDQVART-GSGAE---------PVVTWSE---FGFC
RBOHD_SOLTU/97-197-FDRSST-AAQ--NALKGFK-FISKT----DGG--SGWDTVQQRFDELTAT-SDSL------------LPRAK---FGEC
A0A3B6NPZ8_WHEAT/154-256RLDRSLS-GAR--RALKGLR-FISHAT--GSAEATALWGAVEERFDALSR---DGL------------LARDD---FGDC
K7MZX6_SOYBN/118-216RVDRTKS-GAA--RALKGLK-FMTKN----VGT--EGWSQVEKRFHELAV---EGK------------LPKTR---FSQC
M4D603_BRARP/67-157-LDRQDS------TALTALR-FISKA---------------------------DGVTVLLAGPPSRIGLLRSRPLVVDCC
RBOHC_SOLTU/147-248RFDRNKS-AAA--HALKGLK-FISKT----DGG--AGWAAVEKRFDEITAP-TTGL------------LPRAK---FGEC
U5GAM0_POPTR/143-246KLDRSKL-SAQ--RGLKGLR-FINKTT-GTTSESNELWKRVESRFKLLSK---DGL------------LARED---FGEC
M4EK77_BRARP/135-234KLDRTKS-AAA--QALKGLK-FISKN----DGG--AGWSAVEKRFNQITAT-TGGL------------LIRTK---FGEC
B9RR53_RICCO/151-253KLQRTRS-GAQ--QALKGLR-FINKTT--GDSDANELWRRVELRFNSLAI---DGL------------LARED---FGEC
I1KJX2_SOYBN/78-181KMMRTES-GAA--RGIKGLR-FLDRT---VTGRETDAWKSIEKRFTQNAV---DGK------------LTKDK---FGTC
M4DBK2_BRARP/96-192--SRSKF-DSS--EALKGFTMFISMT--------DAGWIAVERRFDKMTAK-TGGL------------LDPLN---FGEC
M8ABG8_TRIUA/19-118RIDRSNS-KPVATHALEGLK-FISGT----NGS--AEWTAAEGIFDKKAR---NGR------------LPRSK---FGKC
W1P7B1_AMBTC/105-208RLSRQKS-GAE--GALHGLR-FISKAT--EDSDFKTLWESAAARFDRLAS--ADGL------------LSRSD---FGNC
F4HZD8_ARATH/74-173RLDRSKSFGAM--FALRGLR-FIAK-----NDAVGRGWDEVAMRFDKLAV---EGK------------LPKSK---FGHC
B9RG33_RICCO/147-250RFDRTKS-AAA--HALKGLK-FIAAK----TGSSANGWSSVEKRFQQLTVN-TDGL------------LHCSL---FGEC
E0CSL2_VITVI/88-182-----NS-AAL--HALTGLK-FIRQT----DGS--AGWPDVEKSFQQLTDS-TNGL------------LPRSR---FAEC
RBOHA_SOLTU/182-279QLDRTRS-SAH--KALRGLK-FISN-------NKTNGWNEVENNFAKLAK---DGY------------LYRSD---FAQC
M0TT21_MUSAM/102-204-LSRSSS-TAS--RIRRKFS-WLLRTT-TATANLAELWGRVEDRFAVLAK---DGL------------LSRED---FGEC
M4F8V8_BRARP/159-258RFDRTSS-AAV--HALKGLK-FIATK----T----AAWPAVDQRFDKLSLD-SNGL------------LLSSK---FWEC
D8SW62_SELML/70-163---RTKS------NALQGLR-FLTG-----KNKKKVSWLDIERRFTVLAV---DGS------------LSREK---FGEC
D8SPF0_SELML/28-131QLSRSMS-GTE--YAIEGLR-FIEKTI--ASKNAKSQWEAVELRFHKLAN--EECR------------LSRSD---FGEC
D7MGJ6_ARALL/91-190RLDRSKS-TAG--QALKGLK-LISKT----DGN--AAWTVVEKRYLKITAN-TDGL------------LLRSK---FGEC
F6I4L7_VITVI/126-222--DRSKS-SAT--RALKGLQ-FMTKN----VGN--EGWSAIEKRFDQLSV---NGA------------LPKSS---FGQC

PF17901

F4Q0R8_CAVFA/437-529--------------------------------------------------------------------------------
L8HD01_ACACA/528-620--------------------------------------------------------------------------------
L8GWB9_ACACA/342-434--------------------------------------------------------------------------------
A0A152A2U6_9MYCE/589-680--------------------------------------------------------------------------------
D3BJ33_POLPP/584-676--------------------------------------------------------------------------------
F0Z7T3_DICPU/562-653--------------------------------------------------------------------------------
F4Q5C0_CAVFA/555-647--------------------------------------------------------------------------------
A0A151ZGP8_9MYCE/237-329--------------------------------------------------------------------------------
F4PGA4_CAVFA/594-686--------------------------------------------------------------------------------

PF08763

F1NY22_CHICK/1789-1866--------------------------------------------------TSTLMALIRTALEIKLASG---GVKQHQC-
E7F278_DANRE/1735-1819--------------------------------------------------TSTLMALIRTALEIKLASG-----VLAQRI
F1R736_DANRE/1453-1527--------------------------------------------------NATLFALVRTALKIKT--D----GNPDQE-
H2TAB1_TAKRU/1471-1546--------------------------------------------------TSTLMSLIRTALDIKIARG----EDRIGL-
W5L9F3_ASTMX/1727-1800------------------------------------------------------MALIRTALEIKLASG-----MVAQRL
G3HNB4_CRIGR/14-88--------------------------------------------------NATLFALVRTSLKIKT------EGNLDQA-
H9JEF0_BOMMO/1384-1462--------------------------------------------------TTTLFALIRENLNIKMRSA----EEMDQA-
E9HRP6_DAPPU/1430-1508--------------------------------------------------TSTLFALIRENLSIKMRPA----DEMDEA-
B3RN16_TRIAD/1365-1441--------------------------------------------------KATLFALIRTSLKIKV--------REDQHE
W4Y7I6_STRPU/1459-1538--------------------------------------------------TSTLMALIRTALDIKIGS------VADRDR
T1G1F3_HELRO/1329-1408--------------------------------------------------TTTFFALIRESLSIRMGPA----SEMNKQ-
K1Q7D2_CRAGI/1585-1666--------------------------------------------------TTTLFALIRESLSIKMGPV----EEMDKL-
G3UNS2_LOXAF/1818-1895--------------------------------------------------TSTLMALIRTALEIKLAPG-----EQDDSE
T1K0U4_TETUR/1589-1666---------------------------------------------------TTLFALIRENLSIKMRPA----DEMDIA-
A0A068Y901_ECHMU/1470-1548--------------------------------------------------TTTLFALIRESLSIKMGPA----EIMDQR-
F6Q8W5_CIOIN/1720-1800--------------------------------------------------TTTLLALIRTSLKIKMLPQD--AAGIDQWQ
G3UIK5_LOXAF/1816-1889--------------------------------------------------TSTLMALIRTALEIKLAPG-----EQD---
Q5TTU5_ANOGA/1402-1480--------------------------------------------------TTTLFALIRENLSIKMRPA----EEMDQA-
W5M0J9_LEPOC/1810-1887--------------------------------------------------TSTLMALIRTALEIKLGSG-----VIQQQL
A7RNU9_NEMVE/1479-1557--------------------------------------------------NATLFGLVRTSLSIKRP--E-GKGSLEKA-
J9KXL5_ACYPI/1531-1606--------------------------------------------------NATLFAVVRTSLHIKS------EGNIDDA-
F2UMP7_SALR5/1329-1405--------------------------------------------------HACLLAIVRNQLHIKT---SYLDGSWEQR-
K7IRC4_NASVI/1546-1624--------------------------------------------------TTTLFALIRENLSIKMRNA----DEMDQA-
G3Q1X3_GASAC/1792-1881--------------------------------------------------TSTLMALIRTALDIKLASG-----VLAQHL
H9JV40_BOMMO/1394-1469--------------------------------------------------NATLFAVVRTQLQIKT------TGVIDEC-
T1FZJ7_HELRO/1421-1497---------------------------------------------------TTMFALVRESLGIKMGDA----EVMDQL-
F6X5E1_CIOIN/1510-1584--------------------------------------------------NATLFALIRTSLNIKT------EGNIDQA-
T1EHR1_HELRO/1522-1600---------------------------------------------------TTLFALIRESLGIRMGPA----DEMNKN-
F6TVG9_ORNAN/1799-1872--------------------------------------------------TSTLMALIRTALEIKLAPA-----HCVQGM
B3RIC6_TRIAD/1385-1459--------------------------------------------------NATIFALVRKQLKIKL------DGNLDLR-
G3TNN5_LOXAF/1391-1465--------------------------------------------------NATLFALVRTALKIKT------EGKHSLA-

PF08356

D6X1S3_TRICA/224-310-----------------------------------------------------------------------------APL
H2AZK5_KAZAF/234-326-----------------------------------------------------------------------------KNI
B6JZA2_SCHJY/219-305-----------------------------------------------------------------------------KMF
S9VQ26_SCHCR/219-305-----------------------------------------------------------------------------KQL
GEM1_SCHPO/219-305-----------------------------------------------------------------------------KNL
C4R5B1_KOMPG/221-306-----------------------------------------------------------------------------KTI
W1Q826_OGAPD/220-306-----------------------------------------------------------------------------KSL
A5DVJ0_LODEL/274-353-----------------------------------------------------------------------------DIV
A9TB50_PHYPA/223-310-----------------------------------------------------------------------------APL
M1AZB8_SOLTU/162-248-----------------------------------------------------------------------------APL
M4D0F4_BRARP/250-337-----------------------------------------------------------------------------APL
D7L3S7_ARALL/230-317-----------------------------------------------------------------------------TPL
M4CAB7_BRARP/209-296-----------------------------------------------------------------------------EPM
I1N9H1_SOYBN/229-315-----------------------------------------------------------------------------APL
A9UVP4_MONBE/225-311-----------------------------------------------------------------------------QPL
K7IPW0_NASVI/232-318-----------------------------------------------------------------------------TPL
MIRO_DROPS/243-329-----------------------------------------------------------------------------TPL
A0A212ERP1_DANPL/224-310-----------------------------------------------------------------------------SPL
T1IGN0_RHOPR/225-312-----------------------------------------------------------------------------MPL
E0V9W9_PEDHC/49-135-----------------------------------------------------------------------------VPL
J9JNF1_ACYPI/231-316-----------------------------------------------------------------------------LPL
T1FXI2_HELRO/218-305-----------------------------------------------------------------------------VPL
E9H688_DAPPU/223-309-----------------------------------------------------------------------------TSL
B7PAT4_IXOSC/210-296-----------------------------------------------------------------------------TPL
W4ZII8_STRPU/6-92-----------------------------------------------------------------------------APL
W5N8K8_LEPOC/219-305-----------------------------------------------------------------------------TPL
C3YJ97_BRAFL/219-305-----------------------------------------------------------------------------APL
K1Q3S2_CRAGI/221-307-----------------------------------------------------------------------------APL
A7SCK4_NEMVE/221-308-----------------------------------------------------------------------------SPL
B3SDQ1_TRIAD/219-306-----------------------------------------------------------------------------TPL
H3BKJ1_MOUSE/9-95-----------------------------------------------------------------------------HPL
F7BZ68_MONDO/219-305-----------------------------------------------------------------------------NPL
H2ZV29_LATCH/152-238-----------------------------------------------------------------------------NPL
GEMA_DICDI/226-312-----------------------------------------------------------------------------ETM
D3AZH4_POLPP/246-331-----------------------------------------------------------------------------QPM
A0A0D2WRN5_CAPO3/234-320-----------------------------------------------------------------------------APL
U5H7W0_USTV1/225-315-----------------------------------------------------------------------------APL
A8Q530_MALGO/224-314-----------------------------------------------------------------------------APL
M5E520_MALS4/221-311-----------------------------------------------------------------------------APL
S8G4E6_FOMPI/221-307-----------------------------------------------------------------------------APL
F4P5Q3_BATDJ/220-308-----------------------------------------------------------------------------APL
R9AGC1_WALI9/85-176-----------------------------------------------------------------------------SPL
I4YJ35_WALMC/206-297-----------------------------------------------------------------------------TPL
GEM1_CRYNJ/255-342-----------------------------------------------------------------------------TPL
L0P7N5_PNEJ8/168-254-----------------------------------------------------------------------------KPM
R1GF81_BOTPV/219-305-----------------------------------------------------------------------------KPL
E5A5W2_LEPMJ/220-306-----------------------------------------------------------------------------KPL
F9X9N5_ZYMTI/220-313-----------------------------------------------------------------------------KPL
N1Q8U5_PSEFD/220-313-----------------------------------------------------------------------------KQL
M2NKM3_BAUPA/221-309-----------------------------------------------------------------------------KPL
N1QJP4_SPHMS/218-311-----------------------------------------------------------------------------KSL
N1Q268_DOTSN/220-313-----------------------------------------------------------------------------KPL
L8FXF5_PSED2/220-306-----------------------------------------------------------------------------KPL
N4VCM2_COLOR/220-306-----------------------------------------------------------------------------KQL
C9SSV4_VERA1/220-306-----------------------------------------------------------------------------KPL
Q2GS71_CHAGB/221-307-----------------------------------------------------------------------------KPL
B2ARQ2_PODAN/220-306-----------------------------------------------------------------------------KPL
G0S8Z5_CHATD/223-309-----------------------------------------------------------------------------KPL
F7W654_SORMK/221-307-----------------------------------------------------------------------------KPL
G4NCS1_MAGO7/227-313-----------------------------------------------------------------------------KPL
E9E0R5_METAQ/220-306-----------------------------------------------------------------------------KPL
G0RNJ5_HYPJQ/221-308-----------------------------------------------------------------------------KPL
G2YSC4_BOTF4/220-306-----------------------------------------------------------------------------KPL
N1JHH3_BLUG1/221-307-----------------------------------------------------------------------------KPL
K1WJA2_MARBU/246-332-----------------------------------------------------------------------------KPL
A6RHB1_AJECN/221-307-----------------------------------------------------------------------------KPL
E5R159_ARTGP/221-307-----------------------------------------------------------------------------KHL
GEM1_EMENI/222-308-----------------------------------------------------------------------------KPL
H6C9S2_EXODN/220-306-----------------------------------------------------------------------------KGL
S8ADP6_DACHA/219-305-----------------------------------------------------------------------------KSL

PF03556

H2LY45_ORYLA/148-258-----------------------------------------------------------------------------KLK
H3FG64_PRIPA/552-660-------------------------------------------------------------------------------A
W5L397_ASTMX/115-225-----------------------------------------------------------------------------RLQ
I3MAS7_ICTTR/136-246-----------------------------------------------------------------------------KLR
C5G8Y4_AJEDR/134-257-----------------------------------------------------------------------------KQT
C1H704_PARBA/102-225-----------------------------------------------------------------------------KQA
D7T539_VITVI/34-148-----------------------------------------------------------------------------KLQ
G8BR62_TETPH/138-258-----------------------------------------------------------------------------DIK
V5GH37_BYSSN/134-257-----------------------------------------------------------------------------KMI
G3B9I5_CANTC/116-236-----------------------------------------------------------------------------QMK
S2JCL9_MUCC1/109-221-----------------------------------------------------------------------------DFK
K1VC92_TRIAC/50-171-----------------------------------------------------------------------------KMK
C5DY54_ZYGRC/125-244-----------------------------------------------------------------------------QMG
S2JGE7_MUCC1/136-244-----------------------------------------------------------------------------KLR
DCN1_CANGA/142-266-----------------------------------------------------------------------------QMR
Q7SB96_NEUCR/149-275-------------------------------------------------------------------------------R
S3CSX7_GLAL2/146-267-----------------------------------------------------------------------------KQK
G9NRR7_HYPAI/139-258------------------------------------------------------------------------------HA
A5DDG0_PICGU/129-251-----------------------------------------------------------------------------EMK
G8ZXB5_TORDC/133-253-----------------------------------------------------------------------------QMR
A0A3Q7HZ64_SOLLC/109-223-----------------------------------------------------------------------------KLK
A3LQ63_PICST/129-280-----------------------------------------------------------------------------GMK
DCN1_YARLI/127-237-----------------------------------------------------------------------------KLC
G2RAS4_THITE/168-328-----------------------------------------------------------------------------QQR
B5RU94_DEBHA/134-256-----------------------------------------------------------------------------GMR
G0ME26_CAEBE/139-270-----------------------------------------------------------------------------ALR
S9VWD1_SCHCR/125-240-----------------------------------------------------------------------------DLK
I2GVN9_TETBL/138-259-----------------------------------------------------------------------------DIK
H9JN87_BOMMO/67-177-----------------------------------------------------------------------------KLQ
M2LTP0_BAUPA/133-254-----------------------------------------------------------------------------RMR
E0W2G2_PEDHC/125-240-----------------------------------------------------------------------------SIS
B9IMH9_POPTR/110-224-----------------------------------------------------------------------------KLK
G3YAG5_ASPNA/50-173-----------------------------------------------------------------------------KMI
S7ZQ76_PENO1/133-256-----------------------------------------------------------------------------KMA
C5DMX0_LACTC/126-247-----------------------------------------------------------------------------QIK
F0ZZ17_DICPU/136-243-----------------------------------------------------------------------------QVK
DCN1_CRYNJ/138-271-----------------------------------------------------------------------------KLK
B3RIE9_TRIAD/14-124-----------------------------------------------------------------------------KLK
F6YWK0_CIOIN/51-162-----------------------------------------------------------------------------KLE
H2AZ80_KAZAF/137-261-----------------------------------------------------------------------------DIK
B7Q426_IXOSC/121-231-----------------------------------------------------------------------------KIQ
G0SFU8_CHATD/122-273-----------------------------------------------------------------------------SQK
DCN1_SCHPO/125-240-----------------------------------------------------------------------------QLK
B0D749_LACBS/131-267-----------------------------------------------------------------------------GMK
T1HB94_RHOPR/195-310-----------------------------------------------------------------------------GIQ
A0A1X7VSW2_AMPQE/166-279-----------------------------------------------------------------------------SLK
A0A0D2UGU2_CAPO3/187-298-----------------------------------------------------------------------------KLK
W5G2J7_WHEAT/128-239-----------------------------------------------------------------------------KLR
A0A0K3CPU2_RHOTO/158-273-----------------------------------------------------------------------------RQK
A0A0C4EFW8_MAGP6/135-270-----------------------------------------------------------------------------SQK
R4X759_TAPDE/129-239-----------------------------------------------------------------------------GMK
C4R168_KOMPG/134-250-----------------------------------------------------------------------------EMR
M2QFX1_CERS8/129-263--------------------------------------------------------------------------------
J8THY6_SACK1/55-175-----------------------------------------------------------------------------DMQ
A0A0I9N576_BRUMA/137-247-----------------------------------------------------------------------------KLK
C1N6T2_MICPC/84-196--------------------------------------------------------------------------------
R9ACM3_WALI9/128-264-----------------------------------------------------------------------------KQK
W5PEY9_SHEEP/133-244------------------------------------------------------------------------------VR
B8CDZ1_THAPS/117-233--------------------------------------------------------------------------------
Q16FK0_AEDAE/86-197-----------------------------------------------------------------------------DIK
S2JHJ8_MUCC1/136-243-----------------------------------------------------------------------------KLK
M9MRX5_DROME/88-198-----------------------------------------------------------------------------KMV
D2VHW0_NAEGR/153-261-----------------------------------------------------------------------------DMK
S3C3S1_OPHP1/224-347-----------------------------------------------------------------------------EQK
K9GAC2_PEND2/132-255-----------------------------------------------------------------------------KMQ
J7S944_KAZNA/134-257-----------------------------------------------------------------------------EMK
A0A068Y0K0_ECHMU/152-264-----------------------------------------------------------------------------TLR
E3MD25_CAERE/204-345-----------------------------------------------------------------------------TLR
DCN1M_DICDI/149-260-----------------------------------------------------------------------------TLK
DCN1_USTMA/158-305-----------------------------------------------------------------------------KQK
D3BAI5_POLPP/166-278-----------------------------------------------------------------------------KLQ
G1TIN3_RABIT/101-216-----------------------------------------------------------------------------GIC
DCN1_CAEEL/139-270-----------------------------------------------------------------------------NLR
A0A0D2U416_CAPO3/136-246-----------------------------------------------------------------------------KLK
M4CB88_BRARP/129-240-----------------------------------------------------------------------------KLQ
D8LFS0_ECTSI/150-262-----------------------------------------------------------------------------QLR
E9GIK2_DAPPU/126-236-----------------------------------------------------------------------------KLQ
E4V400_ARTGP/104-227-----------------------------------------------------------------------------KQA
A0A0D2Y224_FUSO4/53-173------------------------------------------------------------------------------HA
D8TPE8_VOLCA/146-261-----------------------------------------------------------------------------KLR
A5E066_LODEL/10-166--------------------------------------------------------------------------------
F4Q622_CAVFA/120-233-----------------------------------------------------------------------------TLK
D2VND8_NAEGR/143-256-----------------------------------------------------------------------------QLK
G0VCV6_NAUCC/55-177-----------------------------------------------------------------------------QMK
A4HBF0_LEIBR/125-237-----------------------------------------------------------------------------QLR
W5N9R7_LEPOC/183-293-----------------------------------------------------------------------------KLR
H3G9A2_PHYRM/23-135-----------------------------------------------------------------------------KLK
F4PRH7_CAVFA/130-239-----------------------------------------------------------------------------KLK
DCN1_ASHGO/128-248-----------------------------------------------------------------------------DMR
C4XZR6_CLAL4/116-242-----------------------------------------------------------------------------GMR
J9K3D7_ACYPI/140-250-----------------------------------------------------------------------------KLK
W1PLA6_AMBTC/111-225-----------------------------------------------------------------------------KLK
I2G5J2_USTH4/162-309-----------------------------------------------------------------------------KQQ
I1GS18_BRADI/62-167-----------------------------------------------------------------------------KLM
F2UI03_SALR5/83-196-----------------------------------------------------------------------------DMK
E9EQZ3_METRA/60-179-------------------------------------------------------------------------------A
F4RWX1_MELLP/224-342------------------------------------------------------------------------------QK
B4LH87_DROVI/132-242-----------------------------------------------------------------------------KLK
A8NI83_COPC7/137-274-----------------------------------------------------------------------------GLK
K2RLT3_MACPH/152-275-----------------------------------------------------------------------------KQK
U5HJN4_USTV1/143-258------------------------------------------------------------------------------QR
Q4Q0J0_LEIMA/122-259--------------------------------------------------------------------------------
Q6CQK8_KLULA/169-294-----------------------------------------------------------------------------KMK
H6BNM3_EXODN/169-294-----------------------------------------------------------------------------RQS
F2UGU4_SALR5/118-237-----------------------------------------------------------------------------QLA
A7EE19_SCLS1/135-256-----------------------------------------------------------------------------KQK
G5BM30_HETGA/136-244-----------------------------------------------------------------------------KLK
N1JBE0_BLUG1/143-264-----------------------------------------------------------------------------KQK
DCN1L_DICDI/128-243-----------------------------------------------------------------------------SLE
C9SS58_VERA1/59-179------------------------------------------------------------------------------HA
DCN1_CAEBR/212-343-----------------------------------------------------------------------------GLK
V2WVV5_MONRO/132-268-----------------------------------------------------------------------------ALT
W4Z5P8_STRPU/122-233-----------------------------------------------------------------------------KIR
G8JTG5_ERECY/131-253-----------------------------------------------------------------------------DMS
Q4CTL1_TRYCC/116-237-----------------------------------------------------------------------------AMR
G3JPI5_CORMM/140-260------------------------------------------------------------------------------HA
B2W5R8_PYRTR/113-236-----------------------------------------------------------------------------KQK
D5GLD2_TUBMM/235-349-----------------------------------------------------------------------------KMR
B2AP92_PODAN/230-365-----------------------------------------------------------------------------TQK
C1ECA6_MICCC/91-211-------------------------------------------------------------------------------L
DCN1_MAGO7/134-265-----------------------------------------------------------------------------GQK
G2QC09_MYCTT/213-346--------------------------------------------------------------------------------
M3CNS9_SPHMS/135-256-----------------------------------------------------------------------------KMR
M4E9B4_BRARP/71-179-----------------------------------------------------------------------------KLM
K1X3N5_MARBU/130-251-----------------------------------------------------------------------------KQA
Q01CV7_OSTTA/137-246-----------------------------------------------------------------------------KLK
G0R367_ICHMG/127-238-----------------------------------------------------------------------------ELK
G8YDF6_PICSO/133-255-----------------------------------------------------------------------------TMS
K5VWN1_PHACS/173-278-------------------------------------------------------------------------------R
A4IAJ8_LEIIN/117-228-----------------------------------------------------------------------------QMR
A0EI15_PARTE/161-275-----------------------------------------------------------------------------DLK
A0BIK6_PARTE/127-240-----------------------------------------------------------------------------DLK
M4CH96_BRARP/113-227-----------------------------------------------------------------------------KLK
C4JUU5_UNCRE/114-236------------------------------------------------------------------------------QA
E2B8U4_HARSA/136-246-----------------------------------------------------------------------------KVQ
M0RKZ1_MUSAM/110-224-----------------------------------------------------------------------------KLK
G1X6A6_ARTOA/101-217-----------------------------------------------------------------------------KMQ
W1QIR1_OGAPD/139-254-----------------------------------------------------------------------------KMS
U7PR72_SPOS1/136-257-----------------------------------------------------------------------------EQA
G4TLQ1_SERID/74-215-----------------------------------------------------------------------------RMK
Q0TWZ3_PHANO/142-265-----------------------------------------------------------------------------KQK
H2YRZ9_CIOSA/125-236-----------------------------------------------------------------------------KLE
K5URA1_PHACS/128-268-----------------------------------------------------------------------------TMK
I1BJA6_RHIO9/108-215-----------------------------------------------------------------------------KLK
E9GWX7_DAPPU/23-138-----------------------------------------------------------------------------SLK
K1Q2P2_CRAGI/166-280-----------------------------------------------------------------------------GIQ
F6V304_CIOIN/136-246-----------------------------------------------------------------------------KLR
C4WTR1_ACYPI/113-223-----------------------------------------------------------------------------KLQ
J5JYN6_BEAB2/214-334------------------------------------------------------------------------------HA
F8QA55_SERL3/134-273-----------------------------------------------------------------------------TMK
A4S7Y2_OSTLU/12-140-----------------------------------------------------------------------------RCV
D3B1I6_POLPP/110-222-----------------------------------------------------------------------------QLK
J9K228_ACYPI/173-288------------------------------------------------------------------------------MK
D8SBI4_SELML/1-112-----------------------------------------------------------------------------KLR
M7SZQ3_EUTLA/160-282-----------------------------------------------------------------------------AQK
G7E7V8_MIXOS/137-268-----------------------------------------------------------------------------QQK
E3QX26_COLGM/74-192--------------------------------------------------------------------------------
U4LSS9_PYROM/133-246-----------------------------------------------------------------------------TIR
C5MHZ1_CANTT/17-149--------------------------------------------------------------------------------
S8A8F9_DACHA/128-242-----------------------------------------------------------------------------KKK
D5GNL3_TUBMM/193-333-----------------------------------------------------------------------------SLR
W4YIV3_STRPU/135-245-----------------------------------------------------------------------------TLR
A0A3Q7F8Y8_SOLLC/70-174-----------------------------------------------------------------------------KLR
Q2H7P9_CHAGB/172-308-----------------------------------------------------------------------------GQQ
S8E141_FOMPI/150-285-----------------------------------------------------------------------------GMQ
F4PMH2_CAVFA/184-297-----------------------------------------------------------------------------KLQ
M2Z7Z9_PSEFD/133-254-----------------------------------------------------------------------------KIR
M2U197_COCH5/135-258-----------------------------------------------------------------------------KQR
B8LYA7_TALSN/132-255-----------------------------------------------------------------------------QMI
Q38A65_TRYB2/115-236-----------------------------------------------------------------------------ALR
I1LZM2_SOYBN/106-220-----------------------------------------------------------------------------KLR
B9GVI7_POPTR/112-226-----------------------------------------------------------------------------KLK
A9TUR1_PHYPA/70-173-----------------------------------------------------------------------------HLQ
N1PWR6_DOTSN/134-255-----------------------------------------------------------------------------KIR
H9J1B3_BOMMO/136-246-----------------------------------------------------------------------------KLK
A0A2H2HZ65_CAEJA/147-277-----------------------------------------------------------------------------GLK
E4ZZB0_LEPMJ/136-259-----------------------------------------------------------------------------KQK
DCN1_EMENI/172-295-----------------------------------------------------------------------------KMA
I7MA78_TETTS/190-304-----------------------------------------------------------------------------DLK
W4Z318_STRPU/179-293-----------------------------------------------------------------------------AIK
E2BR92_HARSA/133-243-----------------------------------------------------------------------------KLK
B0G147_DICDI/155-267-----------------------------------------------------------------------------KLQ
F9X328_ZYMTI/133-254-----------------------------------------------------------------------------QMR
E3K9T3_PUCGT/165-280--------------------------------------------------------------------------------
A7TEL5_VANPO/129-249-----------------------------------------------------------------------------HMK
B6JUT9_SCHJY/126-241-----------------------------------------------------------------------------QLK

PF12354

INLA_LISMO/3-58--------------------------------------------------------------------------KKRYVW
Q8Y9W0_LISMO/2-59--------------------------------------------------------------------------KSKNNY
Q8Y8U2_LISMO/1-57--------------------------------------------------------------------------------
Q8Y5N0_LISMO/1-55--------------------------------------------------------------------------MK----
Q7AP86_LISMO/2-56--------------------------------------------------------------------------KRNKTA
INLB_LISMO/4-58---------------------------------------------------------------------------KHNPR
Q7AP88_LISMO/3-58--------------------------------------------------------------------------QRKTSV
INLH_LISMO/3-58--------------------------------------------------------------------------KRWNSV
Q8Y7Y3_LISMO/1-58--------------------------------------------------------------------------------
Q8Y4H2_LISMO/1-55--------------------------------------------------------------------------MR----
Q8Y6A8_LISMO/1-56--------------------------------------------------------------------------MKKNNW

PF15157

F1SJL9_PIG/4-146--------------------------------------------------------------------------------
H2RDW3_PANTR/4-158--------------------------------------------------------------------------------
W5NW45_SHEEP/4-156--------------------------------------------------------------------------------
J9P1M2_CANLF/4-155--------------------------------------------------------------------------------

PF00612

Q20456_CAEEL/659-679--------------------------------------------------------------------------------
Q20456_CAEEL/682-702--------------------------------------------------------------------------------
Q9VGW4_DROME/2672-2692--------------------------------------------------------------------------------
Q9VGW4_DROME/2724-2744--------------------------------------------------------------------------------
MYO8_ARATH/759-779--------------------------------------------------------------------------------
MYO8_ARATH/784-804--------------------------------------------------------------------------------
MYO8_ARATH/807-827--------------------------------------------------------------------------------
MYO8_ARATH/832-852--------------------------------------------------------------------------------
MYO8_ARATH/855-875--------------------------------------------------------------------------------
MYO4_ARATH/833-853--------------------------------------------------------------------------------
MYO4_ARATH/856-876--------------------------------------------------------------------------------
MYO4_ARATH/892-912--------------------------------------------------------------------------------
MYO2_ARATH/882-902--------------------------------------------------------------------------------
MYO2_ARATH/905-925--------------------------------------------------------------------------------
MYO2_ARATH/943-963--------------------------------------------------------------------------------
MYO6_ARATH/806-826--------------------------------------------------------------------------------
MYO16_ARATH/756-776--------------------------------------------------------------------------------
MYO16_ARATH/781-801--------------------------------------------------------------------------------
MYO16_ARATH/804-824--------------------------------------------------------------------------------
MYO16_ARATH/829-849--------------------------------------------------------------------------------
MYO13_ARATH/745-765--------------------------------------------------------------------------------
MYO13_ARATH/768-788--------------------------------------------------------------------------------
MYO13_ARATH/793-813--------------------------------------------------------------------------------
MYO13_ARATH/814-834--------------------------------------------------------------------------------
MYO13_ARATH/837-857--------------------------------------------------------------------------------
MYO13_ARATH/860-880--------------------------------------------------------------------------------
MYO12_ARATH/735-755--------------------------------------------------------------------------------
MYO12_ARATH/758-778--------------------------------------------------------------------------------
MYO12_ARATH/783-803--------------------------------------------------------------------------------
MYO12_ARATH/806-826--------------------------------------------------------------------------------
MYO12_ARATH/831-851--------------------------------------------------------------------------------
MYO12_ARATH/854-874--------------------------------------------------------------------------------
MYO15_ARATH/764-784--------------------------------------------------------------------------------
MYO15_ARATH/789-809--------------------------------------------------------------------------------
MYO15_ARATH/837-857--------------------------------------------------------------------------------
MYO15_ARATH/860-880--------------------------------------------------------------------------------
MYO1_ARATH/840-860--------------------------------------------------------------------------------
MYO1_ARATH/863-883--------------------------------------------------------------------------------
MYO1_ARATH/889-909--------------------------------------------------------------------------------
MYO1_ARATH/912-932--------------------------------------------------------------------------------
MYO14_ARATH/742-762--------------------------------------------------------------------------------
MYO14_ARATH/765-785--------------------------------------------------------------------------------
MYO14_ARATH/790-810--------------------------------------------------------------------------------
MYO14_ARATH/838-858--------------------------------------------------------------------------------
MYO3_ARATH/855-875--------------------------------------------------------------------------------
MYO11_ARATH/835-855--------------------------------------------------------------------------------
MYS9_DROME/809-829--------------------------------------------------------------------------------
ASPM_MOUSE/2562-2582--------------------------------------------------------------------------------
ASPM_MOUSE/2603-2623--------------------------------------------------------------------------------
ASPM_MOUSE/2649-2669--------------------------------------------------------------------------------
ASPM_MOUSE/2675-2695--------------------------------------------------------------------------------
ASPM_MOUSE/2698-2718--------------------------------------------------------------------------------
ASPM_MOUSE/2725-2745--------------------------------------------------------------------------------
ASPM_MOUSE/2763-2783--------------------------------------------------------------------------------
ASPM_MOUSE/2786-2806--------------------------------------------------------------------------------
MYO7A_MOUSE/745-765--------------------------------------------------------------------------------
MYO7A_MOUSE/768-788--------------------------------------------------------------------------------
MYO7A_MOUSE/814-834--------------------------------------------------------------------------------
MYO7A_MOUSE/837-857--------------------------------------------------------------------------------
MYO5A_MOUSE/767-787--------------------------------------------------------------------------------
MYO5A_MOUSE/790-810--------------------------------------------------------------------------------
MYO5A_MOUSE/815-835--------------------------------------------------------------------------------
MYO5A_MOUSE/838-858--------------------------------------------------------------------------------
MYO5A_MOUSE/863-883--------------------------------------------------------------------------------
MYO5A_MOUSE/886-906--------------------------------------------------------------------------------
MYO1C_HUMAN/735-755--------------------------------------------------------------------------------
MYO1C_HUMAN/758-778--------------------------------------------------------------------------------
MYH6_HUMAN/784-804--------------------------------------------------------------------------------
MYO9B_HUMAN/957-977--------------------------------------------------------------------------------
MYO9B_HUMAN/980-1000--------------------------------------------------------------------------------
MYO9B_HUMAN/1002-1022--------------------------------------------------------------------------------
MYO9B_HUMAN/1025-1045--------------------------------------------------------------------------------
MYH13_HUMAN/786-806--------------------------------------------------------------------------------
MYO9A_HUMAN/1020-1040--------------------------------------------------------------------------------
MYO9A_HUMAN/1043-1063--------------------------------------------------------------------------------
MYO9A_HUMAN/1075-1095--------------------------------------------------------------------------------
MYO9A_HUMAN/1116-1136--------------------------------------------------------------------------------
MYO9A_HUMAN/1139-1159--------------------------------------------------------------------------------
IQGA2_HUMAN/691-711--------------------------------------------------------------------------------
IQGA2_HUMAN/721-741--------------------------------------------------------------------------------
IQGA2_HUMAN/751-771--------------------------------------------------------------------------------
MYO5B_HUMAN/788-808--------------------------------------------------------------------------------
MYO5B_HUMAN/813-833--------------------------------------------------------------------------------
MYO5B_HUMAN/836-856--------------------------------------------------------------------------------
SCN4A_HUMAN/1728-1748--------------------------------------------------------------------------------
SCN7A_HUMAN/1626-1646--------------------------------------------------------------------------------
PPE2_HUMAN/20-40--------------------------------------------------------------------------------
MYOA_DICDI/724-744--------------------------------------------------------------------------------
MYOA_DICDI/746-766--------------------------------------------------------------------------------
MYOJ_DICDI/825-845--------------------------------------------------------------------------------
MYOJ_DICDI/873-893--------------------------------------------------------------------------------
MYOJ_DICDI/944-964--------------------------------------------------------------------------------
MYOE_DICDI/697-717--------------------------------------------------------------------------------
MYOE_DICDI/719-739--------------------------------------------------------------------------------
SCN5A_HUMAN/1902-1922--------------------------------------------------------------------------------
MYO15_MOUSE/1887-1907--------------------------------------------------------------------------------
MYO15_MOUSE/1910-1930--------------------------------------------------------------------------------
Q9VHB4_DROME/226-246--------------------------------------------------------------------------------
IQD14_ARATH/322-342--------------------------------------------------------------------------------
PPE1_MOUSE/17-37--------------------------------------------------------------------------------
MYO1A_MOUSE/744-764--------------------------------------------------------------------------------
NEUM_BOVIN/32-52--------------------------------------------------------------------------------
MYS2_DICDI/763-783--------------------------------------------------------------------------------
MYO16_RAT/1147-1167--------------------------------------------------------------------------------
IQCE_HUMAN/543-563--------------------------------------------------------------------------------
IQCE_HUMAN/602-622--------------------------------------------------------------------------------
MYH11_CHICK/793-813--------------------------------------------------------------------------------
Q9VEZ0_DROME/1321-1341--------------------------------------------------------------------------------
Q9VQV7_DROME/581-601--------------------------------------------------------------------------------
CMTA3_ARATH/853-873--------------------------------------------------------------------------------
CMTA3_ARATH/876-896--------------------------------------------------------------------------------
ASP_DROME/973-993--------------------------------------------------------------------------------
ASP_DROME/1005-1025--------------------------------------------------------------------------------
ASP_DROME/1032-1052--------------------------------------------------------------------------------
ASP_DROME/1055-1075--------------------------------------------------------------------------------
ASP_DROME/1082-1102--------------------------------------------------------------------------------
ASP_DROME/1171-1191--------------------------------------------------------------------------------
ASP_DROME/1279-1299--------------------------------------------------------------------------------
ASP_DROME/1387-1407--------------------------------------------------------------------------------
ASP_DROME/1468-1488--------------------------------------------------------------------------------
ASP_DROME/1495-1515--------------------------------------------------------------------------------
ASP_DROME/1657-1677--------------------------------------------------------------------------------
ASP_DROME/1691-1711--------------------------------------------------------------------------------
MYSN_DROME/871-891--------------------------------------------------------------------------------
NEUG_BOVIN/27-47--------------------------------------------------------------------------------
MY61F_DROME/707-727--------------------------------------------------------------------------------
MY61F_DROME/730-750--------------------------------------------------------------------------------
SCN9A_RAT/1888-1908--------------------------------------------------------------------------------
RNG2_SCHPO/330-350--------------------------------------------------------------------------------
RNG2_SCHPO/360-380--------------------------------------------------------------------------------
RNG2_SCHPO/390-410--------------------------------------------------------------------------------
RNG2_SCHPO/419-439--------------------------------------------------------------------------------
RNG2_SCHPO/449-469--------------------------------------------------------------------------------
RNG2_SCHPO/536-556--------------------------------------------------------------------------------
RNG2_SCHPO/566-586--------------------------------------------------------------------------------
RNG2_SCHPO/596-616--------------------------------------------------------------------------------
RNG2_SCHPO/656-676--------------------------------------------------------------------------------
PPE1_HUMAN/17-37--------------------------------------------------------------------------------
O17666_CAEEL/558-578--------------------------------------------------------------------------------
O17666_CAEEL/960-980--------------------------------------------------------------------------------
SP17_MONDO/144-164--------------------------------------------------------------------------------
O64852_ARATH/84-104--------------------------------------------------------------------------------
O64852_ARATH/106-126--------------------------------------------------------------------------------
BAG5_ARATH/51-71--------------------------------------------------------------------------------
MYO51_SCHPO/753-773--------------------------------------------------------------------------------
MYO51_SCHPO/776-796--------------------------------------------------------------------------------
MYO51_SCHPO/801-821--------------------------------------------------------------------------------
MYO51_SCHPO/824-844--------------------------------------------------------------------------------
MYO51_SCHPO/849-869--------------------------------------------------------------------------------
MYO51_SCHPO/872-892--------------------------------------------------------------------------------
O84165_CHLTR/116-136--------------------------------------------------------------------------------
SCN8A_RAT/1894-1914--------------------------------------------------------------------------------
INVS_MOUSE/556-576--------------------------------------------------------------------------------
INVS_MOUSE/915-935--------------------------------------------------------------------------------
MYO52_SCHPO/818-838--------------------------------------------------------------------------------
MYO52_SCHPO/841-861--------------------------------------------------------------------------------
MYO52_SCHPO/866-886--------------------------------------------------------------------------------
MYO52_SCHPO/889-909--------------------------------------------------------------------------------
MYO1D_HUMAN/699-719--------------------------------------------------------------------------------
MYO1D_HUMAN/721-741--------------------------------------------------------------------------------
MYH1B_CHICK/787-807--------------------------------------------------------------------------------
SCN2A_RAT/1906-1926--------------------------------------------------------------------------------
MYSA_DROME/781-801--------------------------------------------------------------------------------
SCN3A_RAT/1852-1872--------------------------------------------------------------------------------
MYO3_CAEEL/795-815--------------------------------------------------------------------------------
MYH7_HUMAN/782-802--------------------------------------------------------------------------------
RGRF1_MOUSE/207-227--------------------------------------------------------------------------------
MYO4_YEAST/804-824--------------------------------------------------------------------------------
MYO4_YEAST/829-849--------------------------------------------------------------------------------
MYO4_YEAST/877-897--------------------------------------------------------------------------------
MYO4_YEAST/900-920--------------------------------------------------------------------------------
SCN1A_HUMAN/1916-1936--------------------------------------------------------------------------------
RDGC_DROME/6-26--------------------------------------------------------------------------------
IQGA1_HUMAN/746-766--------------------------------------------------------------------------------
IQGA1_HUMAN/776-796--------------------------------------------------------------------------------
IQGA1_HUMAN/806-826--------------------------------------------------------------------------------
IQGA1_HUMAN/836-856--------------------------------------------------------------------------------
MYO5B_RAT/767-787--------------------------------------------------------------------------------
MYO5B_RAT/790-810--------------------------------------------------------------------------------
MYO5B_RAT/815-835--------------------------------------------------------------------------------
MYO5B_RAT/838-858--------------------------------------------------------------------------------
MYO5B_RAT/863-883--------------------------------------------------------------------------------
MYO5B_RAT/886-906--------------------------------------------------------------------------------
MYO10_BOVIN/743-763--------------------------------------------------------------------------------
MYO10_BOVIN/766-786--------------------------------------------------------------------------------
MYO10_BOVIN/789-809--------------------------------------------------------------------------------
HUM6_CAEEL/736-756--------------------------------------------------------------------------------
HUM6_CAEEL/759-779--------------------------------------------------------------------------------
HUM6_CAEEL/805-825--------------------------------------------------------------------------------
MYO5A_CHICK/816-836--------------------------------------------------------------------------------
MYO5A_CHICK/839-859--------------------------------------------------------------------------------
MYO5A_CHICK/864-884--------------------------------------------------------------------------------
IQG1_YEAST/569-589--------------------------------------------------------------------------------
IQG1_YEAST/718-738--------------------------------------------------------------------------------
IQCB1_HUMAN/295-315--------------------------------------------------------------------------------
IQCB1_HUMAN/388-408--------------------------------------------------------------------------------
Q20199_CAEEL/82-102--------------------------------------------------------------------------------
Q20199_CAEEL/142-162--------------------------------------------------------------------------------
Q20641_CAEEL/786-806--------------------------------------------------------------------------------
Q21000_CAEEL/792-812--------------------------------------------------------------------------------
Q23673_CAEEL/297-317--------------------------------------------------------------------------------
MY31D_DROME/694-714--------------------------------------------------------------------------------
MY31D_DROME/716-736--------------------------------------------------------------------------------
MYO6_PIG/815-835--------------------------------------------------------------------------------
MYO5_ARATH/733-753--------------------------------------------------------------------------------
MYO5_ARATH/756-776--------------------------------------------------------------------------------
MYO5_ARATH/781-801--------------------------------------------------------------------------------
MYO5_ARATH/804-824--------------------------------------------------------------------------------
MYO5_ARATH/829-849--------------------------------------------------------------------------------
MYO5_ARATH/852-872--------------------------------------------------------------------------------
MYO9B_RAT/1003-1023--------------------------------------------------------------------------------
MY18A_HUMAN/1189-1209--------------------------------------------------------------------------------
MYO9B_MOUSE/957-977--------------------------------------------------------------------------------
Q9SD11_ARATH/37-57--------------------------------------------------------------------------------
Q9SD11_ARATH/59-79--------------------------------------------------------------------------------
IQD1_ARATH/108-128--------------------------------------------------------------------------------
Q9SG11_ARATH/110-130--------------------------------------------------------------------------------
Q9SG11_ARATH/132-152--------------------------------------------------------------------------------
MYOM_DICDI/890-910--------------------------------------------------------------------------------
MYOI_DICDI/692-712--------------------------------------------------------------------------------
MYO2_SCHPO/759-779--------------------------------------------------------------------------------
MYO7A_DROME/737-757--------------------------------------------------------------------------------
MYO7A_DROME/760-780--------------------------------------------------------------------------------
MYO7A_DROME/806-826--------------------------------------------------------------------------------
MYO7A_DROME/829-849--------------------------------------------------------------------------------
Q9VB28_DROME/412-432--------------------------------------------------------------------------------
Q9VGC1_DROME/191-211--------------------------------------------------------------------------------
Q9VGC1_DROME/233-253--------------------------------------------------------------------------------
Q9VGW5_DROME/18-38--------------------------------------------------------------------------------
Q9VGW5_DROME/89-109--------------------------------------------------------------------------------
Q9VGW5_DROME/112-132--------------------------------------------------------------------------------
Q9VLZ3_DROME/741-761--------------------------------------------------------------------------------
Q9VLZ3_DROME/764-784--------------------------------------------------------------------------------
Q9VLZ3_DROME/810-830--------------------------------------------------------------------------------
Q9VSS9_DROME/28-48--------------------------------------------------------------------------------
Q9W1U2_DROME/81-101--------------------------------------------------------------------------------
Q9W1U2_DROME/117-137--------------------------------------------------------------------------------
MYO9A_RAT/1117-1137--------------------------------------------------------------------------------
Q9ZU28_ARATH/100-120--------------------------------------------------------------------------------
B4QEB4_DROSI/785-803--------------------------------------------------------------------------------
C3Z0F9_BRAFL/36-55--------------------------------------------------------------------------------
D7MEN8_ARALL/735-753--------------------------------------------------------------------------------
F1MI43_BOVIN/112-130--------------------------------------------------------------------------------
G3PD79_GASAC/815-834--------------------------------------------------------------------------------
Q7XA83_ARATH/123-141--------------------------------------------------------------------------------

PF13405

A5WWC4_DANRE/529-558-K---------------------------------------------------RL-F--SQ------------------V
A5WWC4_DANRE/603-632-L---------------------------------------------------EI-F--KH------------------R
F7GNT1_CALJA/609-638-R---------------------------------------------------AS-F--NH------------------F
D2A071_TRICA/161-193-E--------------------------------------------------FYY-F--QV------------------H
B3MTC1_DROAN/96-125-R---------------------------------------------------TA-F--QL------------------F
Q5KN37_CRYNJ/78-107-I---------------------------------------------------KG-F--QV------------------F
B5DN90_DROPS/53-82-G---------------------------------------------------LL-V--DL------------------M
B4M210_DROVI/76-105-R---------------------------------------------------EI-F--DK------------------H
Q29GA6_DROPS/127-159-R---------------------------------------------------TL-H--RI------------------M
F5HLN4_ANOGA/622-651-V---------------------------------------------------KR-F--ET------------------I
B9PZD1_TOXGV/10-39-R---------------------------------------------------QA-F--QA------------------L
Q7QH58_ANOGA/21-50-R---------------------------------------------------EK-F--EE------------------I
B9PML0_TOXGV/103-132-K---------------------------------------------------VC-F--DV------------------F
B9PRI1_TOXGV/15-44-K---------------------------------------------------GA-F--DE------------------F
A0A0F7V4L4_TOXGV/73-102-K---------------------------------------------------EL-F--KA------------------A
A0A0F7V1A1_TOXGV/149-178-V---------------------------------------------------EA-F--AY------------------F
CAN8_HUMAN/536-564-R---------------------------------------------------RL-F--EK------------------L
A9V4Q3_MONBE/290-319-S---------------------------------------------------VA-F--DK------------------I
A9V4Q3_MONBE/492-521-L---------------------------------------------------DV-F--EQ------------------L
A0BQH1_PARTE/99-128-K---------------------------------------------------QV-F--DY------------------Y
A0BQH1_PARTE/172-202-R---------------------------------------------------RV-Y--RK------------------Y
B3DGM2_DANRE/12-41-K---------------------------------------------------EC-F--SL------------------Y
B3DGM2_DANRE/85-114-L---------------------------------------------------EA-M--RM------------------T
B4G986_DROPE/40-69-K---------------------------------------------------KA-F--DL------------------F
B4G986_DROPE/113-142-L---------------------------------------------------KA-F--AF------------------F
EFCB6_PONAB/24-53-M---------------------------------------------------KA-F--KL------------------I
EFCB6_PONAB/255-284-K---------------------------------------------------KA-L--LI------------------I
EFCB6_PONAB/699-728-S---------------------------------------------------KN-F--LE------------------T
EFCB6_PONAB/816-845-S---------------------------------------------------KA-F--TK------------------I
B4GVA6_DROPE/51-80-G---------------------------------------------------RI-V--DR------------------I
B4GVA6_DROPE/139-169-R---------------------------------------------------RR-W--AV------------------A
B4GVA6_DROPE/217-247-R---------------------------------------------------KV-F--AK------------------F
A0E4G3_PARTE/299-328-Q---------------------------------------------------EQ-F--SK------------------Y
B4K4U2_DROMO/29-58-T---------------------------------------------------LA-F--SL------------------F
B4K4U2_DROMO/102-131-I---------------------------------------------------LA-F--KV------------------F
A0BG74_PARTE/108-137-E---------------------------------------------------RA-F--HL------------------F
B5Y3F8_PHATC/258-286-R---------------------------------------------------KV-F--KK------------------F
Q7Y0H2_CHLRE/18-47-E---------------------------------------------------RA-F--NT------------------I
C5Z5N8_SORBI/67-96-R---------------------------------------------------DM-F--AF------------------F
C5Z5N8_SORBI/134-163-Y---------------------------------------------------RI-F--QA------------------I
A7SG62_NEMVE/12-41-R---------------------------------------------------ES-F--EL------------------Y
A7SG62_NEMVE/87-116-V---------------------------------------------------DS-L--RV------------------F
Q240R2_TETTS/29-58-I---------------------------------------------------KS-F--KF------------------F
A7RGK2_NEMVE/11-40-R---------------------------------------------------EA-F--SL------------------F
A7RGK2_NEMVE/86-115-V---------------------------------------------------EG-L--RV------------------F
Q4DGX2_TRYCC/326-357-H---------------------------------------------------RA-F--VS------------------C
A9V7J3_MONBE/330-359-K---------------------------------------------------SL-W--KQ------------------A
A9V7J3_MONBE/402-431-W---------------------------------------------------DV-F--ED------------------L
B3LYL3_DROAN/28-57-E---------------------------------------------------EA-F--AL------------------F
A0E0C2_PARTE/300-329-G---------------------------------------------------EL-F--AE------------------L
C3YDW3_BRAFL/85-114-L---------------------------------------------------DA-L--KY------------------T
Q0IEY6_AEDAE/74-103-G---------------------------------------------------II-V--DK------------------I
Q0IEY6_AEDAE/240-270-R---------------------------------------------------ET-F--NN------------------F
A9VBL4_MONBE/184-215-D---------------------------------------------------CI-F--EL------------------F
A0E3X2_PARTE/219-248-K---------------------------------------------------EV-F--EI------------------F
MYL6B_HUMAN/145-174-L---------------------------------------------------EG-F--RV------------------F
Q7QCU7_ANOGA/79-109-T---------------------------------------------------EA-F--AK------------------A
Q7QCU7_ANOGA/211-241-D---------------------------------------------------DI-L--RQ------------------F
D0NI99_PHYIT/995-1024-T---------------------------------------------------RR-L--QA------------------L
D0NZK1_PHYIT/776-806-L---------------------------------------------------SA-F--NE------------------L
C1FGB5_MICCC/2004-2033-T---------------------------------------------------EA-F--HF------------------V
C1FGB5_MICCC/2077-2106-D---------------------------------------------------VG-F--DC------------------F
C1FGB5_MICCC/2208-2238-R---------------------------------------------------DL-I--GA------------------L
D3AYI6_POLPP/6-35-A---------------------------------------------------EC-F--AI------------------Y
D3AYI6_POLPP/79-108-L---------------------------------------------------DA-F--KA------------------L
A2ERW3_TRIVA/9-39-E---------------------------------------------------AR-F--DA------------------L
A2ERW3_TRIVA/82-111-K---------------------------------------------------MI-F--RA------------------F
A7RV39_NEMVE/88-117-M---------------------------------------------------EC-F--KV------------------F
A2DT12_TRIVA/7-37-S---------------------------------------------------QL-F--DK------------------A
A2DT12_TRIVA/80-109-K---------------------------------------------------VL-F--RA------------------H
A4UNW1_CHICK/97-126-L---------------------------------------------------NA-F--KI------------------F
A2DIY5_TRIVA/14-43-K---------------------------------------------------MA-F--DG------------------F
A2DIY5_TRIVA/85-114-T---------------------------------------------------DI-F--KT------------------L
A8N2E2_COPC7/129-158-I---------------------------------------------------EA-F--ES------------------F
A0CCH5_PARTE/297-326-L---------------------------------------------------EL-F--SF------------------F
A0BPZ4_PARTE/198-233-R---------------------------------------------------RI-F--TM------------------I
B6K7R4_SCHJY/10-39-N---------------------------------------------------EA-F--NL------------------Y
B6K7R4_SCHJY/79-108-I---------------------------------------------------KA-F--AV------------------F
C3YGP7_BRAFL/22-51-T---------------------------------------------------EA-F--DI------------------F
Q240Z1_TETTS/371-400-K---------------------------------------------------VQ-F--KK------------------I
Q240Z1_TETTS/445-474-W---------------------------------------------------SI-F--KY------------------F
C3ZWG8_BRAFL/29-59-S---------------------------------------------------EF-F--KD------------------F
Q7T2F7_DANRE/113-143-L---------------------------------------------------FA-F--RL------------------Y
B4LIU4_DROVI/12-41-K---------------------------------------------------RV-F--DK------------------Y
B4LIU4_DROVI/85-114-R---------------------------------------------------KA-F--EV------------------F
A0C7B9_PARTE/44-73-R---------------------------------------------------EF-F--TD------------------F
A0C7B9_PARTE/522-551-A---------------------------------------------------EF-L--RD------------------F
D0NQW3_PHYIT/447-476-L---------------------------------------------------VL-F--SE------------------V
B4KPB2_DROMO/13-42-R---------------------------------------------------LI-Y--DK------------------H
A7SK46_NEMVE/37-66-K---------------------------------------------------EA-F--NI------------------I
A7SK46_NEMVE/105-134-L---------------------------------------------------RA-F--SC------------------L
A7S7W7_NEMVE/508-546-N---------------------------------------------------SK-F--KE------------------F
A7S7W7_NEMVE/583-612-M---------------------------------------------------KI-F--QV------------------F
A9SC48_PHYPA/64-94-Y---------------------------------------------------EL-F--MK------------------I
A9SC48_PHYPA/138-175-Q---------------------------------------------------FA-F--KL------------------Y
Q4N995_THEPA/859-892-K---------------------------------------------------RA-F--SH------------------Y
B8PFW7_POSPM/47-76-R---------------------------------------------------EA-F--SL------------------I
B8CDF2_THAPS/17-48-A---------------------------------------------------RI-F--NH------------------I
A2EWU3_TRIVA/26-55-R---------------------------------------------------QA-F--NL------------------F
A2EWU3_TRIVA/99-128-K---------------------------------------------------RA-F--RK------------------L
B9S960_RICCO/440-471-R---------------------------------------------------SL-F--AE------------------F
D0N3P0_PHYIT/23-52-R---------------------------------------------------AA-F--DM------------------F
D0N3P0_PHYIT/102-131-L---------------------------------------------------AA-F--RV------------------I
D0NIV0_PHYIT/360-387-A---------------------------------------------------EV-F--HS------------------M
C4R6X4_KOMPG/24-55-K---------------------------------------------------QL-F--ER------------------L
B7PVC0_IXOSC/891-929-R---------------------------------------------------II-F--DM------------------C
A2F2K1_TRIVA/16-45-K---------------------------------------------------KA-F--NH------------------Y
A2F2K1_TRIVA/87-116-I---------------------------------------------------NA-F--KI------------------F
B3DFQ1_DANRE/118-147-Q---------------------------------------------------AI-Y--KK------------------Y
Q4DBB8_TRYCC/35-64-R---------------------------------------------------EA-F--DL------------------F
Q4DBB8_TRYCC/108-137-I---------------------------------------------------RA-F--RL------------------I
B6AAA3_CRYMR/149-179-Q---------------------------------------------------LG-F--RL------------------L
B8CB62_THAPS/13-42-A---------------------------------------------------DL-F--KI------------------I
Q6CKI4_KLULA/78-107-I---------------------------------------------------KA-F--QV------------------F
C5DMF9_LACTC/14-45-K---------------------------------------------------TL-F--ST------------------I
A5DJ68_PICGU/64-95-H---------------------------------------------------YL-F--RV------------------F
A0CPY1_PARTE/103-143-N---------------------------------------------------VI-F--SL------------------Y
A8XS91_CAEBR/6-35-R---------------------------------------------------EV-F--AY------------------F
A2DQT8_TRIVA/13-42-K---------------------------------------------------NA-F--DA------------------F
A2DQT8_TRIVA/83-112-V---------------------------------------------------DA-F--RV------------------F
A0DCA4_PARTE/23-52-Y---------------------------------------------------EA-F--VA------------------F
A0BDG8_PARTE/301-330-E---------------------------------------------------KV-F--NK------------------Y
Q66HU4_DANRE/630-659-Q---------------------------------------------------EI-F--KR------------------Y
A9UUF1_MONBE/6-34-L---------------------------------------------------DL-F--RE------------------L
C1EI49_MICCC/48-79-A---------------------------------------------------EV-F--KT------------------Y
B7PJB2_IXOSC/18-48-M---------------------------------------------------SV-F--RS------------------V
B3M2P5_DROAN/85-114-K---------------------------------------------------EV-F--SL------------------F
A8BSJ2_GIAIC/8-37-R---------------------------------------------------EV-F--ET------------------F
A8XSA6_CAEBR/77-106-Q---------------------------------------------------TL-L--SH------------------F
CBPF_DICDI/13-45-Q---------------------------------------------------KF-V--KN------------------Y
C8JQR9_CAEEL/144-173-A---------------------------------------------------EM-F--AD------------------M
Q6FSJ6_CANGA/19-48-K---------------------------------------------------DA-F--QL------------------I
A0BKS7_PARTE/17-46-K---------------------------------------------------DA-F--EA------------------Y
Q4DSH4_TRYCC/48-77-V---------------------------------------------------QW-F--RA------------------V
B0WB65_CULQU/256-285-A---------------------------------------------------EF-K--KI------------------I
A4I3F5_LEIIN/12-41-R---------------------------------------------------KH-F--DL------------------F
A4I3F5_LEIIN/85-114-R---------------------------------------------------EA-F--QG------------------F
A0BU82_PARTE/29-57-H---------------------------------------------------RR-F--QR------------------M
Q755U9_ASHGO/14-45-E---------------------------------------------------QL-F--RR------------------L
A8I1S7_CHLRE/186-215-R---------------------------------------------------KL-F--KM------------------Y
A4HZA9_LEIIN/84-113-Y---------------------------------------------------AA-L--KV------------------L
A0D306_PARTE/59-88-D---------------------------------------------------KV-F--QF------------------F
Q4Q2P9_LEIMA/35-64-S---------------------------------------------------RS-L--GI------------------A
A0E3G8_PARTE/176-205-Q---------------------------------------------------KI-F--TL------------------W
A9V0G9_MONBE/68-97-A---------------------------------------------------SA-F--KV------------------F
A7AQR4_BABBO/777-815-F---------------------------------------------------QK-F--QD------------------Y
A7AQR4_BABBO/875-908-R---------------------------------------------------QA-F--HS------------------Y
A4HBM1_LEIBR/11-40-S---------------------------------------------------LQ-F--LL------------------L
A0CNQ7_PARTE/356-385-R---------------------------------------------------FK-F--EE------------------F
A0CNQ7_PARTE/435-464-W---------------------------------------------------GL-F--KQ------------------F
A0A384KM72_PLAKH/94-123-R---------------------------------------------------SL-F--DL------------------L
C3Y3X5_BRAFL/109-138-K---------------------------------------------------EC-F--ML------------------C
C3Y3X5_BRAFL/178-207-L---------------------------------------------------EA-F--EN------------------L
C5E2K8_LACTC/5-34-K---------------------------------------------------DI-F--TL------------------F
D0NMF2_PHYIT/62-91-R---------------------------------------------------HI-F--CQ------------------I
B9RGV3_RICCO/45-74-R---------------------------------------------------SL-F--NF------------------F
A0DZF8_PARTE/406-435-V---------------------------------------------------KL-F--KQ------------------F
D0NPC8_PHYIT/30-59-R---------------------------------------------------EA-F--AR------------------V
D3B753_POLPP/41-70-K---------------------------------------------------EK-F--ML------------------Y
A7RJ54_NEMVE/73-101-R---------------------------------------------------TA-F--DV------------------F
C3ZK54_BRAFL/145-176-L---------------------------------------------------RR-W--ET------------------A
Q23CU0_TETTS/69-99-K---------------------------------------------------QV-F--DL------------------Y
EFCB7_HUMAN/106-135-L---------------------------------------------------KS-F--KQ------------------L
A0A0D1DU76_USTMA/58-87-K---------------------------------------------------EA-F--NM------------------I
A0BMA1_PARTE/125-154-K---------------------------------------------------EA-F--NF------------------L
A7RI54_NEMVE/73-102-K---------------------------------------------------TT-F--MQ------------------Y
Q7RNY5_PLAYO/47-76-Q---------------------------------------------------RV-F--KM------------------M
A0A0K0JIC8_BRUMA/91-120-H---------------------------------------------------AA-F--EL------------------F
A0NGM4_ANOGA/720-749-K---------------------------------------------------AV-F--KL------------------Y
A0CQY7_PARTE/181-210-Q---------------------------------------------------KI-F--NS------------------W
A2FZQ0_TRIVA/11-40-K---------------------------------------------------QS-F--EE------------------F
A2FZQ0_TRIVA/82-111-I---------------------------------------------------KA-F--TL------------------F
PLSI_BOVIN/15-46-Q---------------------------------------------------EA-F--NK------------------I
A0BVC0_PARTE/355-384-Q---------------------------------------------------FI-F--KK------------------I
A0BVC0_PARTE/444-473-W---------------------------------------------------SI-F--KY------------------F
A0BLQ1_PARTE/56-85-R---------------------------------------------------EN-F--QL------------------F
A0BLQ1_PARTE/129-158-V---------------------------------------------------EA-F--KS------------------V
D3B3V9_POLPP/20-49-R---------------------------------------------------HI-F--DH------------------F
C6WP87_ACTMD/55-86-E---------------------------------------------------VL-A--DH------------------L
B0CEP3_ACAM1/69-106-E---------------------------------------------------FA-F--QL------------------H
B4JQZ6_DROGR/12-41-R---------------------------------------------------QI-F--LQ------------------F
B4JQZ6_DROGR/95-124-K---------------------------------------------------SG-L--RF------------------F
B3RJS5_TRIAD/515-551-H---------------------------------------------------EI-F--DR------------------V
B3RJS5_TRIAD/588-617-K---------------------------------------------------DN-F--QK------------------F
Q236L3_TETTS/181-210-Q---------------------------------------------------KI-F--NA------------------W
A9UU69_MONBE/7-36-K---------------------------------------------------LC-F--EL------------------F
A9UU69_MONBE/73-102-M---------------------------------------------------DA-F--ST------------------F
B3SAM3_TRIAD/385-414-I---------------------------------------------------DF-F--FA------------------L
D0N7S9_PHYIT/33-62-R---------------------------------------------------RW-F--DS------------------L
B4J628_DROGR/30-59-R---------------------------------------------------RL-F--DS------------------I
C5DUR9_ZYGRC/19-48-K---------------------------------------------------DA-F--QT------------------I
B8CFT6_THAPS/84-113-A---------------------------------------------------MY-F--RI------------------Y
C3YER0_BRAFL/167-196-R---------------------------------------------------EV-F--DL------------------F
A8X3X6_CAEBR/106-135-A---------------------------------------------------KV-F--ED------------------F
A0BXL7_PARTE/42-71-H---------------------------------------------------KI-F--RK------------------M
A0BXL7_PARTE/114-145-A---------------------------------------------------YV-F--QM------------------L
A0DNH6_PARTE/2304-2334-F---------------------------------------------------EV-F--KT------------------I
A8XVF9_CAEBR/36-65-F---------------------------------------------------DV-F--KM------------------F
A0D1H3_PARTE/66-95-W---------------------------------------------------KL-F--EF------------------F
A0D1H3_PARTE/181-210-E---------------------------------------------------NF-F--RK------------------L
B7PU66_IXOSC/252-281-R---------------------------------------------------AT-W--RK------------------L
A9UV27_MONBE/2126-2155-F---------------------------------------------------EV-F--EK------------------L
B4L3F1_DROMO/11-40-C---------------------------------------------------NT-F--AI------------------L
B3RIN1_TRIAD/205-233-----------------------------------------------------EL-F--AS------------------V
A0D218_PARTE/76-105-E---------------------------------------------------KV-F--QM------------------L
C1E207_MICCC/45-75-M---------------------------------------------------KI-F--KA------------------W
Q6FMX6_CANGA/187-217-I---------------------------------------------------QL-F--HN------------------H
A7AP31_BABBO/33-62-E---------------------------------------------------DA-F--NL------------------F
A2ETB6_TRIVA/14-43-Q---------------------------------------------------SV-F--KE------------------L
Q6C7R0_YARLI/24-53-A---------------------------------------------------VL-F--EV------------------A
Q6C7R0_YARLI/130-160-R---------------------------------------------------QA-F--GH------------------Y
A7EII8_SCLS1/126-155-K---------------------------------------------------SA-W--KE------------------F
B7Q3R8_IXOSC/111-140-V---------------------------------------------------KA-F--RA------------------S
Q8SS75_ENCCU/23-52-R---------------------------------------------------EA-F--NF------------------M
Q8SS75_ENCCU/92-121-F---------------------------------------------------NA-L--KE------------------F
Q7RGT1_PLAYO/1340-1369-N---------------------------------------------------DI-F--LK------------------T
D0MWK2_PHYIT/425-454-R---------------------------------------------------PF-F--HA------------------Y
A0DI75_PARTE/65-94-E---------------------------------------------------RI-F--RI------------------F
Q2R1L7_ORYSJ/123-154-K---------------------------------------------------QA-F--LV------------------F
A2DMA5_TRIVA/14-43-Q---------------------------------------------------NA-F--DT------------------F
C4QYA1_KOMPG/220-250-M---------------------------------------------------NR-F--KE------------------A
C4QYA1_KOMPG/287-316-E---------------------------------------------------EV-F--FI------------------Y
A7SIU0_NEMVE/415-444-V---------------------------------------------------DL-F--RR------------------L
A2EU49_TRIVA/304-333-W---------------------------------------------------TM-F--KP------------------Y
CPNS2_HUMAN/153-182-Q---------------------------------------------------CV-Y--KQ------------------Y
Q4E300_TRYCC/191-222-K---------------------------------------------------EA-F--KI------------------Y
D0MRM4_PHYIT/32-61-K---------------------------------------------------QQ-F--TD------------------F
Q6DG81_DANRE/12-43-R---------------------------------------------------EA-F--GK------------------V
B4I7K3_DROSE/14-43-S---------------------------------------------------EA-F--CI------------------F
C5DUA6_ZYGRC/18-49-E---------------------------------------------------KL-F--RR------------------L
A0CDJ6_PARTE/157-186-Q---------------------------------------------------QA-F--QM------------------I
A0CRT3_PARTE/42-71-M---------------------------------------------------DM-F--VY------------------F
A0CRT3_PARTE/115-144-I---------------------------------------------------NA-L--KI------------------F
A7RPN5_NEMVE/525-553-K---------------------------------------------------IA-F--EM------------------Y
A7RPN5_NEMVE/596-627-L---------------------------------------------------DA-F--HV------------------F
A7RMQ1_NEMVE/11-40-K---------------------------------------------------DA-F--SL------------------F
A7RMQ1_NEMVE/82-111-I---------------------------------------------------EG-L--RA------------------F
Q5CZ29_CRYPI/514-545-R---------------------------------------------------NV-F--YK------------------L
Q2A943_DANRE/33-62-K---------------------------------------------------CL-F--DK------------------Y
A7S688_NEMVE/8-37-K---------------------------------------------------DI-F--DL------------------Y
A7S688_NEMVE/84-113-I---------------------------------------------------DC-F--KH------------------F
D0NHY4_PHYIT/209-239-E---------------------------------------------------QL-L--IE------------------G
Q4U8S4_THEAN/16-45-R---------------------------------------------------DQ-F--KL------------------V
C1FIV9_MICCC/85-114-L---------------------------------------------------RA-Y--NS------------------L
EFC13_HUMAN/456-485-E---------------------------------------------------NF-C--EA------------------I
Q4SJD6_TETNG/29-56-H---------------------------------------------------KR-F--KQ------------------L
E8RNE1_ASTEC/46-76-K---------------------------------------------------RI-F--AE------------------F
A0DCS1_PARTE/72-101-R---------------------------------------------------KY-F--SS------------------L
Q9EMH8_AMEPV/24-53-R---------------------------------------------------YI-F--DL------------------I
A0CH88_PARTE/390-419-Y---------------------------------------------------RV-G--KI------------------L
A0CH88_PARTE/696-725-Q---------------------------------------------------YR-F--QL------------------Y
C4R1V0_KOMPG/25-54-Q---------------------------------------------------AI-F--EI------------------M
A7SHW4_NEMVE/108-138-K---------------------------------------------------YA-F--KI------------------F
D0MWI5_PHYIT/661-691-G---------------------------------------------------DR-L--NI------------------L
C3YCK9_BRAFL/241-275-M---------------------------------------------------DK-F--DE------------------Y
B3MPK2_DROAN/57-86-H---------------------------------------------------EI-F--LM------------------H
D2VTY7_NAEGR/97-134-R---------------------------------------------------YI-F--EY------------------Y
Q6BFU2_PARTE/195-224-E---------------------------------------------------RV-F--NK------------------F
B5Y4Q9_PHATC/8-42-R---------------------------------------------------DA-F--RL------------------F
B5Y4Q9_PHATC/86-115-Q---------------------------------------------------KV-F--DL------------------F
B7QKE4_IXOSC/612-641-I---------------------------------------------------QK-F--QA------------------I
Q0V5Q9_PHANO/214-243-R---------------------------------------------------EC-F--SV------------------M
Q4DIV1_TRYCC/166-195-Y---------------------------------------------------EA-F--CV------------------L
Q7Q4L8_ANOGA/103-139-E---------------------------------------------------HA-F--RI------------------Y
A8XE93_CAEBR/628-657-K---------------------------------------------------ER-F--NQ------------------L
A7RJ83_NEMVE/514-548-W---------------------------------------------------DV-F--HQ------------------M
A7RJ83_NEMVE/585-614-K---------------------------------------------------NH-F--HK------------------Y
A4HWJ1_LEIIN/25-54-S---------------------------------------------------ST-W--NL------------------F
A2EBQ1_TRIVA/14-43-H---------------------------------------------------EA-F--DT------------------F
A2EBQ1_TRIVA/84-113-I---------------------------------------------------DA-F--HV------------------F
Q4D662_TRYCC/188-217-V---------------------------------------------------SL-F--MV------------------F
Q4D662_TRYCC/269-298-L---------------------------------------------------LQ-F--RG------------------Y
A0EFA3_PARTE/319-348-A---------------------------------------------------KV-F--LE------------------M
Q8SRF8_ENCCU/100-129-R---------------------------------------------------YL-F--DI------------------F
B8BV66_THAPS/328-359-R---------------------------------------------------EE-F--EK------------------L
A7SIU1_NEMVE/364-393-V---------------------------------------------------DL-F--NC------------------L
D0NLH6_PHYIT/779-808-K---------------------------------------------------EV-F--DH------------------F
C1MVN8_MICPC/105-141-R---------------------------------------------------SV-F--DK------------------C
A0BWN9_PARTE/584-613-Y---------------------------------------------------DL-F--RK------------------Y
A0DZH6_PARTE/32-61-Y---------------------------------------------------RL-F--NL------------------Y
Q5CTT5_CRYPI/66-93-R---------------------------------------------------DI-V--SK------------------Y
A0C693_PARTE/354-383-S---------------------------------------------------QK-F--KE------------------L
A7SZ62_NEMVE/480-509-V---------------------------------------------------DL-F--NQ------------------F
C1MZG1_MICPC/117-146-R---------------------------------------------------EV-F--RL------------------L
Q4DZ37_TRYCC/328-358-E---------------------------------------------------VA-F--RK------------------I
B3RKL5_TRIAD/438-467-I---------------------------------------------------DL-F--NR------------------F
A2Q7S2_ASPNC/15-46-K---------------------------------------------------AL-F--QQ------------------A
C1E2H7_MICCC/61-97-A---------------------------------------------------KL-F--ES------------------V
C1FI51_MICCC/18-54-K---------------------------------------------------KI-F--DQ------------------C
B8MY97_ASPFN/34-63-G---------------------------------------------------EA-F--QV------------------L
B3S580_TRIAD/58-91-M---------------------------------------------------HY-F--KL------------------H
D0N582_PHYIT/1409-1438-A---------------------------------------------------IR-L--AR------------------L
B7G8H4_PHATC/377-408-I---------------------------------------------------AE-F--AR------------------I
A0E9E9_PARTE/44-75-T---------------------------------------------------ET-F--HL------------------I
A7RMQ2_NEMVE/10-39-R---------------------------------------------------DG-F--ML------------------F
A7RMQ2_NEMVE/82-111-L---------------------------------------------------EG-L--KV------------------F
B6AAT1_CRYMR/92-121-I---------------------------------------------------NA-F--NI------------------L
Q1DGU0_AEDAE/85-114-G---------------------------------------------------RI-F--AA------------------L
C4VC48_NOSCE/64-95-F---------------------------------------------------RL-F--NT------------------I
D0N398_PHYIT/276-305-S---------------------------------------------------EV-F--AS------------------G
A0A0D1CVJ0_USTMA/739-769-R---------------------------------------------------AK-F--KL------------------L
EFCB9_HUMAN/28-56-A---------------------------------------------------EY-F--HI------------------L
A4HY14_LEIIN/110-138-D---------------------------------------------------HL-F--RG------------------Y
A0BNY1_PARTE/42-71-K---------------------------------------------------AV-F--KS------------------I
A0A0J9Y6X5_BRUMA/121-151-K---------------------------------------------------YA-F--RI------------------Y
CEX1_CAEEL/29-68-E---------------------------------------------------RI-F--SL------------------F
A7SPN7_NEMVE/582-611-K---------------------------------------------------KV-F--SW------------------F
A4FU16_HUMAN/38-67-K---------------------------------------------------VL-F--DQ------------------F
C3YAW3_BRAFL/215-244-L---------------------------------------------------DF-F--MR------------------F
D2V6N0_NAEGR/12-41-K---------------------------------------------------HS-F--SL------------------L
D2V6N0_NAEGR/215-245-D---------------------------------------------------EL-F--SI------------------F
Q5CUC1_CRYPI/325-356-H---------------------------------------------------RF-F--NA------------------L
D2VL69_NAEGR/86-115-L---------------------------------------------------RA-F--EI------------------L
B8BVX2_THAPS/190-219-I---------------------------------------------------SA-F--QK------------------N
A2FS38_TRIVA/86-115-D---------------------------------------------------EL-F--ET------------------I
A9V750_MONBE/19-48-A---------------------------------------------------SE-F--AR------------------T
A2FHL4_TRIVA/83-112-K---------------------------------------------------II-F--RS------------------F
A9FD96_SORC5/187-216-W---------------------------------------------------RR-F--EE------------------I
Q6BG59_PARTE/363-394-Y---------------------------------------------------SV-F--RS------------------L
A0DQE8_PARTE/49-78-K---------------------------------------------------KI-F--IN------------------F
A2DGG1_TRIVA/1002-1031-R---------------------------------------------------ET-F--NH------------------F
C3YFC2_BRAFL/86-117-S---------------------------------------------------DV-F--RR------------------F
A9VC94_MONBE/198-229-A---------------------------------------------------VI-F--RR------------------A
Q4UF53_THEAN/443-471-Y---------------------------------------------------RS-F--FS------------------I
A8XPA0_CAEBR/61-90-F---------------------------------------------------KI-F--QL------------------M
A2FQM2_TRIVA/14-43-R---------------------------------------------------NY-F--TD------------------F
A7RTI1_NEMVE/216-246-F---------------------------------------------------MQ-F--KV------------------F
B6AJS6_CRYMR/55-84-G---------------------------------------------------NL-I--KL------------------I
A0D0W9_PARTE/274-302-N---------------------------------------------------EL-I--KL------------------Y
A2E466_TRIVA/79-108-V---------------------------------------------------SA-F--KV------------------F
C1N3J2_MICPC/18-47-H---------------------------------------------------LA-F--DH------------------L
D2VIE2_NAEGR/8-38-E---------------------------------------------------EI-F--EL------------------Y
Q7QIB4_ANOGA/279-317-E---------------------------------------------------FM-F--RL------------------Y
Q8T5H8_ANOGA/12-41-Q---------------------------------------------------FV-F--SV------------------Y
D0N994_PHYIT/33-63-R---------------------------------------------------ET-F--KG------------------L
C1MU07_MICPC/540-583-R---------------------------------------------------AL-F--RA------------------L
B0XJB8_CULQU/36-75-M---------------------------------------------------DV-W--SH------------------Y
D0MVE6_PHYIT/210-253-I---------------------------------------------------SA-Y--LL------------------F
Q5CPW8_CRYPI/89-118-V---------------------------------------------------NI-F--SC------------------L
Q6NYK0_DANRE/29-57-H---------------------------------------------------SR-F--QY------------------L
D4AID5_ARTBC/715-746-K---------------------------------------------------RL-F--RK------------------W
O97201_LEIMA/270-300-V---------------------------------------------------GI-F--MM------------------F
B3M0N0_DROAN/117-151-Q---------------------------------------------------LL-F--NM------------------F
A9UXC0_MONBE/17-46-R---------------------------------------------------QV-F--DA------------------I
A2F622_TRIVA/94-129-Q---------------------------------------------------DA-Y--KK------------------L
CAN11_RAT/548-584-V---------------------------------------------------EL-F--ET------------------L
B4QEJ5_DROSI/103-132-L---------------------------------------------------QA-F--KI------------------L
D3ZRP1_RAT/120-151-G---------------------------------------------------KY-F--QR------------------L
B4MVV8_DROWI/30-59-R---------------------------------------------------RI-F--LT------------------H
A2FJN7_TRIVA/18-47-K---------------------------------------------------DA-F--NI------------------F
B6AIK9_CRYMR/17-46-R---------------------------------------------------ET-F--NL------------------A
A9UQV7_MONBE/115-144-E---------------------------------------------------KS-F--SE------------------A
B9R7E2_RICCO/18-47-K---------------------------------------------------NW-L--KG------------------F
A0E9R2_PARTE/21-50-L---------------------------------------------------ET-F--NL------------------F
D0N6S6_PHYIT/203-232-R---------------------------------------------------QL-F--RM------------------F
Q4Q156_LEIMA/33-65-Q---------------------------------------------------DL-F--DS------------------L
A7RPN6_NEMVE/2-31-E---------------------------------------------------DA-F--SV------------------Y
A4H5I7_LEIBR/177-206-R---------------------------------------------------VV-F--SE------------------F
C1ECT5_MICCC/271-300-R---------------------------------------------------EI-F--DR------------------F
A9V6X3_MONBE/1141-1170-E---------------------------------------------------AI-F--KT------------------Y
C3ZP66_BRAFL/54-83-K---------------------------------------------------KT-F--ME------------------M
C0H4A2_PLAF7/13-41-E---------------------------------------------------SI-F--KE------------------Y
A9VBY6_MONBE/239-268-R---------------------------------------------------DM-F--NQ------------------S
D2UXJ1_NAEGR/416-444-N---------------------------------------------------AV-F--GY------------------I
B4MM19_DROWI/36-65-K---------------------------------------------------KS-F--DI------------------Y
Q4DRI4_TRYCC/49-79-I---------------------------------------------------EL-F--KK------------------F
B3S1G2_TRIAD/152-183-E---------------------------------------------------YA-F--RV------------------Y
CIB4_MOUSE/101-132-E---------------------------------------------------YA-F--RI------------------Y
C1EBS6_MICCC/387-416-R---------------------------------------------------RA-F--AT------------------Y
B4N916_DROWI/114-145-Q---------------------------------------------------FA-F--EV------------------Y
Q8IE29_PLAF7/251-282-L---------------------------------------------------MV-F--KK------------------L
CAN8_MOUSE/536-572-W---------------------------------------------------SL-S--EE------------------F
A0BF71_PARTE/385-419-Q---------------------------------------------------EI-F--NG------------------L
B0WSM1_CULQU/659-688-Q---------------------------------------------------AV-F--NL------------------Y
D2V5I4_NAEGR/35-64-Q---------------------------------------------------MI-Y--YQ------------------Y
CAN11_MOUSE/547-583-L---------------------------------------------------QL-F--KI------------------M
A7RK77_NEMVE/68-97-R---------------------------------------------------DT-F--NE------------------W
A0C4R5_PARTE/23-53-K---------------------------------------------------ST-F--DS------------------I
Q4QBQ5_LEIMA/330-359-V---------------------------------------------------QL-F--HW------------------V
B4LJI0_DROVI/124-155-Q---------------------------------------------------FV-F--SI------------------Y
C3YQL6_BRAFL/328-359-L---------------------------------------------------TA-L--RE------------------S
A0C1C8_PARTE/336-372-E---------------------------------------------------HI-F--NN------------------I
D0NH53_PHYIT/26-55-R---------------------------------------------------VI-F--RY------------------F
RFIP3_DANRE/710-739-R---------------------------------------------------AV-F--QA------------------L
A0DZK5_PARTE/70-97-Y---------------------------------------------------EE-F--LS------------------Y
EFCB3_BOVIN/51-80-Q---------------------------------------------------DA-Y--NF------------------F
C1EDZ9_MICCC/29-59-Q---------------------------------------------------DL-F--NR------------------L
C1N631_MICPC/47-78-E---------------------------------------------------RL-F--SE------------------F
C1MXG3_MICPC/631-660-G---------------------------------------------------AV-F--DE------------------F
Q6DFZ8_DANRE/606-635-V---------------------------------------------------DV-Y--SK------------------N
B9RD69_RICCO/210-239-V---------------------------------------------------LH-F--FQ------------------F
Q4DDH8_TRYCC/10-40-L---------------------------------------------------DV-F--NV------------------F
A0CSU8_PARTE/30-61-K---------------------------------------------------PI-M--HR------------------L
A2CE70_DANRE/30-58-Y---------------------------------------------------SR-F--HS------------------L
A7SHJ6_NEMVE/330-359-V---------------------------------------------------EM-F--SR------------------Y
A0C9U0_PARTE/401-432-R---------------------------------------------------EL-F--EQ------------------F
A0CIN3_PARTE/412-441-R---------------------------------------------------GI-F--DI------------------I
A7RLF8_NEMVE/106-135-N---------------------------------------------------AF-F--DV------------------L
C3ZDD3_BRAFL/389-419-Y---------------------------------------------------QH-F--KQ------------------Y
A8X343_CAEBR/192-230-D---------------------------------------------------VV-F--HV------------------Y
B3RJJ4_TRIAD/113-142-E---------------------------------------------------KK-F--ME------------------A
A7T7P5_NEMVE/35-64-L---------------------------------------------------EA-F--RT------------------F
Q8STQ3_ENCCU/76-105-Q---------------------------------------------------NS-F--RR------------------L
Q6FSU4_CANGA/603-632-K---------------------------------------------------RL-F--NR------------------W
D0NT24_PHYIT/227-256-R---------------------------------------------------AI-F--NL------------------F
Q5ZJB5_CHICK/68-103-Q--------------------------------------------------LHY-F--KM------------------H
Q4CS95_TRYCC/33-65-Q---------------------------------------------------EL-F--DS------------------L
Q00WG8_OSTTA/33-61-Y---------------------------------------------------AR-F--RS------------------L
RASEF_XENTR/9-38-R---------------------------------------------------AL-F--HT------------------F
Q6TXM2_STRPU/582-611-T---------------------------------------------------EA-F--LQ------------------Y
D2VGQ0_NAEGR/231-261-K---------------------------------------------------EI-F--NL------------------L
D0MVJ8_PHYIT/2641-2670-G---------------------------------------------------DL-F--EL------------------L
A9V7D4_MONBE/231-262-T---------------------------------------------------RW-F--HL------------------L
B7G332_PHATC/130-165-R---------------------------------------------------CA-G--KH------------------L
B3S581_TRIAD/59-96-F---------------------------------------------------HF-F--KL------------------H
B0CNF8_LACBS/51-83-G---------------------------------------------------SF-F--QL------------------H
A0E1J3_PARTE/38-73-R---------------------------------------------------RL-F--DT------------------Y
D3BGC9_POLPP/56-86-R---------------------------------------------------EI-F--SR------------------Y
C1N8S9_MICPC/55-85-G---------------------------------------------------RL-F--AA------------------V
B3RSL0_TRIAD/112-148-A---------------------------------------------------YA-F--RI------------------Y
C1MSB0_MICPC/627-658-R---------------------------------------------------YA-F--VV------------------L
C3YY99_BRAFL/15-44-K---------------------------------------------------RC-F--DM------------------L
B8C8A3_THAPS/287-317-R---------------------------------------------------KK-F--AI------------------A
D7AV60_NOCDD/14-45-R---------------------------------------------------DL-F--TR------------------L
A8Q891_MALGO/17-46-Q---------------------------------------------------RV-F--YA------------------L
B7G8B5_PHATC/86-115-Q---------------------------------------------------ST-F--DL------------------I
A4I9Q9_LEIIN/181-211-G---------------------------------------------------EA-F--RI------------------Y
C6KTA8_PLAF7/77-106-L---------------------------------------------------DI-F--HF------------------Y
A0CSB1_PARTE/153-182-K---------------------------------------------------LL-F--DF------------------F
B9PLU7_TOXGV/4-33-E---------------------------------------------------SI-F--KV------------------F
Q4DPM5_TRYCC/184-213-R---------------------------------------------------TV-F--DA------------------L
B8LD33_THAPS/828-857-I---------------------------------------------------AV-F--DK------------------I
C1MUU0_MICPC/12-42-K---------------------------------------------------LK-F--DA------------------A
C3YUG8_BRAFL/425-454-R---------------------------------------------------RV-F--GE------------------H
Q4U8G1_THEAN/76-105-T---------------------------------------------------EL-F--RF------------------Y
A7SXZ3_NEMVE/9-37-L---------------------------------------------------DV-F--RR------------------A
Q8IJ97_PLAF7/12-41-E---------------------------------------------------KN-F--NL------------------I
A0BF28_PARTE/345-376-M---------------------------------------------------AS-F--IS------------------L
Q4E2K6_TRYCC/617-646-H---------------------------------------------------SI-F--CR------------------H
Q4E1U1_TRYCC/7-40-M---------------------------------------------------QI-F--DL------------------Y
A0C5R3_PARTE/309-338-S---------------------------------------------------QA-F--QF------------------F
A0ED28_PARTE/72-103-R---------------------------------------------------DC-F--NF------------------Y
D2VR29_NAEGR/607-636-V---------------------------------------------------KL-F--RE------------------I
B8BSH1_THAPS/111-142-T---------------------------------------------------KA-F--RL------------------L
Q5KAJ1_CRYNJ/665-697-D---------------------------------------------------RM-F--FA------------------W
C3YDH3_BRAFL/26-58-E--------------------------------------------------WHF-F--KS------------------H
B3S2Z7_TRIAD/64-96-L---------------------------------------------------YY-F--KL------------------H
A2DPY5_TRIVA/83-112-I---------------------------------------------------RA-F--QF------------------F
A0D7T4_PARTE/77-106-T---------------------------------------------------LL-F--EK------------------F
A0DSQ2_PARTE/47-76-N---------------------------------------------------QF-Y--AF------------------F
C1FHF3_MICCC/35-68-K---------------------------------------------------AA-F--IA------------------G
A0BCE1_PARTE/120-149-E---------------------------------------------------SA-F--SV------------------F
B7FPG8_PHATC/98-128-E---------------------------------------------------RA-F--DL------------------L
C3XQZ6_BRAFL/437-468-I---------------------------------------------------DF-F--KS------------------F
Q22DM3_TETTS/41-68-R---------------------------------------------------EK-F--RL------------------L
C7YTC4_NECH7/525-554-R---------------------------------------------------AM-L--RQ------------------Y
D3BH77_POLPP/977-1008-Q---------------------------------------------------AC-L--AN------------------C
B7PAY1_IXOSC/102-130-V---------------------------------------------------NA-F--SM------------------F
A8WRH5_CAEBR/109-138-E---------------------------------------------------LV-F--RN------------------I
CAN11_HUMAN/571-609-L---------------------------------------------------HL-F--KI------------------V
D0MUI2_PHYIT/445-475-K---------------------------------------------------LM-F--SL------------------M
A0BTT3_PARTE/62-91-K---------------------------------------------------QI-F--NV------------------F
A0DVD9_PARTE/23-52-N---------------------------------------------------GA-F--SD------------------L
C3ZDD2_BRAFL/477-508-F---------------------------------------------------DM-F--VK------------------Y
B8BTK8_THAPS/174-205-Y---------------------------------------------------DE-F--KQ------------------P
B8CFD8_THAPS/313-348-R---------------------------------------------------ME-F--EK------------------Y
A2AB62_MOUSE/109-138-Q---------------------------------------------------DI-F--KL------------------F
C3Y3L2_BRAFL/18-48-Q---------------------------------------------------NI-F--SL------------------C
A0EAZ9_PARTE/45-80-R---------------------------------------------------RI-F--KM------------------L
D3BHC5_POLPP/246-276-R---------------------------------------------------SI-F--DR------------------F
CDPKP_ARATH/437-466-R---------------------------------------------------ET-F--KT------------------I
B9R7D2_RICCO/19-48-K---------------------------------------------------GL-L--KR------------------Y
B3RQP5_TRIAD/251-279-L---------------------------------------------------KV-L--AE------------------S
C3YEV6_BRAFL/628-656-T---------------------------------------------------KR-F--NK------------------V
A1CBB6_ASPCL/49-87-DP-------------------------------------------------SSF-F--GL------------------H
C3Z5Z5_BRAFL/533-562-Q---------------------------------------------------KA-L--AA------------------A
D0NH29_PHYIT/57-87-N---------------------------------------------------KL-F--SL------------------F
B7XIJ8_ENTBH/72-101-D---------------------------------------------------EA-F--KI------------------L
A0DMG4_PARTE/351-381-K---------------------------------------------------MK-F--EE------------------L
C3YV00_BRAFL/85-114-G---------------------------------------------------RG-F--GD------------------H
B7FUB0_PHATC/1084-1115-S---------------------------------------------------GI-F--DA------------------F
C3ZH49_BRAFL/1174-1204-L---------------------------------------------------TI-L--KA------------------Q
A7RK79_NEMVE/188-218-E---------------------------------------------------ET-Y--RE------------------W
B3S1A6_TRIAD/67-96------------------------------------------------------A-F--AI------------------Y
Q29IA0_DROPS/39-68-R---------------------------------------------------EI-Y--NM------------------F
A4S9A6_OSTLU/2128-2162-M---------------------------------------------------HD-F--DE------------------T
A0CCU0_PARTE/82-111-E---------------------------------------------------MI-F--QI------------------M
B7Q350_IXOSC/1399-1442-DP-------------------------------------------------NTF-F--AM------------------H
C1MT69_MICPC/45-75-R---------------------------------------------------SF-F--RA------------------L
A9URG6_MONBE/582-611-C---------------------------------------------------DV-L--NR------------------I
B7PQS4_IXOSC/34-61-L---------------------------------------------------EL-F--TL------------------C
A0BSR5_PARTE/180-209-Y---------------------------------------------------QC-F--RQ------------------I
A0BM15_PARTE/63-92-K---------------------------------------------------QI-F--RT------------------L
Q4E142_TRYCC/257-286-H---------------------------------------------------AL-F--QR------------------L
A0A384KRL6_PLAKH/13-41-E---------------------------------------------------SI-F--NE------------------F
B8C031_THAPS/320-349-K---------------------------------------------------CI-F--AW------------------H
A8XF67_CAEBR/57-86-----------------------------------------------------YY-F--KV------------------G
Q38C77_TRYB2/16-45-Q---------------------------------------------------EA-F--RL------------------F
Q4U910_THEAN/477-506-K---------------------------------------------------YA-F--RL------------------Y
B7PG89_IXOSC/60-90-N---------------------------------------------------EL-T--EH------------------A
B8NHB5_ASPFN/61-89-L---------------------------------------------------AD-F--YK------------------A
C3ZYS2_BRAFL/1605-1634-R---------------------------------------------------AL-F--AM------------------A
A9VCA0_MONBE/80-109-L---------------------------------------------------AA-F--KA------------------Y
A7SIS2_NEMVE/98-139-F---------------------------------------------------YF-F--KL------------------H
B0DIL9_LACBS/626-655-D---------------------------------------------------RL-F--FF------------------W
C7G032_DICDI/508-537-D---------------------------------------------------RM-F--KL------------------M
A0EAP2_PARTE/324-354-M---------------------------------------------------AS-F--IS------------------L
A8P2X2_COPC7/487-516-R---------------------------------------------------QY-L--KQ------------------Y
A0DU71_PARTE/549-578-K---------------------------------------------------QM-F--QQ------------------I
Q8LKK4_CHLRE/572-601-R---------------------------------------------------SS-V--IA------------------A
Q54E45_DICDI/138-166-E---------------------------------------------------MI-F--RL------------------F
A0ECX0_PARTE/269-298-Q---------------------------------------------------EM-F--IF------------------I
Q4DLY4_TRYCC/95-128-R---------------------------------------------------GI-F--ND------------------Y
B7Q8D4_IXOSC/82-118-F---------------------------------------------------YF-F--RM------------------H
D0N3C9_PHYIT/174-204-R---------------------------------------------------AA-L--NQ------------------I
A9V4G2_MONBE/147-180-K---------------------------------------------------QT-F--DQ------------------F
A9UU76_MONBE/93-122-Y---------------------------------------------------AA-F--RV------------------F
CGRE1_MOUSE/75-112-L---------------------------------------------------SL-F--AL------------------H
D0NLT0_PHYIT/68-97-G---------------------------------------------------AL-F--TA------------------L
A5KCC4_PLAVS/562-593-K---------------------------------------------------YL-F--NQ------------------Y
Q54EU2_DICDI/187-217-R---------------------------------------------------EI-F--DR------------------F
A8WXW8_CAEBR/591-622-A---------------------------------------------------SI-F--KK------------------I
A0A0D1DQL2_USTMA/20-49-I---------------------------------------------------SR-F--RT------------------L
A2EYC2_TRIVA/29-61-K---------------------------------------------------AA-F--HD------------------V
A0DQ90_PARTE/27-67-H---------------------------------------------------KK-F--QQ------------------L
D0NB87_PHYIT/1035-1065-R---------------------------------------------------AL-F--EK------------------Y
B6K3A4_SCHJY/20-48-T---------------------------------------------------EQ-F--GR------------------L
C4Y9V5_CLAL4/13-44-R---------------------------------------------------NA-F--TL------------------I
Q2H4R6_CHAGB/754-784-Q---------------------------------------------------RL-F--QK------------------W
A7SHV8_NEMVE/147-177-V---------------------------------------------------SI-F--SG------------------W
A4I027_LEIIN/173-200-M---------------------------------------------------QV-W--MM------------------Y
B3MG51_DROAN/125-154-E---------------------------------------------------FA-F--SV------------------Y
EFCB8_MOUSE/115-143-Q---------------------------------------------------KV-F--EK------------------E
A5K8W6_PLAVS/148-177-I---------------------------------------------------KM-F--SH------------------F
B8LWL3_TALSN/221-250-L---------------------------------------------------RA-F--EL------------------F
C4LT56_ENTHI/7-35-D---------------------------------------------------DY-F--AI------------------L
C4LUQ9_ENTHI/16-43-K---------------------------------------------------DA-F--DM------------------F
F1R647_DANRE/83-111-E---------------------------------------------------TM-F--KR------------------F
G3HZP5_CRIGR/33-62-K---------------------------------------------------EA-S--NM------------------I
H0ZMF4_TAEGU/54-83-K---------------------------------------------------EA-F--LL------------------F
H3CP38_TETNG/179-208-K---------------------------------------------------LA-F--KM------------------F
I1LLG5_SOYBN/78-108-E---------------------------------------------------EA-F--EM------------------Y
M9MSK2_DROME/7-36-R---------------------------------------------------TA-F--DL------------------L
Q236J2_TETTS/59-87-E---------------------------------------------------QA-F--KI------------------I
Q38AA2_TRYB2/25-54-K---------------------------------------------------EV-F--SI------------------L
Q38EV6_TRYB2/74-103-R---------------------------------------------------TA-L--RA------------------F
CML9_ORYSJ/91-119-A---------------------------------------------------AC-L--DV------------------F
Q8LHQ5_ORYSJ/28-57-K---------------------------------------------------AW-L--MH------------------F

PF00036

CAYP1_HUMAN/111-139-A---------------------------------------------------RF-F--RQ------------------L
S10AC_RABIT/53-81-D---------------------------------------------------RI-F--RD------------------L
UCP8_SCHPO/337-365-A---------------------------------------------------RI-W--DT------------------V
RPTN_MOUSE/53-81-E---------------------------------------------------TI-L--EH------------------L
2AB2E_ARATH/385-413-E---------------------------------------------------YW-F--KC------------------V
RBOHE_ARATH/272-300-Q---------------------------------------------------IF-F--DM------------------A
CALM4_ARATH/48-76-Q---------------------------------------------------DM-I--NE------------------V
CALM4_ARATH/85-113-K---------------------------------------------------EA-F--RV------------------F
CALM4_ARATH/121-149-E---------------------------------------------------EM-I--RE------------------A
YLJ5_CAEEL/51-79-F---------------------------------------------------KI-F--QL------------------M
YLJ5_CAEEL/87-115-Q---------------------------------------------------AV-M--RS------------------S
DGK3_CAEEL/174-202-D---------------------------------------------------VV-F--HV------------------Y
DGK3_CAEEL/219-247-R---------------------------------------------------QM-M--VD------------------I
Q21408_CAEEL/2329-2357-Q---------------------------------------------------RI-L--DI------------------V
END3_EMENI/46-74-E---------------------------------------------------KV-W--DL------------------A
EP15R_MOUSE/276-304-D---------------------------------------------------EI-F--LK------------------T
Q94288_CAEEL/100-128-K---------------------------------------------------EA-F--LL------------------F
Q94288_CAEEL/136-164-M---------------------------------------------------EI-I--HD------------------V
Q94288_CAEEL/172-200-R---------------------------------------------------EA-F--KI------------------F
CAN9_MOUSE/595-623-M---------------------------------------------------DL-F--LQ------------------F
CABP1_HUMAN/343-370-E---------------------------------------------------EI-I--RD------------------V
O16343_CAEEL/114-142-R---------------------------------------------------FA-F--KM------------------Y
O16343_CAEEL/155-183-D---------------------------------------------------KT-L--EE------------------A
PLSL_HUMAN/13-41-R---------------------------------------------------EA-F--AK------------------V
PLSL_HUMAN/53-81-E---------------------------------------------------NL-M--AT------------------G
DGKG_HUMAN/179-207-E---------------------------------------------------FM-F--RL------------------Y
DGKG_HUMAN/224-252-K---------------------------------------------------EM-L--QG------------------M
RYR2_HUMAN/4027-4055-S---------------------------------------------------DT-F--KE------------------Y
GPDM_HUMAN/627-655-K---------------------------------------------------KR-F--HK------------------F
GPDM_HUMAN/663-691-H---------------------------------------------------EI-L--NE------------------V
DGKA_HUMAN/114-142-E---------------------------------------------------FT-F--KL------------------Y
DGKA_HUMAN/159-187-Q---------------------------------------------------EM-M--KE------------------I
Q93640_CAEEL/121-149-K---------------------------------------------------YA-F--RI------------------Y
Q93640_CAEEL/162-190-E---------------------------------------------------RI-I--EE------------------A
ITSN2_MOUSE/58-86-A---------------------------------------------------EI-W--AL------------------S
ITSN2_MOUSE/282-310-A---------------------------------------------------TI-W--TL------------------A
CALML_DICDI/10-38-K---------------------------------------------------EA-F--NL------------------F
CALML_DICDI/46-73-K---------------------------------------------------DI-A--KE------------------I
CALML_DICDI/82-110-K---------------------------------------------------QA-F--KV------------------F
CAM2_SCHPO/10-38-K---------------------------------------------------EA-F--VL------------------Y
CAM2_SCHPO/79-107-I---------------------------------------------------KA-F--RV------------------F
CAN9_HUMAN/565-593-K---------------------------------------------------NI-I--SL------------------M
CAN9_HUMAN/595-623-I---------------------------------------------------NL-F--LR------------------F
PPE1_HUMAN/570-598-E---------------------------------------------------II-F--NA------------------I
PPE1_HUMAN/610-638-N---------------------------------------------------KL-A--NI------------------M
PPE2_HUMAN/572-600-L---------------------------------------------------SE-F--KK------------------H
PPE2_HUMAN/656-684-E---------------------------------------------------TI-F--RI------------------I
O16158_DROME/11-39-F---------------------------------------------------LF-N--VF------------------F
O16158_DROME/62-90-T---------------------------------------------------GL-R--SK------------------A
O16158_DROME/104-132-N---------------------------------------------------FM-F--DL------------------E
O18058_CAEEL/24-52-A---------------------------------------------------QA-F--KL------------------F
O18058_CAEEL/60-88-L---------------------------------------------------NM-V--NE------------------Y
O18058_CAEEL/96-124-R---------------------------------------------------LA-F--KV------------------F
O18058_CAEEL/132-160-D---------------------------------------------------EI-I--RE------------------V
SCMC1_RABIT/23-51-E---------------------------------------------------TL-F--QA------------------L
SCMC1_RABIT/59-87-E---------------------------------------------------KI-F--TT------------------G
SCMC1_RABIT/90-118-K---------------------------------------------------LA-F--KS------------------L
CML5_ARATH/65-93-K---------------------------------------------------RV-F--QM------------------F
CML5_ARATH/101-129-T---------------------------------------------------QM-I--HK------------------I
CML5_ARATH/143-171-K---------------------------------------------------DA-F--NV------------------F
CML5_ARATH/181-209-K---------------------------------------------------KM-I--MQ------------------V
Y1515_ARATH/10-38-K---------------------------------------------------RI-F--QQ------------------F
CML19_ARATH/27-55-R---------------------------------------------------EI-F--DL------------------F
CML19_ARATH/63-91-N---------------------------------------------------EL-M--AE------------------V
CML19_ARATH/100-128-S---------------------------------------------------KA-F--KI------------------I
CML19_ARATH/136-164-E---------------------------------------------------EM-I--EE------------------A
CML8_ARATH/49-77-H---------------------------------------------------DI-I--TE------------------I
PPE2_MOUSE/576-604-L---------------------------------------------------VE-F--RK------------------R
PPE2_MOUSE/700-728-C---------------------------------------------------DL-A--RS------------------I
ONCO_CAVPO/43-71-K---------------------------------------------------DV-F--RF------------------I
ONCO_CAVPO/82-109-K---------------------------------------------------SL-M--AA------------------A
CALU_RAT/72-100-G---------------------------------------------------MI-V--DK------------------I
CALU_RAT/108-136-E---------------------------------------------------NQ-W--QE------------------F
CHP2_HUMAN/115-143-H---------------------------------------------------YA-F--QL------------------Y
CHP2_HUMAN/156-184-D---------------------------------------------------RT-V--QE------------------A
CALU_HUMAN/72-100-G---------------------------------------------------KI-V--SK------------------I
CALU_HUMAN/192-220-Q---------------------------------------------------ET-M--ED------------------I
O45313_CAEEL/236-262-T---------------------------------------------------KI-F--AE------------------L
GEM1_SCHPO/188-216-S---------------------------------------------------RI-F--FL------------------I
GEM1_SCHPO/308-336-V---------------------------------------------------DL-F--YQ------------------F
FIMB_SCHPO/55-83-R---------------------------------------------------EA-I--RE------------------V
CALM_KLULA/12-40-K---------------------------------------------------EA-F--AL------------------F
CALM_KLULA/48-76-A---------------------------------------------------DL-M--NE------------------I
CALM_KLULA/85-113-L---------------------------------------------------EA-F--KV------------------F
CALM_KLULA/121-147-D---------------------------------------------------EM-L--RE------------------V
O61604_DROME/18-46-K---------------------------------------------------EK-F--IE------------------L
O64866_ARATH/24-52-D---------------------------------------------------ER-F--AA------------------L
O64866_ARATH/73-101-D---------------------------------------------------SI-F--EK------------------F
CDC31_SCHPO/38-66-N---------------------------------------------------EA-F--KL------------------F
CDC31_SCHPO/74-102-L---------------------------------------------------KI-L--RD------------------F
CDC31_SCHPO/147-175-E---------------------------------------------------AM-I--EE------------------F
CMC1_HUMAN/90-118-I---------------------------------------------------VA-F--QL------------------F
CMC1_HUMAN/161-189-R---------------------------------------------------QA-F--AL------------------K
CIB2_HUMAN/107-135-N---------------------------------------------------YA-F--KI------------------Y
CIB2_HUMAN/148-176-D---------------------------------------------------KV-I--EE------------------A
SEGN_HUMAN/16-44-W---------------------------------------------------QV-W--QR------------------F
SEGN_HUMAN/109-137-M---------------------------------------------------QI-W--RK------------------Y
SEGN_HUMAN/201-229-E---------------------------------------------------KI-F--AY------------------Y
SEGN_HUMAN/245-273-E---------------------------------------------------IL-L--RH------------------C
O76670_CAEEL/18-46-N---------------------------------------------------DS-F--DL------------------V
O76670_CAEEL/50-78-Q---------------------------------------------------EY-F--QR------------------F
O76670_CAEEL/117-145-D---------------------------------------------------GI-L--SI------------------A
O76670_CAEEL/158-186-L---------------------------------------------------QL-L--SF------------------I
O76670_CAEEL/195-223-Q---------------------------------------------------QI-F--AM------------------L
RBOHA_ARATH/225-253-R---------------------------------------------------TF-F--AM------------------V
CNBL4_ARATH/75-103-D---------------------------------------------------RI-F--DV------------------F
CNBL4_ARATH/112-140-K---------------------------------------------------FA-F--KL------------------Y
CNBL4_ARATH/156-184-D---------------------------------------------------KA-F--VQ------------------A
CNBL1_ARATH/71-99-N---------------------------------------------------RI-F--DM------------------F
CNBL1_ARATH/108-136-D---------------------------------------------------FT-F--RL------------------Y
YC22_ARATH/388-416-K---------------------------------------------------EL-W--VR------------------A
CML20_ARATH/100-128-T---------------------------------------------------KA-F--QI------------------I
CML20_ARATH/136-164-R---------------------------------------------------EM-V--EE------------------A
CABP1_RAT/157-185-R---------------------------------------------------EA-F--RE------------------F
CABP1_RAT/234-262-R---------------------------------------------------DA-F--RE------------------F
O93409_DANRE/30-58-K---------------------------------------------------EA-F--TI------------------I
RCN1_TAKRU/74-102-S---------------------------------------------------KI-V--DR------------------I
RCN1_TAKRU/110-138-V---------------------------------------------------KV-W--AD------------------Y
RCN1_TAKRU/198-226-L---------------------------------------------------ET-L--ED------------------I
YFFE_SCHPO/13-41-E---------------------------------------------------EA-F--DL------------------F
FKBP9_HUMAN/492-520-P---------------------------------------------------NL-F--EE------------------I
FKBP9_HUMAN/537-563-K---------------------------------------------------NM-F--TN------------------Q
GUC1C_HUMAN/56-84-D---------------------------------------------------QV-Y--NT------------------F
GUC1C_HUMAN/92-120-K---------------------------------------------------WY-F--KL------------------Y
GUC1C_HUMAN/134-162-N---------------------------------------------------LV-F--HK------------------I
O96676_DROME/127-155-R---------------------------------------------------TL-H--RI------------------L
O96676_DROME/249-277-A---------------------------------------------------VS-F--AV------------------I
TNNC2_PIG/94-122-A---------------------------------------------------EC-F--RI------------------F
TNNC2_CHICK/98-126-A---------------------------------------------------NC-F--RI------------------F
CALMS_CHICK/121-149-D---------------------------------------------------EM-I--KE------------------A
CALM_DICDI/87-115-R---------------------------------------------------EA-F--KV------------------F
CALM_DICDI/123-151-D---------------------------------------------------EM-I--RE------------------A
MLE1_CHICK/52-80-K---------------------------------------------------EA-F--LL------------------F
MLE1_CHICK/129-157-V---------------------------------------------------EG-L--RV------------------F
MYL6_CHICK/11-39-K---------------------------------------------------EA-F--QL------------------F
MLRS_CHICK/28-56-K---------------------------------------------------EA-F--TV------------------I
MLRA_CHICK/133-161-D---------------------------------------------------QM-F--AA------------------F
MLRB_CHICK/97-125-L---------------------------------------------------NA-F--KI------------------F
MLRM_CHICK/138-166-D---------------------------------------------------EM-Y--RE------------------A
PRVB_LATCH/42-70-E---------------------------------------------------AI-F--KI------------------L
PRVA_LATCH/44-72-K---------------------------------------------------EV-F--GI------------------L
PRVA_LATCH/83-111-K---------------------------------------------------AL-L--KA------------------G
S100G_BOVIN/49-77-D---------------------------------------------------EL-F--EE------------------L
S100B_BOVIN/53-81-D---------------------------------------------------KV-M--ET------------------L
S10A1_BOVIN/54-82-D---------------------------------------------------KV-M--KE------------------L
SPE1A_STRPU/14-42-K---------------------------------------------------RR-F--KN------------------K
SPE1A_STRPU/50-78-D---------------------------------------------------KM-I--SD------------------V
SPE1A_STRPU/88-116-T---------------------------------------------------KA-F--DD------------------M
SPE2A_STRPU/14-42-K---------------------------------------------------SS-F--KS------------------E
SPE2A_STRPU/50-78-D---------------------------------------------------EM-M--GM------------------V
SPE2A_STRPU/122-150-D---------------------------------------------------AI-I--EK------------------A
SPE2C_STRPU/50-76-D---------------------------------------------------EM-M--SM------------------V
SPE2C_STRPU/85-113-F---------------------------------------------------KA-F--DA------------------L
SPE2C_STRPU/122-150-D---------------------------------------------------AI-I--KK------------------A
CALB1_CHICK/16-44-F---------------------------------------------------EI-W--HH------------------Y
CALB1_CHICK/103-131-M---------------------------------------------------QT-W--RK------------------Y
CALB1_BOVIN/15-43-F---------------------------------------------------EI-W--LH------------------F
CALB1_BOVIN/102-130-M---------------------------------------------------KT-W--RK------------------Y
CALB1_BOVIN/146-174-D---------------------------------------------------LM-L--KL------------------F
CALB1_BOVIN/190-218-N---------------------------------------------------KA-F--EL------------------Y
CALL_CAEEL/25-53-R---------------------------------------------------EA-F--MM------------------F
CALL_CAEEL/61-89-L---------------------------------------------------EM-I--NE------------------V
CALL_CAEEL/97-125-R---------------------------------------------------EA-F--RV------------------F
CALL_CAEEL/133-161-D---------------------------------------------------EM-I--KE------------------V
ACTNA_DICDI/733-761-K---------------------------------------------------AC-F--SH------------------F
ACTNA_DICDI/769-797-N---------------------------------------------------QV-I--SK------------------I
S10A8_HUMAN/50-78-D---------------------------------------------------VW-F--KE------------------L
CALM_SCHPO/13-41-R---------------------------------------------------EA-F--SL------------------F
CALM_SCHPO/86-114-R---------------------------------------------------EA-F--KV------------------F
CALM_SCHPO/122-150-A---------------------------------------------------DM-I--RE------------------A
CDC31_YEAST/24-52-Y---------------------------------------------------EA-F--SL------------------F
CDC31_YEAST/97-125-K---------------------------------------------------RA-F--QL------------------F
CDC31_YEAST/133-161-R---------------------------------------------------AM-I--EE------------------F
SPTA1_MOUSE/2271-2299-S---------------------------------------------------TT-Y--KH------------------F
SPTA1_MOUSE/2314-2342-E---------------------------------------------------KF-L--NA------------------V
MLE_DICDI/7-35-Q---------------------------------------------------EC-F--SI------------------F
MLE_DICDI/79-107-L---------------------------------------------------DA-F--KA------------------L
S10A2_BOVIN/54-82-K---------------------------------------------------KL-M--GD------------------L
CAYP1_CANLF/25-53-A---------------------------------------------------RF-F--RR------------------L
CAYP1_CANLF/61-89-E---------------------------------------------------GV-C--RR------------------W
CAYP1_CANLF/97-125-A---------------------------------------------------AA-F--AK------------------L
PLCD1_BOVIN/144-172-H---------------------------------------------------SC-L--RK------------------A
MLRV_HUMAN/98-126-L---------------------------------------------------NA-F--KV------------------F
ACTN1_HUMAN/750-778-R---------------------------------------------------AS-F--NH------------------F
ACTN1_HUMAN/791-819-A---------------------------------------------------RI-M--SI------------------V
PDCD6_MOUSE/27-55-W---------------------------------------------------NV-F--QR------------------V
PDCD6_MOUSE/94-122-Q---------------------------------------------------NV-F--RT------------------Y
CPNS1_BOVIN/138-166-R---------------------------------------------------SM-V--AV------------------M
CPNS1_BOVIN/168-196-Q---------------------------------------------------AV-Y--KQ------------------F
MRLCA_RAT/33-61-K---------------------------------------------------EA-F--NM------------------I
MRLCA_RAT/102-130-R---------------------------------------------------NA-F--AC------------------F
MLR_DICDI/24-52-K---------------------------------------------------EA-F--EL------------------F
MLR_DICDI/60-88-D---------------------------------------------------AM-F--AE------------------A
MLR_DICDI/97-125-M---------------------------------------------------NA-F--KT------------------F
SPE2D_STRPU/112-140-K---------------------------------------------------EM-I--EK------------------A
SPTN1_RAT/2327-2355-S---------------------------------------------------MM-F--KH------------------F
SPTN1_RAT/2370-2398-E---------------------------------------------------AI-L--DT------------------V
ACTN_DROME/782-810-R---------------------------------------------------SS-F--NH------------------F
ACTN_DROME/823-851-Q---------------------------------------------------RI-L--AV------------------V
MLR_DROME/79-107-K---------------------------------------------------EA-F--QL------------------M
PLSI_CHICK/15-43-R---------------------------------------------------EA-F--NK------------------I
PLSI_CHICK/55-83-E---------------------------------------------------KI-F--AV------------------T
MLR1_CAEEL/28-56-K---------------------------------------------------EA-F--GI------------------M
PRVT_CHICK/82-109-K---------------------------------------------------AF-L--AA------------------G
CAN3_HUMAN/696-724-R---------------------------------------------------SM-I--AL------------------M
FILA_HUMAN/53-81-D---------------------------------------------------VF-M--DH------------------L
RECO_BOVIN/65-93-Q---------------------------------------------------HV-F--RS------------------F
RECO_BOVIN/101-129-E---------------------------------------------------WA-F--SL------------------Y
TRHY_SHEEP/53-81-D---------------------------------------------------LV-L--EL------------------Q
S10AB_CHICK/58-86-D---------------------------------------------------RM-M--KR------------------L
CML24_ARATH/17-45-K---------------------------------------------------KV-F--QR------------------F
CML24_ARATH/53-81-V---------------------------------------------------TM-M--KQ------------------F
CML24_ARATH/94-122-K---------------------------------------------------EA-F--EL------------------Y
CML24_ARATH/130-158-K---------------------------------------------------KM-I--SK------------------V
CML12_ARATH/12-40-R---------------------------------------------------ES-F--RL------------------F
CML12_ARATH/48-76-Q---------------------------------------------------DL-M--NE------------------A
CML12_ARATH/191-219-R---------------------------------------------------EA-F--RV------------------F
CML12_ARATH/227-255-Q---------------------------------------------------DM-I--NE------------------A
CANB_YEAST/25-53-R---------------------------------------------------KR-F--MK------------------L
CANB_YEAST/57-85-G---------------------------------------------------RI-M--EV------------------F
CANB_YEAST/94-122-R---------------------------------------------------FA-F--KI------------------Y
CANB_YEAST/135-163-D---------------------------------------------------RT-I--VE------------------N
S10AA_CHICK/51-79-D---------------------------------------------------KI-M--KD------------------L
S10A8_MOUSE/50-78-E---------------------------------------------------NL-F--RE------------------L
CALL3_HUMAN/48-76-R---------------------------------------------------DM-M--SE------------------I
CALL3_HUMAN/121-149-D---------------------------------------------------EM-I--RA------------------A
M126_CHICK/63-91-D---------------------------------------------------QI-F--KD------------------L
CANB2_RAT/22-50-G---------------------------------------------------RS-F--KK------------------M
CANB2_RAT/132-160-D---------------------------------------------------KS-I--LV------------------L
CDPK_SOYBN/339-367-K---------------------------------------------------EL-F--KM------------------I
CDPK_SOYBN/375-403-K---------------------------------------------------DL-M--DA------------------A
CDPK_SOYBN/411-439-V---------------------------------------------------SA-F--SY------------------F
CDPK_SOYBN/445-473-D---------------------------------------------------DM-I--KE------------------I
GRAN_HUMAN/93-121-R---------------------------------------------------IM-I--AM------------------L
GRAN_HUMAN/123-151-K---------------------------------------------------EN-F--MT------------------V
S10A9_BOVIN/58-86-N---------------------------------------------------EI-M--ED------------------L
CML10_ARATH/12-40-R---------------------------------------------------EQ-F--SV------------------Y
CML10_ARATH/48-76-Q---------------------------------------------------EE-I--ND------------------S
CML10_ARATH/82-110-K---------------------------------------------------KD-F--RL------------------F
CML10_ARATH/118-146-D---------------------------------------------------EI-I--KA------------------A
CML35_ARATH/70-98-V---------------------------------------------------QA-F--KL------------------I
CML35_ARATH/145-173-R---------------------------------------------------EV-F--EI------------------F
CML35_ARATH/182-210-M---------------------------------------------------RM-I--AT------------------V
YNE5_CAEEL/81-109-R---------------------------------------------------SA-F--KL------------------F
YNE5_CAEEL/117-145-D---------------------------------------------------EM-I--RE------------------A
S10A7_HUMAN/54-82-A---------------------------------------------------DV-F--EK------------------K
S10A9_MOUSE/59-87-N---------------------------------------------------DI-M--ED------------------L
PLC1_YEAST/273-301-L---------------------------------------------------EF-F--QL------------------A
PAN1_YEAST/603-631-Y---------------------------------------------------KI-F--ET------------------F
PAN1_YEAST/637-665-E---------------------------------------------------QI-W--NL------------------C
S10A5_HUMAN/51-79-D---------------------------------------------------DL-M--KS------------------L
EDE1_YEAST/51-79-S---------------------------------------------------QV-W--AT------------------V
EDE1_YEAST/171-199-G---------------------------------------------------EI-W--AL------------------C
CBPP_DICDI/403-431-S---------------------------------------------------AA-F--RI------------------H
CBPP_DICDI/439-467-K---------------------------------------------------ML-F--HS------------------I
S10A4_BOVIN/54-82-Q---------------------------------------------------KL-M--SN------------------L
ACTN2_HUMAN/757-785-R---------------------------------------------------AS-F--NH------------------F
ACTN2_HUMAN/793-821-A---------------------------------------------------RI-M--TL------------------V
NCS1_CAEEL/64-92-S---------------------------------------------------FV-F--KV------------------F
NCS1_CAEEL/100-128-H---------------------------------------------------WA-F--KL------------------Y
NCS1_CAEEL/148-176-D---------------------------------------------------RI-F--RM------------------M
NCS2_CAEEL/66-94-E---------------------------------------------------HV-F--RT------------------F
NCS2_CAEEL/102-130-E---------------------------------------------------WA-F--RM------------------Y
NCS2_CAEEL/149-177-K---------------------------------------------------MI-F--EK------------------M
FREQ_DROME/100-128-Q---------------------------------------------------WA-F--RL------------------Y
FREQ_DROME/147-175-D---------------------------------------------------KI-F--DQ------------------M
TRHY_RABIT/53-81-D---------------------------------------------------VM-L--EL------------------L
GEM1_YEAST/205-233-K---------------------------------------------------RI-F--LL------------------S
GEM1_YEAST/334-362-V---------------------------------------------------DI-F--LK------------------F
RDGC_DROME/445-473-E---------------------------------------------------DE-F--RK------------------Y
RDGC_DROME/530-558-V---------------------------------------------------AI-F--NI------------------I
RDGC_DROME/570-598-L---------------------------------------------------EK-C--RM------------------M
PLC1_SCHPO/334-362-E---------------------------------------------------ET-F--QK------------------A
CAB32_DROME/39-67-M---------------------------------------------------DV-W--AH------------------Y
CAB32_DROME/89-117-S---------------------------------------------------CF-M--EA------------------Y
CAB32_DROME/135-163-M---------------------------------------------------KI-W--RE------------------Y
CAB32_DROME/228-256-E---------------------------------------------------KV-F--SL------------------Y
MYL5_FELCA/34-62-K---------------------------------------------------EA-F--TL------------------M
MYL5_FELCA/104-132-L---------------------------------------------------NA-F--KM------------------L
CBPA_DICDI/8-36-E---------------------------------------------------DM-L--RK------------------F
CBPA_DICDI/44-72-S---------------------------------------------------SM-F--IS------------------L
CBPA_DICDI/84-112-N---------------------------------------------------NF-L--KG------------------Y
CBPA_DICDI/122-150-E---------------------------------------------------NF-F--SE------------------L
EPS15_HUMAN/52-80-G---------------------------------------------------KI-W--DL------------------A
EPS15_HUMAN/164-192-G---------------------------------------------------RV-W--EL------------------S
EPS15_HUMAN/227-255-D---------------------------------------------------EI-F--LK------------------T
PRVU_CHICK/43-71-K---------------------------------------------------EI-F--RI------------------L
GUC1A_BOVIN/55-83-E---------------------------------------------------QM-F--ET------------------F
GUC1A_BOVIN/91-119-R---------------------------------------------------WY-F--KL------------------Y
GUC1A_BOVIN/135-163-D---------------------------------------------------TV-F--SK------------------I
TNNC1_DROME/12-40-R---------------------------------------------------NA-F--NA------------------F
TNNC1_DROME/48-76-A---------------------------------------------------DI-I--AE------------------V
TNNC2_DROME/51-79-D---------------------------------------------------EL-I--DE------------------V
TNNC2_DROME/91-119-R---------------------------------------------------EA-F--RL------------------Y
CANB1_DROME/22-50-G---------------------------------------------------KR-F--RK------------------L
CANB1_DROME/54-82-Q---------------------------------------------------RV-I--DI------------------F
CANB1_DROME/91-119-R---------------------------------------------------FA-F--RI------------------Y
CANB1_DROME/132-160-D---------------------------------------------------KT-I--CF------------------A
E631_DROME/39-67-R---------------------------------------------------TA-F--DL------------------L
E631_DROME/131-159-I---------------------------------------------------AA-F--RV------------------F
E631_DROME/167-193-E---------------------------------------------------QL-L--VI------------------A
CDPK2_MAIZE/370-398-K---------------------------------------------------QM-F--MN------------------M
CDPK2_MAIZE/406-434-K---------------------------------------------------QL-M--EA------------------A
CDPK2_MAIZE/442-470-F---------------------------------------------------KA-F--QY------------------F
CDPK2_MAIZE/477-505-R---------------------------------------------------EI-I--SE------------------V
CALL_DROME/11-39-K---------------------------------------------------DA-F--VQ------------------F
CALL_DROME/47-75-Q---------------------------------------------------DL-I--AE------------------A
CALL_DROME/84-112-R---------------------------------------------------EA-F--KI------------------F
CALL_DROME/120-148-D---------------------------------------------------EM-I--RE------------------A
DGKB_RAT/152-180-E---------------------------------------------------FM-F--RL------------------Y
DGKB_RAT/197-225-H---------------------------------------------------EM-M--EE------------------I
CCH1_YEAST/1791-1819-I---------------------------------------------------EA-W--SK------------------F
S10A8_RAT/50-78-E---------------------------------------------------SL-F--KE------------------L
GUC1B_BOVIN/60-88-E---------------------------------------------------AM-F--RA------------------F
GUC1B_BOVIN/96-124-K---------------------------------------------------WT-F--KI------------------Y
GUC1B_BOVIN/149-177-D---------------------------------------------------RI-F--LL------------------V
PRVA_CAVPO/38-66-K---------------------------------------------------MV-F--QI------------------L
ONCO_MOUSE/43-71-K---------------------------------------------------DI-F--QF------------------I
MLC1_YEAST/85-113-V---------------------------------------------------KA-F--QV------------------F
GYP2_YEAST/642-670-N---------------------------------------------------YF-F--SL------------------Y
CDPKN_ORYSJ/413-440-N---------------------------------------------------DL-M--EA------------------A
CDPKN_ORYSJ/448-476-M---------------------------------------------------AA-F--TY------------------F
CDPKN_ORYSJ/482-510-E---------------------------------------------------EM-I--LE------------------V
CDPK7_ORYSJ/384-412-R---------------------------------------------------EM-F--KA------------------V
CDPK7_ORYSJ/490-518-E---------------------------------------------------EI-I--SE------------------V
MLC2_DROME/11-39-Q---------------------------------------------------EA-F--NL------------------F
MLC2_DROME/84-112-I---------------------------------------------------EG-L--RH------------------F
CBP2_DICDI/17-45-E---------------------------------------------------SL-F--KK------------------Y
CBP2_DICDI/92-120-E---------------------------------------------------KF-I--ND------------------N
CBP2_DICDI/128-156-D---------------------------------------------------SI-F--RQ------------------M
CAF1_DICDI/10-38-Q---------------------------------------------------KM-L--DT------------------Y
CAF1_DICDI/133-161-N---------------------------------------------------FI-L--TE------------------M
FIMB_DICDI/11-39-K---------------------------------------------------AS-F--NQ------------------F
FIMB_DICDI/47-75-R---------------------------------------------------DM-I--KE------------------V
CALM_EMENI/121-149-D---------------------------------------------------EM-I--RE------------------A
NCS1_RAT/148-176-D---------------------------------------------------RI-F--AM------------------M
VISL1_RAT/150-178-D---------------------------------------------------KI-F--SK------------------M
CANB1_RAT/132-160-D---------------------------------------------------KT-I--IN------------------A
TAL_SYNY3/356-384-D---------------------------------------------------VV-F--DA------------------L
S10AC_BOVIN/53-81-D---------------------------------------------------KI-F--QD------------------L
PRVA_FELCA/43-71-K---------------------------------------------------KV-F--HI------------------L
PRVA_FELCA/82-110-K---------------------------------------------------ML-M--AA------------------G
S10AC_PIG/53-81-D---------------------------------------------------KI-F--QN------------------L
S10AC_HUMAN/53-81-D---------------------------------------------------EI-F--QG------------------L
NUCB2_MOUSE/245-273-K---------------------------------------------------TF-F--KL------------------H
NUCB2_MOUSE/297-325-E---------------------------------------------------HV-M--SE------------------I
HPCA_RAT/64-92-E---------------------------------------------------HV-F--RT------------------F
HPCA_RAT/100-128-M---------------------------------------------------WA-F--SM------------------Y
HPCA_RAT/148-176-E---------------------------------------------------KI-F--RQ------------------M
CANB_NEUCR/25-53-R---------------------------------------------------KR-F--MK------------------L
CANB_NEUCR/57-85-T---------------------------------------------------RM-I--AI------------------F
CANB_NEUCR/135-163-D---------------------------------------------------KT-I--ME------------------A
GPDM_CAEEL/628-656-K---------------------------------------------------ER-F--QQ------------------L
GPDM_CAEEL/664-692-H---------------------------------------------------EL-L--NE------------------V
P90802_CAEEL/57-85-R---------------------------------------------------QV-F--NM------------------F
P90802_CAEEL/93-121-D---------------------------------------------------KI-I--DE------------------V
P90802_CAEEL/167-195-D---------------------------------------------------EI-F--NE------------------A
P91423_CAEEL/51-79-I---------------------------------------------------QV-I--KE------------------A
LETM1_DROME/691-719-G---------------------------------------------------DL-L--VK------------------L
LETM1_DROME/774-802-E---------------------------------------------------AV-L--EK------------------F
CDPKE_ARATH/359-387-K---------------------------------------------------ER-F--QV------------------M
CDPKE_ARATH/395-423-Q---------------------------------------------------IL-M--DA------------------G
CDPKE_ARATH/431-459-K---------------------------------------------------KA-F--TF------------------F
CDPKE_ARATH/467-495-E---------------------------------------------------AI-I--LD------------------V
S100G_MOUSE/49-77-D---------------------------------------------------NL-F--KE------------------L
MLRA_HUMAN/36-64-K---------------------------------------------------EA-F--SC------------------I
MLRA_HUMAN/106-134-L---------------------------------------------------SA-F--RM------------------F
NCS1_YEAST/64-92-N---------------------------------------------------HL-F--TV------------------F
NCS1_YEAST/100-128-S---------------------------------------------------WA-F--EL------------------Y
NCS1_YEAST/148-176-K---------------------------------------------------KI-F--KL------------------M
MLC2_YEAST/19-47-K---------------------------------------------------DA-F--QM------------------L
CDPK1_ARATH/455-483-K---------------------------------------------------EM-F--NM------------------I
CDPK1_ARATH/491-519-L---------------------------------------------------DL-M--QA------------------A
CDPK1_ARATH/527-555-F---------------------------------------------------AA-F--TY------------------F
CDPK1_ARATH/561-589-E---------------------------------------------------EL-M--RD------------------V
TRHY_HUMAN/53-81-D---------------------------------------------------LI-L--EL------------------L
ACTN3_HUMAN/764-792-R---------------------------------------------------AS-F--NH------------------F
CAST_SOLTU/40-68-R---------------------------------------------------RI-F--DV------------------F
CAST_SOLTU/129-157-K---------------------------------------------------EA-F--DV------------------F
CAST_SOLTU/167-195-E---------------------------------------------------MM-I--SS------------------V
MLR4_SCHPO/78-106-V---------------------------------------------------KG-F--QV------------------F
MLRH_CAEEL/102-130-R---------------------------------------------------NA-F--QC------------------F
NCS1_SCHPO/64-92-E---------------------------------------------------YV-F--NV------------------F
NCS1_SCHPO/100-128-I---------------------------------------------------WA-F--QL------------------Y
NCS1_SCHPO/148-176-N---------------------------------------------------KI-F--NM------------------M
Q09980_CAEEL/8-36-R---------------------------------------------------EV-F--RE------------------F
Q09980_CAEEL/44-72-E---------------------------------------------------TM-I--EQ------------------A
Q09980_CAEEL/81-109-R---------------------------------------------------DV-F--NV------------------F
Q09980_CAEEL/117-145-K---------------------------------------------------EM-I--KQ------------------G
CANA_DROME/703-731-R---------------------------------------------------SM-V--AM------------------L
CANA_DROME/733-761-K---------------------------------------------------AI-F--KV------------------Y
YT67_CAEEL/52-80-R---------------------------------------------------QL-F--NM------------------F
YT67_CAEEL/88-116-D---------------------------------------------------NV-I--KE------------------V
YT67_CAEEL/127-155-R---------------------------------------------------EC-F--EI------------------F
YT67_CAEEL/162-190-E---------------------------------------------------KV-F--RE------------------L
PKD2_HUMAN/754-782-E---------------------------------------------------AI-F--TK------------------Y
PLSI_HUMAN/55-83-E---------------------------------------------------KI-L--SV------------------A
RCN1_HUMAN/83-111-G---------------------------------------------------KI-V--DR------------------I
Q18136_CAEEL/22-50-K---------------------------------------------------GI-F--RE------------------F
Q18136_CAEEL/58-86-D---------------------------------------------------AM-F--QA------------------A
Q18136_CAEEL/91-119-K---------------------------------------------------AV-F--EE------------------L
Q18874_CAEEL/420-448-S---------------------------------------------------MI-F--RI------------------F
Q18887_CAEEL/66-94-K---------------------------------------------------EM-F--KK------------------T
Q18887_CAEEL/193-221-N---------------------------------------------------DL-M--GV------------------Y
Q18887_CAEEL/276-304-N---------------------------------------------------DI-M--ML------------------T
CMC3_CAEEL/74-102-R---------------------------------------------------DM-Y--DR------------------L
CMC3_CAEEL/140-168-A---------------------------------------------------EV-F--DK------------------I
Q19770_CAEEL/423-451-D---------------------------------------------------AV-F--KH------------------Y
Q19770_CAEEL/452-480-I---------------------------------------------------DA-F--VN------------------I
CDPKI_ARATH/457-485-R---------------------------------------------------AA-F--DK------------------F
CDPKI_ARATH/487-515-E---------------------------------------------------PL-L--EE------------------A
CDPKJ_ARATH/440-468-K---------------------------------------------------QL-L--ED------------------A
CDPKJ_ARATH/476-504-F---------------------------------------------------KA-F--QH------------------F
CDPKJ_ARATH/511-539-K---------------------------------------------------EI-I--SE------------------V
Q20358_CAEEL/23-51-S---------------------------------------------------ET-F--DL------------------L
Q20358_CAEEL/59-87-D---------------------------------------------------FI-F--GE------------------M
Q20358_CAEEL/96-124-E---------------------------------------------------VQ-F--RK------------------F
CMC2_CAEEL/77-105-R---------------------------------------------------DI-Y--DR------------------L
CMC2_CAEEL/144-172-A---------------------------------------------------EM-F--AD------------------M
Q21201_CAEEL/82-110-I---------------------------------------------------KG-L--SH------------------F
RASEF_CAEEL/37-65-R---------------------------------------------------FI-F--TE------------------L
Q26572_SCHMA/11-39-H---------------------------------------------------EM-F--LL------------------F
Q26572_SCHMA/84-112-I---------------------------------------------------ES-F--RV------------------F
CATR1_PARTE/41-69-K---------------------------------------------------EA-F--DL------------------F
CATR1_PARTE/77-105-Y---------------------------------------------------QM-I--SD------------------L
CATR1_PARTE/114-142-Q---------------------------------------------------KV-F--NL------------------F
CATR1_PARTE/150-178-Q---------------------------------------------------EM-I--DR------------------A
S10A7_BOVIN/54-82-S---------------------------------------------------NI-F--EK------------------Q
CDPK9_ARATH/468-496-Y---------------------------------------------------KA-F--QH------------------F
CDPK9_ARATH/503-531-K---------------------------------------------------EV-L--SD------------------V
CDPK4_ARATH/436-464-D---------------------------------------------------DM-I--KE------------------I
CDPK5_ARATH/508-536-E---------------------------------------------------DI-I--KE------------------V
CDPK6_ARATH/462-490-V---------------------------------------------------SA-F--QY------------------F
CDPK7_ARATH/364-392-K---------------------------------------------------EA-F--EM------------------M
CDPK7_ARATH/400-428-Q---------------------------------------------------IL-M--EA------------------T
CDPK7_ARATH/436-464-H---------------------------------------------------KA-F--NF------------------F
CDPK7_ARATH/473-501-A---------------------------------------------------AI-M--QD------------------V
Q39890_SOYBN/121-149-E---------------------------------------------------QM-I--KE------------------A
CDPKC_ARATH/363-391-Q---------------------------------------------------EL-L--RA------------------A
CDPKC_ARATH/399-427-V---------------------------------------------------AA-F--SF------------------F
CDPK8_ARATH/362-390-K---------------------------------------------------EA-F--EM------------------M
CDPK3_ARATH/383-411-K---------------------------------------------------EM-F--KS------------------L
CDPK3_ARATH/419-447-R---------------------------------------------------QL-M--EA------------------A
CDPK3_ARATH/455-483-Y---------------------------------------------------TA-F--QF------------------F
CDPK3_ARATH/490-518-K---------------------------------------------------EI-I--AE------------------V
CML21_ARATH/58-86-K---------------------------------------------------AI-F--QE------------------F
CML21_ARATH/149-177-V---------------------------------------------------DT-F--VF------------------L
CBPC_DICDI/10-38-Q---------------------------------------------------KF-A--KG------------------Y
CBPC_DICDI/93-121-E---------------------------------------------------AF-L--LR------------------F
CBPC_DICDI/128-156-D---------------------------------------------------YV-L--KI------------------I
CBPB_DICDI/42-70-K---------------------------------------------------TQ-F--MS------------------Y
CBPB_DICDI/78-106-K---------------------------------------------------KM-I--EQ------------------V
CAB45_MOUSE/101-129-M---------------------------------------------------VI-F--SK------------------V
CAB45_MOUSE/236-264-K---------------------------------------------------EI-F--RD------------------L
CAB45_MOUSE/317-345-K---------------------------------------------------QM-I--AI------------------A
RCN2_RAT/104-132-K---------------------------------------------------QQ-F--VE------------------Y
PLCD4_RAT/174-202-F---------------------------------------------------SL-F--QE------------------A
TBCD9_HUMAN/890-918-S---------------------------------------------------RL-F--QL------------------L
CAN8_RAT/579-607-R---------------------------------------------------EM-I--SL------------------L
CAN8_RAT/609-637-L---------------------------------------------------EI-F--QE------------------M
CNBLA_ARATH/117-145-D---------------------------------------------------RV-F--DL------------------F
CNBLA_ARATH/154-182-D---------------------------------------------------FA-F--RL------------------Y
CNBLA_ARATH/198-226-D---------------------------------------------------KT-F--AD------------------A
CNBL5_ARATH/70-98-E---------------------------------------------------RI-F--GL------------------F
CNBL5_ARATH/107-135-I---------------------------------------------------FA-F--RL------------------Y
CNBL5_ARATH/151-179-S---------------------------------------------------KT-F--EE------------------A
GRP2_HUMAN/430-458-E---------------------------------------------------SV-F--RN------------------F
RCN2_MOUSE/68-96-Q---------------------------------------------------SI-I--KK------------------I
RCN2_MOUSE/193-221-Q---------------------------------------------------EA-L--EE------------------H
RCN2_MOUSE/234-262-D---------------------------------------------------RF-V--ND------------------Y
GRP3_HUMAN/424-452-E---------------------------------------------------SV-F--RN------------------Y
GRP3_HUMAN/453-481-L---------------------------------------------------DS-F--CV------------------L
CNBL2_ARATH/86-114-D---------------------------------------------------RV-F--DL------------------F
CNBL2_ARATH/123-151-H---------------------------------------------------FS-F--QL------------------Y
CDPKD_ARATH/359-387-K---------------------------------------------------VM-F--NK------------------M
CDPKD_ARATH/395-423-Q---------------------------------------------------ML-I--EA------------------V
CDPKD_ARATH/467-495-N---------------------------------------------------DI-F--QE------------------V
CAN3_CHICK/685-713-R---------------------------------------------------SM-I--AL------------------M
CAN3_CHICK/715-743-Q---------------------------------------------------KI-F--KH------------------Y
CAN2_CHICK/576-604-K---------------------------------------------------IM-V--DL------------------L
CAN2_CHICK/606-634-Q---------------------------------------------------KI-Y--RE------------------I
MIRO1_CAEEL/192-220-I---------------------------------------------------RV-F--KI------------------C
MIRO1_CAEEL/312-340-S---------------------------------------------------AL-F--EK------------------Y
CML13_ARATH/13-41-K---------------------------------------------------EA-F--ML------------------F
TPC1_ARATH/326-354-E---------------------------------------------------KA-F--GL------------------I
TPC1_ARATH/367-395-G---------------------------------------------------LI-F--DE------------------L
S10A6_CHICK/52-80-A---------------------------------------------------GL-M--ED------------------L
CHP1_HUMAN/114-142-H---------------------------------------------------FA-F--RL------------------Y
CHP1_HUMAN/155-183-D---------------------------------------------------RT-I--QE------------------A
CIB1_HUMAN/107-135-H---------------------------------------------------YA-F--RI------------------F
CIB1_HUMAN/152-180-D---------------------------------------------------NI-L--EE------------------S
MICU1_HUMAN/412-440-D---------------------------------------------------VV-F--AL------------------F
CNBL6_ARATH/161-189-D---------------------------------------------------KT-F--EE------------------A
CML43_ARATH/111-139-E---------------------------------------------------EA-F--NV------------------F
RBOHD_ARATH/257-285-Q---------------------------------------------------VF-F--DM------------------V
CDPKN_ARATH/373-401-K---------------------------------------------------TL-F--AN------------------M
CDPKN_ARATH/445-473-H---------------------------------------------------KA-F--QH------------------L
CDPKN_ARATH/480-508-K---------------------------------------------------EV-I--SE------------------V
CDPKA_ARATH/368-396-K---------------------------------------------------NM-F--SL------------------M
CDPKA_ARATH/404-432-K---------------------------------------------------ML-M--EV------------------A
CDPKA_ARATH/440-468-K---------------------------------------------------LA-F--MF------------------F
CDPKA_ARATH/476-504-S---------------------------------------------------DI-M--RE------------------V
CDPK3_PLAF7/422-450-K---------------------------------------------------ST-F--LV------------------L
CDPK3_PLAF7/457-485-D---------------------------------------------------LL-L--DQ------------------I
GRP1_RAT/474-502-D---------------------------------------------------SV-F--KN------------------Y
RBOHB_ARATH/175-203-Q---------------------------------------------------IF-F--DM------------------V
CANB_DROME/800-828-R---------------------------------------------------SM-V--AM------------------L
KIC_ARATH/78-106-Q---------------------------------------------------GM-V--RE------------------G
CML30_ARATH/50-78-R---------------------------------------------------RV-F--SR------------------F
CML30_ARATH/86-114-P---------------------------------------------------KI-F--KA------------------V
CML30_ARATH/121-149-R---------------------------------------------------NS-F--WT------------------F
CML30_ARATH/157-185-N---------------------------------------------------RM-V--RA------------------V
CML48_ARATH/56-84-V---------------------------------------------------RS-F--ES------------------A
CML48_ARATH/125-153-R---------------------------------------------------AI-F--NR------------------Y
CML6_ARATH/5-33-N---------------------------------------------------RV-F--QM------------------F
CML6_ARATH/41-69-T---------------------------------------------------QI-I--QK------------------I
CML6_ARATH/81-109-K---------------------------------------------------EA-F--NV------------------F
CML6_ARATH/119-147-R---------------------------------------------------KM-I--MQ------------------V
CDPKM_ARATH/350-378-K---------------------------------------------------TM-F--EN------------------M
CDPKM_ARATH/422-450-Y---------------------------------------------------KA-F--QY------------------F
CDPKM_ARATH/457-485-K---------------------------------------------------DL-I--SE------------------F
CDPKK_ARATH/439-467-K---------------------------------------------------EM-F--KM------------------I
CDPKK_ARATH/511-539-F---------------------------------------------------TA-F--SY------------------F
CDPKK_ARATH/545-573-D---------------------------------------------------DI-L--RE------------------V
A0DAT1_PARTE/456-482-T---------------------------------------------------EI-L--QM------------------C
A2DKH3_TRIVA/802-830-K---------------------------------------------------DT-F--KY------------------F
A2DXW5_TRIVA/52-79-Q---------------------------------------------------DM-I--NE------------------I
A5KBU9_PLAVS/422-448-D---------------------------------------------------NI-L--KE------------------V
A7X9M1_PHYPA/417-443-K---------------------------------------------------EM-F--KM------------------M
A8HNF8_CHLRE/23-50-R---------------------------------------------------KA-F--AM------------------F
A8JC40_CHLRE/65-92-K---------------------------------------------------KM-I--SE------------------I
B2RYZ0_XENTR/43-70-K---------------------------------------------------NV-F--AI------------------L
B4HBA9_DROPE/62-88-D---------------------------------------------------EI-S--AI------------------A
B4J6G6_DROGR/50-76-K---------------------------------------------------AL-I--KE------------------V
C3YK83_BRAFL/11-38-K---------------------------------------------------DG-F--PL------------------F
C3YYW0_BRAFL/109-136-L---------------------------------------------------RA-F--KV------------------F
C3ZY23_BRAFL/55-82-Q---------------------------------------------------QM-I--EE------------------V
C5MCF3_CANTT/85-112-D---------------------------------------------------QM-I--KE------------------A
C5WY52_SORBI/565-591-E---------------------------------------------------DM-I--GE------------------V
C5Y427_SORBI/388-414-K---------------------------------------------------EM-F--KN------------------I
D2UYG7_NAEGR/127-154-D---------------------------------------------------EM-I--RE------------------A
D2V5Z7_NAEGR/140-166-D---------------------------------------------------KT-I--LE------------------A
D2VXQ7_NAEGR/141-168-R---------------------------------------------------EM-I--EE------------------A
A8BQU2_GIAIC/144-171-L---------------------------------------------------AM-I--QE------------------F
E2RU85_GIAIC/130-157-Q---------------------------------------------------EM-I--DE------------------A
A0A183HAI3_9BILA/10-37-R---------------------------------------------------EV-F--CY------------------F
F6RDI4_XENTR/92-118-K---------------------------------------------------WT-F--KV------------------Y
F6WJV7_XENTR/97-124-S---------------------------------------------------DL-F--RM------------------F
F6X6F2_XENTR/50-78-K---------------------------------------------------EA-F--LL------------------F
I1KY83_SOYBN/402-429-K---------------------------------------------------AM-F--TN------------------M
I1MDY1_SOYBN/29-57-K---------------------------------------------------EA-F--EL------------------F
M0SNQ3_MUSAM/466-492-N---------------------------------------------------AI-I--RD------------------V
M4CA48_BRARP/11-37-D---------------------------------------------------RI-F--KK------------------F
M4E4B8_BRARP/7-33-E---------------------------------------------------RI-F--KK------------------F
Q4CS04_TRYCC/28-55-T---------------------------------------------------VM-F--DE------------------I
Q4CSZ0_TRYCC/139-167-R---------------------------------------------------SA-F--FH------------------Y
Q4DUP6_TRYCC/100-126-M---------------------------------------------------MI-W--MK------------------Y
TEGU_SCHMA/12-39-I---------------------------------------------------RA-F--LE------------------I
GNPTA_MOUSE/989-1015-S---------------------------------------------------QV-F--HE------------------V
Q6YYX3_ORYSJ/9-36-E---------------------------------------------------RI-F--KR------------------F
Q7R9F4_PLAYO/85-113-I---------------------------------------------------EA-F--RV------------------F
CDPK2_PLAF7/375-401-R---------------------------------------------------NI-F--IA------------------L
CML1_ORYSJ/48-75-Q---------------------------------------------------DM-I--SE------------------V
CDPKD_ARATH/432-458-R---------------------------------------------------KA-F--SY------------------F
A0A3B1K0Y5_ASTMX/43-70-K---------------------------------------------------KA-F--FV------------------I
W5MGE4_LEPOC/20-48-K---------------------------------------------------AA-F--DM------------------F

PF13202

A0A0F7V4V1_TOXGV/470-493-A------------------------------------------------------F--QQ------------------F
C4P7X0_CHLVA/167-192-D---------------------------------------------------QT-F--NE------------------M
MICU1_XENTR/220-244-I----------------------------------------------------A-F--KM------------------F
O26668_METTH/8-31-D------------------------------------------------------L--RQ------------------L
D3E367_METRM/266-289-D------------------------------------------------------L--SQ------------------L
C3ZQ19_BRAFL/1361-1385-K----------------------------------------------------A-F--RK------------------V
B5YG07_THEYD/135-158-S------------------------------------------------------F--SL------------------Y
A9T5H9_PHYPA/22-46-D----------------------------------------------------A-F--DF------------------F
A9T5H9_PHYPA/107-131-T------------------------------------------------------F--NR------------------F
C4P7Y4_SORBI/152-177-D---------------------------------------------------QT-F--KQ------------------A
B9RDE4_RICCO/35-59-Q----------------------------------------------------V-F--KL------------------I
A0BVC5_PARTE/382-405-A------------------------------------------------------F--EA------------------I
C1N2Y6_MICPC/9-33-D----------------------------------------------------V-F--DA------------------F
B6TKT3_MAIZE/153-178-D---------------------------------------------------NT-F--SQ------------------A
A0DDA5_PARTE/353-376-E------------------------------------------------------F--QK------------------Y
Q4UIH6_THEAN/479-503-Q----------------------------------------------------I-L--KE------------------I
B7QHF1_IXOSC/149-174-D---------------------------------------------------KI-F--RQ------------------G
CML38_ARATH/44-69-A----------------------------------------------------V-F--SY------------------M
A0DVR4_PARTE/154-178-V----------------------------------------------------W-L--EA------------------A
D2VRB9_NAEGR/331-355-A----------------------------------------------------W-F--DA------------------V
B6KJ69_TOXGV/232-256-K----------------------------------------------------E-F--KS------------------Y
D2VB88_NAEGR/225-250IA------------------------------------------------------F--QC------------------F
D2VA25_NAEGR/11-35-P----------------------------------------------------L-F--NA------------------V
C5XIH5_SORBI/22-46-S----------------------------------------------------L-F--AA------------------F
B4HTW1_DROSE/40-64-T----------------------------------------------------A-F--DL------------------L
A4ZKI6_POPTR/152-177-D---------------------------------------------------KT-F--SD------------------A
A0C5A2_PARTE/441-468-K----------------------------------------------------T-F--QA------------------I
C3ZF66_BRAFL/98-123-N---------------------------------------------------TM-I--SV------------------A
A0DA67_PARTE/343-367-A------------------------------------------------------F--QA------------------L
CANB_KLULA/26-50-K----------------------------------------------------R-F--MK------------------L
A4HVS3_LEIIN/72-97-E----------------------------------------------------W-F--RA------------------V
CNBL2_ARATH/167-192-D---------------------------------------------------KT-F--EE------------------A
B0XGS0_CULQU/246-272-H----------------------------------------------------V-F--RK------------------L
B8DL48_DESVM/259-282-R------------------------------------------------------F--AQ------------------F
C5Z8P2_SORBI/58-82-D----------------------------------------------------M-L--AR------------------A
Y2130_DICDI/94-119-D---------------------------------------------------TS-F--HC------------------M
Y2130_DICDI/154-178-D----------------------------------------------------L-F--LQ------------------L
Q4QG09_LEIMA/54-79-S----------------------------------------------------G-F--QA------------------A
C9SFB3_VERA1/63-87-Q----------------------------------------------------I-L--SR------------------V
Q4D2E0_TRYCC/138-163-D---------------------------------------------------KT-F--IE------------------V
A2FET7_TRIVA/16-40-Q----------------------------------------------------Q-F--ED------------------L
C3YD91_BRAFL/134-159-Q---------------------------------------------------EY-F--KK------------------V
A4YRX7_BRASO/88-113-D----------------------------------------------------L-F--SQ------------------I
A0DSC5_PARTE/21-44-I------------------------------------------------------F--RR------------------I
A7APE2_BABBO/16-41-D---------------------------------------------------NH-F--KL------------------V
A7T743_NEMVE/31-54-A------------------------------------------------------I--RL------------------F
B4KQ48_DROMO/52-76-D----------------------------------------------------L-I--DE------------------I
D3B5T3_POLPP/148-172-D----------------------------------------------------F-F--EK------------------M
B9SPR6_RICCO/147-171-K----------------------------------------------------M-L--KV------------------V
A9UX06_MONBE/90-113-A------------------------------------------------------F--KA------------------M
A3LTX1_PICST/205-231-S----------------------------------------------------V-F--EK------------------V
A7S611_NEMVE/41-67-E----------------------------------------------------V-F--NK------------------L
B0W1J6_CULQU/268-292IA------------------------------------------------------F--RM------------------F
Q0UM05_PHANO/88-113-S----------------------------------------------------L-F--KS------------------I
A0A3N7E8H4_POPTR/156-181-D---------------------------------------------------KT-M--IE------------------A
Q15VG6_PSEA6/81-104-S------------------------------------------------------F--SR------------------I
B8CE53_THAPS/330-354-D----------------------------------------------------V-F--TK------------------I
Q47I72_DECAR/140-163-N------------------------------------------------------F--DA------------------A
A8XVB7_CAEBR/473-497-A------------------------------------------------------F--VN------------------I
Q3A3S2_PELCD/55-78-D------------------------------------------------------F--GK------------------I
A0C9M2_PARTE/19-43-E----------------------------------------------------A-F--DQ------------------F
Q4N591_THEPA/813-837-D----------------------------------------------------I-L--EE------------------V
Q3JEE9_NITOC/75-99-L----------------------------------------------------Y-F--KQ------------------L
C1FF66_MICCC/33-57-A----------------------------------------------------V-F--AD------------------I
A0A3N7FRP7_POPTR/143-167-E----------------------------------------------------T-F--NV------------------F
CML50_ARATH/188-213-A----------------------------------------------------C-F--QA------------------A
A4RU14_OSTLU/441-466-D---------------------------------------------------RL-F--EA------------------F
D3BNS7_POLPP/96-121-D---------------------------------------------------VS-F--RC------------------L
A0DMF3_PARTE/401-425-T------------------------------------------------------F--LY------------------L
A4RZI0_OSTLU/14-38-H------------------------------------------------------F--NA------------------V
Q804W1_DANRE/83-107-A----------------------------------------------------F-L--QA------------------A
B7G459_PHATC/14-38-E----------------------------------------------------T-F--QL------------------I
A8IXR0_CHLRE/4-29-Q----------------------------------------------------W-F--AS------------------I
D3EQM6_ATETH/729-752-R------------------------------------------------------F--RF------------------F
A9UZJ7_MONBE/82-106-A------------------------------------------------------F--QV------------------I
A0CIV5_PARTE/365-389-K------------------------------------------------------F--KQ------------------I
A9VD02_MONBE/88-111-G------------------------------------------------------L--RV------------------F
B7GBA5_PHATC/485-509-D----------------------------------------------------V-F--NI------------------A
A0DK50_PARTE/458-483-A----------------------------------------------------C-F--EF------------------F
A5K4A9_PLAVS/215-237-D------------------------------------------------------F--NF------------------F
D7SNZ6_VITVI/403-425-D----------------------------------------------------Q-F--DA------------------I
F1QUS0_DANRE/67-89-E----------------------------------------------------F-M--QK------------------F
F4HZU8_ARATH/290-313-R----------------------------------------------------L-F--QK------------------I
F6HHF9_VITVI/59-82-S------------------------------------------------------F--QM------------------V
H2LE63_ORYLA/44-67-K----------------------------------------------------A-F--GI------------------I
I1Q944_ORYGL/86-110-D----------------------------------------------------A-F--YV------------------F
K3XLQ6_SETIT/156-179-D---------------------------------------------------RT-F--DQ------------------A
K7UU06_MAIZE/38-61-R----------------------------------------------------V-F--SR------------------I
Q22RP4_TETTS/886-908-A------------------------------------------------------F--RI------------------A
Q57W92_TRYB2/288-312-T----------------------------------------------------L-F--RT------------------L
Q6N380_RHOPA/95-117-D----------------------------------------------------L-F--KQ------------------I

PF13833

W5KKQ5_ASTMX/541-595-C---------------------------------------------------LI-FFDRC------------------I
D4A938_RAT/94-146-C---------------------------------------------------EA-L--RL------------------A
EFCB3_RAT/61-113-Y---------------------------------------------------NE-L--KC------------------A
A5ARZ8_VITVI/40-93-R---------------------------------------------------SM-V--TE------------------G
B9INT1_POPTR/41-94-V---------------------------------------------------SM-V--KE------------------G
PBP1_ARATH/50-104-R---------------------------------------------------YM-I--NE------------------G
B9RPS2_RICCO/36-90-V---------------------------------------------------SM-V--KE------------------G
B9I910_POPTR/47-100-E---------------------------------------------------AM-V--RE------------------G
Q6Z727_ORYSJ/59-117-A---------------------------------------------------AM-V--RE------------------G
D0NVB9_PHYIT/85-137-Q---------------------------------------------------WM-I--WE------------------V
D0P2Y1_PHYIT/101-153-S---------------------------------------------------DM-I--WE------------------A
Q54HB8_DICDI/91-143-N---------------------------------------------------VI-F--KF------------------I
A0CF79_PARTE/166-215-F---------------------------------------------------II-M--KY------------------F
D0MVE6_PHYIT/108-160-S---------------------------------------------------EI-F--YE------------------S
A0DTQ9_PARTE/83-135-T---------------------------------------------------ML-V--RI------------------F
B4MB62_DROVI/283-336-D---------------------------------------------------VI-F--TV------------------F
PCAT1_MOUSE/432-483-T---------------------------------------------------DL-F--QA------------------I
PCAT1_HUMAN/432-483-T---------------------------------------------------DL-F--RA------------------I
B4JIX5_DROGR/476-528-Q---------------------------------------------------TL-F--YA------------------L
PCAT_DROME/455-507-Q---------------------------------------------------AL-F--YA------------------L
B4L1J4_DROMO/476-528-Q---------------------------------------------------TL-F--YA------------------L
B7G2K7_PHATC/364-418-D---------------------------------------------------LL-F--DV------------------F
C3Z2D7_BRAFL/396-448-E---------------------------------------------------HM-L--DR------------------L
C3Z612_BRAFL/548-601-E---------------------------------------------------IL-L--DR------------------V
C3Z612_BRAFL/788-840-H---------------------------------------------------VL-A--DK------------------F
Q69Z12_CAEEL/55-111-Q---------------------------------------------------TL-L--SH------------------F
B0WLJ4_CULQU/72-125-D---------------------------------------------------HV-F--RT------------------F
A2FHL4_TRIVA/21-75-D---------------------------------------------------II-F--SG------------------I
C3Y1D3_BRAFL/16-70-E---------------------------------------------------IL-F--MK------------------V
C3YJD8_BRAFL/199-252-D---------------------------------------------------AL-F--KK------------------M
A0A3N7FW51_POPTR/94-147-R---------------------------------------------------CM-L--RE------------------G
I1LRV1_SOYBN/37-90-V---------------------------------------------------SM-M--RE------------------G
I1M2E4_SOYBN/41-94-R---------------------------------------------------CM-L--RE------------------G
Q57WF9_TRYB2/87-140-D---------------------------------------------------AL-F--NA------------------L

PF13499

F7H9X0_CALJA/14-82-EL-------------------------------------------------KEA-F--AK------------------V
B0S5T5_DANRE/253-355-VI-------------------------------------------------YCK-F--WE------------------L
B4K5H6_DROMO/74-157-KI-------------------------------------------------FYM-F--KA------------------H
B0W4V1_CULQU/107-174-KV-------------------------------------------------FYA-F--KI------------------Y
A0CA88_PARTE/343-408-AM-------------------------------------------------MAS-F--IS------------------L
E9AEY5_LEIMA/91-155-VI-------------------------------------------------HRM-V--ES------------------M
B4KQ53_DROMO/120-192-RM-------------------------------------------------IFV-Y--SI------------------Y
Q9VDI5_DROME/166-252-EL-------------------------------------------------QFHYF--KM------------------H
C1FGJ2_MICCC/15-91-SL-------------------------------------------------RPI-L--EE------------------I
Q22Y73_TETTS/418-482-NL-------------------------------------------------QDA-Y--RV------------------F
Q7XUK2_ORYSJ/675-739-RI-------------------------------------------------GNR-W--QL------------------L
Q179P5_AEDAE/119-191-KV-------------------------------------------------KYC-F--KV------------------Y
Q03ZC4_LEUMM/205-292-AT-------------------------------------------------EDITY--IA-----------------AA
Q384M5_TRYB2/10-74-YL-------------------------------------------------KRR-F--DA------------------F
A0A0D1DYS1_USTMA/669-733-DV-------------------------------------------------GSR-M--HL------------------I
D2W3R3_NAEGR/27-89-QA-------------------------------------------------QST-F--QQ------------------Y
A7T5T7_NEMVE/484-551-DM-------------------------------------------------KHA-F--ME------------------L
C1MJG0_MICPC/4-66-RL-------------------------------------------------REL-F--SR------------------I
A9TA03_PHYPA/319-420-VI-------------------------------------------------YCK-F--WE------------------L
Q8ILL9_PLAF7/780-853-AL-------------------------------------------------FQK-F--KN------------------Y
A0C6I2_PARTE/147-212-PL-------------------------------------------------EQA-F--SL------------------L
A2FGB1_TRIVA/30-97-KL-------------------------------------------------RNS-F--TE------------------A
Q4UGG2_THEAN/877-948-SL-------------------------------------------------KRA-F--SY------------------Y
Q4QI25_LEIMA/175-239-KL-------------------------------------------------RVV-F--SE------------------F
Q4QF91_LEIMA/93-157-DL-------------------------------------------------VTA-L--RA------------------F
Q4DBK1_TRYCC/324-390-EI-------------------------------------------------HRA-F--VS------------------C
EFCB9_HUMAN/104-166-HS-------------------------------------------------RPV-F--DL------------------L
RHBL3_HUMAN/36-100-HW-------------------------------------------------KVL-F--DQ------------------F
B0WCB9_CULQU/103-174-KA-------------------------------------------------AWA-F--RV------------------F
C4MAF9_ENTHI/45-109-EL-------------------------------------------------QDF-F--VK------------------T
Q17J61_AEDAE/75-143-EL-------------------------------------------------TMA-F--NK------------------A
Q383U3_TRYB2/31-98-KL-------------------------------------------------QEL-F--DS------------------L
F1QW82_DANRE/246-324-KT-------------------------------------------------F---F--NL------------------H
B0BNB8_RAT/10-74-EY-------------------------------------------------KEC-F--SL------------------Y
C5DF93_LACTC/134-200-QI-------------------------------------------------ATQLF--QN------------------H
A8Y4B4_CAEBR/161-225-KL-------------------------------------------------AEM-F--AD------------------M
2AB2B_ARATH/316-417-VI-------------------------------------------------YCK-F--WE------------------L
Q9T0I9_ARATH/31-105-FV-------------------------------------------------EQK-F--QQ------------------L
O77424_DROME/28-137-QL-------------------------------------------------HTR-F--RS------------------L
A0E9H8_PARTE/87-164-TA-------------------------------------------------KTI-F--DL------------------Y
Q5KK44_CRYNJ/679-743-HL-------------------------------------------------RTQ-F--ER------------------F
Q4UGG2_THEAN/779-852-AL-------------------------------------------------FQK-F--QE------------------Y
C3YCL0_BRAFL/77-150-QL-------------------------------------------------MMDNF--DQ------------------H
A0C466_PARTE/34-96-EI-------------------------------------------------EAE-F--KA------------------L
F6HM70_VITVI/148-216-RI-------------------------------------------------REV-F--HE------------------I
B4NST7_DROSI/40-104-DI-------------------------------------------------KEA-F--DL------------------F
B5YLV0_THAPS/86-155-AL-------------------------------------------------APKIF--EL------------------L
EFCB7_MOUSE/104-168-EL-------------------------------------------------LKS-F--KK------------------L
Q7QDS4_ANOGA/162-227-RD-------------------------------------------------RRR-W--SI------------------A
E0CTM8_VITVI/295-363-AI-------------------------------------------------KKL-F--ET------------------I
B0WSP5_CULQU/60-140-KN-------------------------------------------------FYF-