Sequence alignment for CL0222

PF14667

Q03SZ7_LACBA/349-498--------------------------------------------------------------------------------
Q38V74_LACSS/358-503--------------------------------------------------------------------------------
B3WAP5_LACCB/356-499--------------------------------------------------------------------------------
A8UAN8_9LACT/362-510--------------------------------------------------------------------------------
D0BM46_9LACT/359-506--------------------------------------------------------------------------------
C8NI78_9LACT/366-514--------------------------------------------------------------------------------
C0WQN7_LACBU/354-501--------------------------------------------------------------------------------
C2EHH6_9LACO/356-502--------------------------------------------------------------------------------
E6LEY4_9ENTE/358-506--------------------------------------------------------------------------------
C9A420_ENTGA/359-508--------------------------------------------------------------------------------
C2HEH9_ENTFC/359-507--------------------------------------------------------------------------------
C0X942_ENTFL/359-507--------------------------------------------------------------------------------
E0RUK9_BUTPB/373-516--------------------------------------------------------------------------------
C5Q1B2_STAAU/332-469--------------------------------------------------------------------------------
E7MM58_9FIRM/379-526--------------------------------------------------------------------------------
E4LZJ6_9CLOT/384-531--------------------------------------------------------------------------------
D4W2K6_9FIRM/377-526--------------------------------------------------------------------------------
D5E4C9_BACMQ/373-523--------------------------------------------------------------------------------
B7JJF5_BACC0/376-524--------------------------------------------------------------------------------
Q8EP19_OCEIH/372-521--------------------------------------------------------------------------------
B1YKH1_EXIS2/386-534--------------------------------------------------------------------------------
D6Y0K7_BACIE/382-530--------------------------------------------------------------------------------
Q5WE75_BACSK/374-522--------------------------------------------------------------------------------
E6U1Q3_BACCJ/375-523--------------------------------------------------------------------------------
D3FXP2_BACPE/374-522--------------------------------------------------------------------------------
A4IRX9_GEOTN/371-520--------------------------------------------------------------------------------
D5DN36_BACMD/374-521--------------------------------------------------------------------------------
A7Z7U6_BACA2/375-524--------------------------------------------------------------------------------
A0RJU4_BACAH/372-520--------------------------------------------------------------------------------
E7RE43_9BACL/368-516--------------------------------------------------------------------------------
A3I8W7_9BACI/372-521--------------------------------------------------------------------------------
A6CQJ8_9BACI/372-520--------------------------------------------------------------------------------
D3UNL4_LISSS/370-518--------------------------------------------------------------------------------
B8DHB8_LISMH/370-518--------------------------------------------------------------------------------
A0A008APY8_STAAU/386-533--------------------------------------------------------------------------------
B9E7H2_MACCJ/374-522--------------------------------------------------------------------------------
D5T1U4_LEUKI/363-511--------------------------------------------------------------------------------
Q03XR0_LEUMM/330-477--------------------------------------------------------------------------------
A0NHL2_OENOE/387-534--------------------------------------------------------------------------------
B1MY12_LEUCK/485-634--------------------------------------------------------------------------------
C2KKY7_LEUMC/498-647--------------------------------------------------------------------------------
C0WLU0_LACBU/374-518--------------------------------------------------------------------------------
C2EP42_9LACO/342-483--------------------------------------------------------------------------------
A0A038C172_ENTFL/370-519--------------------------------------------------------------------------------
C5RB06_WEIPA/501-648--------------------------------------------------------------------------------
A8UCR2_9LACT/391-539--------------------------------------------------------------------------------
A2RMM4_LACLM/390-539--------------------------------------------------------------------------------
C9A2J3_ENTGA/381-529--------------------------------------------------------------------------------
E6LIJ6_9ENTE/381-529--------------------------------------------------------------------------------
A0A037ZTL3_ENTFL/382-530--------------------------------------------------------------------------------
C2H7P1_ENTFC/381-529--------------------------------------------------------------------------------
A4VW05_STRSY/379-527--------------------------------------------------------------------------------
E3CI47_STRDO/375-523--------------------------------------------------------------------------------
A5LCT3_STREE/372-520--------------------------------------------------------------------------------
A3CPL5_STRSV/375-523--------------------------------------------------------------------------------
A2RG74_STRPG/377-525--------------------------------------------------------------------------------
E8K660_STRPA/410-558--------------------------------------------------------------------------------
B1SH45_9STRE/377-525--------------------------------------------------------------------------------
C2LQ70_STRSL/432-580--------------------------------------------------------------------------------
C6SP25_STRMN/377-525--------------------------------------------------------------------------------
B3W6R7_LACCB/364-511--------------------------------------------------------------------------------
A5VL26_LACRD/382-530--------------------------------------------------------------------------------
D2ELV8_PEDAC/393-541--------------------------------------------------------------------------------
C0WUG9_LACBU/378-530--------------------------------------------------------------------------------
Q03RI1_LACBA/378-525--------------------------------------------------------------------------------
C2EED2_9LACO/381-529--------------------------------------------------------------------------------
Q38VP9_LACSS/378-526--------------------------------------------------------------------------------
C8PCY7_9LACO/375-523--------------------------------------------------------------------------------
D0DXL5_9LACO/375-523--------------------------------------------------------------------------------
C2E7U4_LACJH/384-532--------------------------------------------------------------------------------
C2KAZ9_9LACO/380-528--------------------------------------------------------------------------------
B3WCD6_LACCB/380-528--------------------------------------------------------------------------------
D0BKY7_9LACT/390-538--------------------------------------------------------------------------------
C8NE09_9LACT/413-561--------------------------------------------------------------------------------
E4KNA5_9LACT/790-938--------------------------------------------------------------------------------
D4YJ56_9LACT/433-583--------------------------------------------------------------------------------
E0IFR0_9BACL/366-514--------------------------------------------------------------------------------
E0RCM4_PAEP6/382-529--------------------------------------------------------------------------------
C6J0R0_9BACL/364-511--------------------------------------------------------------------------------
E5Z458_9BACL/362-509--------------------------------------------------------------------------------
C0Z9G8_BREBN/364-513--------------------------------------------------------------------------------
C4GB38_9FIRM/387-530--------------------------------------------------------------------------------
A8RUL6_CLOBW/387-539--------------------------------------------------------------------------------
E6LN70_9FIRM/381-525--------------------------------------------------------------------------------
C7GE86_9FIRM/383-527--------------------------------------------------------------------------------
E3GGE0_EUBLK/365-508--------------------------------------------------------------------------------
E6MGM4_9FIRM/373-516--------------------------------------------------------------------------------
B8D0L3_HALOH/359-505--------------------------------------------------------------------------------
C6PQD8_9CLOT/131-275--------------------------------------------------------------------------------
C8VXJ1_DESAS/366-509--------------------------------------------------------------------------------
D9QSV7_ACEAZ/363-507--------------------------------------------------------------------------------
B2A8K9_NATTJ/363-507--------------------------------------------------------------------------------
A8MK38_ALKOO/363-506--------------------------------------------------------------------------------
A5D2G5_PELTS/358-502--------------------------------------------------------------------------------
D5X9J9_THEPJ/361-503--------------------------------------------------------------------------------
B2A2Z4_NATTJ/361-504--------------------------------------------------------------------------------
C7GYH1_9FIRM/373-517--------------------------------------------------------------------------------
A6TN15_ALKMQ/363-506--------------------------------------------------------------------------------
A8MIG9_ALKOO/365-508--------------------------------------------------------------------------------
Q67JD5_SYMTH/384-522--------------------------------------------------------------------------------
C4FNY8_9FIRM/361-503--------------------------------------------------------------------------------
D3LVV9_9FIRM/358-500--------------------------------------------------------------------------------
E2ZD67_9FIRM/360-502--------------------------------------------------------------------------------
C9LLX4_9FIRM/363-506--------------------------------------------------------------------------------
D3LX29_9FIRM/358-500--------------------------------------------------------------------------------
C4FPR1_9FIRM/359-501--------------------------------------------------------------------------------
A1HLQ5_9FIRM/371-513--------------------------------------------------------------------------------
C4V2B6_9FIRM/374-517--------------------------------------------------------------------------------
E8LB44_9FIRM/369-509--------------------------------------------------------------------------------
C0WBK9_9FIRM/378-517--------------------------------------------------------------------------------
B7DPH6_9BACL/373-525--------------------------------------------------------------------------------
C0ZHE2_BREBN/367-517--------------------------------------------------------------------------------
C2YMP0_BACCE/352-495--------------------------------------------------------------------------------
B7GMA5_ANOFW/366-505--------------------------------------------------------------------------------
E7RL93_9BACL/356-500--------------------------------------------------------------------------------
D3FZH8_BACPE/357-501--------------------------------------------------------------------------------
B0MPG6_9FIRM/391-534--------------------------------------------------------------------------------
B0PEA8_9FIRM/441-584--------------------------------------------------------------------------------
A7VWY4_9CLOT/433-577--------------------------------------------------------------------------------
E6TRQ4_BACCJ/362-512--------------------------------------------------------------------------------
D5WSL0_KYRT2/373-521--------------------------------------------------------------------------------
B1YGP9_EXIS2/345-491--------------------------------------------------------------------------------
C5RD31_WEIPA/359-505--------------------------------------------------------------------------------
Q8EU30_OCEIH/362-509--------------------------------------------------------------------------------
B9E8U7_MACCJ/341-481--------------------------------------------------------------------------------
Q49V13_STAS1/337-479--------------------------------------------------------------------------------
B9CVC4_STACP/347-489--------------------------------------------------------------------------------
C2M158_STAHO/360-502--------------------------------------------------------------------------------
D3QG68_STALH/343-485--------------------------------------------------------------------------------
E8SIP0_STAPH/344-486--------------------------------------------------------------------------------
A0A008AT25_STAAU/343-485--------------------------------------------------------------------------------
F2F183_SOLSS/360-508--------------------------------------------------------------------------------
A3IEA1_9BACI/365-514--------------------------------------------------------------------------------
E7RLD1_9BACL/354-503--------------------------------------------------------------------------------
A0AF13_LISW6/361-504--------------------------------------------------------------------------------
D7UUI0_LISGR/356-499--------------------------------------------------------------------------------
A6CR25_9BACI/352-499--------------------------------------------------------------------------------
E5WT44_9BACI/362-510--------------------------------------------------------------------------------
Q2B249_9BACI/362-508--------------------------------------------------------------------------------
A8F924_BACP2/360-506--------------------------------------------------------------------------------
E5WAE4_9BACI/356-502--------------------------------------------------------------------------------
A7Z0I0_BACA2/354-499--------------------------------------------------------------------------------
D4G3E4_BACNB/359-505--------------------------------------------------------------------------------
D5D970_BACMD/362-511--------------------------------------------------------------------------------
B7GFI4_ANOFW/350-497--------------------------------------------------------------------------------
A4IJD3_GEOTN/352-496--------------------------------------------------------------------------------
C5D378_GEOSW/360-505--------------------------------------------------------------------------------
Q5WAF7_BACSK/347-496--------------------------------------------------------------------------------
D3FR13_BACPE/361-509--------------------------------------------------------------------------------
Q9KGJ0_BACHD/361-507--------------------------------------------------------------------------------
D6XV50_BACIE/360-507--------------------------------------------------------------------------------
D3E759_GEOS4/381-532--------------------------------------------------------------------------------
E0RM54_PAEP6/373-525--------------------------------------------------------------------------------
A7GJW7_BACCN/360-506--------------------------------------------------------------------------------
B5UWQ0_BACCE/360-510--------------------------------------------------------------------------------
D2BMG7_LACLK/323-465--------------------------------------------------------------------------------
B8IEZ7_METNO/324-461--------------------------------------------------------------------------------
C7NM90_HALUD/327-463--------------------------------------------------------------------------------
A6DHF1_9BACT/293-436--------------------------------------------------------------------------------
Q47U72_COLP3/338-481--------------------------------------------------------------------------------
B4AGJ7_BACPU/343-486--------------------------------------------------------------------------------
Q1K412_DESAC/351-495--------------------------------------------------------------------------------
C0QCL2_DESAH/352-496--------------------------------------------------------------------------------
Q2YCG5_NITMU/323-466--------------------------------------------------------------------------------
E6QMG7_9ZZZZ/367-517--------------------------------------------------------------------------------
F2G999_ALTMD/323-467--------------------------------------------------------------------------------
C6JQC3_FUSVA/323-462--------------------------------------------------------------------------------
E5X0H2_9BACE/326-464--------------------------------------------------------------------------------
A3DHV8_CLOTH/327-465--------------------------------------------------------------------------------
B5CWR8_BACPM/324-466--------------------------------------------------------------------------------
F1VXT7_9BURK/320-462--------------------------------------------------------------------------------
Q2YCC1_NITMU/331-475--------------------------------------------------------------------------------
Q0AHL3_NITEC/325-466--------------------------------------------------------------------------------
D4YX22_SPHJU/336-476--------------------------------------------------------------------------------
Q1GPL1_SPHAL/342-484--------------------------------------------------------------------------------
B0VF98_CLOAI/326-465--------------------------------------------------------------------------------
A1S103_THEPD/335-472--------------------------------------------------------------------------------
E8R8C0_DESM0/349-487--------------------------------------------------------------------------------
A3DIV8_CLOTH/358-500--------------------------------------------------------------------------------
F2JLQ5_CELLD/355-497--------------------------------------------------------------------------------
A7VPC0_9CLOT/355-497--------------------------------------------------------------------------------
A8SAU1_9FIRM/356-502--------------------------------------------------------------------------------
A6TSY6_ALKMQ/375-519--------------------------------------------------------------------------------
A6NPI5_9FIRM/351-494--------------------------------------------------------------------------------
B0K3R2_THEPX/360-504--------------------------------------------------------------------------------
B7AQB6_9FIRM/351-493--------------------------------------------------------------------------------
D3AN52_9CLOT/376-519--------------------------------------------------------------------------------
B0TAY6_HELMI/361-505--------------------------------------------------------------------------------
Q3ADH7_CARHZ/346-484--------------------------------------------------------------------------------
E0RMQ1_PAEP6/366-508--------------------------------------------------------------------------------
C0ZAP4_BREBN/363-505--------------------------------------------------------------------------------
D7WQC4_9BACI/353-489--------------------------------------------------------------------------------
C8WQG9_ALIAD/361-502--------------------------------------------------------------------------------
B7DPL3_9BACL/356-497--------------------------------------------------------------------------------
D5QEL1_KOMHA/351-483--------------------------------------------------------------------------------
A9WAD6_CHLAA/337-475--------------------------------------------------------------------------------
E1IEK9_9CHLR/380-529--------------------------------------------------------------------------------
B9JKJ2_AGRRK/321-464--------------------------------------------------------------------------------
Q2Y4J6_9ARCH/377-524--------------------------------------------------------------------------------
E8V165_TERSS/339-475--------------------------------------------------------------------------------
B8IGJ3_METNO/336-472--------------------------------------------------------------------------------
D7BDH0_MEISD/336-473--------------------------------------------------------------------------------
F2NKF2_MARHT/337-483--------------------------------------------------------------------------------
D8J725_HALJB/340-478--------------------------------------------------------------------------------
B8D178_HALOH/340-478--------------------------------------------------------------------------------
C4RGH8_9ACTO/364-502--------------------------------------------------------------------------------
Q18GU8_HALWD/357-496--------------------------------------------------------------------------------
Q469G3_METBF/349-484--------------------------------------------------------------------------------
C5A2Y0_THEGJ/342-480--------------------------------------------------------------------------------
F0LLW6_THEBM/342-478--------------------------------------------------------------------------------
F2KQE3_ARCVS/343-481--------------------------------------------------------------------------------
F0LLZ4_THEBM/339-477--------------------------------------------------------------------------------
Q5JDW0_THEKO/345-480--------------------------------------------------------------------------------
A1BJ49_CHLPD/337-476--------------------------------------------------------------------------------
B3EHD9_CHLL2/365-504--------------------------------------------------------------------------------
Q3APG3_CHLCH/338-477--------------------------------------------------------------------------------
B4SBS0_PELPB/338-477--------------------------------------------------------------------------------
Q3B6G9_PELLD/337-476--------------------------------------------------------------------------------
A4SCQ1_PROVI/337-476--------------------------------------------------------------------------------
D8PBA0_9BACT/336-473--------------------------------------------------------------------------------
D3SSH7_NATMM/337-474--------------------------------------------------------------------------------
B6IYF6_RHOCS/343-484--------------------------------------------------------------------------------
D0LQE6_HALO1/374-513--------------------------------------------------------------------------------
D2RVV2_HALTV/336-474--------------------------------------------------------------------------------
D3STC0_NATMM/337-475--------------------------------------------------------------------------------
D8J472_HALJB/339-477--------------------------------------------------------------------------------
D2RXY9_HALTV/340-478--------------------------------------------------------------------------------
E7QQ57_9EURY/339-477--------------------------------------------------------------------------------
C7P069_HALMD/318-461--------------------------------------------------------------------------------
C7NSR3_HALUD/331-469--------------------------------------------------------------------------------
Q5V4U1_HALMA/327-465--------------------------------------------------------------------------------
D8J7W8_HALJB/319-457--------------------------------------------------------------------------------
C7NSL6_HALUD/319-457--------------------------------------------------------------------------------
E4NUG7_HALBP/319-458--------------------------------------------------------------------------------
AGL15_HALVD/319-457--------------------------------------------------------------------------------
Q12VM9_METBU/345-483--------------------------------------------------------------------------------
A3CVY7_METMJ/333-471--------------------------------------------------------------------------------
A2STD2_METLZ/331-469--------------------------------------------------------------------------------
A5UQJ1_ROSS1/330-463--------------------------------------------------------------------------------
D3FFB8_CONWI/338-471--------------------------------------------------------------------------------
D8GMK0_CLOLD/327-460--------------------------------------------------------------------------------
F0KAR0_CLOAE/326-458--------------------------------------------------------------------------------
D5XD05_THEPJ/326-457--------------------------------------------------------------------------------
Q2NIB6_METST/328-458--------------------------------------------------------------------------------
F0T719_METSL/333-463--------------------------------------------------------------------------------
Q2NH55_METST/331-464--------------------------------------------------------------------------------
E3GZ73_METFV/328-459--------------------------------------------------------------------------------
A5UNI7_METS3/328-460--------------------------------------------------------------------------------
F0TC71_METSL/328-460--------------------------------------------------------------------------------
Q12XY4_METBU/326-458--------------------------------------------------------------------------------
Q46FX4_METBF/329-461--------------------------------------------------------------------------------
F0TBQ9_METSL/329-463--------------------------------------------------------------------------------
Q0W809_UNCMA/331-464--------------------------------------------------------------------------------
D1Z261_METPS/328-462--------------------------------------------------------------------------------
O26442_METTH/329-460--------------------------------------------------------------------------------
A5UWW7_ROSS1/374-505--------------------------------------------------------------------------------
E1IAS8_9CHLR/378-523--------------------------------------------------------------------------------
D5UPU7_TSUPD/350-482--------------------------------------------------------------------------------
Q97AA3_THEVO/339-476--------------------------------------------------------------------------------
Q2S953_HAHCH/328-463--------------------------------------------------------------------------------
F2NHK3_DESAR/367-498--------------------------------------------------------------------------------
A3W1Y0_9RHOB/329-468--------------------------------------------------------------------------------
C4XGJ8_DESMR/335-465--------------------------------------------------------------------------------
A9EQ86_SORC5/331-462--------------------------------------------------------------------------------
B9K2D6_AGRVS/332-468--------------------------------------------------------------------------------
E3FNG9_STIAD/347-485--------------------------------------------------------------------------------
B6YVL8_THEON/328-461--------------------------------------------------------------------------------
E0I7A7_9BACL/353-491--------------------------------------------------------------------------------
D5DY76_BACMQ/331-468--------------------------------------------------------------------------------
D7E977_METEZ/332-466--------------------------------------------------------------------------------
A1ASY9_PELPD/345-481--------------------------------------------------------------------------------
D7D534_GEOSC/329-466--------------------------------------------------------------------------------
E8RTH0_ASTEC/331-467--------------------------------------------------------------------------------
Q0AP11_MARMM/327-464--------------------------------------------------------------------------------
E7RZY6_9BURK/339-474--------------------------------------------------------------------------------
Q12TY8_METBU/325-459--------------------------------------------------------------------------------
D9PYX0_METTM/350-483--------------------------------------------------------------------------------
F0TB30_METSL/351-484--------------------------------------------------------------------------------
F0EKD4_ENTCA/327-465--------------------------------------------------------------------------------
Q5M4A4_STRT2/55-193--------------------------------------------------------------------------------
F0HVE0_LACDL/327-469--------------------------------------------------------------------------------
E4SMU5_LACAR/327-469--------------------------------------------------------------------------------
D4LGF1_9FIRM/327-469--------------------------------------------------------------------------------
A5ZUX1_9FIRM/326-464--------------------------------------------------------------------------------
D5TQD2_BACT1/321-460--------------------------------------------------------------------------------
A0A016CGV6_BACFG/328-466--------------------------------------------------------------------------------
E8JWJ5_STRCR/327-467--------------------------------------------------------------------------------
Q4JZ09_STREE/330-470--------------------------------------------------------------------------------
E6MFC3_9FIRM/328-466--------------------------------------------------------------------------------
E9RY62_9FIRM/330-468--------------------------------------------------------------------------------
C5NWI0_9BACL/318-458--------------------------------------------------------------------------------
A1ILY9_STROR/319-458--------------------------------------------------------------------------------
Q4JYJ9_STREE/323-464--------------------------------------------------------------------------------
E0PD92_STREI/325-464--------------------------------------------------------------------------------
C6CSD9_PAESJ/327-465--------------------------------------------------------------------------------
B0N362_9FIRM/290-427--------------------------------------------------------------------------------
A5M4K0_STREE/211-349--------------------------------------------------------------------------------
C9LAR2_BLAHA/325-463--------------------------------------------------------------------------------
Q4K189_STREE/323-460--------------------------------------------------------------------------------
C4FB42_9ACTN/325-467--------------------------------------------------------------------------------
E0S188_BUTPB/322-462--------------------------------------------------------------------------------
C3HRG9_BACTU/323-461--------------------------------------------------------------------------------
A7HKJ9_FERNB/322-460--------------------------------------------------------------------------------
E4L4W5_9STRE/321-459--------------------------------------------------------------------------------
E7S3G0_STRAG/321-459--------------------------------------------------------------------------------
E0NHN4_PEDAC/321-459--------------------------------------------------------------------------------
E6LD53_9ENTE/253-391--------------------------------------------------------------------------------
C2KJQ1_LEUMC/329-467--------------------------------------------------------------------------------
B3XNV8_LACRE/322-460--------------------------------------------------------------------------------
B2GDL9_LACF3/322-460--------------------------------------------------------------------------------
C0WVB1_LACFE/322-460--------------------------------------------------------------------------------
A2RHU4_LACLM/321-459--------------------------------------------------------------------------------
A1YVF6_LACJH/321-459--------------------------------------------------------------------------------
C2D643_LACBR/210-348--------------------------------------------------------------------------------
Q3ZK40_9LACT/322-460--------------------------------------------------------------------------------
D8MET9_LEUGT/321-460--------------------------------------------------------------------------------
A3F4D6_LACLC/321-459--------------------------------------------------------------------------------
D2EJ27_PEDAC/321-459--------------------------------------------------------------------------------
O06039_LACLC/321-459--------------------------------------------------------------------------------
Q8GPE5_STRTR/321-459--------------------------------------------------------------------------------
D7DRX9_METV3/353-490--------------------------------------------------------------------------------
A4FX93_METM5/354-492--------------------------------------------------------------------------------
A6UPA0_METVS/351-488--------------------------------------------------------------------------------
A6UU30_META3/353-490--------------------------------------------------------------------------------
D5VU50_METIM/353-494--------------------------------------------------------------------------------
D4W1F1_9FIRM/338-485--------------------------------------------------------------------------------
B9DSP4_STRU0/342-480--------------------------------------------------------------------------------
F1Z193_9STRE/350-488--------------------------------------------------------------------------------
D4YGG7_9LACT/385-532--------------------------------------------------------------------------------
F2I7P9_AERUA/374-520--------------------------------------------------------------------------------
Q03E00_PEDPA/355-503--------------------------------------------------------------------------------
D2EHX4_PEDAC/355-503--------------------------------------------------------------------------------
A0A021WE79_LACPN/357-507--------------------------------------------------------------------------------
E7FPH6_9LACO/355-501--------------------------------------------------------------------------------

PF03023

MURJ_BORBU/29-473FSYYFGANLDADIFNYVFNIPNNLRKILS..EGAMTSAFLPEFTHEK.N......KSHEKAVSFFRTVITFNIISIGLIV
MURJ_RICPR/28-477IASLFGSTPMGDSMNIAFKLPNLFRRIFA..EGALSSVFIPIYNEKM.L......ISKKAANNFSGKVFTLLSLTLIVII
MURJ_ECOLI/28-479VARIFGAGMATDAFFVAFKLPNLLRRIFA..EGAFSQAFVPILAEYKSK......QGEDATRVFVSYVSGLLTLALAVVT
MURJ_SYNY3/36-495IAAAFGVGTVVTAYAYAYVIPGFLFILLGGINGPFHSALVSVLSKRD..........REEAAPLVETVTTLVSGVLLGVT
MURJ_AQUAE/29-466VAYYFGASAVSDAFFIAFRIPNAFRRIFG..EGGFNAVFIPFYGEAV.........KQNREEEFLRKTFGLLITFSLSVV
MURJ_HAEIN/16-479IAHLIGAGAAADVFLFANRIPNFLRRLFA..EGAFSQAFVPVLAEYQQS......GDMNKTREFIGKVSGTLGGLVSIVT
MURJ_THEMA/28-450LAKTFGASSTLDAYYVSIVFPFFLRRTFA..EGAMSSAFMAIYKKLK.........NKEEKAQFTSAVLTSLGLVTLLIV
Q9X8T0_STRCO/300-778IVSALGVGLLGDTFQVAYQLPTMIYILTV..GGGLNSVFVPQLVRAMKD.......DEDGGEAFANRLLTLVMVALGALT
MURJ_TREPA/32-489KSTLMGTSATADAFTVAFMIPNLFRRLFA..ENAISVAFIPVFTQHYSMPSSAQVPCSSKTKEFLSAIFTLMSSVTASIS
Q9RX17_DEIRA/83-522IN..LFDTTLTDAFNVAIKVPNLMRELLA..EGALVNSFIPVYKTLD..........AAERRKLAQSFSGFLIAINLLLM
MURJ_CHLTR/34-482MATYFGADPLVASFWLAFRTIFFLRKLLG..GPILGLAFIPHFEFLR.A......QNISRATFFFRSFSRFFCYSAILFT
MURJ_HELPY/2-458MANILGAGVYSDIFFVAFKLPNLFRRIFA..EGSFSQSFLPSFIRSS........IKGSFASLVGLIFCIVLFMWCLLVA
MVIN_MYCTU/48-521LAAILGAALASS.FSVANQLPNLVAALVL..EATFTAIFVPVLARAE.Q......DDPDGGAAFVRRLVTLATTLLLGAT

PF01554

O51531_BORBU/22-182--------------------------------------------------------------------------------
YOEA_BACSU/28-189--------------------------------------------------------------------------------
YOEA_BACSU/257-418--------------------------------------------------------------------------------
O66528_AQUAE/245-406--------------------------------------------------------------------------------
YPNP_BACSU/241-402--------------------------------------------------------------------------------
NORM_VIBPA/243-404--------------------------------------------------------------------------------
O80695_ARATH/278-441--------------------------------------------------------------------------------
O26414_METTH/244-409--------------------------------------------------------------------------------
O28801_ARCFU/21-180--------------------------------------------------------------------------------
YISQ_BACSU/27-187--------------------------------------------------------------------------------
Y709_METJA/243-408--------------------------------------------------------------------------------
YPNP_BACSU/21-182--------------------------------------------------------------------------------
O25454_HELPY/214-375--------------------------------------------------------------------------------
NORM_BACSU/20-180--------------------------------------------------------------------------------
HMRM_HAEIN/249-410--------------------------------------------------------------------------------
O49660_ARATH/262-426--------------------------------------------------------------------------------
O82752_ARATH/42-203--------------------------------------------------------------------------------
DINF_ECOLI/35-196--------------------------------------------------------------------------------
Q9ZVH5_ARATH/238-401--------------------------------------------------------------------------------
O28801_ARCFU/239-404--------------------------------------------------------------------------------
Q38956_ARATH/275-438--------------------------------------------------------------------------------
ERC1_YEAST/174-335--------------------------------------------------------------------------------
Q9ZVH5_ARATH/16-176--------------------------------------------------------------------------------
YAO6_SCHPO/17-177--------------------------------------------------------------------------------
O82752_ARATH/264-427--------------------------------------------------------------------------------
O51429_BORBU/27-187--------------------------------------------------------------------------------
O83871_TREPA/32-196--------------------------------------------------------------------------------
O51429_BORBU/248-409--------------------------------------------------------------------------------
YISQ_BACSU/252-413--------------------------------------------------------------------------------
O66528_AQUAE/25-183--------------------------------------------------------------------------------
O51530_BORBU/21-181--------------------------------------------------------------------------------
Y709_METJA/21-181--------------------------------------------------------------------------------
NORM_BACSU/247-408--------------------------------------------------------------------------------
NORM_VIBPA/17-176--------------------------------------------------------------------------------
O26414_METTH/24-183--------------------------------------------------------------------------------
HMRM_HAEIN/22-181--------------------------------------------------------------------------------
YD338_YEAST/238-397--------------------------------------------------------------------------------
MDTK_ECOLI/17-177--------------------------------------------------------------------------------
Q38956_ARATH/55-215--------------------------------------------------------------------------------
P71616_MYCTU/19-179--------------------------------------------------------------------------------
O49660_ARATH/40-200--------------------------------------------------------------------------------
O80695_ARATH/57-217--------------------------------------------------------------------------------
MDTK_ECOLI/244-405--------------------------------------------------------------------------------
F4IHU9_ARATH/37-197--------------------------------------------------------------------------------
O25796_HELPY/23-184--------------------------------------------------------------------------------
YEEO_ECOLI/48-208--------------------------------------------------------------------------------
Q8DNG1_STRR6/24-183--------------------------------------------------------------------------------

PF07260

G1KED7_ANOCA/1-345MVKFPALTNYW---------------------------------------------------------------------
I3JFW4_ORENI/1-349MVEFPSLSPYW---------------------------------------------------------------------
F1Q528_DANRE/1-344MKDCLSETAYW---------------------------------------------------------------------

PF01943

SP5B_BACSU/6-308-----------------------------------------------------------------------------FLK
EXOT_RHIME/10-277-----------------------------------------------------------------------------VTR
TUAB_BACSU/10-277-----------------------------------------------------------------------------SGA
RFBX_ECOLI/8-279-----------------------------------------------------------------------------LRR
O26447_METTH/15-286-----------------------------------------------------------------------------VLD
YTGP_BACSU/5-320-----------------------------------------------------------------------------LLR
Y1068_METJA/7-302-----------------------------------------------------------------------------AVK
Y1375_METJA/3-283-----------------------------------------------------------------------------LCK
O26479_METTH/10-276-----------------------------------------------------------------------------LAR
O29660_ARCFU/6-285-----------------------------------------------------------------------------VLK
O26467_METTH/18-289-----------------------------------------------------------------------------LAE
O26442_METTH/7-278-----------------------------------------------------------------------------IVK
YABM_BACSU/12-309-----------------------------------------------------------------------------IWQ
WZXC_ECOLI/9-276-----------------------------------------------------------------------------SGA
Q2K5A6_RHIEC/11-272-----------------------------------------------------------------------------...
Q32EG2_SHIDS/2-269-----------------------------------------------------------------------------.KK
Q8DZE2_STRA5/6-273-----------------------------------------------------------------------------LLQ
Q8P805_XANCP/25-289-----------------------------------------------------------------------------...

PF13440

A8UQ25_9FLAO/16-256--------------------------------------------------------------------------------
B5JNG5_9BACT/22-272--------------------------------------------------------------------------------
D0YZQ3_LISDA/18-261--------------------------------------------------------------------------------
D2BRK8_DICD5/18-261--------------------------------------------------------------------------------
B1IZZ3_ECOLC/18-261--------------------------------------------------------------------------------
D0I1Y2_VIBCL/18-260--------------------------------------------------------------------------------
D0HB98_VIBMI/18-260--------------------------------------------------------------------------------
A9AXJ4_HERA2/36-280--------------------------------------------------------------------------------
A4EAS6_9ACTN/45-291--------------------------------------------------------------------------------
Q2YCG5_NITMU/22-272--------------------------------------------------------------------------------
B9JQS0_AGRRK/94-340--------------------------------------------------------------------------------
C2KV49_9FIRM/32-288--------------------------------------------------------------------------------
C8XCC3_NAKMY/40-272--------------------------------------------------------------------------------
Q3K9H6_PSEPF/12-266--------------------------------------------------------------------------------
O58733_PYRHO/24-253--------------------------------------------------------------------------------
C8KY87_9PAST/18-266--------------------------------------------------------------------------------
C5RZU1_9PAST/18-266--------------------------------------------------------------------------------
Q1D7B4_MYXXD/29-283--------------------------------------------------------------------------------
C4WNX8_9RHIZ/31-284--------------------------------------------------------------------------------
A6X6T8_OCHA4/16-269--------------------------------------------------------------------------------
B1M5Z3_METRJ/17-264--------------------------------------------------------------------------------
A1UCH8_MYCSK/30-289--------------------------------------------------------------------------------
A3PW68_MYCSJ/30-289--------------------------------------------------------------------------------
Q89SM5_BRADU/14-269--------------------------------------------------------------------------------
Q2CIK8_OCEGH/14-260--------------------------------------------------------------------------------
C7LVX3_DESBD/8-264--------------------------------------------------------------------------------
A4FEI7_SACEN/8-256--------------------------------------------------------------------------------
C5ATW3_METEA/42-293--------------------------------------------------------------------------------
A9VW94_METEP/42-293--------------------------------------------------------------------------------
B7KU42_METC4/42-293--------------------------------------------------------------------------------
C7C8V6_METED/42-293--------------------------------------------------------------------------------
C8XCR8_NAKMY/39-289--------------------------------------------------------------------------------
Q0RPT3_FRAAA/322-573--------------------------------------------------------------------------------
D3CWT1_9ACTO/203-455--------------------------------------------------------------------------------
Q0RCF1_FRAAA/179-430--------------------------------------------------------------------------------
D2PZ16_KRIFD/24-275--------------------------------------------------------------------------------
Q8KN00_9ACTO/40-289--------------------------------------------------------------------------------
D6EG66_STRLI/34-283--------------------------------------------------------------------------------
A8UIN6_9FLAO/18-257--------------------------------------------------------------------------------
M1I249_9CREN/28-278--------------------------------------------------------------------------------
A6Q4F3_NITSB/16-266--------------------------------------------------------------------------------
B8CST1_SHEPW/46-301--------------------------------------------------------------------------------
A6FGK5_9GAMM/27-282--------------------------------------------------------------------------------
Q8EFK4_SHEON/24-279--------------------------------------------------------------------------------
A6WPP6_SHEB8/25-280--------------------------------------------------------------------------------
A1RKH9_SHESW/25-280--------------------------------------------------------------------------------
A4Y617_SHEPC/25-280--------------------------------------------------------------------------------
E6XI49_SHEP2/25-280--------------------------------------------------------------------------------
A6VTF9_MARMS/19-265--------------------------------------------------------------------------------
B9EAW7_MACCJ/18-258--------------------------------------------------------------------------------

PF04506

RFT1_CANGA/9-542----------------------------------------------------------------------------KTTR
E9IWP9_SOLIN/8-542----------------------------------------------------------------------------SSLE
S9VRB9_SCHCR/24-535----------------------------------------------------------------------------SSSK
C5E2W4_LACTC/16-558----------------------------------------------------------------------------RSAK
E9EIH0_METAQ/28-566----------------------------------------------------------------------------SMVQ
G8BWS7_TETPH/20-558----------------------------------------------------------------------------KSTK
H2ASC3_KAZAF/14-533----------------------------------------------------------------------------KSAK
RFT1_YARLI/102-645----------------------------------------------------------------------------TSAA
RFT1_SCHPO/10-520----------------------------------------------------------------------------SSSK
I2GX14_TETBL/21-581----------------------------------------------------------------------------KSTK
A7TRS5_VANPO/18-551----------------------------------------------------------------------------KSAK
J7R8K9_KAZNA/27-584----------------------------------------------------------------------------.STK
M2PSW7_CERS8/12-528----------------------------------------------------------------------------..LT
RFT1_CAEEL/2-516----------------------------------------------------------------------------SLFS
G8ZPN0_TORDC/18-550----------------------------------------------------------------------------KSTK
C4R7X1_PICPG/21-528----------------------------------------------------------------------------KSAS
H9KBA9_APIME/8-516----------------------------------------------------------------------------SSLE
U5D209_AMBTC/17-521----------------------------------------------------------------------------....
G0W6B8_NAUDC/22-586----------------------------------------------------------------------------KSTK
E2AM70_CAMFO/8-540----------------------------------------------------------------------------SSLE
E9GUV5_DAPPU/9-536----------------------------------------------------------------------------GSIK
D8M9P3_BLAHO/10-506----------------------------------------------------------------------------..AR
F4K836_ARATH/105-602----------------------------------------------------------------------------....
U4LAR2_PYROM/52-567----------------------------------------------------------------------------.SAA
RFT1_DROME/8-549----------------------------------------------------------------------------SSLL
G8BFC9_CANPC/25-545----------------------------------------------------------------------------.SAK
M3BX75_SPHMS/8-530----------------------------------------------------------------------------SSAR
W4Z9M3_STRPU/12-532----------------------------------------------------------------------------SSAR
RFT1_ASHGO/11-543----------------------------------------------------------------------------KSTQ
M3K0B3_CANMX/13-532----------------------------------------------------------------------------QSAK
G8JV96_ERECY/11-550----------------------------------------------------------------------------KSTK
G0V9M8_NAUCC/17-571----------------------------------------------------------------------------KSTK
H9J737_BOMMO/8-547----------------------------------------------------------------------------SSLE
R4XDT4_TAPDE/6-505----------------------------------------------------------------------------SSLK
RFT1_YEAST/18-565----------------------------------------------------------------------------RSTT

PF14667

Q03SZ7_LACBA/349-498-------------------------------------MLDIYMLSIILATLI.QTYNSVL----QS--------------
Q38V74_LACSS/358-503-------------------------------------ALVWYMLSIVIIALI.NACNSVL----QS--------------
B3WAP5_LACCB/356-499-------------------------------------ALQLYAVAIVVVAMI.NAYNAIL----QS--------------
A8UAN8_9LACT/362-510-------------------------------------VLSLYSVAILFASFI.GAYNAIF----QS--------------
D0BM46_9LACT/359-506-------------------------------------VLSIYIISIILASMM.MAYHGIL----QS--------------
C8NI78_9LACT/366-514-------------------------------------VLLVYITSIFFASVI.MSLHGIF----QS--------------
C0WQN7_LACBU/354-501-------------------------------------TIAVYCFSIVLTTII.LTYNMVL----QA--------------
C2EHH6_9LACO/356-502-------------------------------------VIGIYLLGIILMTVI.NSYSSIL----QS--------------
E6LEY4_9ENTE/358-506-------------------------------------TLLLFVFAIALMAII.QAFQSIE----QS--------------
C9A420_ENTGA/359-508-------------------------------------ALVLFVFAVALMAAI.QAYQSIQ----QS--------------
C2HEH9_ENTFC/359-507-------------------------------------ALVLFVFSIAFTAVI.QAYQSIA----QS--------------
C0X942_ENTFL/359-507-------------------------------------VLGVYVLSIAFMAII.QAYQSIE----QS--------------
E0RUK9_BUTPB/373-516-------------------------------------IFRLAAILIVLLSIG.VLVSWLL----NH--------------
C5Q1B2_STAAU/332-469-------------------------------------LMTILAILVLIIPLNMLISRQYL----LI--------------
E7MM58_9FIRM/379-526-------------------------------------ALFWSSILAFGTTVT.PVLLSIL----LS--------------
E4LZJ6_9CLOT/384-531-------------------------------------ILSWFSIEAFLNTIG.PIFTALL----MA--------------
D4W2K6_9FIRM/377-526-------------------------------------IFLLGSLLGLFMALY.SIVTAIL----QG--------------
D5E4C9_BACMQ/373-523-------------------------------------ILQWYAPMAILFALF.TVTASIL----QG--------------
B7JJF5_BACC0/376-524-------------------------------------YLISFAPSAILSAIF.TVSAAIL----QG--------------
Q8EP19_OCEIH/372-521-------------------------------------LMAWYAPVALLFGFI.TVTAGML----QG--------------
B1YKH1_EXIS2/386-534-------------------------------------YLLSYAPSALFLALY.SVTAAVL----QG--------------
D6Y0K7_BACIE/382-530-------------------------------------ILQFYAPVAILFSVF.AVTAALL----QG--------------
Q5WE75_BACSK/374-522-------------------------------------TLGFYAPATVFFSIY.AVTGSIL----QG--------------
E6U1Q3_BACCJ/375-523-------------------------------------MLKYYAPVAILFSIF.AVTSSLL----QG--------------
D3FXP2_BACPE/374-522-------------------------------------VLQYYGPMTLLFSLF.AVTAAIL----QG--------------
A4IRX9_GEOTN/371-520-------------------------------------VLRWYAPAAILYALF.SVTSAIM----QG--------------
D5DN36_BACMD/374-521-------------------------------------VLLYYAPVALLFSFF.TVNGAIL----QG--------------
A7Z7U6_BACA2/375-524-------------------------------------ILFWYAPVAILFSLF.TVNAAIL----QG--------------
A0RJU4_BACAH/372-520-------------------------------------VLMWYAPVALLFALF.TVTAAIL----QG--------------
E7RE43_9BACL/368-516-------------------------------------ILAHYLPVAILFSAF.PVTASIL----QG--------------
A3I8W7_9BACI/372-521-------------------------------------ILAHYAPVAILFALF.QVTAALL----QG--------------
A6CQJ8_9BACI/372-520-------------------------------------VLRTYAPVAILFALF.AVTAAIL----QG--------------
D3UNL4_LISSS/370-518-------------------------------------LLSFFAPFAIFFSLF.SVTAAIL----QG--------------
B8DHB8_LISMH/370-518-------------------------------------LLQLFAPIAILFSLF.SVSAAVL----QG--------------
A0A008APY8_STAAU/386-533-------------------------------------LLFYYAPVAILISLL.SVTASML----QG--------------
B9E7H2_MACCJ/374-522-------------------------------------LLFYYAPVAILLALV.SVSSAML----QG--------------
D5T1U4_LEUKI/363-511-------------------------------------MTQISAITSIFMGGA.TVLAMIM----QS--------------
Q03XR0_LEUMM/330-477-------------------------------------MVQISAVIALFMGLT.SVLAMIL----QG--------------
A0NHL2_OENOE/387-534-------------------------------------LLKVSAIVAIFFGHF.TILSFII----QG--------------
B1MY12_LEUCK/485-634-------------------------------------LLQYSTVLAVVFSLF.MLLSFIL----QA--------------
C2KKY7_LEUMC/498-647-------------------------------------MLQYSTILALVFSLF.MLLAFVL----QA--------------
C0WLU0_LACBU/374-518-------------------------------------YLFWNIIQSLILGLA.INSLTLL----QA--------------
C2EP42_9LACO/342-483-------------------------------------YLVENIVQSLLAGLV.MNSLTLL----LA--------------
A0A038C172_ENTFL/370-519-------------------------------------YLSATIISTSLLGIF.TIVLSIL----QA--------------
C5RB06_WEIPA/501-648-------------------------------------ILQFASYSAIFLSLY.MVVLAIY----QG--------------
A8UCR2_9LACT/391-539-------------------------------------SLQVASFMSLFLGLF.VLMGSTM----QA--------------
A2RMM4_LACLM/390-539-------------------------------------LFVFAILQTFLLGLY.MIVYPPL----TV--------------
C9A2J3_ENTGA/381-529-------------------------------------VLVAACISGLILGLF.MLTSSML----QG--------------
E6LIJ6_9ENTE/381-529-------------------------------------VLIEASLSGLVLGFF.MLTASML----QG--------------
A0A037ZTL3_ENTFL/382-530-------------------------------------LLVQACYASLFLGLY.MLVSNML----MG--------------
C2H7P1_ENTFC/381-529-------------------------------------VLIQASFVGLFLGLY.MLVSNML----QG--------------
A4VW05_STRSY/379-527-------------------------------------LFIWNLFLILPLGLY.SVISVVI----QA--------------
E3CI47_STRDO/375-523-------------------------------------LFVFVMAETILLALY.SLMAPML----QA--------------
A5LCT3_STREE/372-520-------------------------------------LFVFAVLQSIILGLY.MVLSPML----QA--------------
A3CPL5_STRSV/375-523-------------------------------------LFIFAMLQTIILSLY.TVLAPMI----QA--------------
A2RG74_STRPG/377-525-------------------------------------LFVAVLFQTLLLALY.TLFSPML----QA--------------
E8K660_STRPA/410-558-------------------------------------LFIVAMLQTVILGLY.TVLSPMI----QA--------------
B1SH45_9STRE/377-525-------------------------------------LFVVALIQVIFLALY.SLLAPML----QA--------------
C2LQ70_STRSL/432-580-------------------------------------LFVASLIQVIFLALY.SVLAPML----QA--------------
C6SP25_STRMN/377-525-------------------------------------LFIVSLLQTIILAIY.TVLAPML----QA--------------
B3W6R7_LACCB/364-511-------------------------------------ILELNAAVANLIGLF.ILLVAIM----QA--------------
A5VL26_LACRD/382-530-------------------------------------VLQFAAYISIMLGLY.TVAAAMM----QG--------------
D2ELV8_PEDAC/393-541-------------------------------------ILQFNSYVAIVLGLF.TVISAVM----QG--------------
C0WUG9_LACBU/378-530-------------------------------------ILTFSSMISIPMGMF.VVISAVM----QG--------------
Q03RI1_LACBA/378-525-------------------------------------ILAFSSYLSILLGLY.TVVAALM----QG--------------
C2EED2_9LACO/381-529-------------------------------------VLAFSSYIALALGLF.MVLAALL----QG--------------
Q38VP9_LACSS/378-526-------------------------------------VLQFSSYISILLGLF.TVLGAIL----QG--------------
C8PCY7_9LACO/375-523-------------------------------------ILFLSGIAAMFLGAF.TILMAIL----QG--------------
D0DXL5_9LACO/375-523-------------------------------------VLFIASFTAIILGLF.TVLMAVQ----QG--------------
C2E7U4_LACJH/384-532-------------------------------------VLYLSSFTAISLGLF.TVLMAIL----QG--------------
C2KAZ9_9LACO/380-528-------------------------------------VLYISAFTAISLGLF.TVLMAIL----QG--------------
B3WCD6_LACCB/380-528-------------------------------------LLQISSLLAIMLGLF.TVLAAIL----QG--------------
D0BKY7_9LACT/390-538-------------------------------------LLMVSCVLCIFMGAF.TVFTSIQ----QS--------------
C8NE09_9LACT/413-561-------------------------------------LLVVSCVMCVFLGLF.VTFTYIL----QS--------------
E4KNA5_9LACT/790-938-------------------------------------LLITGSLSSIFLGAY.TVLSTIL----QS--------------
D4YJ56_9LACT/433-583-------------------------------------LLQLSAAVAVTMGLF.SVLVAML----QA--------------
E0IFR0_9BACL/366-514-------------------------------------IVAALTAGTIFQISM.MTSNSIL----YG--------------
E0RCM4_PAEP6/382-529-------------------------------------IIAVLTLGTIFQITM.MTSNSIL----IG--------------
C6J0R0_9BACL/364-511-------------------------------------IVALLTYATIFQITM.MTSNSIL----LG--------------
E5Z458_9BACL/362-509-------------------------------------IIGFLTFGTIFQITM.MTTNSIL----LG--------------
C0Z9G8_BREBN/364-513-------------------------------------AMAILGITAIPLSLL.LATNGIL----QG--------------
C4GB38_9FIRM/387-530-------------------------------------MMVVGGLTIVFVCLS.TLSNSLL----QG--------------
A8RUL6_CLOBW/387-539-------------------------------------LSMAGSLAVVFYSLS.TVTNAVL----QG--------------
E6LN70_9FIRM/381-525-------------------------------------LMIIGSGIVVLYSVS.TVTNAIL----QG--------------
C7GE86_9FIRM/383-527-------------------------------------MLQVGAVTILFFSLS.TLSNGLL----QG--------------
E3GGE0_EUBLK/365-508-------------------------------------ILKYYAYATIFMMLS.NTFQSIL----QA--------------
E6MGM4_9FIRM/373-516-------------------------------------MLRVFAYATMFMMLS.NIFQSIL----QS--------------
B8D0L3_HALOH/359-505-------------------------------------ILSAMALTATFIYYL.HVSSGML----NG--------------
C6PQD8_9CLOT/131-275-------------------------------------ILQYSAISIPFIILA.QTSTAIL----QG--------------
C8VXJ1_DESAS/366-509-------------------------------------PLAYVAFSIVFWSIH.LVTTGVL----QG--------------
D9QSV7_ACEAZ/363-507-------------------------------------PLRYVSWGVIFVCLQ.QTSSSIL----QG--------------
B2A8K9_NATTJ/363-507-------------------------------------PLRFLAAGTIFLSFQ.QVSASAL----QG--------------
A8MK38_ALKOO/363-506-------------------------------------VLLFLSFATFSLCMV.QTLTGIL----QG--------------
A5D2G5_PELTS/358-502-------------------------------------SLEVLAVGGPFLYVQ.QTTTGIL----QG--------------
D5X9J9_THEPJ/361-503-------------------------------------PLSILAPAAVFLGLH.QTTSGVL----QG--------------
B2A2Z4_NATTJ/361-504-------------------------------------PLRYLSPSVIFLLLK.FATTGVL----QG--------------
C7GYH1_9FIRM/373-517-------------------------------------ILAIMSLGVFFLAMI.LTLSAVL----QG--------------
A6TN15_ALKMQ/363-506-------------------------------------ILSVLAINVVFISLA.QSLTSIL----QG--------------
A8MIG9_ALKOO/365-508-------------------------------------ILRILSFNVIFISIG.QILGSIL----QG--------------
Q67JD5_SYMTH/384-522-------------------------------------ALEAMAWSVLPIMLQ.QTTSGVL----QG--------------
C4FNY8_9FIRM/361-503-------------------------------------VIAVISLSIIFLGWQ.QITAGIL----QG--------------
D3LVV9_9FIRM/358-500-------------------------------------AICVLSISVFLVGVQ.QITGALL----QG--------------
E2ZD67_9FIRM/360-502-------------------------------------AIRVLALATFLIGLQ.QITNGLL----QG--------------
C9LLX4_9FIRM/363-506-------------------------------------CIAVMSFGVFLLGVQ.QVTTGVL----QG--------------
D3LX29_9FIRM/358-500-------------------------------------ATRTIAIAIFFLGMH.QITTAIL----QG--------------
C4FPR1_9FIRM/359-501-------------------------------------ATQITAFSIFFLGVH.QVTTGIL----QG--------------
A1HLQ5_9FIRM/371-513-------------------------------------VVSVLAVSVYLLGLH.QTTTGVL----QG--------------
C4V2B6_9FIRM/374-517-------------------------------------AVMISAVSIILLGLH.QVSTGIL----QG--------------
E8LB44_9FIRM/369-509-------------------------------------AIQTMSIGILFLGMH.QISTGIL----QG--------------
C0WBK9_9FIRM/378-517-------------------------------------AIEIMSWAIFLLGLH.QVSTGIL----QG--------------
B7DPH6_9BACL/373-525-------------------------------------IISTVSFMSIFASME.LISTYVL----QG--------------
C0ZHE2_BREBN/367-517-------------------------------------ALAVQSFTIIFATVS.IASAGIL----QG--------------
C2YMP0_BACCE/352-495-------------------------------------MLAILIGSSYFTSLM.VLSIGIL----QG--------------
B7GMA5_ANOFW/366-505-------------------------------------TMAIVLASSVFTSLA.LLGTGIL----QG--------------
E7RL93_9BACL/356-500-------------------------------------VLAIVSFSSLFTSLT.VLGTGVL----QG--------------
D3FZH8_BACPE/357-501-------------------------------------VIFILSVSALFTSFS.VLTTGML----QG--------------
B0MPG6_9FIRM/391-534-------------------------------------SLFILGLGGVFLTLS.STFISIF----QV--------------
B0PEA8_9FIRM/441-584-------------------------------------ALRFMGLSAIFVAVS.LPVNAIL----QA--------------
A7VWY4_9CLOT/433-577-------------------------------------VLVILGIAAIFTSTS.TPLCSML----QA--------------
E6TRQ4_BACCJ/362-512-------------------------------------ALQILSTTVLFAALF.MTIAALL----HA--------------
D5WSL0_KYRT2/373-521-------------------------------------AIAILALSTVFSTLE.SVSSSVL----QG--------------
B1YGP9_EXIS2/345-491-------------------------------------ALSWLAATAFTASLS.MIIVSCL----QS--------------
C5RD31_WEIPA/359-505-------------------------------------ALMVFVLTIIPATLI.LIITSVL----QS--------------
Q8EU30_OCEIH/362-509-------------------------------------ELRVLMLSIVFATLA.IIGSTVL----QG--------------
B9E8U7_MACCJ/341-481-------------------------------------ALAIYMLSVIFVSLI.IMFTAML----QI--------------
Q49V13_STAS1/337-479-------------------------------------TLAVYMLTVIFVSLI.MMDIALL----QV--------------
B9CVC4_STACP/347-489-------------------------------------TLSIYMITVVCVSLI.MMNIALL----QV--------------
C2M158_STAHO/360-502-------------------------------------TLSIYTLTVIGVSLI.MMDIALL----QV--------------
D3QG68_STALH/343-485-------------------------------------TLSVYMITVILVSLI.MMYIALL----QV--------------
E8SIP0_STAPH/344-486-------------------------------------TLSLYMLTVICVSLI.MMYIALL----EV--------------
A0A008AT25_STAAU/343-485-------------------------------------TLSVYMITVICVSLI.MMDMALL----QA--------------
F2F183_SOLSS/360-508-------------------------------------VLKLYSFQIVPLSII.LTFTAIL----QG--------------
A3IEA1_9BACI/365-514-------------------------------------VLIVYVFQIVPLSII.LTFTAIL----QG--------------
E7RLD1_9BACL/354-503-------------------------------------TLIIFSWQIVWMSLL.LIMTAML----HG--------------
A0AF13_LISW6/361-504-------------------------------------VLQLFMPAVFLSSLI.VMLSSIL----QG--------------
D7UUI0_LISGR/356-499-------------------------------------ELQLFMPAVLLSSLI.VMFASIL----QG--------------
A6CR25_9BACI/352-499-------------------------------------VIAVFCLSILFSSVI.LTISAIL----QG--------------
E5WT44_9BACI/362-510-------------------------------------VLAILSLLILLSSLI.ITITGIL----QG--------------
Q2B249_9BACI/362-508-------------------------------------VLAVLSLFIFFASII.MTLAAIL----QG--------------
A8F924_BACP2/360-506-------------------------------------ALQIFCISIAFTSIA.ITQAALL----QG--------------
E5WAE4_9BACI/356-502-------------------------------------ALQIFSASILFASLA.MTMTAVL----QG--------------
A7Z0I0_BACA2/354-499-------------------------------------TLQIFSLSIFFASIA.LTAAAIL----QG--------------
D4G3E4_BACNB/359-505-------------------------------------ALQVFSCSILFASMA.VTAAAVL----QG--------------
D5D970_BACMD/362-511-------------------------------------VLQILSLLVIFTTVA.ATAGAVL----QG--------------
B7GFI4_ANOFW/350-497-------------------------------------ELTILAVSILFTSLT.LTFIAIL----QG--------------
A4IJD3_GEOTN/352-496-------------------------------------VLAVLSASVFFTTMA.LTSSAML----QG--------------
C5D378_GEOSW/360-505-------------------------------------PLAILAASIFFTTLA.LTLSALL----QG--------------
Q5WAF7_BACSK/347-496-------------------------------------ILQVVAVSIFPASLY.LTAAAIL----QG--------------
D3FR13_BACPE/361-509-------------------------------------VLAVLAFAIFFSSIY.LTTAAIL----QG--------------
Q9KGJ0_BACHD/361-507-------------------------------------VLQVYGFSIFFASLF.VVTAALL----QG--------------
D6XV50_BACIE/360-507-------------------------------------ALRIAGLGVLPGSLF.MTAAVLW----HA--------------
D3E759_GEOS4/381-532-------------------------------------TMQVIAFTAAGGTLS.TITAALL----QG--------------
E0RM54_PAEP6/373-525-------------------------------------VMRWMALTAVGGTLS.IISAALL----QG--------------
A7GJW7_BACCN/360-506-------------------------------------VLAILAISILFSSLS.ITTASIL----QG--------------
B5UWQ0_BACCE/360-510-------------------------------------VLSILSLSILFSSLS.ITTASIL----QG--------------
D2BMG7_LACLK/323-465-------------------------------------PLSILSLSICPQMLS.....QSM----SA--------------
B8IEZ7_METNO/324-461-------------------------------------YTLILLPGLFAGALMNFALNPIF----QI--------------
C7NM90_HALUD/327-463-------------------------------------PLVVLLAGRIPYSLS.RILVQLG----YS--------------
A6DHF1_9BACT/293-436-------------------------------------ICALLCLNFFMSGLI.NLVGTFM----NS--------------
Q47U72_COLP3/338-481-------------------------------------LAPILGFAYICRTVS.RPISSLL----LA--------------
B4AGJ7_BACPU/343-486-------------------------------------LLMIHAAYLCLTLMF.LPLTYVP----TA--------------
Q1K412_DESAC/351-495-------------------------------------VMAVLALSKIPTLYL.LPCINVL----SA--------------
C0QCL2_DESAH/352-496-------------------------------------VMAILSCAKLLLLLG.QFSRSLL----AA--------------
Q2YCG5_NITMU/323-466-------------------------------------IFSALSIGMIAFSLS.LLSGAIL----TA--------------
E6QMG7_9ZZZZ/367-517-------------------------------------LFVAFSISMQFHMLT.GPGTSIL----RG--------------
F2G999_ALTMD/323-467-------------------------------------YMTISAFSIFPLVVA.NFLPNLL----IS--------------
C6JQC3_FUSVA/323-462-------------------------------------ILRILSGLLIFSFIAVFLDTNIS----IP--------------
E5X0H2_9BACE/326-464-------------------------------------LLQILCFDWMFDHLS.IINLNLL----YV--------------
A3DHV8_CLOTH/327-465-------------------------------------FLQIFCMSYMFMPFH.TANLEAI----KA--------------
B5CWR8_BACPM/324-466-------------------------------------VFQILALSLPLQMIL.STTGAIY----QA--------------
F1VXT7_9BURK/320-462-------------------------------------ILAWLAAVGFIQSLT.STTGSVF----MA--------------
Q2YCC1_NITMU/331-475-------------------------------------PLALLSTVMPFRMTT.SFLRPVL----AS--------------
Q0AHL3_NITEC/325-466-------------------------------------PLQLLALMMPLRMIA.NFLPSAV----DA--------------
D4YX22_SPHJU/336-476-------------------------------------FVAILALAMPFMTLQ.VMFAPVS----NA--------------
Q1GPL1_SPHAL/342-484-------------------------------------YIQLFALALILMTVQ.ILFAPVT----NA--------------
B0VF98_CLOAI/326-465-------------------------------------YFRIYLFLLPLRI...ATYGILF----QA--------------
A1S103_THEPD/335-472-------------------------------------YLSLYSASLLLSGLGTAALPSFF----QG--------------
E8R8C0_DESM0/349-487-------------------------------------YLALTATGALGVGLGAYVLGGLF----AG--------------
A3DIV8_CLOTH/358-500-------------------------------------ILYLLSFTGIFIYLQ.QTLLGIM----NG--------------
F2JLQ5_CELLD/355-497-------------------------------------LLKWLAIICPFLYLQ.NILTGAM----NG--------------
A7VPC0_9CLOT/355-497-------------------------------------YLSVLAPVIPLMYLD.SVVDGML----KG--------------
A8SAU1_9FIRM/356-502-------------------------------------YLETLAPAMPLMYLE.SMVDGAM----KG--------------
A6TSY6_ALKMQ/375-519-------------------------------------YLSIISYGTLFLCMQ.HTISGIL----HG--------------
A6NPI5_9FIRM/351-494-------------------------------------YMVPLSVGVLLSCYQ.SVLSGVL----SG--------------
B0K3R2_THEPX/360-504-------------------------------------FVRVISMGSIFAFLE.AVVASIL----HG--------------
B7AQB6_9FIRM/351-493-------------------------------------FMRVLAWLCPFLYIN.TTLTGIL----NG--------------
D3AN52_9CLOT/376-519-------------------------------------FIMTLAWLCPFLYLV.TTMGSIL----NG--------------
B0TAY6_HELMI/361-505-------------------------------------TIQILAWGAPFFYLQ.STTGGIL----QG--------------
Q3ADH7_CARHZ/346-484-------------------------------------LLVILAVSGPFLYWY.QTVTGIF----QG--------------
E0RMQ1_PAEP6/366-508-------------------------------------MLKLMAPFALFMYIQ.APLQAAL----QA--------------
C0ZAP4_BREBN/363-505-------------------------------------LLKELAPFSVFLFFQ.APLAAAL----QG--------------
D7WQC4_9BACI/353-489-------------------------------------YVKILAPIFYFYYIQ.SPLHSIL----QA--------------
C8WQG9_ALIAD/361-502-------------------------------------MLAIMAPFVFMLCLQ.SPLTGIL----QG--------------
B7DPL3_9BACL/356-497-------------------------------------LLAYLAPSCLFFYLS.DPLFAVL----QG--------------
D5QEL1_KOMHA/351-483-------------------------------------IMKCLSIGVFVFGMD.AVAAGFL----DG--------------
A9WAD6_CHLAA/337-475-------------------------------------VLAVLGLVLICTYLN.TVLSQLL----IA--------------
E1IEK9_9CHLR/380-529-------------------------------------IVWVLVPCLFIECLL.TTAHNAL----IV--------------
B9JKJ2_AGRRK/321-464-------------------------------------LLSMLSLAVIPIPYF.QTLYSAS----LA--------------
Q2Y4J6_9ARCH/377-524-------------------------------------TLAMLTIYVFVLSLT.RPYSSLI----IG--------------
E8V165_TERSS/339-475-------------------------------------VLIVASILSIPRAFQ.EIPDILL----RA--------------
B8IGJ3_METNO/336-472-------------------------------------PAVILIASSCLGGNS.MLFAGLI----IG--------------
D7BDH0_MEISD/336-473-------------------------------------VAQILFLGLIPSLLV.TVTGLTL----GA--------------
F2NKF2_MARHT/337-483-------------------------------------AAYILFAGLVPAMTL.SVFGLAL----SA--------------
D8J725_HALJB/340-478-------------------------------------AVVILAVGITISATCGGPDGGLL----QG--------------
B8D178_HALOH/340-478-------------------------------------ALVLISIGQVVNAGV.GSAGYIN----VM--------------
C4RGH8_9ACTO/364-502-------------------------------------VTVFLALTMLVATGC.GMVDTVL----NM--------------
Q18GU8_HALWD/357-496-------------------------------------YLVILAISYFVMAVT.GPNQRAL----SA--------------
Q469G3_METBF/349-484-------------------------------------TLRILALGFIANSYF.GFNYHTL----LA--------------
C5A2Y0_THEGJ/342-480-------------------------------------TLQILAIGFMFHSAL.GPNGLTL----TV--------------
F0LLW6_THEBM/342-478-------------------------------------ALQILALGFMFHTFL.GLNGLSL----VV--------------
F2KQE3_ARCVS/343-481-------------------------------------ALRALALGFFTHVML.GPNGLTL----IA--------------
F0LLZ4_THEBM/339-477-------------------------------------ALRILAVGFIVHVLF.GLNGMSL----VI--------------
Q5JDW0_THEKO/345-480-------------------------------------ALRILALGFMFHVVM.GLNAMSL----VA--------------
A1BJ49_CHLPD/337-476-------------------------------------VLTILAATALVQALT.GISGTVF----AM--------------
B3EHD9_CHLL2/365-504-------------------------------------ALALLAAAAFAQSFG.GIAGTVL----SM--------------
Q3APG3_CHLCH/338-477-------------------------------------ALQLLSAAYFVQCVF.GIASTLL----AM--------------
B4SBS0_PELPB/338-477-------------------------------------ALLLLTVASFLQASF.GLSATVL----AM--------------
Q3B6G9_PELLD/337-476-------------------------------------VLGLLTAGAFLQALF.GISATLL----AM--------------
A4SCQ1_PROVI/337-476-------------------------------------ALVLLSGAALLQAFF.GMAATLL----AM--------------
D8PBA0_9BACT/336-473-------------------------------------GLRLLVPGALCYAVA.RVLWPVI----QA--------------
D3SSH7_NATMM/337-474-------------------------------------PLLLLLPGALGFALA.RPVLAIS----QG--------------
B6IYF6_RHOCS/343-484-------------------------------------VLRWLALGGIPTIIG.SMSGTVL----RG--------------
D0LQE6_HALO1/374-513-------------------------------------ALMALALGNVGFCLF.AIAGTIL----NG--------------
D2RVV2_HALTV/336-474-------------------------------------VVQILSLFVFFEALE.NISGPAL----DY--------------
D3STC0_NATMM/337-475-------------------------------------VIQIFAFFIVFQAID.KITNDAL----DY--------------
D8J472_HALJB/339-477-------------------------------------VIQVLSGFVVLQAID.KITNDGL----DF--------------
D2RXY9_HALTV/340-478-------------------------------------VLQVLAAFIILQAIT.NLTSDSL----DY--------------
E7QQ57_9EURY/339-477-------------------------------------VVQVFSGYVVLEAVT.LITSDAL----DY--------------
C7P069_HALMD/318-461-------------------------------------VLWLLIVAVLVYGYQ.SQIVNAL----SG--------------
C7NSR3_HALUD/331-469-------------------------------------VLVILVGAYTADVYA.NQLLNTV----NA--------------
Q5V4U1_HALMA/327-465-------------------------------------VLLILIAAYLADAFA.SQFTNVI----NG--------------
D8J7W8_HALJB/319-457-------------------------------------VLVVLMLEKVFQSVN.DVLGSTL----RG--------------
C7NSL6_HALUD/319-457-------------------------------------VLIILMGEKLLQSVH.TILGRSL----QA--------------
E4NUG7_HALBP/319-458-------------------------------------VLVILTGEKILQSVH.IILGRAL----QG--------------
AGL15_HALVD/319-457-------------------------------------VLIILAGEKILQSVH.VIIGRSL----QA--------------
Q12VM9_METBU/345-483-------------------------------------LLVILLAVQIVNVFQ.YFFTMYL----NA--------------
A3CVY7_METMJ/333-471-------------------------------------ALAILLLVQVAHVFM.FLQTMCL----NA--------------
A2STD2_METLZ/331-469-------------------------------------VCSILFIMQIISVFT.LLLGVAL----TA--------------
A5UQJ1_ROSS1/330-463-------------------------------------VLQILIWSFVFTTLL.VPGGRLI----LA--------------
D3FFB8_CONWI/338-471-------------------------------------PFMLLIWSAVIALLQ.VNYTNGV----LA--------------
D8GMK0_CLOLD/327-460-------------------------------------VFTILIAYVSIFYIR.EIYGYEL----TA--------------
F0KAR0_CLOAE/326-458-------------------------------------PFSILLIYSLILFIR.EIYAYGL----NA--------------
D5XD05_THEPJ/326-457-------------------------------------SLQILLIATGIIFIS.APLNLSL----LA--------------
Q2NIB6_METST/328-458-------------------------------------VLELIIWALPAIFLS.YILGTSI----AS--------------
F0T719_METSL/333-463-------------------------------------VLQILIWTVPITFLN.YIFGSIL----PA--------------
Q2NH55_METST/331-464-------------------------------------ALTILIWAGIFMFLS.GLTSTLL----GA--------------
E3GZ73_METFV/328-459-------------------------------------AFQILIWTIVFIFTN.GIFANLL----NS--------------
A5UNI7_METS3/328-460-------------------------------------VLKILIWTVCFLFIN.GACSMIL----NA--------------
F0TC71_METSL/328-460-------------------------------------ALQALIFVVPVIFIT.YLFGNIL----GA--------------
Q12XY4_METBU/326-458-------------------------------------ALQILIWATSIMFIN.ILLSFTY----IS--------------
Q46FX4_METBF/329-461-------------------------------------ALQILIWASVLSFIN.YAPSTYF----SS--------------
F0TBQ9_METSL/329-463-------------------------------------TLQILVWAIVFTFAG.ASYIQLL----QS--------------
Q0W809_UNCMA/331-464-------------------------------------VLQIIIWAALFIFLS.SAYGCLF----MS--------------
D1Z261_METPS/328-462-------------------------------------VMQIVIWSVFLSFVY.TPFLQTF----SS--------------
O26442_METTH/329-460-------------------------------------AFQILALFIPIRLVS.TITGTLL----SS--------------
A5UWW7_ROSS1/374-505-------------------------------------ALAILIWYLPLSYAN.GVTQYVL----IA--------------
E1IAS8_9CHLR/378-523-------------------------------------VLAILAWFLPLSFVN.GLLQYVL----IA--------------
D5UPU7_TSUPD/350-482-------------------------------------ALGLLFIAVALRFVN.AVLSQAL----FA--------------
Q97AA3_THEVO/339-476-------------------------------------AISIIMVFSALFVTS.NVMTQLI----AA--------------
Q2S953_HAHCH/328-463-------------------------------------ILQALAVAIFFIFPS.SIMIYVY----SA--------------
F2NHK3_DESAR/367-498-------------------------------------VFKILSLALIFSFWN.YLGDNML----IA--------------
A3W1Y0_9RHOB/329-468-------------------------------------LLSILAVAAAVSAPL.YFNQPLL----IA--------------
C4XGJ8_DESMR/335-465-------------------------------------VMRLLALALPLLALD.MLVNNLL----VA--------------
A9EQ86_SORC5/331-462-------------------------------------VLRILACSVPVTFAF.QVVTLPL----LA--------------
B9K2D6_AGRVS/332-468-------------------------------------MLTLLALSVPVAVAC.QVATQYL----FA--------------
E3FNG9_STIAD/347-485-------------------------------------VLRLQAPILALTYVA.MVCASVL----TV--------------
B6YVL8_THEON/328-461-------------------------------------VLRIFGLTLIFIFFR.TAFERVL----EA--------------
E0I7A7_9BACL/353-491-------------------------------------ILPYMMFGLIMWNFG.MYGHKGF----EI--------------
D5DY76_BACMQ/331-468-------------------------------------TLIISALGMVIYGIT.FYYNKTW----EL--------------
D7E977_METEZ/332-466-------------------------------------ITPFVALSALVFGVF.IIFEKVI----YL--------------
A1ASY9_PELPD/345-481-------------------------------------LVPYVSLSVLVAGII.YKYKLGI----MA--------------
D7D534_GEOSC/329-466-------------------------------------IIPVVAISVLLQGMKSYYLDLSF----QL--------------
E8RTH0_ASTEC/331-467-------------------------------------VTALISVGALLSGFNTYYFLQAF----TL--------------
Q0AP11_MARMM/327-464-------------------------------------ILPWIALSGLMKGMMTYYFHEAF----TL--------------
E7RZY6_9BURK/339-474-------------------------------------IIPWVIGGVALQGLF.PVASAGL----QI--------------
Q12TY8_METBU/325-459-------------------------------------ALAIVAIGMGFLVMT.MVFTNIF----QA--------------
D9PYX0_METTM/350-483-------------------------------------ALSILVVGMSFYTLF.MISSSIA----QG--------------
F0TB30_METSL/351-484-------------------------------------ALQILAAGMLFFTLY.TISSSIS----QG--------------
F0EKD4_ENTCA/327-465-------------------------------------SLSILSLASVFSLLSSFYVYAIL----LP--------------
Q5M4A4_STRT2/55-193-------------------------------------SLRILCLALICSIISWIFNDGVL----IP--------------
F0HVE0_LACDL/327-469-------------------------------------SLRILAFAMVGSGISGIFGQCAL----MP--------------
E4SMU5_LACAR/327-469-------------------------------------SLQILCFALIISAFSRIFSDCIL----IP--------------
D4LGF1_9FIRM/327-469-------------------------------------SLQILSISLIFAIYGGLITSVYN----IT--------------
A5ZUX1_9FIRM/326-464-------------------------------------IMRILSPNIIFAVMNGFLAYQIF----IP--------------
D5TQD2_BACT1/321-460-------------------------------------LIILMSPVIVFVGLANIFGLQIL----IP--------------
A0A016CGV6_BACFG/328-466-------------------------------------TLKLVAPIVLFIGLSGIIGMQIL----YP--------------
E8JWJ5_STRCR/327-467-------------------------------------SMQILMPILVISGFSNITGNQIL----IP--------------
Q4JZ09_STREE/330-470-------------------------------------AMQILMPILVISGFSNITGNQIL----IP--------------
E6MFC3_9FIRM/328-466-------------------------------------PMQLIMPTLLFIGLTNILGLQML----VP--------------
E9RY62_9FIRM/330-468-------------------------------------PMQIIMPTLLLIGLTNIMGIQIL----VP--------------
C5NWI0_9BACL/318-458-------------------------------------VLYVIVFNIMFVGWTNILGFQVL----VV--------------
A1ILY9_STROR/319-458-------------------------------------AIAIMIFRMFFIGWTNIMGIQIL----IP--------------
Q4JYJ9_STREE/323-464-------------------------------------ALNIVVFSLIPIAFSEIVGRQTL----IP--------------
E0PD92_STREI/325-464-------------------------------------MLIGLSISIPIWTIGEVIRNQFL----LP--------------
C6CSD9_PAESJ/327-465-------------------------------------IMQGLAITIPFIAFANVIRTQYL----IP--------------
B0N362_9FIRM/290-427-------------------------------------IITILVLSSIFISWANVIRTQYL----IP--------------
A5M4K0_STREE/211-349-------------------------------------LIAAMAPVFVFSVPGNIIRTQYL----IP--------------
C9LAR2_BLAHA/325-463-------------------------------------LIACMAPAVLFSVFGNVIRTQYL----IP--------------
Q4K189_STREE/323-460-------------------------------------IIAGMTPALVFSAFGNVIRTQFL----IP--------------
C4FB42_9ACTN/325-467-------------------------------------IMTFLVVIIPVISMTNVIGKQYL----LP--------------
E0S188_BUTPB/322-462-------------------------------------LIILLSVVMIFKSLSNIIQNQYL----IP--------------
C3HRG9_BACTU/323-461-------------------------------------LMFWVSFIIIFIPIGGVFANQYA----LA--------------
A7HKJ9_FERNB/322-460-------------------------------------LIVYITPIILFISWSNLFGIQIM----VP--------------
E4L4W5_9STRE/321-459-------------------------------------LMAIQSFMIIFISYGNALGTQYL----LA--------------
E7S3G0_STRAG/321-459-------------------------------------LMAVESLMIICISYGNALGTQYL----LA--------------
E0NHN4_PEDAC/321-459-------------------------------------LMIVESAVIFLIGWGVMLGNQYL----IP--------------
E6LD53_9ENTE/253-391-------------------------------------LIPILSIVIILIGWSNVLGMQYL----LP--------------
C2KJQ1_LEUMC/329-467-------------------------------------VIVLLSPIIIFIGWSTVIGTQYL----VP--------------
B3XNV8_LACRE/322-460-------------------------------------LMMIEAPIILFIGWSNVTGTQYL----MP--------------
B2GDL9_LACF3/322-460-------------------------------------IIFFEAPAIIFIAWSNVTGTQYL----MP--------------
C0WVB1_LACFE/322-460-------------------------------------IIFFEAPAIVFIAWSNVTGDQYL----MP--------------
A2RHU4_LACLM/321-459-------------------------------------LLMMEAPIIIFIAWSNVLGIQYL----LP--------------
A1YVF6_LACJH/321-459-------------------------------------AMMIESIVILIIAWSNVIGVQYL----LP--------------
C2D643_LACBR/210-348-------------------------------------AMFIESIVILMIGWSNVIGTQYL----LP--------------
Q3ZK40_9LACT/322-460-------------------------------------LIFVQSPFLIFISWNYIIGGQYL----LA--------------
D8MET9_LEUGT/321-460-------------------------------------LIILESPIIILISWSIAITNQYL----IP--------------
A3F4D6_LACLC/321-459-------------------------------------VLMIESIAIIFIAWSNAIGTQYL----LP--------------
D2EJ27_PEDAC/321-459-------------------------------------LMMLESVVILLIAWSNALGTQYL----LP--------------
O06039_LACLC/321-459-------------------------------------LLVLSSPIVVLVTWSNVLGQQYL----IP--------------
Q8GPE5_STRTR/321-459-------------------------------------ILSILVFELIFMGWSSIIGNQYL----VA--------------
D7DRX9_METV3/353-490-------------------------------------AVRILMISAIFSSLN.VISSDIL----VG--------------
A4FX93_METM5/354-492-------------------------------------PMKILSIGAIFLTLN.TIGFSVL----NG--------------
A6UPA0_METVS/351-488-------------------------------------PMSILSFGIVFLSMN.NIVFNVF----NG--------------
A6UU30_META3/353-490-------------------------------------AIRILSLGTVFMTLN.GIGFTVL----NG--------------
D5VU50_METIM/353-494-------------------------------------AMRILSFGIIFMSLN.RVGFTIL----NG--------------
D4W1F1_9FIRM/338-485-------------------------------------ALKILTIQILFYPFI.FLSTAVM----QQ--------------
B9DSP4_STRU0/342-480-------------------------------------ALEIYLGTIALSSFI.QFFHQKM----FI--------------
F1Z193_9STRE/350-488-------------------------------------ALEVYLLMILLASLI.QYCHQKF----FI--------------
D4YGG7_9LACT/385-532-------------------------------------VLVVYVLMVIFASLI.LGQNNIL----QA--------------
F2I7P9_AERUA/374-520-------------------------------------VLEQYLLMIVLASWV.LIYHNIF----LG--------------
Q03E00_PEDPA/355-503-------------------------------------ALAVYNLSVIFAALI.FVYNSIL----QS--------------
D2EHX4_PEDAC/355-503-------------------------------------ALAIYNLSVILAALI.FVNNSVL----QS--------------
A0A021WE79_LACPN/357-507-------------------------------------ALRIYIISILFAALI.TTYTSVL----QS--------------
E7FPH6_9LACO/355-501-------------------------------------TISAYVVSIVFISLI.STYNSIL----QS--------------

PF03023

MURJ_BORBU/29-473LVMIIFAKPIMYFISYYR..........GENLIFASSVFGYLVLYILLISLS-SIFVSVL----NS--------------
MURJ_RICPR/28-477ALMQIFMPQLILCIAPGFY.......AKKEKFELTVFLCRITIPYLIFVSLT-ALLGGIL----NS--------------
MURJ_ECOLI/28-479VAGMLAAPWVIMVTAPGFA.......DTADKFALTSQLLKITFPYILLISLA-SLVGAIL----NT--------------
MURJ_SYNY3/36-495IILVLGAGIFIDLLAPGL.........EPETRRMAVQQLQIMAPMALLSGLI-GIGFGTL----NA--------------
MURJ_AQUAE/29-466IIGLLFPEEIISVISPGI........KEKETFSYAVEFLKFTILYLPLVSFY-AYSMAIL----LV--------------
MURJ_HAEIN/16-479ILAMVGSPHVAALFGMGWFTDWMNDGPDAHKFEQASLLLKITFPYLWFVTFV-AFSGAVL----NT--------------
MURJ_THEMA/28-450FLSEVFPYFMASIFATGA.........DEEVKSLAADLIRLTAPFITIVFVW-AVFYSVH----NA--------------
Q9X8T0_STRCO/300-778VITVFAAPLLIRLLSNPVA.......SDPAANEVGITFVRYFLPSIFFMGLH-VVMGQVL----NA--------------
MURJ_TREPA/32-489LIGILGAPYIVRLFDTDQ..............SLTVSLTRLMFPYLWMISLA-AFFQGML----HS--------------
Q9RX17_DEIRA/83-522ALGIFAAPWVVGLLTSTH.........ANIDRAIAIYMTQLVMPFLTLISLS-AVAMGLL----NA--------------
MURJ_CHLTR/34-482LI.IELGLCVWCSCVTGS.........LFDTLLLT....IILLPSGIFLMMY-TVNSTLL----HC--------------
MURJ_HELPY/2-458LN....PLWLAKLLAYGF.........DEETLKLCAPIVAINFWYLLLVFIT-TFLGALL----QY--------------
MVIN_MYCTU/48-521TLSVLAAPLLVRLMLGTN.........PQVNEPLTTAFAYLLLPQVLVYGLS-SVFMAIL----NT--------------

PF01554

O51531_BORBU/22-182-------------------------------------PTAIEFFLFNFISLTDNAMVAYL..GDYP--------------
YOEA_BACSU/28-189-------------------------------------PLLLSNVLQSVGQLVGMMAVGRW.LGVDA--------------
YOEA_BACSU/257-418-------------------------------------PASINMILVSLSEIAVISFVNHY..GSNA--------------
O66528_AQUAE/245-406-------------------------------------PTALERAITTLSFNVFVGFLAKF..GDKV--------------
YPNP_BACSU/241-402-------------------------------------PAGLQMMVITGGMMAIMSVVNSY..GDHV--------------
NORM_VIBPA/243-404-------------------------------------PVAAALFFEVTLFAVVALLVSPL..GPII--------------
O80695_ARATH/278-441-------------------------------------ASAVMLCLESWYSQILVLLAGLLKNPELA--------------
O26414_METTH/244-409-------------------------------------PASAEFLVMSMVTALLNWILTSV.AGTSA--------------
O28801_ARCFU/21-180-------------------------------------PMVVSNLIFTLYNLVDGIWVAGL..GPDA--------------
YISQ_BACSU/27-187-------------------------------------PIFIEVSLYMFMGNADTLMLSQY..SDNS--------------
Y709_METJA/243-408-------------------------------------PSALIEITVAVSFFIMTSIIMMV.GDSRG--------------
YPNP_BACSU/21-182-------------------------------------PIMLGNALQVSFQFIDSLWIGNL.LGAKA--------------
O25454_HELPY/214-375-------------------------------------PAGFERLLSLFSLILLSKFVASY..GDKV--------------
NORM_BACSU/20-180-------------------------------------PIFITQAGLSLITFLDTVMSGKV..SPAD--------------
HMRM_HAEIN/249-410-------------------------------------PIAIAICCEVALYALTSLMLSPL..GATI--------------
O49660_ARATH/262-426-------------------------------------PCCLTVCLEWWCYEILVLLTGRLPNPVQA--------------
O82752_ARATH/42-203-------------------------------------PLILTGLLLYSRSMISMLFLGRL.NDLSA--------------
DINF_ECOLI/35-196-------------------------------------PMIFSNITVPLLGLVDTAVIGHL.DSPVY--------------
Q9ZVH5_ARATH/238-401-------------------------------------PSAISVCLEYWWYEIMLFLCGLLGNPKAS--------------
O28801_ARCFU/239-404-------------------------------------PASLSMLTMSVAFMLINRVVIET.GGSEG--------------
Q38956_ARATH/275-438-------------------------------------ASAVMLCLEVWYFMAIILFAGYLKNAEIS--------------
ERC1_YEAST/174-335-------------------------------------PLIFTFILQNSLSLASIFSVSHL..GTKE--------------
Q9ZVH5_ARATH/16-176-------------------------------------PIVMTSLLIFSRSIISMWFLSHL..GKVE--------------
YAO6_SCHPO/17-177-------------------------------------PVILGYALQNSLQTSSVIVTGRL..GPSE--------------
O82752_ARATH/264-427-------------------------------------PSCVSVCLEWWWYEIMILLCGLLLNPQAT--------------
O51429_BORBU/27-187-------------------------------------PIVITNIIQAFYDLTDMFYVGKL..GAMP--------------
O83871_TREPA/32-196-------------------------------------PVMLHSFIQTGISFLDNVMVSRL..GDVK--------------
O51429_BORBU/248-409-------------------------------------PSTFGQIMVSLSFFIFNYIVIEI..SPKF--------------
YISQ_BACSU/252-413-------------------------------------PSAGEQLSYNLSQMIVTYFIAIM..GAQA--------------
O66528_AQUAE/25-183-------------------------------------PIIVVNLLYTVENMISMILVSSI..SPSA--------------
O51530_BORBU/21-181-------------------------------------PTAFESLLFQMVTFFDNFMISYL..GSFH--------------
Y709_METJA/21-181-------------------------------------PIIVATFIESIYSLVDSIWVSGL..GADA--------------
NORM_BACSU/247-408-------------------------------------PIGFAVFFETSIFAAVTLLMSHF..HTVT--------------
NORM_VIBPA/17-176-------------------------------------PVLIASVAQTGMGFVDTVMAGGV..SATD--------------
O26414_METTH/24-183-------------------------------------PLIVAMLLTSIYNLVDAVWVAGL..GGEA--------------
HMRM_HAEIN/22-181-------------------------------------PILLAQIAQNSMGLADTIMAGRV..SSTD--------------
YD338_YEAST/238-397-------------------------------------PLIFTFLLEQIFPMVCSLTVGHL..GKNE--------------
MDTK_ECOLI/17-177-------------------------------------PVILAQIAQTAMGFVDTVMAGGY..SATD--------------
Q38956_ARATH/55-215-------------------------------------PAIFTSVNQYSLGAITQVFAGHI..STIA--------------
P71616_MYCTU/19-179-------------------------------------PALGVLAAEPLYLLFDIAVVGRL..GAIS--------------
O49660_ARATH/40-200-------------------------------------PLVVMNLL.WFGKMTTTSVFLGR.QGELN--------------
O80695_ARATH/57-217-------------------------------------PAIFVYVINNGMSILTRIFAGHV..GSFE--------------
MDTK_ECOLI/244-405-------------------------------------PIALALFFEVTLFAVVALLVSPL..GIVD--------------
F4IHU9_ARATH/37-197-------------------------------------PLIAVSLLQFCLQIISVMFVGHL..GSLP--------------
O25796_HELPY/23-184-------------------------------------PLAFSMISLSTYSMIDGMFVGKK.LGKEA--------------
YEEO_ECOLI/48-208-------------------------------------PIFMENACVLLMGVLSTFLVSWL..GKDA--------------
Q8DNG1_STRR6/24-183-------------------------------------PILLSNIFQQLYNTADVLIVGRF.LGQES--------------

PF07260

G1KED7_ANOCA/1-345-------------------------------------PLIRFLVPLGITNIAIDFGEQALNRGIAA--------------
I3JFW4_ORENI/1-349-------------------------------------PLIRFLVPLAITNVAIDLGEQALNRGIAT--------------
F1Q528_DANRE/1-344-------------------------------------PLIRFLLPLAITNIAIDFGEQALNRGIAS--------------

PF01943

SP5B_BACSU/6-308GTLILIAAGMVTRMLGFVNRVVIAR--FIGEEGVGL-YMMAAPTFFLATTLTQFGLPVAISKLVAE--------------
EXOT_RHIME/10-277NVGWSVLSKTGTFGLKFVTVPILAR--ILSPEEFGA-VAVALTVVQFLAMIGGAGLTSALVIQQHE--------------
TUAB_BACSU/10-277KWTSISTMCITI..IQIVQFALLGN--MMTLTEFGL-VGMITTVTVFAQIVLDMGFGAALIQRDDA--------------
RFBX_ECOLI/8-279NVIYLAVVQGSNYLLPLLTFPYLVR--TLGPENFGI-FGFCQATMLYMIMFVEYGFNLTATQSIAK--------------
O26447_METTH/15-286NIISLTGIQLVQYLLPLITFPYLTR--VLGPANFGK-VAFAVAFITYFQILTDYGFNFSATREISI--------------
YTGP_BACSU/5-320GTFVLTLGTYISRILGMVYLIPFSI--MVGATGGAL-FQYGYNQYTLFLNIATMGFPAAVSKFVSK--------------
Y1068_METJA/7-302GVSWHLLSYFLAAPIAYLVRVLYAN--EIPKLDVGL-FYAVLDFFSMLVVFRAFGLDQALIRYIPK--------------
Y1375_METJA/3-283DSIYILMSNLYSKGMAYLFYFITAF--LLGTEAFGI-LKGLMPIADTLTIFFSSGIPPAIAKFLAE--------------
O26479_METTH/10-276NTAFLLVATLFTNLAAFVWNVYLAR--YLGTAGFGI-LSTALALTGIFSILADLGIGTYITREIAR--------------
O29660_ARCFU/6-285NVIYNSSSVLIGNLAGLVISIYVAR--VLKPELFGI-YSLAISVAFLLMTFTDLGINATLVRYVAH--------------
O26467_METTH/18-289NFLSLSTLQVLVYIIPFITLPYLTR--VLGVYNYGL-VNFAIAFNTYFIIITDYGFNLSAVREISV--------------
O26442_METTH/7-278NIGVTGSAQILTALMSFVFMIYLAR--FLGEAGFGK-YNFAFSLTTLLVTFTDLGVNQLLVREIAR--------------
YABM_BACSU/12-309GAFVLILAGVITKILSAVYRVPFQN--IVGDVGFYI-YQQVYPFLGIAVMLSTSGFPVIISKLMND--------------
WZXC_ECOLI/9-276KWSAIATVIIIG..LGLVQMTVLAR--IIDNHQFGL-LTVSLVIIALADTLSDFGIANSIIQRKEI--------------
Q2K5A6_RHIEC/11-272GSMWLSLSRAIVNGLSALSTFVLAW--YLVPADFGL-VAIATTIQVILSSVTELSLNQALIRHESP--------------
Q32EG2_SHIDS/2-269NILLLFLVHGANYLFPFIVLPYQTR--ILSIETFAD-VAKIQAAVMLLSLIVNYGYNLSSTRAIAR--------------
Q8DZE2_STRA5/6-273SGFIYTLGNLLVQGLAFITLPIYTR--VISTEVYGQ-YSLYVAWMGIITLFIGLQTSGSLSSARVK--------------
Q8P805_XANCP/25-289GAAVTMIGQSAKMIVQFGGIVLLAR--LLTPYDYGL-MAMVTAIVGAAEILRDFGLSAAAVQAKHV--------------

PF13440

A8UQ25_9FLAO/16-256------------HIVTLLSLKYIST--YVNSKTIAF.IGNVDSLTLLLISIIAFGLQL....SATR--------------
B5JNG5_9BACT/22-272------------TILQFFAISLISH--QLTLKERGT.YILIISILPATSSILSLGL......TNII--------------
D0YZQ3_LISDA/18-261------------QVIGAFTILFMSY--RFGMSDVGN.YSLIYGIILIGAQVALYGS......HFLL--------------
D2BRK8_DICD5/18-261------------QVIGALSIWLISH--KYNMAEVGA.YALNYSIVLVGAQVCTFAS......QLLI--------------
B1IZZ3_ECOLC/18-261------------QLIGAFSIWLISY--KYDLAEVGL.YALNYSIAVIGAQVCTFAS......QLLI--------------
D0I1Y2_VIBCL/18-260------------TVSNIGIFVLIGH--FYDNELFSQ.YILMSALATFLAFIADFGYA.....TKIV--------------
D0HB98_VIBMI/18-260------------AISNFGLFFFIGH--FYDGVIFTQ.YIYISAFAAFLSVVVDMGYS.....TKIV--------------
A9AXJ4_HERA2/36-280------------NLGNYGFAIVLGR--GLGPQVYAE.VNLIVTCFALATLLSSMFQ......IYAA--------------
A4EAS6_9ACTN/45-291------------GMAFPLLTIVSTQ--LVGAEEAGK.FSIAFVTGTLIMIACNY........GVRN--------------
Q2YCG5_NITMU/22-272------------IGAQFGAQILIMR--QLDPELVGA.FGYVLLLHGILALIIDQGY......GWSL--------------
B9JQS0_AGRRK/94-340------------TGSMYFLAPILST--YIDSKSLSK.FLYILSIMNLITPLCLIGLD.....TALL--------------
C2KV49_9FIRM/32-288------------ALASMVLAFFVLR--LGGEEQGGI.FGFGYSTLGQQFFIVAYFGLRPFLITDMK--------------
C8XCC3_NAKMY/40-272------------AGVAFITNILISR--ELGPDSRGE.VAFVLQASYLIVPFVLL........GAER--------------
Q3K9H6_PSEPF/12-266------------LGAKFLLVLAITH--YLGYEALGF.YGVVVAASLIASKFYSVGFSS....EINR--------------
O58733_PYRHO/24-253------------GGSRFLYNVIISR--KFGVEVLGEINSLISQAFFLAGFLAFFSIGV....GKYT--------------
C8KY87_9PAST/18-266------------MGLTVVSSFILAR--FLSVDDRGA.HQLFITTVSYVVTLSTGGVGFAC..ALSM--------------
C5RZU1_9PAST/18-266------------MGLTVVSSFILAR--FLSVDDRGA.HQLFITTVSYVVTLSTGGVGFAC..ALSM--------------
Q1D7B4_MYXXD/29-283------------AGLTLSIPLVLAR--VLNLDDYGTYYQLFLIATTLYYVLPFGVVQSLYY.FLPR--------------
C4WNX8_9RHIZ/31-284------------LVVSLVYFIALAN--TLPTGDFGI.FATASGTGVVLSRIVSLGFSSPL......--------------
A6X6T8_OCHA4/16-269------------LVVSLVYFIALAN--TLPTGDFGI.FATASGTGVVLSRLVSLGFSSPL......--------------
B1M5Z3_METRJ/17-264------------AALNMASVAVFTR--LAPVESYGT.YLYVLSWALVLYGATCQWPKFAF..FALY--------------
A1UCH8_MYCSK/30-289------------LLSTLLLTVIVYR--TLDARDAAV.FFAILAALSIGPLMGRLGLGPNVI.RLLA--------------
A3PW68_MYCSJ/30-289------------LLSTLLLTVIVYR--TLDARDAAV.FFAILAALSIGPLMGRLGLGPNVI.RLLA--------------
Q89SM5_BRADU/14-269------------SASAIILIFAVSH--ILSPAQYTS.FSLALAASQLFCVFVFEWLQLA...GVRF--------------
Q2CIK8_OCEGH/14-260------------SGANFLLALTLQS--AVPPAAFGR.YAFALVCLQLGLSLSNALFASPL..LQSL--------------
C7LVX3_DESBD/8-264------------AGANFLVSILLAR--WLEPAAYGA.FSLAYAIFLLLGTVHTGLWTEPM..LVYG--------------
A4FEI7_SACEN/8-256------------AGTSLLLQMVAAR--VLGLAEFGA.FAVFLALLVSASALYTGWVGD....SLAV--------------
C5ATW3_METEA/42-293------------SACNFATTIVLAH--ALGLEAFGL.FSTAWIAVLLTVSLQLGLVVCP...MISI--------------
A9VW94_METEP/42-293------------SACNFATTIVLAH--ALGLEAFGL.FSTAWIAVLLTVSLQLGLVVCP...MISI--------------
B7KU42_METC4/42-293------------SACNFATTIVLAH--ALGLEAFGL.FSTAWIAVLLTVSLQLGLVVCP...MISI--------------
C7C8V6_METED/42-293------------SACNFATTIVLAH--ALGLEAFGL.FSTAWIAVLLTVSLQLGLVVCP...MISI--------------
C8XCR8_NAKMY/39-289------------AASNFLLAVLVAR--AVDAEAFGA.FSVAFLVYSIVVAVNRAAVGQPL..QITF--------------
Q0RPT3_FRAAA/322-573------------SGTNAVMSFIIAR--SVSSSEFGA.FGVAFAIFSLMIGFSKAAGTAPL..GIKF--------------
D3CWT1_9ACTO/203-455------------SATNAAVSILVAH--FVGKTEYAAGFAVPYLIFSVIIGISRSSCCVPL..GIAY--------------
Q0RCF1_FRAAA/179-430------------SATNAAISFLIAR--QVSDVEYGA.FGIAYTLFAIVIGLCRGATCMPL..SMHY--------------
D2PZ16_KRIFD/24-275------------SLSNLAVGVLVAR--SSSVADFGV.YALAFGGYTIALNVSRAVATEPL..GVRY--------------
Q8KN00_9ACTO/40-289------------SLSNFAVGVYVAR--SLGLTAFGV.FSLAWVTYGVVLSVSRGVATDPL..VVRF--------------
D6EG66_STRLI/34-283------------SLSNFVVGIYVAR--SLGLTAFGV.FSLAWVTYGVVLNVSRGLATDPL..VVRF--------------
A8UIN6_9FLAO/18-257------------PLFNFFIAIIGIK--FFGKENWGE.VIDILLWVYFILIIANWGNRE....YLIR--------------
M1I249_9CREN/28-278------------APISFVFTYLVAH--YLSNLQNGQ...IIFATWQSMFVLIMGYFTLPAD.IFSL--------------
A6Q4F3_NITSB/16-266------------MGINFLFKIYLSY--KISKHELGL.FYTFMDLIAIGVMAFSGFK......DSLV--------------
B8CST1_SHEPW/46-301------------ISLGLAFKVWLAQ--WVAKSDLAL.YHTVVDIISLSLILLSGFRTSM...VVSF--------------
A6FGK5_9GAMM/27-282------------IAIGFSFKIWLAH--WIPKDDLAL.FHSVVDLISLSLILMTGFRSSM...VVSY--------------
Q8EFK4_SHEON/24-279------------IVVGFLFKLWLAQ--WVAKADLAL.YHTVIDIISLSLILMTGFRSSM...VVTY--------------
A6WPP6_SHEB8/25-280------------ISVGFLFKLWLAQ--WVAKADLAL.YHTVIDIISLSLILMTGFRSSM...VVTY--------------
A1RKH9_SHESW/25-280------------ISIGFLFKLWLAQ--WVAKADLAL.YHTVIDIISLSLILMTGFRSSM...VVTY--------------
A4Y617_SHEPC/25-280------------ISIGFLFKLWLAQ--WVAKADLAL.YHTVIDIISLSLILMTGFRSSM...VVTY--------------
E6XI49_SHEP2/25-280------------ISIGFLFKLWLAQ--WVAKADLAL.YHTVIDIISLSLILMTGFRSSM...VVTY--------------
A6VTF9_MARMS/19-265------------SLSQIVIVIFIAR--EGLMLDLSF.YTMAISISSPIYMLCSFNLRL....GVIT--------------
B9EAW7_MACCJ/18-258------------GVSQWIILLGILK--IFGVYDAGI.YSLGVAIISPLVLLFSLGL......NTLY--------------

PF04506

RFT1_CANGA/9-542GATFLMMGQLFSKIVTFLLNNTLVR..YLSPRIFG.ITAFLEFIVGTVLFFSREAIRLSTQRIADG............ND
E9IWP9_SOLIN/8-542NASFSIIFQIFCRCVTFGLNAFVIR..HVGQAILGVINVRLLLLESMILFLSREPFMKACLT..................
S9VRB9_SCHCR/24-535GLGSSIFFQSISRGLTFVLNQLTIR..FTSPQAYAYSSIHFEILRSTILFISRESVRLAMQRMPSQ......ENCLEDTF
C5E2W4_LACTC/16-558GVTFLMFSQLFSKIVTFILNTLLVR..YLSPRVFG.INAFLEFLLSTVLFFSREAIRMSTLRIKSP.......VAASSAT
E9EIH0_METAQ/28-566GASLLILLQLISRLITFVANQLLLR..FLTPRLVG.LSSQLEVYYLSVLFFARESLRVAIQRQGSS.......TAQSAES
G8BWS7_TETPH/20-558AATFLMMGQLFTKIVTFLLNNLLVR..YLSPRIFG.ITAFLEFLLGTVLFFSREAIRISTLRIKDN.........NGEMT
H2ASC3_KAZAF/14-533GATFLVLGQLFTKMSTFLLNSLLIR..FLSPRIFG.ITTFLEFLLNTILFFSREAIRLSVWRISDS..............
RFT1_YARLI/102-645GATLLIGIQILSKLASFGLNQMLLL..VATPALFG.ANAQLEFVLNTVLFFSREAVRLALQRLTLA......GKKPDVYV
RFT1_SCHPO/10-520GLRSSIFFQGSSRILTFFLNQLTIR..LTSPSAYAFSSIHFEILQSTILFLSRESVRLAMQRIPSE.......NAIITST
I2GX14_TETBL/21-581GATFLMMTQIFTKMITFILNSLLVR..FLSPRIFG.ITAFLEFILGTVLFFSREAIRLSTLRIKENQESVSETNTYSTGT
A7TRS5_VANPO/18-551GATFLMMGQFFTKLVTFFLNSLLVR..FLSPRIFG.IIAFLEFILGTILFFSREAIRLSTLRIKEN............TS
J7R8K9_KAZNA/27-584GATFLMFGQLFTKLVSFALNSVLIR..HLSPRIFG.ITSFLEFILGTTLFFSREAMRLSILRISSTHNNDGDDGNGVGDD
M2PSW7_CERS8/12-528SASFLVLLQLFSRLFTFILNQALVR..LVSPQVFGTAAIQFELLLSTILFLSREGVRNALLRAPSS..............
RFT1_CAEEL/2-516SLVHNVRGQLIARIISFAINMYLLR..RINNDVLGLVNVRLTLLYSSILFLTREPLRKA.....................
G8ZPN0_TORDC/18-550GATFLMMGQLFTKLITFVLNNVLVR..FLSPRIFG.ITAFLDFIVGTVLFFSREAIRLSTLRIKDH..........DDEE
C4R7X1_PICPG/21-528GASFLMLTQLSSKLCTFFINQLLMS..YISARILG.ATSYIDFLVATSLFFSREAVRLSCQRIKLP..............
H9KBA9_APIME/8-516NASFNIIFQILCRGVTFVLNAFVVR..HVGQAVLGVINVRLLLLESMILFLSREPFMKACLT..................
U5D209_AMBTC/17-521..FYLIASQVISRALSFLLNLLIAR..QLTEVDYALYAIQFHLLVTTILFLSREGFRRACMRTELW..............
G0W6B8_NAUDC/22-586GATFLMLGQLFTKLITFFLNSLLVR..FLSPRIFG.ITAFLEFIVNTVLFFSREAIRLSTLRITED.............H
E2AM70_CAMFO/8-540NASFSIIFQIFCRCITFLLNAFVVR..HVGQAILGVINVRLLLLESMILFLSREPFMKACLT..................
E9GUV5_DAPPU/9-536SASYNMILQVAFRVITFVLNGLVLH..NVDKDVLGILNVRLMLLIMTILFVSREAFRRACMS..................
D8M9P3_BLAHO/10-506SAGLNMVIQVLNRLFSFLINAILIR..FVSIELIGVVNVRLSLFATTVVFLSREPIRKACL...................
F4K836_ARATH/105-602..KFSLSRQFISRSIPFVFNSWIVR..HLTERDYALYAIQFHLFVTCVLFLSREGFRRACLRAGTK..............
U4LAR2_PYROM/52-567GARYLILLSISSRLLTFLVNNLLLR..YLSPSLLG.ISVQLELLSISILYFSRESLRTALQRQSQN..............
RFT1_DROME/8-549GAGFSIIFQILCRILTFGINAYIVR..HVGREVLGIMNVRLLLLESTLLFLSREAINRAALSANAQ..............
G8BFC9_CANPC/25-545GISSLIFVQVITKLFTFILNQALIR..FVSPDVFG.LIVYLEFLQSSVLFISRESVRLAVQRIAHD..............
M3BX75_SPHMS/8-530GAGFLILLQVSSRALTFALNQLLLR..FLSPTLLG.ASVQLELFVISAHHFARESLRVACQRQPEG..............
W4Z9M3_STRPU/12-532SASYNMVLQVMFRVLTFMLNAFIIKYGYVHEDMLGVVNVRLMLLYSTILFIAREAFRRACLS..................
RFT1_ASHGO/11-543GATFLMMGQLFGKLVTFVLHNVLVR..FLSPRIFG.ITSFLDFLSSTVLFFSREAIRLATLRIKTG.........GDGGR
M3K0B3_CANMX/13-532GVTYLILVQIITKLFTFILNQLIIR..YLTPSIIG.ITTYLDFIYSTILFFSRESIRLSIQRIQSK..............
G8JV96_ERECY/11-550GATFLMLGQLFTKVVTFILNTLLVR..FLSPRIFG.ITSFLEFLSSTVLFFSREAIRIATLRINGS.........NEGGH
G0V9M8_NAUCC/17-571GATFLMLGQLFTKAITFFLNSILVR..FLSPRIFG.ITAFLEFILGTVLFFSREAVRLSTLRIDDN..............
H9J737_BOMMO/8-547NASFNILIQILFRCITFIINAWVIR..NVGHEILGIMNVRLLLLESTILFLSREPFNRACLG..................
R4XDT4_TAPDE/6-505GTTYLILLQAVSRVLTFTLNQLILR..YTTPSIFGFATIQLELLLSTILFLCREGFRTAVQRLPVQ..............
RFT1_YEAST/18-565GATFLMMGQLFTKLVTFILNNLLIR..FLSPRIFG.ITAFLEFIQGTVLFFSRDAIRLSTLRISDS.....GNGIIDDDD

PF14667

Q03SZ7_LACBA/349-498-----------------------------QDTYRLTVVA---------------------------------------LM
Q38V74_LACSS/358-503-----------------------------LDQFHKTTIA---------------------------------------LL
B3WAP5_LACCB/356-499-----------------------------LDQYAGISVA---------------------------------------LL
A8UAN8_9LACT/362-510-----------------------------QNKHKVALIG---------------------------------------LL
D0BM46_9LACT/359-506-----------------------------TGKYSITLIA---------------------------------------LL
C8NI78_9LACT/366-514-----------------------------QHQYPKTLLA---------------------------------------LV
C0WQN7_LACBU/354-501-----------------------------HGYYAPTMLA---------------------------------------IT
C2EHH6_9LACO/356-502-----------------------------IDEYRVLLIG---------------------------------------LG
E6LEY4_9ENTE/358-506-----------------------------RNKVLASFKA---------------------------------------VV
C9A420_ENTGA/359-508-----------------------------RNQFRVGIYA---------------------------------------AG
C2HEH9_ENTFC/359-507-----------------------------KNSFRPSLKG---------------------------------------AG
C0X942_ENTFL/359-507-----------------------------RNRFKGPLVA---------------------------------------AG
E0RUK9_BUTPB/373-516-----------------------------MGKKLLTTIN---------------------------------------LT
C5Q1B2_STAAU/332-469-----------------------------VNKIRLYNAS---------------------------------------IT
E7MM58_9FIRM/379-526-----------------------------LKMRRHTLIY---------------------------------------FL
E4LZJ6_9CLOT/384-531-----------------------------VGLRRLNIRN---------------------------------------LA
D4W2K6_9FIRM/377-526-----------------------------IGGQWYGIAF---------------------------------------LV
D5E4C9_BACMQ/373-523-----------------------------INQQKKVIIG---------------------------------------MF
B7JJF5_BACC0/376-524-----------------------------IDYQRKTMIA---------------------------------------FS
Q8EP19_OCEIH/372-521-----------------------------IDQQNYAVIS---------------------------------------LL
B1YKH1_EXIS2/386-534-----------------------------INRQYFTIIA---------------------------------------TL
D6Y0K7_BACIE/382-530-----------------------------LNRQKVAVLA---------------------------------------LL
Q5WE75_BACSK/374-522-----------------------------MDRQRNAVLS---------------------------------------LV
E6U1Q3_BACCJ/375-523-----------------------------INRQRYAVIA---------------------------------------LL
D3FXP2_BACPE/374-522-----------------------------MNRQKQAVLS---------------------------------------LV
A4IRX9_GEOTN/371-520-----------------------------INQQRFTVIS---------------------------------------LA
D5DN36_BACMD/374-521-----------------------------INKQKYAVLS---------------------------------------LL
A7Z7U6_BACA2/375-524-----------------------------INKQKFAVVS---------------------------------------LF
A0RJU4_BACAH/372-520-----------------------------INQQKHAIIA---------------------------------------LI
E7RE43_9BACL/368-516-----------------------------INKQKWIIIN---------------------------------------LS
A3I8W7_9BACI/372-521-----------------------------IDFQKWIVFS---------------------------------------LL
A6CQJ8_9BACI/372-520-----------------------------IDKQKFTILS---------------------------------------LL
D3UNL4_LISSS/370-518-----------------------------IDEQRYTVLS---------------------------------------LL
B8DHB8_LISMH/370-518-----------------------------IDEQRFTVLG---------------------------------------LL
A0A008APY8_STAAU/386-533-----------------------------IDKQKLTVYV---------------------------------------IL
B9E7H2_MACCJ/374-522-----------------------------IDKQAMTVYI---------------------------------------VV
D5T1U4_LEUKI/363-511-----------------------------LLKTKLILYY---------------------------------------FT
Q03XR0_LEUMM/330-477-----------------------------LSKTGIALRA---------------------------------------IG
A0NHL2_OENOE/387-534-----------------------------LGHARTAMKA---------------------------------------LI
B1MY12_LEUCK/485-634-----------------------------LSEVSIVIKA---------------------------------------FV
C2KKY7_LEUMC/498-647-----------------------------LSEVEIVMKA---------------------------------------FF
C0WLU0_LACBU/374-518-----------------------------LHYSKKAMFY---------------------------------------LI
C2EP42_9LACO/342-483-----------------------------LNMNKLAVIY---------------------------------------MI
A0A038C172_ENTFL/370-519-----------------------------LSFHKKAMQI---------------------------------------TS
C5RB06_WEIPA/501-648-----------------------------LGRLRYTVRL---------------------------------------LI
A8UCR2_9LACT/391-539-----------------------------ANQTRPALWA---------------------------------------LV
A2RMM4_LACLM/390-539-----------------------------MDHKRLAMRI---------------------------------------FT
C9A2J3_ENTGA/381-529-----------------------------MYHNTEAVIF---------------------------------------FF
E6LIJ6_9ENTE/381-529-----------------------------MYENKAAVQY---------------------------------------LV
A0A037ZTL3_ENTFL/382-530-----------------------------MYENRDAMRY---------------------------------------LG
C2H7P1_ENTFC/381-529-----------------------------MFENRAAISY---------------------------------------LV
A4VW05_STRSY/379-527-----------------------------IFENRRAIYY---------------------------------------FL
E3CI47_STRDO/375-523-----------------------------LFENRKAIQY---------------------------------------FL
A5LCT3_STREE/372-520-----------------------------MFRNRKAVLY---------------------------------------FI
A3CPL5_STRSV/375-523-----------------------------LFQNRKAIIY---------------------------------------FL
A2RG74_STRPG/377-525-----------------------------LFENRKAIYY---------------------------------------FA
E8K660_STRPA/410-558-----------------------------LFQNRKAIRY---------------------------------------FL
B1SH45_9STRE/377-525-----------------------------LFENRKAINY---------------------------------------FA
C2LQ70_STRSL/432-580-----------------------------IFETRKAINY---------------------------------------FA
C6SP25_STRMN/377-525-----------------------------LFENRKAIRY---------------------------------------FI
B3W6R7_LACCB/364-511-----------------------------VHHSRLAIKY---------------------------------------FA
A5VL26_LACRD/382-530-----------------------------ISENKKMMMF---------------------------------------LA
D2ELV8_PEDAC/393-541-----------------------------IGENVLAVKY---------------------------------------FV
C0WUG9_LACBU/378-530-----------------------------LSQNRRAVKF---------------------------------------FA
Q03RI1_LACBA/378-525-----------------------------ISQNKRAVRY---------------------------------------FL
C2EED2_9LACO/381-529-----------------------------IYENTIAIKF---------------------------------------AV
Q38VP9_LACSS/378-526-----------------------------LYQNRLALFY---------------------------------------LL
C8PCY7_9LACO/375-523-----------------------------LSENGLAIKY---------------------------------------LL
D0DXL5_9LACO/375-523-----------------------------LSENILAIKY---------------------------------------LV
C2E7U4_LACJH/384-532-----------------------------LSENGLAIKY---------------------------------------LV
C2KAZ9_9LACO/380-528-----------------------------LSENGLAIKY---------------------------------------LI
B3WCD6_LACCB/380-528-----------------------------LFNNRLAIQE---------------------------------------ML
D0BKY7_9LACT/390-538-----------------------------MQQHMIAIKA---------------------------------------LV
C8NE09_9LACT/413-561-----------------------------MEQHIIAIKA---------------------------------------LG
E4KNA5_9LACT/790-938-----------------------------MDQRRMAIRY---------------------------------------LL
D4YJ56_9LACT/433-583-----------------------------MSFFKDAIMG---------------------------------------ML
E0IFR0_9BACL/366-514-----------------------------FGKPRIPMYN---------------------------------------TL
E0RCM4_PAEP6/382-529-----------------------------MGKPRISMVN---------------------------------------VM
C6J0R0_9BACL/364-511-----------------------------VGKANLSMVH---------------------------------------VA
E5Z458_9BACL/362-509-----------------------------IGKAKLSMVH---------------------------------------VM
C0Z9G8_BREBN/364-513-----------------------------IGKEKIPARH---------------------------------------LL
C4GB38_9FIRM/387-530-----------------------------IDHLNLPIIH---------------------------------------SL
A8RUL6_CLOBW/387-539-----------------------------LNHMDVPIRH---------------------------------------AV
E6LN70_9FIRM/381-525-----------------------------TNLINKPVKN---------------------------------------AF
C7GE86_9FIRM/383-527-----------------------------IGRMKEPIKN---------------------------------------AI
E3GGE0_EUBLK/365-508-----------------------------IDRFRVPLIN---------------------------------------LA
E6MGM4_9FIRM/373-516-----------------------------IDHFRVPLIT---------------------------------------LG
B8D0L3_HALOH/359-505-----------------------------LGKPQLALLN---------------------------------------LG
C6PQD8_9CLOT/131-275-----------------------------VGEYVMPIVN---------------------------------------LA
C8VXJ1_DESAS/366-509-----------------------------IGKISIPVRN---------------------------------------LL
D9QSV7_ACEAZ/363-507-----------------------------IGKTVIPARN---------------------------------------LF
B2A8K9_NATTJ/363-507-----------------------------TGYPVLPVKN---------------------------------------LC
A8MK38_ALKOO/363-506-----------------------------LGKPEIPVRN---------------------------------------LL
A5D2G5_PELTS/358-502-----------------------------LGEASRPLRN---------------------------------------LV
D5X9J9_THEPJ/361-503-----------------------------LGRTHLPVKN---------------------------------------LL
B2A2Z4_NATTJ/361-504-----------------------------LNKPMIPVKN---------------------------------------LI
C7GYH1_9FIRM/373-517-----------------------------IEKQFRPVRN---------------------------------------IL
A6TN15_ALKMQ/363-506-----------------------------IGKVYIPVRN---------------------------------------LM
A8MIG9_ALKOO/365-508-----------------------------MNRVYIPLRS---------------------------------------LL
Q67JD5_SYMTH/384-522-----------------------------MGRIGAPVRN---------------------------------------FV
C4FNY8_9FIRM/361-503-----------------------------LGRTVIPMVA---------------------------------------IF
D3LVV9_9FIRM/358-500-----------------------------MGRTVIPLVN---------------------------------------MA
E2ZD67_9FIRM/360-502-----------------------------MGHTGIPLLN---------------------------------------MG
C9LLX4_9FIRM/363-506-----------------------------MGKTAVPFIN---------------------------------------MV
D3LX29_9FIRM/358-500-----------------------------LKKPKIPVMN---------------------------------------MM
C4FPR1_9FIRM/359-501-----------------------------LNKPRIPVIN---------------------------------------MG
A1HLQ5_9FIRM/371-513-----------------------------LGHTAIPVVN---------------------------------------MG
C4V2B6_9FIRM/374-517-----------------------------LGHPTIPMVN---------------------------------------MV
E8LB44_9FIRM/369-509-----------------------------LGRTAIPVIN---------------------------------------MI
C0WBK9_9FIRM/378-517-----------------------------LGKTRIPVIN---------------------------------------MI
B7DPH6_9BACL/373-525-----------------------------LGKMYRPVRN---------------------------------------MF
C0ZHE2_BREBN/367-517-----------------------------LGRVMRPARN---------------------------------------LF
C2YMP0_BACCE/352-495-----------------------------INRSKQAAWI---------------------------------------VV
B7GMA5_ANOFW/366-505-----------------------------VGESKRAAVI---------------------------------------IL
E7RL93_9BACL/356-500-----------------------------INKARLGAWI---------------------------------------II
D3FZH8_BACPE/357-501-----------------------------ANREFAAAII---------------------------------------VL
B0MPG6_9FIRM/391-534-----------------------------IGRSDLPVKL---------------------------------------ML
B0PEA8_9FIRM/441-584-----------------------------IGRADLPVKL---------------------------------------LF
A7VWY4_9CLOT/433-577-----------------------------VGRVDLPVKL---------------------------------------LS
E6TRQ4_BACCJ/362-512-----------------------------INRARDAALL---------------------------------------LA
D5WSL0_KYRT2/373-521-----------------------------MGMTVRPVVN---------------------------------------LF
B1YGP9_EXIS2/345-491-----------------------------VDAEKYAFVG---------------------------------------VV
C5RD31_WEIPA/359-505-----------------------------LDYTRGVSWF---------------------------------------VL
Q8EU30_OCEIH/362-509-----------------------------FGYIKRTALF---------------------------------------IA
B9E8U7_MACCJ/341-481-----------------------------YNAFRIQLVA---------------------------------------VI
Q49V13_STAS1/337-479-----------------------------KNQVRSIFQA---------------------------------------FI
B9CVC4_STACP/347-489-----------------------------LNRIRPILVG---------------------------------------IV
C2M158_STAHO/360-502-----------------------------MNHIRPIFIG---------------------------------------VM
D3QG68_STALH/343-485-----------------------------FNEVATVMIS---------------------------------------VG
E8SIP0_STAPH/344-486-----------------------------HEEFRMIMKA---------------------------------------LV
A0A008AT25_STAAU/343-485-----------------------------QHAVRPIFVG---------------------------------------MT
F2F183_SOLSS/360-508-----------------------------YSKLKGPAVF---------------------------------------LG
A3IEA1_9BACI/365-514-----------------------------YGKLKKPALF---------------------------------------LM
E7RLD1_9BACL/354-503-----------------------------LGKVRVPAVL---------------------------------------LI
A0AF13_LISW6/361-504-----------------------------FGKIIVPAVG---------------------------------------VG
D7UUI0_LISGR/356-499-----------------------------FGKLYIPVIS---------------------------------------VL
A6CR25_9BACI/352-499-----------------------------IELIYFPALT---------------------------------------IL
E5WT44_9BACI/362-510-----------------------------LGFIFFPAAA---------------------------------------IL
Q2B249_9BACI/362-508-----------------------------LGHTFFPAAV---------------------------------------II
A8F924_BACP2/360-506-----------------------------LGHTVYPAVV---------------------------------------VL
E5WAE4_9BACI/356-502-----------------------------LGNTCLPAVF---------------------------------------VC
A7Z0I0_BACA2/354-499-----------------------------AGHTVFPAVS---------------------------------------VL
D4G3E4_BACNB/359-505-----------------------------AGYTVFPAIA---------------------------------------VG
D5D970_BACMD/362-511-----------------------------MGAVFAPVIA---------------------------------------VI
B7GFI4_ANOFW/350-497-----------------------------LGDVFRPFFV---------------------------------------VC
A4IJD3_GEOTN/352-496-----------------------------MGKEWAAAAG---------------------------------------VA
C5D378_GEOSW/360-505-----------------------------MGYEWIAVAG---------------------------------------VC
Q5WAF7_BACSK/347-496-----------------------------YGKIHIPLYA---------------------------------------VA
D3FR13_BACPE/361-509-----------------------------YGYVHIPAWV---------------------------------------MG
Q9KGJ0_BACHD/361-507-----------------------------SGYVHIPMIA---------------------------------------LA
D6XV50_BACIE/360-507-----------------------------VGKAGKPAVW---------------------------------------LL
D3E759_GEOS4/381-532-----------------------------IGMVKGPAIH---------------------------------------LL
E0RM54_PAEP6/373-525-----------------------------LGAVRAPALA---------------------------------------ML
A7GJW7_BACCN/360-506-----------------------------LGQTLKPALF---------------------------------------VV
B5UWQ0_BACCE/360-510-----------------------------LGQTFKPALF---------------------------------------VV
D2BMG7_LACLK/323-465-----------------------------IWQSRNLTKI---------------------------------------QS
B8IEZ7_METNO/324-461-----------------------------RRRTRPVIAA---------------------------------------AL
C7NM90_HALUD/327-463-----------------------------YNIDKGVARA---------------------------------------SL
A6DHF1_9BACT/293-436-----------------------------LGVFTKGRLV---------------------------------------VI
Q47U72_COLP3/338-481-----------------------------KAQHQLLSVV---------------------------------------NL
B4AGJ7_BACPU/343-486-----------------------------FNRLKVPAVV---------------------------------------TL
Q1K412_DESAC/351-495-----------------------------MGHVRFTAKR---------------------------------------AV
C0QCL2_DESAH/352-496-----------------------------TGHISFSAKM---------------------------------------TI
Q2YCG5_NITMU/323-466-----------------------------TGDQKTVLYS---------------------------------------QM
E6QMG7_9ZZZZ/367-517-----------------------------IGKVWEEFYY---------------------------------------SV
F2G999_ALTMD/323-467-----------------------------QAKTKDAFNI---------------------------------------VL
C6JQC3_FUSVA/323-462-----------------------------HNKEKNTFYG---------------------------------------NM
E5X0H2_9BACE/326-464-----------------------------KGRSDWAFRL---------------------------------------EI
A3DHV8_CLOTH/327-465-----------------------------LGYSDLILKI---------------------------------------EI
B5CWR8_BACPM/324-466-----------------------------AGKTNWLFYG---------------------------------------GV
F1VXT7_9BURK/320-462-----------------------------TGRTDLLLRL---------------------------------------GI
Q2YCC1_NITMU/331-475-----------------------------MGRADLSLKS---------------------------------------AV
Q0AHL3_NITEC/325-466-----------------------------LGRPDVTMRN---------------------------------------VL
D4YX22_SPHJU/336-476-----------------------------VGRPGTTARI---------------------------------------AA
Q1GPL1_SPHAL/342-484-----------------------------LGKPSISMFT---------------------------------------AM
B0VF98_CLOAI/326-465-----------------------------FGKTRFVMYN---------------------------------------SL
A1S103_THEPD/335-472-----------------------------VGDTRANLEA---------------------------------------SL
E8R8C0_DESM0/349-487-----------------------------IGKTQEVFRS---------------------------------------WI
A3DIV8_CLOTH/358-500-----------------------------LGKQGILLRN---------------------------------------SI
F2JLQ5_CELLD/355-497-----------------------------LGMQKQTFKT---------------------------------------NV
A7VPC0_9CLOT/355-497-----------------------------LNEQLSYLSY---------------------------------------NI
A8SAU1_9FIRM/356-502-----------------------------IGEQKAAFRY---------------------------------------SV
A6TSY6_ALKMQ/375-519-----------------------------LGKQVVTTIN---------------------------------------YM
A6NPI5_9FIRM/351-494-----------------------------IGRQAAAARS---------------------------------------SL
B0K3R2_THEPX/360-504-----------------------------LGKQTVVLKN---------------------------------------SI
B7AQB6_9FIRM/351-493-----------------------------LGKTGYTFVC---------------------------------------GI
D3AN52_9CLOT/376-519-----------------------------LGKTSTTFIQ---------------------------------------NV
B0TAY6_HELMI/361-505-----------------------------LGMVVFPLLV---------------------------------------TV
Q3ADH7_CARHZ/346-484-----------------------------LSKPQTPFYI---------------------------------------LL
E0RMQ1_PAEP6/366-508-----------------------------LDRPGSALLN---------------------------------------TF
C0ZAP4_BREBN/363-505-----------------------------LDYAQVVFRN---------------------------------------TL
D7WQC4_9BACI/353-489-----------------------------IGEARAAMMN---------------------------------------SI
C8WQG9_ALIAD/361-502-----------------------------LNRAGTAMVN---------------------------------------SI
B7DPL3_9BACL/356-497-----------------------------LNRAFVSTVI---------------------------------------TF
D5QEL1_KOMHA/351-483-----------------------------IGRAEMNAIL---------------------------------------SV
A9WAD6_CHLAA/337-475-----------------------------AERTAALNVI---------------------------------------MI
E1IEK9_9CHLR/380-529-----------------------------HERLGTIIIS---------------------------------------RL
B9JKJ2_AGRRK/321-464-----------------------------LDRPHILFRL---------------------------------------NA
Q2Y4J6_9ARCH/377-524-----------------------------INRPDIAAKI---------------------------------------GV
E8V165_TERSS/339-475-----------------------------ADRQKKLFLW---------------------------------------LI
B8IGJ3_METNO/336-472-----------------------------MERSDFSFYL---------------------------------------NL
D7BDH0_MEISD/336-473-----------------------------IRRPWATIPL---------------------------------------GF
F2NKF2_MARHT/337-483-----------------------------INRPWALIPL---------------------------------------GV
D8J725_HALJB/340-478-----------------------------LGYSRLVLCN---------------------------------------TA
B8D178_HALOH/340-478-----------------------------TGHPHYELYT---------------------------------------NI
C4RGH8_9ACTO/364-502-----------------------------AGRTSWTFYN---------------------------------------AL
Q18GU8_HALWD/357-496-----------------------------FGDTRAIFLV---------------------------------------NA
Q469G3_METBF/349-484-----------------------------SGDSDFLMKC---------------------------------------SV
C5A2Y0_THEGJ/342-480-----------------------------IGNTGFLTVS---------------------------------------NV
F0LLW6_THEBM/342-478-----------------------------IGESKFIMLF---------------------------------------NL
F2KQE3_ARCVS/343-481-----------------------------AGEAKFPTIA---------------------------------------GF
F0LLZ4_THEBM/339-477-----------------------------IGKTTLNLVG---------------------------------------EL
Q5JDW0_THEKO/345-480-----------------------------VGRTSDNLIG---------------------------------------NL
A1BJ49_CHLPD/337-476-----------------------------TGHSRIILLN---------------------------------------AI
B3EHD9_CHLL2/365-504-----------------------------AGHARVTFLN---------------------------------------AL
Q3APG3_CHLCH/338-477-----------------------------SGYAQLSLIN---------------------------------------AV
B4SBS0_PELPB/338-477-----------------------------TGHARLSLLN---------------------------------------AL
Q3B6G9_PELLD/337-476-----------------------------AGHSRLSLLN---------------------------------------AL
A4SCQ1_PROVI/337-476-----------------------------TGHARLSLMN---------------------------------------AA
D8PBA0_9BACT/336-473-----------------------------GGEGGHLVRL---------------------------------------IG
D3SSH7_NATMM/337-474-----------------------------NGTLRYPVAA---------------------------------------TG
B6IYF6_RHOCS/343-484-----------------------------VGHAGRFMLL---------------------------------------IG
D0LQE6_HALO1/374-513-----------------------------AGHTREAILC---------------------------------------AA
D2RVV2_HALTV/336-474-----------------------------LGRARSRAIL---------------------------------------KA
D3STC0_NATMM/337-475-----------------------------LGRAKHRAIS---------------------------------------KG
D8J472_HALJB/339-477-----------------------------LGRARARAVS---------------------------------------KG
D2RXY9_HALTV/340-478-----------------------------LGRARHRAIA---------------------------------------KG
E7QQ57_9EURY/339-477-----------------------------LGRARERAWA---------------------------------------KG
C7P069_HALMD/318-461-----------------------------IDRPGEAFKV---------------------------------------NA
C7NSR3_HALUD/331-469-----------------------------VDRPDASMRV---------------------------------------NA
Q5V4U1_HALMA/327-465-----------------------------VDRPDAAFRV---------------------------------------NM
D8J7W8_HALJB/319-457-----------------------------IDRVDLVARA---------------------------------------VV
C7NSL6_HALUD/319-457-----------------------------LDRPDLAAYA---------------------------------------TV
E4NUG7_HALBP/319-458-----------------------------IDRPDLAAWA---------------------------------------TV
AGL15_HALVD/319-457-----------------------------LNQPGLAARA---------------------------------------TV
Q12VM9_METBU/345-483-----------------------------IDHPKESFKV---------------------------------------TF
A3CVY7_METMJ/333-471-----------------------------LDRPKDSFKV---------------------------------------TA
A2STD2_METLZ/331-469-----------------------------SDHARQAFYA---------------------------------------AG
A5UQJ1_ROSS1/330-463-----------------------------AGQQSAFVPL---------------------------------------LI
D3FFB8_CONWI/338-471-----------------------------LGDEKHYLLA---------------------------------------VV
D8GMK0_CLOLD/327-460-----------------------------WGLQKKYMKI---------------------------------------VL
F0KAR0_CLOAE/326-458-----------------------------WNMEKKYLRA---------------------------------------VV
D5XD05_THEPJ/326-457-----------------------------CNQQKKLTTI---------------------------------------VF
Q2NIB6_METST/328-458-----------------------------INKQHETVKA---------------------------------------TF
F0T719_METSL/333-463-----------------------------MNRQTTLLKI---------------------------------------TF
Q2NH55_METST/331-464-----------------------------INKQVSVTKN---------------------------------------AA
E3GZ73_METFV/328-459-----------------------------SNRQVTVTKT---------------------------------------TG
A5UNI7_METS3/328-460-----------------------------SHRETAVTKI---------------------------------------YC
F0TC71_METSL/328-460-----------------------------INKQRILLIV---------------------------------------TA
Q12XY4_METBU/326-458-----------------------------SGNQGVMAKL---------------------------------------TA
Q46FX4_METBF/329-461-----------------------------TNRQRALMIF---------------------------------------TF
F0TBQ9_METSL/329-463-----------------------------TNKQLIITKI---------------------------------------SL
Q0W809_UNCMA/331-464-----------------------------TNRQKTTTNI---------------------------------------AG
D1Z261_METPS/328-462-----------------------------TNHQRLTTVI---------------------------------------IG
O26442_METTH/329-460-----------------------------IDRQGYRMLS---------------------------------------VG
A5UWW7_ROSS1/374-505-----------------------------LRRQQSITVA---------------------------------------FA
E1IAS8_9CHLR/378-523-----------------------------LNRQTAITRA---------------------------------------FV
D5UPU7_TSUPD/350-482-----------------------------AHDQVFLLRL---------------------------------------NV
Q97AA3_THEVO/339-476-----------------------------VRETRVFIYS---------------------------------------SA
Q2S953_HAHCH/328-463-----------------------------MGRQRLFTLI---------------------------------------SV
F2NHK3_DESAR/367-498-----------------------------RNREKRLLRL---------------------------------------TW
A3W1Y0_9RHOB/329-468-----------------------------VGRAKTALQI---------------------------------------AT
C4XGJ8_DESMR/335-465-----------------------------IGRQRYALYY---------------------------------------AG
A9EQ86_SORC5/331-462-----------------------------AKREVAMVKL---------------------------------------LA
B9K2D6_AGRVS/332-468-----------------------------LDKIRQRLFV---------------------------------------GL
E3FNG9_STIAD/347-485-----------------------------TGQGWRVTRT---------------------------------------SV
B6YVL8_THEON/328-461-----------------------------SNRQAIVTRT---------------------------------------FV
E0I7A7_9BACL/353-491-----------------------------KNKTRTMLMF---------------------------------------VI
D5DY76_BACMQ/331-468-----------------------------SKDTKKIFLH---------------------------------------AL
D7E977_METEZ/332-466-----------------------------EKKTKTIGKI---------------------------------------WM
A1ASY9_PELPD/345-481-----------------------------MEKTRSLMYI---------------------------------------VI
D7D534_GEOSC/329-466-----------------------------GKKTTLQIWP---------------------------------------VL
E8RTH0_ASTEC/331-467-----------------------------SKKTKLLTVA---------------------------------------MA
Q0AP11_MARMM/327-464-----------------------------MRRTGVMALV---------------------------------------MA
E7RZY6_9BURK/339-474-----------------------------QKRSGRILLA---------------------------------------IL
Q12TY8_METBU/325-459-----------------------------RNVPRIPAIV---------------------------------------LP
D9PYX0_METTM/350-483-----------------------------IGYPRLPMYV---------------------------------------LV
F0TB30_METSL/351-484-----------------------------LGKPRLPMYV---------------------------------------LV
F0EKD4_ENTCA/327-465-----------------------------FKKEKLILYS---------------------------------------TI
Q5M4A4_STRT2/55-193-----------------------------TKREKYALYS---------------------------------------TI
F0HVE0_LACDL/327-469-----------------------------AKRERKNLIS---------------------------------------SA
E4SMU5_LACAR/327-469-----------------------------AKREKMVLKN---------------------------------------TV
D4LGF1_9FIRM/327-469-----------------------------QGREKENLMA---------------------------------------TT
A5ZUX1_9FIRM/326-464-----------------------------FGKELYTCIA---------------------------------------TF
D5TQD2_BACT1/321-460-----------------------------TNQSNKYSIA---------------------------------------VT
A0A016CGV6_BACFG/328-466-----------------------------QGREKYVIIS---------------------------------------TM
E8JWJ5_STRCR/327-467-----------------------------MNRERYFMFA---------------------------------------VS
Q4JZ09_STREE/330-470-----------------------------TGNEKYFMRA---------------------------------------VS
E6MFC3_9FIRM/328-466-----------------------------LGKEKVVLYS---------------------------------------EI
E9RY62_9FIRM/330-468-----------------------------LGKERIVLYS---------------------------------------EI
C5NWI0_9BACL/318-458-----------------------------RNKNKEYMLS---------------------------------------TT
A1ILY9_STROR/319-458-----------------------------HNQNKEFMIS---------------------------------------TT
Q4JYJ9_STREE/323-464-----------------------------TDNVRYFTIS---------------------------------------VM
E0PD92_STREI/325-464-----------------------------TGRDKEYTWV---------------------------------------FV
C6CSD9_PAESJ/327-465-----------------------------NNLDSIFVKS---------------------------------------VL
B0N362_9FIRM/290-427-----------------------------NKKDKIYIVS---------------------------------------VF
A5M4K0_STREE/211-349-----------------------------RAKDKDYVLS---------------------------------------LI
C9LAR2_BLAHA/325-463-----------------------------RSKDKEYTIS---------------------------------------LI
Q4K189_STREE/323-460-----------------------------RSFDKEYTVS---------------------------------------LL
C4FB42_9ACTN/325-467-----------------------------LSRDREYTLS---------------------------------------LI
E0S188_BUTPB/322-462-----------------------------YNKEKMLLVS---------------------------------------II
C3HRG9_BACTU/323-461-----------------------------FEKDKQYVLP---------------------------------------LV
A7HKJ9_FERNB/322-460-----------------------------MKKENYLTIS---------------------------------------VI
E4L4W5_9STRE/321-459-----------------------------SKRTKAYTYS---------------------------------------AV
E7S3G0_STRAG/321-459-----------------------------SRRTKAYTMS---------------------------------------AV
E0NHN4_PEDAC/321-459-----------------------------TNQTNKYTIA---------------------------------------VS
E6LD53_9ENTE/253-391-----------------------------TNQTKYFTIS---------------------------------------VT
C2KJQ1_LEUMC/329-467-----------------------------TKRLNEFTLS---------------------------------------VT
B3XNV8_LACRE/322-460-----------------------------ISRTKEYTIS---------------------------------------VT
B2GDL9_LACF3/322-460-----------------------------VNRVKEYTIS---------------------------------------VT
C0WVB1_LACFE/322-460-----------------------------IDRVKEYTVS---------------------------------------VS
A2RHU4_LACLM/321-459-----------------------------LNRMREFTTS---------------------------------------VT
A1YVF6_LACJH/321-459-----------------------------IHRQKQFTWS---------------------------------------VT
C2D643_LACBR/210-348-----------------------------VNRVKEFTTS---------------------------------------II
Q3ZK40_9LACT/322-460-----------------------------TNKIKIYSTS---------------------------------------II
D8MET9_LEUGT/321-460-----------------------------SGLNKEYIGS---------------------------------------TF
A3F4D6_LACLC/321-459-----------------------------TNQNKSYTVS---------------------------------------VI
D2EJ27_PEDAC/321-459-----------------------------TNQNGAYTKS---------------------------------------VI
O06039_LACLC/321-459-----------------------------LNRMKIFTKS---------------------------------------LI
Q8GPE5_STRTR/321-459-----------------------------INKPTGLTIS---------------------------------------VF
D7DRX9_METV3/353-490-----------------------------VGKPQIATKF---------------------------------------LY
A4FX93_METM5/354-492-----------------------------IGKPALSTKI---------------------------------------LY
A6UPA0_METVS/351-488-----------------------------IGKPYLSTKI---------------------------------------LY
A6UU30_META3/353-490-----------------------------IGKPSLSTKI---------------------------------------LY
D5VU50_METIM/353-494-----------------------------IGKSFLSIKI---------------------------------------LY
D4W1F1_9FIRM/338-485-----------------------------EGQYSRLVMS---------------------------------------VL
B9DSP4_STRU0/342-480-----------------------------EENQKKSFIY---------------------------------------LS
F1Z193_9STRE/350-488-----------------------------ENHQKRSFII---------------------------------------LM
D4YGG7_9LACT/385-532-----------------------------QGQWYKAGIA---------------------------------------FV
F2I7P9_AERUA/374-520-----------------------------QNQWFYSAMA---------------------------------------LG
Q03E00_PEDPA/355-503-----------------------------AGAVKPTLVA---------------------------------------II
D2EHX4_PEDAC/355-503-----------------------------MGRLKMTFWA---------------------------------------IA
A0A021WE79_LACPN/357-507-----------------------------LNEYTAMIIG---------------------------------------II
E7FPH6_9LACO/355-501-----------------------------MNLFSKAAFS---------------------------------------LL

PF03023

MURJ_BORBU/29-473-----------------------------YKIFFIPSFSPIMLSFGIILSIFLFYGRFG...IY..........S...AV
MURJ_RICPR/28-477-----------------------------VKKFAAFAFSPIILSVCVIIFTLIFGNYIE..STI..........S...IS
MURJ_ECOLI/28-479-----------------------------WNRFSIPAFAPTLLNISMIGFALFAAPYFN.PPVL..........A...LA
MURJ_SYNY3/36-495-----------------------------ADQYLLPSISPLLSSITVILGLGVAVWQLGQQLNTEPY....WLLGSLLLA
MURJ_AQUAE/29-466-----------------------------QGKFFVPSVSQTLFNLGFILSLVILFHTLG...HY..........S...LA
MURJ_HAEIN/16-479-----------------------------IGKFGVMSFSPVLLNIAMIATALFLAPQMD.NPDL..........A...LA
MURJ_THEMA/28-450-----------------------------SHRYFLPALTPMFSNVGVIVGCLFGDVRWA...............A.....
Q9X8T0_STRCO/300-778-----------------------------RGRFGAMMWTPVLNNIVIIVTLGLFIWVYGTAETSGMKVTSIPPEGERLLG
MURJ_TREPA/32-489-----------------------------IKVFVPSGCTPIFFNVSVIFSMYFLNVSHMNVAIA..........A....A
Q9RX17_DEIRA/83-522-----------------------------DEHFRESSFAPVAFNIASIIALLLLPNNAT..................WLA
MURJ_CHLTR/34-482-----------------------------EKKFFSVGLAPSVVNVSWIGTVFLARNYDPRNRIF..........G...LA
MURJ_HELPY/2-458-----------------------------KHSFFASAYSASLLNVCMILALLISKEKTHLEALY..........Y...LS
MVIN_MYCTU/48-521-----------------------------RNVFGPPAWAPVVNNVVAIATLAVYLAVPGELSVDPVRMGNAKLLV...LG

PF01554

O51531_BORBU/22-182-----------------------------VAGVSLANKF---------------------------------------FE
YOEA_BACSU/28-189-----------------------------VAAVSSFFPL---------------------------------------FF
YOEA_BACSU/257-418-----------------------------TAAYGVVNQV---------------------------------------AS
O66528_AQUAE/245-406-----------------------------LAAHQIGLRI---------------------------------------ES
YPNP_BACSU/241-402-----------------------------VSGFGAVQRL---------------------------------------DS
NORM_VIBPA/243-404-----------------------------VAAHQVAINF---------------------------------------SS
O80695_ARATH/278-441-----------------------------LDSLAICMSI---------------------------------------SA
O26414_METTH/244-409-----------------------------VAVYSAGWRI---------------------------------------VM
O28801_ARCFU/21-180-----------------------------LSAVGLFFPI---------------------------------------FF
YISQ_BACSU/27-187-----------------------------VAAVGVSNQI---------------------------------------LN
Y709_METJA/243-408-----------------------------LAVYTGALRI---------------------------------------TE
YPNP_BACSU/21-182-----------------------------LGAAAVSSTI---------------------------------------VL
O25454_HELPY/214-375-----------------------------LAGMQIGIRV---------------------------------------ET
NORM_BACSU/20-180-----------------------------LAGVAIGSSL---------------------------------------WT
HMRM_HAEIN/249-410-----------------------------VASHQITLNT---------------------------------------SS
O49660_ARATH/262-426-----------------------------VSILIIVFNF---------------------------------------DY
O82752_ARATH/42-203-----------------------------LSGGSLALGF---------------------------------------AN
DINF_ECOLI/35-196-----------------------------LGGVAVGATA---------------------------------------TS
Q9ZVH5_ARATH/238-401-----------------------------VAAMGILIQT---------------------------------------TG
O28801_ARCFU/239-404-----------------------------LAAYTSAWRL---------------------------------------IQ
Q38956_ARATH/275-438-----------------------------VAALSICMNI---------------------------------------LG
ERC1_YEAST/174-335-----------------------------LGGVTLGSMT---------------------------------------AN
Q9ZVH5_ARATH/16-176-----------------------------LAGGALAMGF---------------------------------------GN
YAO6_SCHPO/17-177-----------------------------LSVAAFAYMF---------------------------------------AM
O82752_ARATH/264-427-----------------------------VASMGILIQT---------------------------------------TA
O51429_BORBU/27-187-----------------------------LSALSLAGPV---------------------------------------NF
O83871_TREPA/32-196-----------------------------MGAVNVVNSL---------------------------------------LF
O51429_BORBU/248-409-----------------------------LAAYGLTNTI---------------------------------------IS
YISQ_BACSU/252-413-----------------------------LTTKVYTQNI---------------------------------------TM
O66528_AQUAE/25-183-----------------------------VAATGFSLSL---------------------------------------LW
O51530_BORBU/21-181-----------------------------VTGVSLANRV---------------------------------------TF
Y709_METJA/21-181-----------------------------LAAVGASFPI---------------------------------------LI
NORM_BACSU/247-408-----------------------------IASHQAAMNF---------------------------------------AS
NORM_VIBPA/17-176-----------------------------MAAVSVASSI---------------------------------------WL
O26414_METTH/24-183-----------------------------LAAIGFVTPI---------------------------------------YM
HMRM_HAEIN/22-181-----------------------------MAAISIGASI---------------------------------------WM
YD338_YEAST/238-397-----------------------------LAAVSLASMT---------------------------------------SN
MDTK_ECOLI/17-177-----------------------------MAAVAIGTSI---------------------------------------WL
Q38956_ARATH/55-215-----------------------------LAAVSVENSV---------------------------------------VA
P71616_MYCTU/19-179-----------------------------LAGLAIGSLV---------------------------------------LG
O49660_ARATH/40-200-----------------------------LAGGSLGFSF---------------------------------------AN
O80695_ARATH/57-217-----------------------------LAAASLGNSG---------------------------------------FN
MDTK_ECOLI/244-405-----------------------------VAGHQIALNF---------------------------------------SS
F4IHU9_ARATH/37-197-----------------------------LSAASIATSF---------------------------------------AS
O25796_HELPY/23-184-----------------------------IAAVNIAWPI---------------------------------------FP
YEEO_ECOLI/48-208-----------------------------MAGVGLADSF---------------------------------------NM
Q8DNG1_STRR6/24-183-----------------------------LAAVGATTAI---------------------------------------FD

PF07260

G1KED7_ANOCA/1-345-----------------------------VKEDAVEMLASYGLAYSLMKFFTGPMSDFKNVGLVFVNSKRDRTKAVLCMV
I3JFW4_ORENI/1-349-----------------------------VKEDAVEMLASYGLAYSLMKFFTGPMSDFKNVGLVFVNSKRDRRKAVFCMV
F1Q528_DANRE/1-344-----------------------------VKEDKVEMLASYGLAYSLMKFFTGPMSDFKNVGLVFVNSKKERSKAILCMA

PF01943

SP5B_BACSU/6-308-------------------ASARG.....DHQKTKNILV---------------------------------------MS
EXOT_RHIME/10-277-------------------EMET.........VHSVFWA---------------------------------------NL
TUAB_BACSU/10-277-------------------TER.........QLSTLYWL---------------------------------------NI
RFBX_ECOLI/8-279-------------------AADS.......KDKVTSIFW---------------------------------------AV
O26447_METTH/15-286-------------------HRDD.......TERVSLIYS---------------------------------------SV
YTGP_BACSU/5-320-------------------YNSKG.....DYETSRKMLK---------------------------------------AG
Y1068_METJA/7-302-------------------YLAENRLDMLKSSIVFVGIL---------------------------------------QT
Y1375_METJA/3-283-------------------EKE.........VDINKYIP---------------------------------------IL
O26479_METTH/10-276-------------------NPGG......ARELVAAGLG---------------------------------------NR
O29660_ARCFU/6-285-------------------ANIKGDDELVRGYIRSLTKL---------------------------------------KA
O26467_METTH/18-289-------------------NRED.......PHRVSEIFS---------------------------------------SV
O26442_METTH/7-278-------------------ERD..........LSSYYVN---------------------------------------NA
YABM_BACSU/12-309-------------------YSEK........NHHTILKI---------------------------------------SA
WZXC_ECOLI/9-276-------------------SHL.........ELTTLYWL---------------------------------------NV
Q2K5A6_RHIEC/11-272-------------------SET.........HFSAVWTL---------------------------------------SV
Q32EG2_SHIDS/2-269-------------------AVS........QAEINKIYS---------------------------------------ET
Q8DZE2_STRA5/6-273-------------------YG..........EEFKSYSG---------------------------------------SA
Q8P805_XANCP/25-289-------------------SRE.........QRDNLFWI---------------------------------------NS

PF13440

A8UQ25_9FLAO/16-256-------------------NMAI------LEDWKKEYYL---------------------------------------TQ
B5JNG5_9BACT/22-272-------------------PAST------NGCLTRLPIA---------------------------------------IQ
D0YZQ3_LISDA/18-261-------------------PKVD------QQDLGKAVVF---------------------------------------GL
D2BRK8_DICD5/18-261-------------------PKQP------DDALAQSVVF---------------------------------------ST
B1IZZ3_ECOLC/18-261-------------------PKQS------EEELTQNVVF---------------------------------------CL
D0I1Y2_VIBCL/18-260-------------------VDFT------ANPVSVALKN---------------------------------------SF
D0HB98_VIBMI/18-260-------------------IDFV------DKKQSQAMYE---------------------------------------SY
A9AXJ4_HERA2/36-280-------------------NASV------RPNNHATLRR---------------------------------------LR
A4EAS6_9ACTN/45-291-------------------FQVS------DIDEKTSFAS---------------------------------------YQ
Q2YCG5_NITMU/22-272-------------------IQGH------FNDKREIAIV---------------------------------------FS
B9JQS0_AGRRK/94-340-------------------KLDN------AGTALASAWR---------------------------------------HA
C2KV49_9FIRM/32-288-------------------GEFS------FRQYRQFRSL---------------------------------------TG
C8XCC3_NAKMY/40-272-------------------VALR------RSGDQGSFVP---------------------------------------VH
Q3K9H6_PSEPF/12-266-------------------LISV------GGSSRRVVDK---------------------------------------VL
O58733_PYRHO/24-253-------------------AEFL------GRGEKNRIKS---------------------------------------IA
C8KY87_9PAST/18-266-------------------RNKQ------YLGWRFYFLC---------------------------------------FL
C5RZU1_9PAST/18-266-------------------RNKQ------YLGWRFYFLC---------------------------------------FL
Q1D7B4_MYXXD/29-283-------------------ADAK------RPFLGQTLLF---------------------------------------MS
C4WNX8_9RHIZ/31-284-------------------..YR------ISTVKPRLLG---------------------------------------IY
A6X6T8_OCHA4/16-269-------------------..YR------ISTVKPRLLG---------------------------------------IY
B1M5Z3_METRJ/17-264-------------------DEAR------EPAQVGTVVR---------------------------------------IL
A1UCH8_MYCSK/30-289-------------------AEGR------QDRRRAIASS---------------------------------------HL
A3PW68_MYCSJ/30-289-------------------AEGR------QDRRRAIASS---------------------------------------HL
Q89SM5_BRADU/14-269-------------------LAAA------SGEEAARLRF---------------------------------------SL
Q2CIK8_OCEGH/14-260-------------------LKAA------DPAPIVASYW---------------------------------------RV
C7LVX3_DESBD/8-264-------------------SGRF------REAFTSYQRI---------------------------------------LL
A4FEI7_SACEN/8-256-------------------LDRH------DPDTRAALVS---------------------------------------SA
C5ATW3_METEA/42-293-------------------GPGL------GDEARPAYYA---------------------------------------IV
A9VW94_METEP/42-293-------------------GPGL------GDEARPAYYA---------------------------------------IV
B7KU42_METC4/42-293-------------------GPGL------GDEARPAYYA---------------------------------------IV
C7C8V6_METED/42-293-------------------GPGL------GDEARPAYYA---------------------------------------IV
C8XCR8_NAKMY/39-289-------------------AAEG------RRQFRSAVRS---------------------------------------AL
Q0RPT3_FRAAA/322-573-------------------ADVS------PRVFRAAGAA---------------------------------------GT
D3CWT1_9ACTO/203-455-------------------AGRS------AAAFRHAAGS---------------------------------------TT
Q0RCF1_FRAAA/179-430-------------------SGAT------PSSFRTAASA---------------------------------------TT
D2PZ16_KRIFD/24-275-------------------SGQR------TPQWHKAVRA---------------------------------------ST
Q8KN00_9ACTO/40-289-------------------SAVA------EASWRQAVAR---------------------------------------ST
D6EG66_STRLI/34-283-------------------SGVP------ESSWRGAVAR---------------------------------------AS
A8UIN6_9FLAO/18-257-------------------TYSR------LPSKIYTLYF---------------------------------------KS
M1I249_9CREN/28-278-------------------VTSR------FSVENRPVGG---------------------------------------IL
A6Q4F3_NITSB/16-266-------------------KAFD------EEYFKGVVYW---------------------------------------YL
B8CST1_SHEPW/46-301-------------------SQTK------NAQDITNIFR---------------------------------------YS
A6FGK5_9GAMM/27-282-------------------SQTQ------NDRDIINVFR---------------------------------------YS
Q8EFK4_SHEON/24-279-------------------SQTK------QDVDITNIFR---------------------------------------YS
A6WPP6_SHEB8/25-280-------------------SQTK------QDVDITNIFR---------------------------------------YS
A1RKH9_SHESW/25-280-------------------SQTK------QDVDITNIFR---------------------------------------YS
A4Y617_SHEPC/25-280-------------------SQTK------QDVDITNIFR---------------------------------------YS
E6XI49_SHEP2/25-280-------------------SQTK------QDVDITNIFR---------------------------------------YS
A6VTF9_MARMS/19-265-------------------DQKN------NFNFHEYLYL---------------------------------------RI
B9EAW7_MACCJ/18-258-------------------VTDK------RFDYKIYAYN---------------------------------------RN

PF04506

RFT1_CANGA/9-542ADNDHDHD...........RDDSALQVCVNFAMIPLFIG---------------------------------------IP
E9IWP9_SOLIN/8-542.......N...........TVEHNWAQVVNLLWLTVPIC---------------------------------------VV
S9VRB9_SCHCR/24-535KAPVPDSK...........YRSGRLQLVKNASVITVYAG---------------------------------------II
C5E2W4_LACTC/16-558EDDPETDD...........AGPGVLQTAINFAYIPLCIG---------------------------------------VP
E9EIH0_METAQ/28-566EKGDEQLL...........VTRRDSQAVVNLGYLAIVLG---------------------------------------LF
G8BWS7_TETPH/20-558LDVKKQKN...........SPNNTLQIAVNFAMVPLMIG---------------------------------------IP
H2ASC3_KAZAF/14-533.....................KTNLQNVFNFGYLSIFIG---------------------------------------IP
RFT1_YARLI/102-645FGGGVVQD...........TVSGTSQAVINMGYISVLLG---------------------------------------VF
RFT1_SCHPO/10-520STESNKSK...........KLSDQLQLIKNTSLISVYIG---------------------------------------IV
I2GX14_TETBL/21-581KHHSHSNNSKDVLTSSNRLSKSPVLQTVVNFAHIPLWIG---------------------------------------IP
A7TRS5_VANPO/18-551DSSISVSN...........EKTIVLQTAVNFAHIPIWIG---------------------------------------IP
J7R8K9_KAZNA/27-584RNKWENRD...........ADRTVLQTAVNFSHVAMYIG---------------------------------------IP
M2PSW7_CERS8/12-528...GQTSE...........KKSDDEALVSNISLLPILLG---------------------------------------VP
RFT1_CAEEL/2-516.......E...........IIRGSLPKFINLLWLSPIIS---------------------------------------TV
G8ZPN0_TORDC/18-550SISSEDSK...........GRSDVLQTAVNFAHISMRIG---------------------------------------VP
C4R7X1_PICPG/21-528....................KGKAYQAIFNLSLIPLVIG---------------------------------------VP
H9KBA9_APIME/8-516.......N...........TIEHNWAQVVNLLWMTVPIC---------------------------------------FL
U5D209_AMBTC/17-521....DEG............SMEENGSKLLAVAWITVPIG---------------------------------------FL
G0W6B8_NAUDC/22-586TTSSVEKT...........KNSQILQTAVNFAYIPFVIG---------------------------------------VP
E2AM70_CAMFO/8-540.......N...........TAEHNWAQVVNLLWLTVPIC---------------------------------------LV
E9GUV5_DAPPU/9-536.......K...........TRDHNWPQVINLLWLTVPSV---------------------------------------II
D8M9P3_BLAHO/10-506.......D...........KGKEEWSKVNQLVWLAVPTG---------------------------------------VV
F4K836_ARATH/105-602....RDGP...........ESEENVTRILKVAWVTVPLG---------------------------------------IA
U4LAR2_PYROM/52-567....................TKNSSIIITNLALLCLPLG---------------------------------------IC
RFT1_DROME/8-549.......Q...........GDRCSWAQLINQMWLTVPIC---------------------------------------AV
G8BFC9_CANPC/25-545.......Q...........TKTRTLQKVMNFGFIPFLIA---------------------------------------IP
M3BX75_SPHMS/8-530.......................GIQAAINLSYLAIAGG---------------------------------------IP
W4Z9M3_STRPU/12-532.......Q...........SSKHYWPQVINLLWCSLPLG---------------------------------------VV
RFT1_ASHGO/11-543GGEMSAE.................LQTAVNFANIPMCIG---------------------------------------AP
M3K0B3_CANMX/13-532.....................HQTSQKVINFGILGILL.---------------------------------------..
G8JV96_ERECY/11-550DGEDKDYV...........DDPNVLQAAVNLGYIPICIG---------------------------------------FP
G0V9M8_NAUCC/17-571NEDEDEEK...........QKSNVLQTLANFAYIPLCIG---------------------------------------IP
H9J737_BOMMO/8-547.......R...........TDGFGWSHLINQIWLSVPIS---------------------------------------SL
R4XDT4_TAPDE/6-505...................GNNDRVQEIINISYIPVTAG---------------------------------------LF
RFT1_YEAST/18-565EEEYQETH...........YKSKVLQTAVNFAYIPFWIG---------------------------------------FP

PF14667

Q03SZ7_LACBA/349-498TGFI...VK------------------------------CLFNRWSV..I...H--------------------------
Q38V74_LACSS/358-503IGLL...VK------------------------------VVINQWLV..Q...H--------------------------
B3WAP5_LACCB/356-499LGIL...LK------------------------------AVINQPLV..V...K--------------------------
A8UAN8_9LACT/362-510IGLG...VK------------------------------IVLNEWFV..E...H--------------------------
D0BM46_9LACT/359-506IGLI...AK------------------------------GIGNLWFI..P...Q--------------------------
C8NI78_9LACT/366-514AGLV...VK------------------------------AGTNYLFV..A...M--------------------------
C0WQN7_LACBU/354-501CGFV...VK------------------------------LIINKWLV..A...T--------------------------
C2EHH6_9LACO/356-502VAFL...TK------------------------------YILNSYLI..G...K--------------------------
E6LEY4_9ENTE/358-506CGCI...VK------------------------------FVTTGILT..A...G--------------------------
C9A420_ENTGA/359-508CGLL...LK------------------------------GLLTWPLT..Y...L--------------------------
C2HEH9_ENTFC/359-507WGLL...VK------------------------------GLTTSFLT..G...L--------------------------
C0X942_ENTFL/359-507VGLL...VK------------------------------LLTTGFFT..I...R--------------------------
E0RUK9_BUTPB/373-516VGWA...VH------------------------------IGLLVLLS..I...V--------------------------
C5Q1B2_STAAU/332-469IGAV...MN------------------------------LVLCLVLI..Y...F--------------------------
E7MM58_9FIRM/379-526IGFL...VK------------------------------VVTFYPCC..Y...L--------------------------
E4LZJ6_9CLOT/384-531IMMV...VK------------------------------FSVAYPLL..K...Y--------------------------
D4W2K6_9FIRM/377-526VGLL...IK------------------------------YVGNVILI..P...M--------------------------
D5E4C9_BACMQ/373-523LGIV...IK------------------------------LILNFILL..T...N--------------------------
B7JJF5_BACC0/376-524VGIL...VK------------------------------VLVNTPLL..H...L--------------------------
Q8EP19_OCEIH/372-521TGLF...VK------------------------------ILLNSQLI..H...M--------------------------
B1YKH1_EXIS2/386-534AGLL...TK------------------------------YLLNAPLI..H...W--------------------------
D6Y0K7_BACIE/382-530IGIL...TK------------------------------LIVNIPFI..T...W--------------------------
Q5WE75_BACSK/374-522VGLL...LK------------------------------LGLTYVFL..K...W--------------------------
E6U1Q3_BACCJ/375-523AGLI...FK------------------------------LTFTYLMI..V...W--------------------------
D3FXP2_BACPE/374-522AALL...VK------------------------------LALNYLML..L...L--------------------------
A4IRX9_GEOTN/371-520AGLL...VK------------------------------LSLNTLLI..M...K--------------------------
D5DN36_BACMD/374-521FGLI...VK------------------------------IVVNVPFI..L...M--------------------------
A7Z7U6_BACA2/375-524IGVI...IK------------------------------VVLNMPLI..K...L--------------------------
A0RJU4_BACAH/372-520MGVI...LK------------------------------FVCNVIFI..R...Y--------------------------
E7RE43_9BACL/368-516TGLL...LK------------------------------ALLNTPLI..E...R--------------------------
A3I8W7_9BACI/372-521SGIF...VK------------------------------LALNIPLI..R...L--------------------------
A6CQJ8_9BACI/372-520VGLL...IK------------------------------LVLNIPLI..K...L--------------------------
D3UNL4_LISSS/370-518LGLL...TK------------------------------SVLQMPLI..L...L--------------------------
B8DHB8_LISMH/370-518LGLL...AK------------------------------SVLQMPLI..M...L--------------------------
A0A008APY8_STAAU/386-533ASVV...IK------------------------------LALNYPLI..M...L--------------------------
B9E7H2_MACCJ/374-522ASLL...VK------------------------------LVINFPLI..Y...L--------------------------
D5T1U4_LEUKI/363-511LGFV...VK------------------------------LILQPILI..N...A--------------------------
Q03XR0_LEUMM/330-477WGIA...VK------------------------------ILCQPIMI..Y...L--------------------------
A0NHL2_OENOE/387-534YGIL...LK------------------------------MVFQVPMI..Y...M--------------------------
B1MY12_LEUCK/485-634FGLL...VK------------------------------VALQVPFI......R--------------------------
C2KKY7_LEUMC/498-647VGII...IK------------------------------IVLQIPLI......R--------------------------
C0WLU0_LACBU/374-518GGLI...VK------------------------------LVLQIPLV......T--------------------------
C2EP42_9LACO/342-483WGVV...VK------------------------------LILQVPMT..F...L--------------------------
A0A038C172_ENTFL/370-519ITLL...LK------------------------------LIIQIPCI..Y...L--------------------------
C5RB06_WEIPA/501-648FIFA...VK------------------------------IVLQVPLT......I--------------------------
A8UCR2_9LACT/391-539IGLV...VK------------------------------LAFQYPML..A...I--------------------------
A2RMM4_LACLM/390-539LTLV...IK------------------------------LVLQVPMI..L...I--------------------------
C9A2J3_ENTGA/381-529IGLL...LK------------------------------FILQYPAI..W...L--------------------------
E6LIJ6_9ENTE/381-529IGFI...LK------------------------------LILQVPFI..F...L--------------------------
A0A037ZTL3_ENTFL/382-530IGLA...VK------------------------------LIVQFPAI..R...L--------------------------
C2H7P1_ENTFC/381-529VGFL...VK------------------------------LLLQYPAI..R...L--------------------------
A4VW05_STRSY/379-527IGML...VK------------------------------IVLQVPMI..Y...V--------------------------
E3CI47_STRDO/375-523WGIL...AK------------------------------LVFQVPML..Y...V--------------------------
A5LCT3_STREE/372-520YGSI...AK------------------------------LVLQLPTI..A...L--------------------------
A3CPL5_STRSV/375-523YGVG...VK------------------------------LVLQVPLI..Y...I--------------------------
A2RG74_STRPG/377-525YGIL...IK------------------------------LVLQIPLI......Y--------------------------
E8K660_STRPA/410-558YGVV...VK------------------------------LVLQIPFI..L...V--------------------------
B1SH45_9STRE/377-525YGLV...VK------------------------------IVLQVPFI..F...L--------------------------
C2LQ70_STRSL/432-580IGVL...VK------------------------------AILQLPLI..I...F--------------------------
C6SP25_STRMN/377-525YGVI...AK------------------------------FVLQVPLI......Y--------------------------
B3W6R7_LACCB/364-511FGVI...AK------------------------------MLAEVFCI......W--------------------------
A5VL26_LACRD/382-530IGIV...IK------------------------------FILQFPCI..W...I--------------------------
D2ELV8_PEDAC/393-541VGMI...VK------------------------------FIFQFPMV..A...I--------------------------
C0WUG9_LACBU/378-530VGTL...IK------------------------------FIIQWPCV..Y...Y--------------------------
Q03RI1_LACBA/378-525VGTV...VK------------------------------FIVQWPLV..Y...F--------------------------
C2EED2_9LACO/381-529IGMI...VK------------------------------VIIQFPLT..A...F--------------------------
Q38VP9_LACSS/378-526IGFI...VK------------------------------VVAQYPAI..Y...F--------------------------
C8PCY7_9LACO/375-523IGII...IK------------------------------SIFQWPAI..K...L--------------------------
D0DXL5_9LACO/375-523VGLI...IK------------------------------CIIQYPLI..R...L--------------------------
C2E7U4_LACJH/384-532LGII...IK------------------------------FAVQLPMI..E...F--------------------------
C2KAZ9_9LACO/380-528LGLI...LK------------------------------GILQYPMI..F...L--------------------------
B3WCD6_LACCB/380-528IGLA...VK------------------------------VIVQWPMI..F...F--------------------------
D0BKY7_9LACT/390-538IALV...VK------------------------------MLWQPMMI..Y...F--------------------------
C8NE09_9LACT/413-561FTVI...IK------------------------------LLWQPMMM..Y...F--------------------------
E4KNA5_9LACT/790-938IGLL...VK------------------------------AMAQYPFV..A...V--------------------------
D4YJ56_9LACT/433-583LGVT...LK------------------------------LVLQAPFL..A...M--------------------------
E0IFR0_9BACL/366-514IGIA...VK------------------------------LVASVALA..P...V--------------------------
E0RCM4_PAEP6/382-529VGIV...VK------------------------------FAASWLLA..G...W--------------------------
C6J0R0_9BACL/364-511IGIL...VK------------------------------LAASYVFA..Q...F--------------------------
E5Z458_9BACL/362-509IGIV...VK------------------------------LAASFLLA..P...L--------------------------
C0Z9G8_BREBN/364-513YGVI...VK------------------------------VLATLVFT..S...M--------------------------
C4GB38_9FIRM/387-530IATG...VQ------------------------------ALFLVVAMLVF...H--------------------------
A8RUL6_CLOBW/387-539IALV...IH------------------------------VAVLEVFLMVF...K--------------------------
E6LN70_9FIRM/381-525ISLI...IH------------------------------FIILYILLFTL...K--------------------------
C7GE86_9FIRM/383-527IALV...LH------------------------------LGLLAALM..F...L--------------------------
E3GGE0_EUBLK/365-508IAIV...IR------------------------------FVTGWICLAVP...A--------------------------
E6MGM4_9FIRM/373-516LGII...VF------------------------------SVTGWIAMSIP...A--------------------------
B8D0L3_HALOH/359-505IGSA...IK------------------------------LTGIYFLTPRP...E--------------------------
C6PQD8_9CLOT/131-275IGCA...IK------------------------------TAITIQMVSIP...G--------------------------
C8VXJ1_DESAS/366-509VGII...FK------------------------------IGFTYYLTPSP....--------------------------
D9QSV7_ACEAZ/363-507LGGA...LN------------------------------AVLNYFLTAIP...S--------------------------
B2A8K9_NATTJ/363-507YGAL...VN------------------------------LVINYYLTAIP...Q--------------------------
A8MK38_ALKOO/363-506IGAL...LK------------------------------LVVTYTLAGIP...W--------------------------
A5D2G5_PELTS/358-502LASL...FK------------------------------ITGIYFLTGLP...Q--------------------------
D5X9J9_THEPJ/361-503VGVV...VK------------------------------LGLNYYLTGLP...V--------------------------
B2A2Z4_NATTJ/361-504IGTF...LK------------------------------AILTYWLTAVP...Y--------------------------
C7GYH1_9FIRM/373-517IGIV...AK------------------------------IILTYVLTSIP...S--------------------------
A6TN15_ALKMQ/363-506IGVL...VK------------------------------IIISYILL.VS...H--------------------------
A8MIG9_ALKOO/365-508IGAI...IK------------------------------VVVSYYLLMSS....--------------------------
Q67JD5_SYMTH/384-522LGAA...VK------------------------------IGLTAWWT..G...P--------------------------
C4FNY8_9FIRM/361-503IGLL...AK------------------------------TFLDYQLTGTI...E--------------------------
D3LVV9_9FIRM/358-500IGAG...IK------------------------------IFLSWHLTAVP...A--------------------------
E2ZD67_9FIRM/360-502ISAL...VK------------------------------IVLSWYLTAIP...W--------------------------
C9LLX4_9FIRM/363-506VSAA...VK------------------------------VFLSWNLTAMP...S--------------------------
D3LX29_9FIRM/358-500IAAA...VK------------------------------VCCNWFLVAIP...A--------------------------
C4FPR1_9FIRM/359-501IALV...IK------------------------------VILNWTLTAIP...W--------------------------
A1HLQ5_9FIRM/371-513ISAV...VK------------------------------VVLNWRLVALP...A--------------------------
C4V2B6_9FIRM/374-517LAAA...AK------------------------------IFLNWHLTAIP...W--------------------------
E8LB44_9FIRM/369-509IACI...VK------------------------------IVMSWYLTAVP...E--------------------------
C0WBK9_9FIRM/378-517IAAI...VK------------------------------VFLNWNLTAMP...T--------------------------
B7DPH6_9BACL/373-525LGLG...IK------------------------------TALNFALI..L...G--------------------------
C0ZHE2_BREBN/367-517IGVL...VK------------------------------LILNLALV..P...F--------------------------
C2YMP0_BACCE/352-495GASF...VK------------------------------VILNIVLV..S...Q--------------------------
B7GMA5_ANOFW/366-505IGCF...VK------------------------------WGTNILFV..S...W--------------------------
E7RL93_9BACL/356-500IGVG...IK------------------------------LFLNLTLV..N...L--------------------------
D3FZH8_BACPE/357-501MCSA...VK------------------------------FVLNIILV..A...Q--------------------------
B0MPG6_9FIRM/391-534PGCA...VK------------------------------LIFNVFTISVP...A--------------------------
B0PEA8_9FIRM/441-584AGGL...MK------------------------------LALNFVLVAIP...Q--------------------------
A7VWY4_9CLOT/433-577VGVI...IK------------------------------IILNYTLVGIP...A--------------------------
E6TRQ4_BACCJ/362-512AGVV...IK------------------------------IIGNNIAV..P...V--------------------------
D5WSL0_KYRT2/373-521IGLV...LK------------------------------VVLNLWWV..P...L--------------------------
B1YGP9_EXIS2/345-491AGLL...IK------------------------------LGLNIYLI..P...L--------------------------
C5RD31_WEIPA/359-505LTMI...VK------------------------------YILNMIFI..P...Q--------------------------
Q8EU30_OCEIH/362-509ITFI...IK------------------------------WIGNLLFI..P...I--------------------------
B9E8U7_MACCJ/341-481AGIL...TK------------------------------FLLNLLLI..P...Q--------------------------
Q49V13_STAS1/337-479TGVV...SK------------------------------AILNVVLI..P...P--------------------------
B9CVC4_STACP/347-489LGIL...SK------------------------------AILNIMCI..S...Q--------------------------
C2M158_STAHO/360-502SGLL...FK------------------------------IIFNVIFI..Y...F--------------------------
D3QG68_STALH/343-485IGLI...VK------------------------------GLLNIMLI..Y...Q--------------------------
E8SIP0_STAPH/344-486IGIV...TK------------------------------GVLNIIVI..P...L--------------------------
A0A008AT25_STAAU/343-485AGLV...IK------------------------------FILNIILI..R...L--------------------------
F2F183_SOLSS/360-508VGIV...LK------------------------------YIGNIIFI..P...R--------------------------
A3IEA1_9BACI/365-514IGFV...LK------------------------------IILNVRLI..G...W--------------------------
E7RLD1_9BACL/354-503SGLV...VK------------------------------VICNLLLV..P...A--------------------------
A0AF13_LISW6/361-504IGLI...VK------------------------------WIIGSILI..P...Q--------------------------
D7UUI0_LISGR/356-499IGIV...VK------------------------------WLANQFLI..P...R--------------------------
A6CR25_9BACI/352-499GGLA...VK------------------------------FGLNILLV..S...R--------------------------
E5WT44_9BACI/362-510MGFA...VK------------------------------LALNILLV..P...S--------------------------
Q2B249_9BACI/362-508GGFG...IK------------------------------YILNILLV..P...A--------------------------
A8F924_BACP2/360-506LSVL...VK------------------------------WILTLALV..P...L--------------------------
E5WAE4_9BACI/356-502CGIL...VK------------------------------AVLNELLI..P...G--------------------------
A7Z0I0_BACA2/354-499AGGA...LK------------------------------WVLNVWLV..P...G--------------------------
D4G3E4_BACNB/359-505AGVA...VK------------------------------WVLNTLLV..P...R--------------------------
D5D970_BACMD/362-511AGMA...VK------------------------------LILNLWLI..P...D--------------------------
B7GFI4_ANOFW/350-497VGMI...AK------------------------------WGLNVLLV..P...L--------------------------
A4IJD3_GEOTN/352-496VAVA...GK------------------------------MALMHWLV..P...P--------------------------
C5D378_GEOSW/360-505VAVA...GK------------------------------TACNWLLI..P...L--------------------------
Q5WAF7_BACSK/347-496VGLA...VK------------------------------LAGNLLFI..P...V--------------------------
D3FR13_BACPE/361-509LGIL...VK------------------------------LGLNILLV..P...V--------------------------
Q9KGJ0_BACHD/361-507VSLL...VK------------------------------MVANVVLI..P...A--------------------------
D6XV50_BACIE/360-507AGVG...VK------------------------------GLGNAVLV..P...L--------------------------
D3E759_GEOS4/381-532AAAG...LK------------------------------LLLNLLLV..P...Q--------------------------
E0RM54_PAEP6/373-525AAAV...AK------------------------------ALLNWLLV..P...Q--------------------------
A7GJW7_BACCN/360-506LGSC...LK------------------------------VVLNYILM..P...Y--------------------------
B5UWQ0_BACCE/360-510FGGC...LK------------------------------LALNYIFM..P...Y--------------------------
D2BMG7_LACLK/323-465VSGF...IS------------------------------LGIISLCI......F--------------------------
B8IEZ7_METNO/324-461IGAA...VN------------------------------AFGVLTLA..G...R--------------------------
C7NM90_HALUD/327-463SAAV...LN------------------------------AVVNLFLI..S...W--------------------------
A6DHF1_9BACT/293-436FTAI...FN------------------------------VVLSVLFG..L...S--------------------------
Q47U72_COLP3/338-481LGAL...LN------------------------------IGLSLVLG..S...Q--------------------------
B4AGJ7_BACPU/343-486ILGV...SN------------------------------VLFAYGLTHTL...Q--------------------------
Q1K412_DESAC/351-495VEAV...MN------------------------------VVFSLLFV..M...L--------------------------
C0QCL2_DESAH/352-496VEAM...IN------------------------------LILSISFVVVF...D--------------------------
Q2YCG5_NITMU/323-466ACLMVMIFG------------------------------LSLTINVS..L...V--------------------------
E6QMG7_9ZZZZ/367-517PNILFLAVT------------------------------VPLSYLYL..H...A--------------------------
F2G999_ALTMD/323-467INIF...CN------------------------------ILIASCTI......W--------------------------
C6JQC3_FUSVA/323-462GVMI...VS------------------------------ILISLILT..E...K--------------------------
E5X0H2_9BACE/326-464IKKT...IA------------------------------TLILLLSI......P--------------------------
A3DHV8_CLOTH/327-465IKKV...LE------------------------------LLILLISL......K--------------------------
B5CWR8_BACPM/324-466SNTC...FT------------------------------VLGFIIAS..V...Y--------------------------
F1VXT7_9BURK/320-462IGTI...LQ------------------------------VTSFFIGV......N--------------------------
Q2YCC1_NITMU/331-475FALI.....------------------------------ILLPLILVG.A...H--------------------------
Q0AHL3_NITEC/325-466LASI...VM------------------------------PIAFLIGC......N--------------------------
D4YX22_SPHJU/336-476VGAV...LM------------------------------PAAFLIGI......R--------------------------
Q1GPL1_SPHAL/342-484SGAM.....------------------------------LFPASFLIGAE....--------------------------
B0VF98_CLOAI/326-465FLLI...SN------------------------------AILNYLLI..I...K--------------------------
A1S103_THEPD/335-472AGLA...VL------------------------------LPLAAPLT..Q...R--------------------------
E8R8C0_DESM0/349-487VNTL...VS------------------------------LPLTLILL..P...R--------------------------
A3DIV8_CLOTH/358-500VGYV...IR------------------------------ILFVIYFV..P...S--------------------------
F2JLQ5_CELLD/355-497MGSL...IC------------------------------IALILLMV..P...R--------------------------
A7VPC0_9CLOT/355-497IDSV...MR------------------------------VGLILFLL..P...L--------------------------
A8SAU1_9FIRM/356-502WDAV...LR------------------------------IGGVAVLL..P...R--------------------------
A6TSY6_ALKMQ/375-519LGMS...IQ------------------------------LYCTYILVPNP...K--------------------------
A6NPI5_9FIRM/351-494ICGA...VQ------------------------------LGCTWVLMGLP...G--------------------------
B0K3R2_THEPX/360-504IWLG...VC------------------------------IIGMYYLTAMP...Q--------------------------
B7AQB6_9FIRM/351-493ISTL...MR------------------------------IAFIIFLI..P...S--------------------------
D3AN52_9CLOT/376-519TALF...VR------------------------------LAFVLFGI..P...K--------------------------
B0TAY6_HELMI/361-505ATSL...LR------------------------------VGLFLTLATLP...S--------------------------
Q3ADH7_CARHZ/346-484GASG...VK------------------------------ILSLLLLT..P...K--------------------------
E0RMQ1_PAEP6/366-508IGAV...IK------------------------------IALIVWLASQP...Q--------------------------
C0ZAP4_BREBN/363-505ISAI...IK------------------------------TVAMFFFTAHP...S--------------------------
D7WQC4_9BACI/353-489YGGL...GK------------------------------LFVMFVLASQP....--------------------------
C8WQG9_ALIAD/361-502VGGV...AR------------------------------LAVILVLATRP...S--------------------------
B7DPL3_9BACL/356-497FSSA...VR------------------------------LACIYEFVAVG...N--------------------------
D5QEL1_KOMHA/351-483VEVV...VY------------------------------IPLLLLFL..H...W--------------------------
A9WAD6_CHLAA/337-475AATV...AT------------------------------LPLDFVLV..P...W--------------------------
E1IEK9_9CHLR/380-529ITLL...VV------------------------------VPLAILLP..P...W--------------------------
B9JKJ2_AGRRK/321-464IDLC...FR------------------------------IVLISIGF..Y...F--------------------------
Q2Y4J6_9ARCH/377-524GICI...AN------------------------------IGLNYLFI..P...E--------------------------
E8V165_TERSS/339-475LTGV...LN------------------------------IALDAALI..P...H--------------------------
B8IGJ3_METNO/336-472SGAA...LT------------------------------LLIGFLLI..P...H--------------------------
D7BDH0_MEISD/336-473AASA...LN------------------------------IGLDYLLI..P...Q--------------------------
F2NKF2_MARHT/337-483ATSV...LN------------------------------LGLDLLLI..P...S--------------------------
D8J725_HALJB/340-478VLVA...VN------------------------------VGVSVLLV..P...R--------------------------
B8D178_HALOH/340-478LVVG...MN------------------------------VTLNYALI..P...N--------------------------
C4RGH8_9ACTO/364-502AGTL...VN------------------------------VVLNVLLI..P...R--------------------------
Q18GU8_HALWD/357-496LAAG...VN------------------------------ITLNYFLL..I...L--------------------------
Q469G3_METBF/349-484ASAG...IN------------------------------VAVNFMLI..P...E--------------------------
C5A2Y0_THEGJ/342-480LAVI...SD------------------------------FLLNILLI..P...R--------------------------
F0LLW6_THEBM/342-478ISAM...FN------------------------------LLLNTLLI..P...V--------------------------
F2KQE3_ARCVS/343-481IAAV...IN------------------------------FVLNLILI..P...L--------------------------
F0LLZ4_THEBM/339-477TAVL...VN------------------------------VILNILLI..P...K--------------------------
Q5JDW0_THEKO/345-480LAAL...LN------------------------------VALNMALI..P...V--------------------------
A1BJ49_CHLPD/337-476AGLC...IQ------------------------------AAATLLLI..P...R--------------------------
B3EHD9_CHLL2/365-504AALA...VQ------------------------------VVLSVLLI..P...L--------------------------
Q3APG3_CHLCH/338-477VALA...LQ------------------------------AGLNWLFI..P...T--------------------------
B4SBS0_PELPB/338-477AALG...LQ------------------------------VALNFLLI..P...K--------------------------
Q3B6G9_PELLD/337-476SALT...LQ------------------------------VALNLLLI..P...R--------------------------
A4SCQ1_PROVI/337-476VALL...LQ------------------------------LLLNLILI..P...R--------------------------
D8PBA0_9BACT/336-473IIVP...VD------------------------------VGLCAGLI..P...R--------------------------
D3SSH7_NATMM/337-474VAAL...IN------------------------------VILNALLI..P...R--------------------------
B6IYF6_RHOCS/343-484LGAA...CN------------------------------LLLIALLI.......--------------------------
D0LQE6_HALO1/374-513VTLA...AS------------------------------VLANAFVV..P...L--------------------------
D2RVV2_HALTV/336-474TTST...GN------------------------------VALNLALI..P...I--------------------------
D3STC0_NATMM/337-475VTGG...FN------------------------------FGLNLLLI..P...T--------------------------
D8J472_HALJB/339-477STAL...LN------------------------------FLLNLLLI..P...A--------------------------
D2RXY9_HALTV/340-478GTAV...AN------------------------------FLLNLVLI..P...T--------------------------
E7QQ57_9EURY/339-477ATSA...AN------------------------------FALNLVLI..P...S--------------------------
C7P069_HALMD/318-461VLVV...SN------------------------------VVLNFALI..W...Q--------------------------
C7NSR3_HALUD/331-469VFIL...VN------------------------------VVLNVVLVWQF...S--------------------------
Q5V4U1_HALMA/327-465VFIV...SN------------------------------AILNAVLIWQL...S--------------------------
D8J7W8_HALJB/319-457VTIA...IN------------------------------LVLNVALV..L...S--------------------------
C7NSL6_HALUD/319-457ASIT...VN------------------------------LVLNVVLI..L...E--------------------------
E4NUG7_HALBP/319-458VSVA...LN------------------------------LILNVVLI..L...S--------------------------
AGL15_HALVD/319-457ISVV...LN------------------------------LILNVILI..L...S--------------------------
Q12VM9_METBU/345-483IGVA...AN------------------------------IALNFILI..P...L--------------------------
A3CVY7_METMJ/333-471IAVT...VN------------------------------IGLNILLI..P...A--------------------------
A2STD2_METLZ/331-469IAAL...LN------------------------------IALNVTLI..P...I--------------------------
A5UQJ1_ROSS1/330-463GSLS...LN------------------------------IVLNLILQ..P...A--------------------------
D3FFB8_CONWI/338-471VAAL...AN------------------------------VGLDILLI..P...S--------------------------
D8GMK0_CLOLD/327-460ISSM...FN------------------------------VISNLIFI..P...K--------------------------
F0KAR0_CLOAE/326-458ISSL...FN------------------------------LIINLLLT..P...K--------------------------
D5XD05_THEPJ/326-457VGAL...LN------------------------------TVLNLILI..P...R--------------------------
Q2NIB6_METST/328-458ICLL...FS------------------------------TIGNFILI..K...L--------------------------
F0T719_METSL/333-463ISMI...FN------------------------------IVLNLWAI..P...H--------------------------
Q2NH55_METST/331-464IGAI...FS------------------------------IILNLILI..Y...Y--------------------------
E3GZ73_METFV/328-459IAAA...FN------------------------------VVVNLILI..P...K--------------------------
A5UNI7_METS3/328-460LAAL...FN------------------------------VALNFILI..P...H--------------------------
F0TC71_METSL/328-460INAI...IN------------------------------VALNLVLI..P...H--------------------------
Q12XY4_METBU/326-458FAAF...FN------------------------------IALNFIFI..P...S--------------------------
Q46FX4_METBF/329-461IGAV...LN------------------------------ICLNFILI..P...R--------------------------
F0TBQ9_METSL/329-463VCLV...LN------------------------------VILNLILI..P...S--------------------------
Q0W809_UNCMA/331-464VCML...VY------------------------------LALNIILI..D...R--------------------------
D1Z261_METPS/328-462IGML...VN------------------------------FALNIILI..P...L--------------------------
O26442_METTH/329-460ISAA...FN------------------------------IVLNMILI..P...Y--------------------------
A5UWW7_ROSS1/374-505TGAL...FN------------------------------LGMNLALI..P...V--------------------------
E1IAS8_9CHLR/378-523IGAV...AN------------------------------LCMNLVAI..P...V--------------------------
D5UPU7_TSUPD/350-482VNLI...GN------------------------------IVLNVILI..P...P--------------------------
Q97AA3_THEVO/339-476ASLA...SN------------------------------AILSIILI..P...H--------------------------
Q2S953_HAHCH/328-463ATLA...TN------------------------------AILDILLI..P...H--------------------------
F2NHK3_DESAR/367-498LGAL...IH------------------------------ITANLLLI..P...L--------------------------
A3W1Y0_9RHOB/329-468IGSI...VQ------------------------------ILCVAVGA......S--------------------------
C4XGJ8_DESMR/335-465AALV...LA------------------------------FAANAFLV..P...R--------------------------
A9EQ86_SORC5/331-462LALV...AD------------------------------VALNLLLL..P...R--------------------------
B9K2D6_AGRVS/332-468GGAF...IM------------------------------LVGDVLLV..P...S--------------------------
E3FNG9_STIAD/347-485VSMV...LN------------------------------ATLNLTLA.RPFLAW--------------------------
B6YVL8_THEON/328-461EGAV...LN------------------------------IFLNLILI..P...I--------------------------
E0I7A7_9BACL/353-491CCVV...VN------------------------------VGLNVLLI..P...K--------------------------
D5DY76_BACMQ/331-468YSGV...IN------------------------------ILLNIILV..P...R--------------------------
D7E977_METEZ/332-466FAAV...LN------------------------------FGLNILII..P...Y--------------------------
A1ASY9_PELPD/345-481AAGI...FN------------------------------VILNIILV..P...F--------------------------
D7D534_GEOSC/329-466AGGV...IN------------------------------IILNLVFI..P...V--------------------------
E8RTH0_ASTEC/331-467IPAI...AN------------------------------VGLNLWLI..P...L--------------------------
Q0AP11_MARMM/327-464ASAG...LN------------------------------LALNLLLI..P...A--------------------------
E7RZY6_9BURK/339-474SAAG...LN------------------------------VLLNLLLI..P...S--------------------------
Q12TY8_METBU/325-459LAVI...IE------------------------------IILLILLV..P...S--------------------------
D9PYX0_METTM/350-483AGTV...IN------------------------------LALNVALV..P...L--------------------------
F0TB30_METSL/351-484AGIT...VD------------------------------LILSLALI..P...P--------------------------
F0EKD4_ENTCA/327-465SSAL...LN------------------------------IILNLILI..P...Y--------------------------
Q5M4A4_STRT2/55-193ISAI...LN------------------------------IIASFLLI..G...R--------------------------
F0HVE0_LACDL/327-469TSAV...LN------------------------------IVLNFALI..P...F--------------------------
E4SMU5_LACAR/327-469ITAV...LN------------------------------VVLNFILI..P...S--------------------------
D4LGF1_9FIRM/327-469VSAI...IN------------------------------CGLNLYMI..P...K--------------------------
A5ZUX1_9FIRM/326-464VGAI...LN------------------------------VVLNSIFI..I...T--------------------------
D5TQD2_BACT1/321-460VGAV...LS------------------------------LIINLILV..P...S--------------------------
A0A016CGV6_BACFG/328-466VGAC...IN------------------------------LLINYLLI..P...Q--------------------------
E8JWJ5_STRCR/327-467LGAL...VN------------------------------LGLNLILM..P...K--------------------------
Q4JZ09_STREE/330-470IGAI...VN------------------------------LCLNLLLM..P...I--------------------------
E6MFC3_9FIRM/328-466AGAL...VD------------------------------LVVNWLLI..P...K--------------------------
E9RY62_9FIRM/330-468AGAV...ID------------------------------LILNLILI..P...H--------------------------
C5NWI0_9BACL/318-458IPAF...VS------------------------------VAVNIAVI..P...F--------------------------
A1ILY9_STROR/319-458APAI...IS------------------------------VGLNLLFL..P...K--------------------------
Q4JYJ9_STREE/323-464SGAV...VS------------------------------ILLNFIVI..P...F--------------------------
E0PD92_STREI/325-464AGVV...TN------------------------------AIVNSILI..P...Q--------------------------
C6CSD9_PAESJ/327-465IGAV...IS------------------------------VITNIILI..P...H--------------------------
B0N362_9FIRM/290-427LGAI...VN------------------------------IVINLLLI..P...Y--------------------------
A5M4K0_STREE/211-349IGAL...VN------------------------------ILLNCFLI..K...P--------------------------
C9LAR2_BLAHA/325-463IGAI...VN------------------------------LCVNLVLI..P...E--------------------------
Q4K189_STREE/323-460YGAV...VN------------------------------ILINILLI..P...K--------------------------
C4FB42_9ACTN/325-467VGAA...LN------------------------------VAVNVLLI..P...R--------------------------
E0S188_BUTPB/322-462IGAF...VN------------------------------LIINYTFI..G...I--------------------------
C3HRG9_BACTU/323-461LGAI...IS------------------------------LILNIIFI..P...R--------------------------
A7HKJ9_FERNB/322-460AGAI...TN------------------------------FTMNLILI..P...K--------------------------
E4L4W5_9STRE/321-459VGLI...TN------------------------------VIGNIILI..P...I--------------------------
E7S3G0_STRAG/321-459IGLV...AN------------------------------VVLNILLI..P...I--------------------------
E0NHN4_PEDAC/321-459ISAL...VN------------------------------LVLNVPLI..Y...S--------------------------
E6LD53_9ENTE/253-391VGAL...VN------------------------------LFLNVFFI..K...L--------------------------
C2KJQ1_LEUMC/329-467IGAL...AN------------------------------VLLNFWLIYVA....--------------------------
B3XNV8_LACRE/322-460IGAV...VN------------------------------VITNFLFI..A...K--------------------------
B2GDL9_LACF3/322-460AGAV...VN------------------------------IIANLFLI..S...K--------------------------
C0WVB1_LACFE/322-460IGAV...VN------------------------------VIANILLI..P...F--------------------------
A2RHU4_LACLM/321-459IGAV...LN------------------------------ILLNFALI..P...L--------------------------
A1YVF6_LACJH/321-459LGAI...VN------------------------------LSLNVPLI..K...M--------------------------
C2D643_LACBR/210-348VGAV...VN------------------------------IILNFPLI......Y--------------------------
Q3ZK40_9LACT/322-460IAAI...VS------------------------------LITNLILI..P...T--------------------------
D8MET9_LEUGT/321-460AGAI...SN------------------------------IILNLLFI..R...N--------------------------
A3F4D6_LACLC/321-459IGAI...VN------------------------------LMLNIPLI..I...Y--------------------------
D2EJ27_PEDAC/321-459IGAI...VN------------------------------IVINIPFI..L...V--------------------------
O06039_LACLC/321-459CGNL...VN------------------------------VSLNLILL..P...K--------------------------
Q8GPE5_STRTR/321-459ISVI...IS------------------------------LGVSFVLV..P...I--------------------------
D7DRX9_METV3/353-490FGAM...VN------------------------------VILNILLI..P...Q--------------------------
A4FX93_METM5/354-492IGAF...FN------------------------------LTFNLLLI..P...K--------------------------
A6UPA0_METVS/351-488IGAI...FN------------------------------LIFNLILI..P...K--------------------------
A6UU30_META3/353-490FGAT...FN------------------------------LIFNLLLI..P...K--------------------------
D5VU50_METIM/353-494IGAF...FN------------------------------LIFNILLI..P...K--------------------------
D4W1F1_9FIRM/338-485AGIL...VK------------------------------IGLTAPLT..M...E--------------------------
B9DSP4_STRU0/342-480FGLL...LK------------------------------IMLTPILT..Y...Y--------------------------
F1Z193_9STRE/350-488CGLI...LK------------------------------LLLTPIMT..F...H--------------------------
D4YGG7_9LACT/385-532VGML...VK------------------------------GIFTASLV..G...F--------------------------
F2I7P9_AERUA/374-520LGLL...VK------------------------------GVFAHMLV..S...R--------------------------
Q03E00_PEDPA/355-503TGII...IK------------------------------VVLNSWAT..Q...W--------------------------
D2EHX4_PEDAC/355-503AGLC...VK------------------------------VICNGWAV..R...H--------------------------
A0A021WE79_LACPN/357-507AGLA...TK------------------------------VLANYIFV..V...H--------------------------
E7FPH6_9LACO/355-501CGIF...VK------------------------------ACTNVWLI..G...Q--------------------------

PF03023

MURJ_BORBU/29-473IGVI---FG------------------------------GFLQFLIPFAN---C--------------------------
MURJ_RICPR/28-477VSLI---IA------------------------------GILQVVFMFIC---V--------------------------
MURJ_ECOLI/28-479WAVT---VG------------------------------GVLQLVYQLPH---L--------------------------
MURJ_SYNY3/36-495GGTT---AG------------------------------AVLQWLAQIVP---Q--------------------------
MURJ_AQUAE/29-466LAVL---IG------------------------------GLFQIIPNTFL---L--------------------------
MURJ_HAEIN/16-479IGIF---LG------------------------------GLLQFLFQIPF---M--------------------------
MURJ_THEMA/28-450AGFT---IG------------------------------GLAALLVLLPF---G--------------------------
Q9X8T0_STRCO/300-778IGVL---LG------------------------------LIVQSLAMIPY---L--------------------------
MURJ_TREPA/32-489IGVL---IG------------------------------GCAQALFQLIF---V--------------------------
Q9RX17_DEIRA/83-522FGWL---IG------------------------------GVAQLLVQLPA---L--------------------------
MURJ_CHLTR/34-482VVLV---IG------------------------------FILEWAVTLPG---V--------------------------
MURJ_HELPY/2-458YGVL---LG------------------------------GVAQILLHFYP---L--------------------------
MVIN_MYCTU/48-521IGTT---AG------------------------------VFAQTAVLLVA---I--------------------------

PF01554

O51531_BORBU/22-182LFVT.IGFS------------------------------MAGAYNIIATR---Q--------------------------
YOEA_BACSU/28-189LLIS.FTIG------------------------------IGSGSSILIGQ---A--------------------------
YOEA_BACSU/257-418YVQM.PAVS------------------------------LGIAVSIFAAQ---S--------------------------
O66528_AQUAE/245-406ISFM.IGFG------------------------------VMIASTTLAGQ---N--------------------------
YPNP_BACSU/241-402IITL.PAMA------------------------------AGTAVNSMAGQ---N--------------------------
NORM_VIBPA/243-404LVFM.LPMS------------------------------VGAAVSIRVGH---R--------------------------
O80695_ARATH/278-441ISFM.VSVG------------------------------FNAAASVRVSN---E--------------------------
O26414_METTH/244-409LAIV.PVIS------------------------------VATALVSVSGV---A--------------------------
O28801_ARCFU/21-180VFIA.ISFG------------------------------LSVGANSAVSR---R--------------------------
YISQ_BACSU/27-187LIIVMFSF.------------------------------IATGTTVIISQ---F--------------------------
Y709_METJA/243-408FGFI.PMLG------------------------------LASGATSVIGA---T--------------------------
YPNP_BACSU/21-182TVLS.FILG------------------------------LNNATLTILSQ---Q--------------------------
O25454_HELPY/214-375FSFM.PGFG------------------------------FMIAAMVLTGQ---N--------------------------
NORM_BACSU/20-180PVYT.GLAG------------------------------ILMAVTPIVAQ---L--------------------------
HMRM_HAEIN/249-410FIFM.FPMS------------------------------IGMATTILVGQ---A--------------------------
O49660_ARATH/262-426LLYA.VMLS------------------------------LGTCVATRVSN---E--------------------------
O82752_ARATH/42-203ITGYSLLSG------------------------------LSIGMEPICVQ---A--------------------------
DINF_ECOLI/35-196FLFM.LLLF------------------------------LRMSTTGLTAQ---A--------------------------
Q9ZVH5_ARATH/238-401ILYV.VPFA------------------------------ISSAIATRVGH---A--------------------------
O28801_ARCFU/239-404FGFV.PLFG------------------------------VSAALTAVSGA---A--------------------------
Q38956_ARATH/275-438WTAM.IAIG------------------------------MNTAVSVRVSN---E--------------------------
ERC1_YEAST/174-335ITGLAAIQG------------------------------LCTCLDTLCAQ---A--------------------------
Q9ZVH5_ARATH/16-176ITGVSVLKG------------------------------LSVGMDPICGQ---A--------------------------
YAO6_SCHPO/17-177STGWLIALG------------------------------GTTAFDTLGSN---L--------------------------
O82752_ARATH/264-427LIYI.FPSS------------------------------LSISVSTRVGN---E--------------------------
O51429_BORBU/27-187FIIA.IAMG------------------------------MATGSISLMSK---C--------------------------
O83871_TREPA/32-196LYVT.ALMT------------------------------VSNAGSVFMTQ---Y--------------------------
O51429_BORBU/248-409FLFL.PAMG------------------------------IGTGIISIVGQ---N--------------------------
YISQ_BACSU/252-413FILL.FGTA------------------------------ISQGTQILIGR---Y--------------------------
O66528_AQUAE/25-183FIYS.LMAL------------------------------SYSGTNILIAQ---F--------------------------
O51530_BORBU/21-181LFFI.IVFG------------------------------LGTALSAYVSQ---A--------------------------
Y709_METJA/21-181SIYA.VSWG------------------------------LSIGISSGIAR---R--------------------------
NORM_BACSU/247-408LLYM.LPLS------------------------------VSMALTIVVGF---E--------------------------
NORM_VIBPA/17-176PSIL.FGIG------------------------------LLMALVPVVAQ---L--------------------------
O26414_METTH/24-183ILVG.LSNG------------------------------LGAGAASSVSR---C--------------------------
HMRM_HAEIN/22-181PLMF.FGQG------------------------------LLLALPPTISY---L--------------------------
YD338_YEAST/238-397ITLA.IFEG------------------------------IATSLDTLCPQ---A--------------------------
MDTK_ECOLI/17-177PAIL.FGHG------------------------------LLLALTPVIAQ---L--------------------------
Q38956_ARATH/55-215GFSFGIMLG------------------------------MGSALETLCGQ---A--------------------------
P71616_MYCTU/19-179LVGS.QATF------------------------------LSYGTTARAAR---R--------------------------
O49660_ARATH/40-200VTGFSVLYG------------------------------ISAAMEPICGQ---A--------------------------
O80695_ARATH/57-217MFTYGLLLG------------------------------MGSAVETLCGQ---A--------------------------
MDTK_ECOLI/244-405LMFV.LPMS------------------------------LAAAVTIRVGY---R--------------------------
F4IHU9_ARATH/37-197VTGFTFLMG------------------------------TASAMDTVCGQ---S--------------------------
O25796_HELPY/23-184GLIA.YELL------------------------------FGFGAASIVGY---F--------------------------
YEEO_ECOLI/48-208VIMA.FFAA------------------------------IDLGTTVVVAF---S--------------------------
Q8DNG1_STRR6/24-183LIVG.FTLG------------------------------VGNGMGIVIAR---Y--------------------------

PF07260

G1KED7_ANOCA/1-345VAGA---IA------------------------------AIFHTLIAYSDLGYY--------------------------
I3JFW4_ORENI/1-349AAGA---IA------------------------------FILHILIAYTDLGYY--------------------------
F1Q528_DANRE/1-344VAGV---IA------------------------------IILHVLIAYTDLGYY--------------------------

PF01943

SP5B_BACSU/6-308LTIT---GV------------------------------LSLIFTPLFL--FFAPV........MA--------------
EXOT_RHIME/10-277AIAL---MM------------------------------ALGLFVFAEP--LAT............--------------
TUAB_BACSU/10-277MTGV---LL------------------------------FVLLYVSSPV--IAG............--------------
RFBX_ECOLI/8-279IFSK---IV------------------------------LIVITLIFLT--S.M............--------------
O26447_METTH/15-286MVTK---TI------------------------------LLAVTFMAML--V.T............--------------
YTGP_BACSU/5-320MSVM---LV------------------------------TGMIAFFILY--LSAPMFAEISLGGKD--------------
Y1068_METJA/7-302ILAF---IV------------------------------AFLVVIFAPY--IAEFYIN....NQGQ--------------
Y1375_METJA/3-283YLMI---LL------------------------------SVVGFILTPY--IKY............--------------
O26479_METTH/10-276IILS---CI------------------------------VFVLILLFPL--T.G............--------------
O29660_ARCFU/6-285LLVL---AV------------------------------ASMLFLGSDF--IAE...........Q--------------
O26467_METTH/18-289MLIK---GI------------------------------LATLSFCILL--L.V............--------------
O26442_METTH/7-278VFLK---IP------------------------------LSILTFVLIA--VLA...........W--------------
YABM_BACSU/12-309LFLS---LI------------------------------GILLFLCLYL--GAVPI........AL--------------
WZXC_ECOLI/9-276GLGI---VV------------------------------CVAVFLLSDL--IGD............--------------
Q2K5A6_RHIEC/11-272TRSA---IL------------------------------ALLFAAASYP--IAE............--------------
Q32EG2_SHIDS/2-269LIVK---LL------------------------------LATICLALGC--V.H............--------------
Q8DZE2_STRA5/6-273FSVG---NI------------------------------WFLIVLLIAF--LFR............--------------
Q8P805_XANCP/25-289GIGL---ML------------------------------SVVVFATAHW--IAD............--------------

PF13440

A8UQ25_9FLAO/16-256SARL---TL------------------------------S...........LFL--------------------------
B5JNG5_9BACT/22-272KTFI---KI------------------------------ILPTIAPIPV..LSI--------------------------
D0YZQ3_LISDA/18-261LQSW---IV------------------------------SAAYIFVVSY...FF--------------------------
D2BRK8_DICD5/18-261LQSL---IV------------------------------AVPYAV......LTA--------------------------
B1IZZ3_ECOLC/18-261LQSA---IL------------------------------ALPYAL......LTA--------------------------
D0I1Y2_VIBCL/18-260MTRF---FV------------------------------FAVLLALVSL....L--------------------------
D0HB98_VIBMI/18-260KVRF---LI------------------------------VVPVTIFIIL....I--------------------------
A9AXJ4_HERA2/36-280QIAW---GI------------------------------GAASAGVCTGLAAFW--------------------------
A4EAS6_9ACTN/45-291LNRW---LC------------------------------GALALACGLV...YS--------------------------
Q2YCG5_NITMU/22-272RIML---LS------------------------------FIGMLCVFAI..SYP--------------------------
B9JQS0_AGRRK/94-340VFAI---CV------------------------------SGVAGAILDSAIMDQ--------------------------
C2KV49_9FIRM/32-288GLAL---IL------------------------------AVLFLLFQYG..SGL--------------------------
C8XCC3_NAKMY/40-272LTSL---CL------------------------------LVTVAVFAL...TRD--------------------------
Q3K9H6_PSEPF/12-266LLYL---AV------------------------------GLALSVLTVV....I--------------------------
O58733_PYRHO/24-253GISF---LS------------------------------PLLGLVLMPI.....--------------------------
C8KY87_9PAST/18-266ILSA---VV------------------------------AALSCLLFDF..TAF--------------------------
C5RZU1_9PAST/18-266ILSA---VV------------------------------AALSCLLFDF..TAF--------------------------
Q1D7B4_MYXXD/29-283AMGL---VG------------------------------AGAVWALLGY..VAG--------------------------
C4WNX8_9RHIZ/31-284TAGF---LV------------------------------AILVSLPLFA..LAS--------------------------
A6X6T8_OCHA4/16-269TAGF---LV------------------------------ALLVSLPLFA..LAS--------------------------
B1M5Z3_METRJ/17-264GGTL---LL------------------------------AGLGSALAAA..LGL--------------------------
A1UCH8_MYCSK/30-289VATA---LL------------------------------SMASAPAVAV..IAT--------------------------
A3PW68_MYCSJ/30-289VATA---LL------------------------------SMASAPAVAV..IAT--------------------------
Q89SM5_BRADU/14-269FSAG---LL------------------------------SALVLLLVGS.....--------------------------
Q2CIK8_OCEGH/14-260NVAF---CF------------------------------VGAALLALSM.....--------------------------
C7LVX3_DESBD/8-264RSHW---RF------------------------------GGAACLFFLVLHLGF--------------------------
A4FEI7_SACEN/8-256VGGW---AL------------------------------LFAAGCGAGL.....--------------------------
C5ATW3_METEA/42-293LVHE---AA------------------------------FLALAGGAVA..IGL--------------------------
A9VW94_METEP/42-293LVHE---AA------------------------------FLTLAGGAVA..IGL--------------------------
B7KU42_METC4/42-293LVHE---AA------------------------------FLTLAGGAVA..IGL--------------------------
C7C8V6_METED/42-293LVHE---AA------------------------------FLTLAGGAVA..IGL--------------------------
C8XCR8_NAKMY/39-289GATI---AL------------------------------GVVAGILTAA..TGL--------------------------
Q0RPT3_FRAAA/322-573GTAF---VI------------------------------GLLSGAVTLV..VGL--------------------------
D3CWT1_9ACTO/203-455GACL---AF------------------------------GAVLSLPTVL..VGF--------------------------
Q0RCF1_FRAAA/179-430GSSF---VF------------------------------GIGIGVGFVG..VGL--------------------------
D2PZ16_KRIFD/24-275ATAF---LA------------------------------GVAAMLVGLL..IAA--------------------------
Q8KN00_9ACTO/40-289GTSL---VV------------------------------GAGVGTLCLA..LWP--------------------------
D6EG66_STRLI/34-283GAAL---LV------------------------------GAGIGTVSLV..AGL--------------------------
A8UIN6_9FLAO/18-257TLSR---SP------------------------------LLLLSLLFFV.....--------------------------
M1I249_9CREN/28-278LLNL---IT------------------------------GAISSLIYVV..LTP--------------------------
A6Q4F3_NITSB/16-266ISFW---GL------------------------------FIITCCFEII..YYN--------------------------
B8CST1_SHEPW/46-301LILM---VL------------------------------LTWGIVLPYI....K--------------------------
A6FGK5_9GAMM/27-282LITM---VL------------------------------ITWGVVIPYI....K--------------------------
Q8EFK4_SHEON/24-279LIAM---VL------------------------------LAWGVVLPYI....K--------------------------
A6WPP6_SHEB8/25-280LIAM---VL------------------------------LTWGLVLPYI....K--------------------------
A1RKH9_SHESW/25-280LIAM---VL------------------------------LTWGLVLPYI....K--------------------------
A4Y617_SHEPC/25-280LIAM---VL------------------------------LTWGLVLPYI....K--------------------------
E6XI49_SHEP2/25-280LIAM---VL------------------------------LTWGLVLPYI....K--------------------------
A6VTF9_MARMS/19-265IGSV---LF------------------------------LFFVFIVVYV.....--------------------------
B9EAW7_MACCJ/18-258FYTV---FM------------------------------FITYFIILVL.....--------------------------

PF04506

RFT1_CANGA/9-542LSIG---LI...AWQ..YH.NINGYFVTLPFFQWSVFA.IWVGIILELVNEPLFVLNQHFLNYGAR........SRYESI
E9IWP9_SOLIN/8-542MSFF---FG..YIWL..FL.LSTTEALPPY.YTFAVWA.VGLSCVIELSSLVVQLAASAFLFVRLK........IILDTI
S9VRB9_SCHCR/24-535VSIL---VA...FFY.......MYAMPIFPYKTICILL.YSFAGFLYLLSEPYYQILHWRRQFSPT........ASAEGL
C5E2W4_LACTC/16-558LSLV---LI...GWQ..YS.NLNEYFLSLPYFKLSIAM.IWLSIIFELLNEPFFVVNQLMLNYKVR........SQLESI
E9EIH0_METAQ/28-566VSTG---LG....WI.YLA.CANESILQTPYLVHSLYL.YGLAAMVELLSEPCFVLMQRRLQFGTR........ATAESA
G8BWS7_TETPH/20-558LSIV---LT...TWQ..YN.NVNSFFVSLPYFTTSIFL.IWISILIELLSEPFYVVNQFMLNFGTR........SKFETI
H2ASC3_KAZAF/14-533LSIV---LT...VWQ..YN.NINSYFVNLPFFNWSILI.IWLSGLLELLSEPFFILNQFMLNYSKR........SKFESL
RFT1_YARLI/102-645FSSV---AA............ASHSLFSVAYASWAVQL.VCIAAMVDLASEPYYVLAMQQLRFRSR........AAAEAV
RFT1_SCHPO/10-520ISLL---VS...LFY.......FYSLPNFPYSKTCIFI.YTVSSFIELLSEPYYEVLQWRQKFSKT........ASAEGL
I2GX14_TETBL/21-581LSIG---LI...SWQ..YR.NVNSYFVGLPFFTWSIFL.IWASIIIELLSEPFFIVNQFFLNYGTR........SCFESI
A7TRS5_VANPO/18-551LSIV---LI...TWQ..YT.NVNAYFISLPHFQLSIFL.IWISIIIELLSEPFFVVNQFMLNYGLR........SRFEGI
J7R8K9_KAZNA/27-584LSLI---LT...TWQ..YR.NINEYFVQLPHFTMSICI.IWAACILELMCEPFLVVTQIAMDYAKR........SKLESI
M2PSW7_CERS8/12-528TAIL---AT...LLY..LK.TASSTTTSQPHFRLAVVI.YALAALFELLSEPLYVRAQNELRVDVR........VRAEGA
RFT1_CAEEL/2-516ISVV---CV..YLWYAFSS.TSDE.......VSWSVLLSFPISAIIESIAEPFSVIS...LRLESKCGSLAQHFAIGQGM
G8ZPN0_TORDC/18-550LSIV---LI...TWQ..YR.NISNYFIGLPYFTWSIFL.IWLSIIVELLSEPLFIVNQFMLNYGKR........SQFESI
C4R7X1_PICPG/21-528FSSI---LI...YTQ.FIR.QQNAAVLQSPLFRYSVGF.MWLSVIIELLSEPLYNINQYDLDIKTR........SKIESF
H9KBA9_APIME/8-516MSLM---FG..YIWL..SV.LSTSETLPSY.YTFAVWA.VALSCIIELSSLIVQLVASAFLFVRLK........IILDTI
U5D209_AMBTC/17-521LTIA---ACSFVLWW..QS.LNLSGK.....YAQAVLI.HGFACILEILAEPLYILAQNMLLFGLR........LKVETA
G0W6B8_NAUDC/22-586LSIV---LT...TWQ..YK.NINGYFINLPFFQVSILL.IWISIIVELLSEPFFIINQFMLNYSSR........SRIESL
E2AM70_CAMFO/8-540MSFL---FG..YIWL..FL.LSTAEALPPY.YTFAVWA.VGLSCIIELSSLIVQLVANAFLFVRLK........IILDTI
E9GUV5_DAPPU/9-536CSLT---FC..YIWL..HL.LELPADKYVADYKFAVYM.FGASCTIESFVEPVYIFSQAFQYVRWR........IFVDCV
D8M9P3_BLAHO/10-506ISIV---TS..LIWL..YV.LPDP...QVAFYKQSIFV.FALSSIIALCSEVGYVLTQMTLHTNVK........VFVEST
F4K836_ARATH/105-602ITIA---ACIFVLWW..QN.LSYSDP.....YAQAIWI.HGFACVLELMAEPLYILSQTLLKLQLR........LIVETV
U4LAR2_PYROM/52-567FSGV---LG.WSYWR.......GSEVGQLPWGKEAVGL.YVLATIFELASEPGFALGQAGLRYKLR........AGAESA
RFT1_DROME/8-549LCAP---CL..YIWL..NW.LSAVDAIYASQYEFACYA.VAFSCVLELMAESAVFVAQVFCFVKLK........ILLNTL
G8BFC9_CANPC/25-545VTLL---VG...YYQGIKSVNFQDFFLILPFNKIAIGV.LFSSTILELSIEPIYCVYQYELEFGKR........SKFEGI
M3BX75_SPHMS/8-530IVLA---LA...QWY......LTTSLPDVPYFVESLRI.YQLAAVIELLSEPAFVAVQQNMLYKSR........AAAEAS
W4Z9M3_STRPU/12-532CATI---LS..YVWI..AL.LSQPDPNIVPHYNTSVLV.FAFSAVIELVAEPFWVVGQAMLFVRLK........VVIEGI
RFT1_ASHGO/11-543LAVV---LA...VWQ..YS.NLNSYFTQLPFFSWSIYL.VLLSILAELASEPLYVVNQFMLNYRKR........SQFEGA
M3K0B3_CANMX/13-532LSVI---LPIIGYWQFQYS.SVIASLYSLPYHQLTILL.VVLSIVVEMVIEPIYCLYQFQLDFGKR........SKFEGL
G8JV96_ERECY/11-550LALV---LM...AWQ..YS.NINEYFIELPFFSWSIFF.IFVGILAELFSEPLYIVNQFMLNYKTR........SEIEGL
G0V9M8_NAUCC/17-571LSIV---LT...TWQ..YR.NINAYFVTLPFFTWSILL.IWCSIIIELLSEPFFIVNQFLLNYSTR........SSFESA
H9J737_BOMMO/8-547LSIV---FV..YIWL..NW.LPLGNPEHAYQYTFGCWS.VAFSCVLELCSANLALVAQHFCFIKLK........IVLDTL
R4XDT4_TAPDE/6-505ISSV---LS...AAY..IS.RAPDESRRIDYFTSTVSI.YAFSTIIELLSEPGYNVALHKLRYKVR........ASCEGL
RFT1_YEAST/18-565LSIG---LI...AWQ..YR.NINAYFITLPFFRWSIFL.IWLSIIVELLSEPFFIVNQFMLNYAAR........SRFESI

PF14667

Q03SZ7_LACBA/349-498--------------------------------------------------------------------------------
Q38V74_LACSS/358-503--------------------------------------------------------------------------------
B3WAP5_LACCB/356-499--------------------------------------------------------------------------------
A8UAN8_9LACT/362-510--------------------------------------------------------------------------------
D0BM46_9LACT/359-506--------------------------------------------------------------------------------
C8NI78_9LACT/366-514--------------------------------------------------------------------------------
C0WQN7_LACBU/354-501--------------------------------------------------------------------------------
C2EHH6_9LACO/356-502--------------------------------------------------------------------------------
E6LEY4_9ENTE/358-506--------------------------------------------------------------------------------
C9A420_ENTGA/359-508--------------------------------------------------------------------------------
C2HEH9_ENTFC/359-507--------------------------------------------------------------------------------
C0X942_ENTFL/359-507--------------------------------------------------------------------------------
E0RUK9_BUTPB/373-516--------------------------------------------------------------------------------
C5Q1B2_STAAU/332-469--------------------------------------------------------------------------------
E7MM58_9FIRM/379-526--------------------------------------------------------------------------------
E4LZJ6_9CLOT/384-531--------------------------------------------------------------------------------
D4W2K6_9FIRM/377-526--------------------------------------------------------------------------------
D5E4C9_BACMQ/373-523--------------------------------------------------------------------------------
B7JJF5_BACC0/376-524--------------------------------------------------------------------------------
Q8EP19_OCEIH/372-521--------------------------------------------------------------------------------
B1YKH1_EXIS2/386-534--------------------------------------------------------------------------------
D6Y0K7_BACIE/382-530--------------------------------------------------------------------------------
Q5WE75_BACSK/374-522--------------------------------------------------------------------------------
E6U1Q3_BACCJ/375-523--------------------------------------------------------------------------------
D3FXP2_BACPE/374-522--------------------------------------------------------------------------------
A4IRX9_GEOTN/371-520--------------------------------------------------------------------------------
D5DN36_BACMD/374-521--------------------------------------------------------------------------------
A7Z7U6_BACA2/375-524--------------------------------------------------------------------------------
A0RJU4_BACAH/372-520--------------------------------------------------------------------------------
E7RE43_9BACL/368-516--------------------------------------------------------------------------------
A3I8W7_9BACI/372-521--------------------------------------------------------------------------------
A6CQJ8_9BACI/372-520--------------------------------------------------------------------------------
D3UNL4_LISSS/370-518--------------------------------------------------------------------------------
B8DHB8_LISMH/370-518--------------------------------------------------------------------------------
A0A008APY8_STAAU/386-533--------------------------------------------------------------------------------
B9E7H2_MACCJ/374-522--------------------------------------------------------------------------------
D5T1U4_LEUKI/363-511--------------------------------------------------------------------------------
Q03XR0_LEUMM/330-477--------------------------------------------------------------------------------
A0NHL2_OENOE/387-534--------------------------------------------------------------------------------
B1MY12_LEUCK/485-634--------------------------------------------------------------------------------
C2KKY7_LEUMC/498-647--------------------------------------------------------------------------------
C0WLU0_LACBU/374-518--------------------------------------------------------------------------------
C2EP42_9LACO/342-483--------------------------------------------------------------------------------
A0A038C172_ENTFL/370-519--------------------------------------------------------------------------------
C5RB06_WEIPA/501-648--------------------------------------------------------------------------------
A8UCR2_9LACT/391-539--------------------------------------------------------------------------------
A2RMM4_LACLM/390-539--------------------------------------------------------------------------------
C9A2J3_ENTGA/381-529--------------------------------------------------------------------------------
E6LIJ6_9ENTE/381-529--------------------------------------------------------------------------------
A0A037ZTL3_ENTFL/382-530--------------------------------------------------------------------------------
C2H7P1_ENTFC/381-529--------------------------------------------------------------------------------
A4VW05_STRSY/379-527--------------------------------------------------------------------------------
E3CI47_STRDO/375-523--------------------------------------------------------------------------------
A5LCT3_STREE/372-520--------------------------------------------------------------------------------
A3CPL5_STRSV/375-523--------------------------------------------------------------------------------
A2RG74_STRPG/377-525--------------------------------------------------------------------------------
E8K660_STRPA/410-558--------------------------------------------------------------------------------
B1SH45_9STRE/377-525--------------------------------------------------------------------------------
C2LQ70_STRSL/432-580--------------------------------------------------------------------------------
C6SP25_STRMN/377-525--------------------------------------------------------------------------------
B3W6R7_LACCB/364-511--------------------------------------------------------------------------------
A5VL26_LACRD/382-530--------------------------------------------------------------------------------
D2ELV8_PEDAC/393-541--------------------------------------------------------------------------------
C0WUG9_LACBU/378-530--------------------------------------------------------------------------------
Q03RI1_LACBA/378-525--------------------------------------------------------------------------------
C2EED2_9LACO/381-529--------------------------------------------------------------------------------
Q38VP9_LACSS/378-526--------------------------------------------------------------------------------
C8PCY7_9LACO/375-523--------------------------------------------------------------------------------
D0DXL5_9LACO/375-523--------------------------------------------------------------------------------
C2E7U4_LACJH/384-532--------------------------------------------------------------------------------
C2KAZ9_9LACO/380-528--------------------------------------------------------------------------------
B3WCD6_LACCB/380-528--------------------------------------------------------------------------------
D0BKY7_9LACT/390-538--------------------------------------------------------------------------------
C8NE09_9LACT/413-561--------------------------------------------------------------------------------
E4KNA5_9LACT/790-938--------------------------------------------------------------------------------
D4YJ56_9LACT/433-583--------------------------------------------------------------------------------
E0IFR0_9BACL/366-514--------------------------------------------------------------------------------
E0RCM4_PAEP6/382-529--------------------------------------------------------------------------------
C6J0R0_9BACL/364-511--------------------------------------------------------------------------------
E5Z458_9BACL/362-509--------------------------------------------------------------------------------
C0Z9G8_BREBN/364-513--------------------------------------------------------------------------------
C4GB38_9FIRM/387-530--------------------------------------------------------------------------------
A8RUL6_CLOBW/387-539--------------------------------------------------------------------------------
E6LN70_9FIRM/381-525--------------------------------------------------------------------------------
C7GE86_9FIRM/383-527--------------------------------------------------------------------------------
E3GGE0_EUBLK/365-508--------------------------------------------------------------------------------
E6MGM4_9FIRM/373-516--------------------------------------------------------------------------------
B8D0L3_HALOH/359-505--------------------------------------------------------------------------------
C6PQD8_9CLOT/131-275--------------------------------------------------------------------------------
C8VXJ1_DESAS/366-509--------------------------------------------------------------------------------
D9QSV7_ACEAZ/363-507--------------------------------------------------------------------------------
B2A8K9_NATTJ/363-507--------------------------------------------------------------------------------
A8MK38_ALKOO/363-506--------------------------------------------------------------------------------
A5D2G5_PELTS/358-502--------------------------------------------------------------------------------
D5X9J9_THEPJ/361-503--------------------------------------------------------------------------------
B2A2Z4_NATTJ/361-504--------------------------------------------------------------------------------
C7GYH1_9FIRM/373-517--------------------------------------------------------------------------------
A6TN15_ALKMQ/363-506--------------------------------------------------------------------------------
A8MIG9_ALKOO/365-508--------------------------------------------------------------------------------
Q67JD5_SYMTH/384-522--------------------------------------------------------------------------------
C4FNY8_9FIRM/361-503--------------------------------------------------------------------------------
D3LVV9_9FIRM/358-500--------------------------------------------------------------------------------
E2ZD67_9FIRM/360-502--------------------------------------------------------------------------------
C9LLX4_9FIRM/363-506--------------------------------------------------------------------------------
D3LX29_9FIRM/358-500--------------------------------------------------------------------------------
C4FPR1_9FIRM/359-501--------------------------------------------------------------------------------
A1HLQ5_9FIRM/371-513--------------------------------------------------------------------------------
C4V2B6_9FIRM/374-517--------------------------------------------------------------------------------
E8LB44_9FIRM/369-509--------------------------------------------------------------------------------
C0WBK9_9FIRM/378-517--------------------------------------------------------------------------------
B7DPH6_9BACL/373-525--------------------------------------------------------------------------------
C0ZHE2_BREBN/367-517--------------------------------------------------------------------------------
C2YMP0_BACCE/352-495--------------------------------------------------------------------------------
B7GMA5_ANOFW/366-505--------------------------------------------------------------------------------
E7RL93_9BACL/356-500--------------------------------------------------------------------------------
D3FZH8_BACPE/357-501--------------------------------------------------------------------------------
B0MPG6_9FIRM/391-534--------------------------------------------------------------------------------
B0PEA8_9FIRM/441-584--------------------------------------------------------------------------------
A7VWY4_9CLOT/433-577--------------------------------------------------------------------------------
E6TRQ4_BACCJ/362-512--------------------------------------------------------------------------------
D5WSL0_KYRT2/373-521--------------------------------------------------------------------------------
B1YGP9_EXIS2/345-491--------------------------------------------------------------------------------
C5RD31_WEIPA/359-505--------------------------------------------------------------------------------
Q8EU30_OCEIH/362-509--------------------------------------------------------------------------------
B9E8U7_MACCJ/341-481--------------------------------------------------------------------------------
Q49V13_STAS1/337-479--------------------------------------------------------------------------------
B9CVC4_STACP/347-489--------------------------------------------------------------------------------
C2M158_STAHO/360-502--------------------------------------------------------------------------------
D3QG68_STALH/343-485--------------------------------------------------------------------------------
E8SIP0_STAPH/344-486--------------------------------------------------------------------------------
A0A008AT25_STAAU/343-485--------------------------------------------------------------------------------
F2F183_SOLSS/360-508--------------------------------------------------------------------------------
A3IEA1_9BACI/365-514--------------------------------------------------------------------------------
E7RLD1_9BACL/354-503--------------------------------------------------------------------------------
A0AF13_LISW6/361-504--------------------------------------------------------------------------------
D7UUI0_LISGR/356-499--------------------------------------------------------------------------------
A6CR25_9BACI/352-499--------------------------------------------------------------------------------
E5WT44_9BACI/362-510--------------------------------------------------------------------------------
Q2B249_9BACI/362-508--------------------------------------------------------------------------------
A8F924_BACP2/360-506--------------------------------------------------------------------------------
E5WAE4_9BACI/356-502--------------------------------------------------------------------------------
A7Z0I0_BACA2/354-499--------------------------------------------------------------------------------
D4G3E4_BACNB/359-505--------------------------------------------------------------------------------
D5D970_BACMD/362-511--------------------------------------------------------------------------------
B7GFI4_ANOFW/350-497--------------------------------------------------------------------------------
A4IJD3_GEOTN/352-496--------------------------------------------------------------------------------
C5D378_GEOSW/360-505--------------------------------------------------------------------------------
Q5WAF7_BACSK/347-496--------------------------------------------------------------------------------
D3FR13_BACPE/361-509--------------------------------------------------------------------------------
Q9KGJ0_BACHD/361-507--------------------------------------------------------------------------------
D6XV50_BACIE/360-507--------------------------------------------------------------------------------
D3E759_GEOS4/381-532--------------------------------------------------------------------------------
E0RM54_PAEP6/373-525--------------------------------------------------------------------------------
A7GJW7_BACCN/360-506--------------------------------------------------------------------------------
B5UWQ0_BACCE/360-510--------------------------------------------------------------------------------
D2BMG7_LACLK/323-465--------------------------------------------------------------------------------
B8IEZ7_METNO/324-461--------------------------------------------------------------------------------
C7NM90_HALUD/327-463--------------------------------------------------------------------------------
A6DHF1_9BACT/293-436--------------------------------------------------------------------------------
Q47U72_COLP3/338-481--------------------------------------------------------------------------------
B4AGJ7_BACPU/343-486--------------------------------------------------------------------------------
Q1K412_DESAC/351-495--------------------------------------------------------------------------------
C0QCL2_DESAH/352-496--------------------------------------------------------------------------------
Q2YCG5_NITMU/323-466--------------------------------------------------------------------------------
E6QMG7_9ZZZZ/367-517--------------------------------------------------------------------------------
F2G999_ALTMD/323-467--------------------------------------------------------------------------------
C6JQC3_FUSVA/323-462--------------------------------------------------------------------------------
E5X0H2_9BACE/326-464--------------------------------------------------------------------------------
A3DHV8_CLOTH/327-465--------------------------------------------------------------------------------
B5CWR8_BACPM/324-466--------------------------------------------------------------------------------
F1VXT7_9BURK/320-462--------------------------------------------------------------------------------
Q2YCC1_NITMU/331-475--------------------------------------------------------------------------------
Q0AHL3_NITEC/325-466--------------------------------------------------------------------------------
D4YX22_SPHJU/336-476--------------------------------------------------------------------------------
Q1GPL1_SPHAL/342-484--------------------------------------------------------------------------------
B0VF98_CLOAI/326-465--------------------------------------------------------------------------------
A1S103_THEPD/335-472--------------------------------------------------------------------------------
E8R8C0_DESM0/349-487--------------------------------------------------------------------------------
A3DIV8_CLOTH/358-500--------------------------------------------------------------------------------
F2JLQ5_CELLD/355-497--------------------------------------------------------------------------------
A7VPC0_9CLOT/355-497--------------------------------------------------------------------------------
A8SAU1_9FIRM/356-502--------------------------------------------------------------------------------
A6TSY6_ALKMQ/375-519--------------------------------------------------------------------------------
A6NPI5_9FIRM/351-494--------------------------------------------------------------------------------
B0K3R2_THEPX/360-504--------------------------------------------------------------------------------
B7AQB6_9FIRM/351-493--------------------------------------------------------------------------------
D3AN52_9CLOT/376-519--------------------------------------------------------------------------------
B0TAY6_HELMI/361-505--------------------------------------------------------------------------------
Q3ADH7_CARHZ/346-484--------------------------------------------------------------------------------
E0RMQ1_PAEP6/366-508--------------------------------------------------------------------------------
C0ZAP4_BREBN/363-505--------------------------------------------------------------------------------
D7WQC4_9BACI/353-489--------------------------------------------------------------------------------
C8WQG9_ALIAD/361-502--------------------------------------------------------------------------------
B7DPL3_9BACL/356-497--------------------------------------------------------------------------------
D5QEL1_KOMHA/351-483--------------------------------------------------------------------------------
A9WAD6_CHLAA/337-475--------------------------------------------------------------------------------
E1IEK9_9CHLR/380-529--------------------------------------------------------------------------------
B9JKJ2_AGRRK/321-464--------------------------------------------------------------------------------
Q2Y4J6_9ARCH/377-524--------------------------------------------------------------------------------
E8V165_TERSS/339-475--------------------------------------------------------------------------------
B8IGJ3_METNO/336-472--------------------------------------------------------------------------------
D7BDH0_MEISD/336-473--------------------------------------------------------------------------------
F2NKF2_MARHT/337-483--------------------------------------------------------------------------------
D8J725_HALJB/340-478--------------------------------------------------------------------------------
B8D178_HALOH/340-478--------------------------------------------------------------------------------
C4RGH8_9ACTO/364-502--------------------------------------------------------------------------------
Q18GU8_HALWD/357-496--------------------------------------------------------------------------------
Q469G3_METBF/349-484--------------------------------------------------------------------------------
C5A2Y0_THEGJ/342-480--------------------------------------------------------------------------------
F0LLW6_THEBM/342-478--------------------------------------------------------------------------------
F2KQE3_ARCVS/343-481--------------------------------------------------------------------------------
F0LLZ4_THEBM/339-477--------------------------------------------------------------------------------
Q5JDW0_THEKO/345-480--------------------------------------------------------------------------------
A1BJ49_CHLPD/337-476--------------------------------------------------------------------------------
B3EHD9_CHLL2/365-504--------------------------------------------------------------------------------
Q3APG3_CHLCH/338-477--------------------------------------------------------------------------------
B4SBS0_PELPB/338-477--------------------------------------------------------------------------------
Q3B6G9_PELLD/337-476--------------------------------------------------------------------------------
A4SCQ1_PROVI/337-476--------------------------------------------------------------------------------
D8PBA0_9BACT/336-473--------------------------------------------------------------------------------
D3SSH7_NATMM/337-474--------------------------------------------------------------------------------
B6IYF6_RHOCS/343-484--------------------------------------------------------------------------------
D0LQE6_HALO1/374-513--------------------------------------------------------------------------------
D2RVV2_HALTV/336-474--------------------------------------------------------------------------------
D3STC0_NATMM/337-475--------------------------------------------------------------------------------
D8J472_HALJB/339-477--------------------------------------------------------------------------------
D2RXY9_HALTV/340-478--------------------------------------------------------------------------------
E7QQ57_9EURY/339-477--------------------------------------------------------------------------------
C7P069_HALMD/318-461--------------------------------------------------------------------------------
C7NSR3_HALUD/331-469--------------------------------------------------------------------------------
Q5V4U1_HALMA/327-465--------------------------------------------------------------------------------
D8J7W8_HALJB/319-457--------------------------------------------------------------------------------
C7NSL6_HALUD/319-457--------------------------------------------------------------------------------
E4NUG7_HALBP/319-458--------------------------------------------------------------------------------
AGL15_HALVD/319-457--------------------------------------------------------------------------------
Q12VM9_METBU/345-483--------------------------------------------------------------------------------
A3CVY7_METMJ/333-471--------------------------------------------------------------------------------
A2STD2_METLZ/331-469--------------------------------------------------------------------------------
A5UQJ1_ROSS1/330-463--------------------------------------------------------------------------------
D3FFB8_CONWI/338-471--------------------------------------------------------------------------------
D8GMK0_CLOLD/327-460--------------------------------------------------------------------------------
F0KAR0_CLOAE/326-458--------------------------------------------------------------------------------
D5XD05_THEPJ/326-457--------------------------------------------------------------------------------
Q2NIB6_METST/328-458--------------------------------------------------------------------------------
F0T719_METSL/333-463--------------------------------------------------------------------------------
Q2NH55_METST/331-464--------------------------------------------------------------------------------
E3GZ73_METFV/328-459--------------------------------------------------------------------------------
A5UNI7_METS3/328-460--------------------------------------------------------------------------------
F0TC71_METSL/328-460--------------------------------------------------------------------------------
Q12XY4_METBU/326-458--------------------------------------------------------------------------------
Q46FX4_METBF/329-461--------------------------------------------------------------------------------
F0TBQ9_METSL/329-463--------------------------------------------------------------------------------
Q0W809_UNCMA/331-464--------------------------------------------------------------------------------
D1Z261_METPS/328-462--------------------------------------------------------------------------------
O26442_METTH/329-460--------------------------------------------------------------------------------
A5UWW7_ROSS1/374-505--------------------------------------------------------------------------------
E1IAS8_9CHLR/378-523--------------------------------------------------------------------------------
D5UPU7_TSUPD/350-482--------------------------------------------------------------------------------
Q97AA3_THEVO/339-476--------------------------------------------------------------------------------
Q2S953_HAHCH/328-463--------------------------------------------------------------------------------
F2NHK3_DESAR/367-498--------------------------------------------------------------------------------
A3W1Y0_9RHOB/329-468--------------------------------------------------------------------------------
C4XGJ8_DESMR/335-465--------------------------------------------------------------------------------
A9EQ86_SORC5/331-462--------------------------------------------------------------------------------
B9K2D6_AGRVS/332-468--------------------------------------------------------------------------------
E3FNG9_STIAD/347-485--------------------------------------------------------------------------------
B6YVL8_THEON/328-461--------------------------------------------------------------------------------
E0I7A7_9BACL/353-491--------------------------------------------------------------------------------
D5DY76_BACMQ/331-468--------------------------------------------------------------------------------
D7E977_METEZ/332-466--------------------------------------------------------------------------------
A1ASY9_PELPD/345-481--------------------------------------------------------------------------------
D7D534_GEOSC/329-466--------------------------------------------------------------------------------
E8RTH0_ASTEC/331-467--------------------------------------------------------------------------------
Q0AP11_MARMM/327-464--------------------------------------------------------------------------------
E7RZY6_9BURK/339-474--------------------------------------------------------------------------------
Q12TY8_METBU/325-459--------------------------------------------------------------------------------
D9PYX0_METTM/350-483--------------------------------------------------------------------------------
F0TB30_METSL/351-484--------------------------------------------------------------------------------
F0EKD4_ENTCA/327-465--------------------------------------------------------------------------------
Q5M4A4_STRT2/55-193--------------------------------------------------------------------------------
F0HVE0_LACDL/327-469--------------------------------------------------------------------------------
E4SMU5_LACAR/327-469--------------------------------------------------------------------------------
D4LGF1_9FIRM/327-469--------------------------------------------------------------------------------
A5ZUX1_9FIRM/326-464--------------------------------------------------------------------------------
D5TQD2_BACT1/321-460--------------------------------------------------------------------------------
A0A016CGV6_BACFG/328-466--------------------------------------------------------------------------------
E8JWJ5_STRCR/327-467--------------------------------------------------------------------------------
Q4JZ09_STREE/330-470--------------------------------------------------------------------------------
E6MFC3_9FIRM/328-466--------------------------------------------------------------------------------
E9RY62_9FIRM/330-468--------------------------------------------------------------------------------
C5NWI0_9BACL/318-458--------------------------------------------------------------------------------
A1ILY9_STROR/319-458--------------------------------------------------------------------------------
Q4JYJ9_STREE/323-464--------------------------------------------------------------------------------
E0PD92_STREI/325-464--------------------------------------------------------------------------------
C6CSD9_PAESJ/327-465--------------------------------------------------------------------------------
B0N362_9FIRM/290-427--------------------------------------------------------------------------------
A5M4K0_STREE/211-349--------------------------------------------------------------------------------
C9LAR2_BLAHA/325-463--------------------------------------------------------------------------------
Q4K189_STREE/323-460--------------------------------------------------------------------------------
C4FB42_9ACTN/325-467--------------------------------------------------------------------------------
E0S188_BUTPB/322-462--------------------------------------------------------------------------------
C3HRG9_BACTU/323-461--------------------------------------------------------------------------------
A7HKJ9_FERNB/322-460--------------------------------------------------------------------------------
E4L4W5_9STRE/321-459--------------------------------------------------------------------------------
E7S3G0_STRAG/321-459--------------------------------------------------------------------------------
E0NHN4_PEDAC/321-459--------------------------------------------------------------------------------
E6LD53_9ENTE/253-391--------------------------------------------------------------------------------
C2KJQ1_LEUMC/329-467--------------------------------------------------------------------------------
B3XNV8_LACRE/322-460--------------------------------------------------------------------------------
B2GDL9_LACF3/322-460--------------------------------------------------------------------------------
C0WVB1_LACFE/322-460--------------------------------------------------------------------------------
A2RHU4_LACLM/321-459--------------------------------------------------------------------------------
A1YVF6_LACJH/321-459--------------------------------------------------------------------------------
C2D643_LACBR/210-348--------------------------------------------------------------------------------
Q3ZK40_9LACT/322-460--------------------------------------------------------------------------------
D8MET9_LEUGT/321-460--------------------------------------------------------------------------------
A3F4D6_LACLC/321-459--------------------------------------------------------------------------------
D2EJ27_PEDAC/321-459--------------------------------------------------------------------------------
O06039_LACLC/321-459--------------------------------------------------------------------------------
Q8GPE5_STRTR/321-459--------------------------------------------------------------------------------
D7DRX9_METV3/353-490--------------------------------------------------------------------------------
A4FX93_METM5/354-492--------------------------------------------------------------------------------
A6UPA0_METVS/351-488--------------------------------------------------------------------------------
A6UU30_META3/353-490--------------------------------------------------------------------------------
D5VU50_METIM/353-494--------------------------------------------------------------------------------
D4W1F1_9FIRM/338-485--------------------------------------------------------------------------------
B9DSP4_STRU0/342-480--------------------------------------------------------------------------------
F1Z193_9STRE/350-488--------------------------------------------------------------------------------
D4YGG7_9LACT/385-532--------------------------------------------------------------------------------
F2I7P9_AERUA/374-520--------------------------------------------------------------------------------
Q03E00_PEDPA/355-503--------------------------------------------------------------------------------
D2EHX4_PEDAC/355-503--------------------------------------------------------------------------------
A0A021WE79_LACPN/357-507--------------------------------------------------------------------------------
E7FPH6_9LACO/355-501--------------------------------------------------------------------------------

PF03023

MURJ_BORBU/29-473--------------------------------------------------------------------------------
MURJ_RICPR/28-477--------------------------------------------------------------------------------
MURJ_ECOLI/28-479--------------------------------------------------------------------------------
MURJ_SYNY3/36-495--------------------------------------------------------------------------------
MURJ_AQUAE/29-466--------------------------------------------------------------------------------
MURJ_HAEIN/16-479--------------------------------------------------------------------------------
MURJ_THEMA/28-450--------------------------------------------------------------------------------
Q9X8T0_STRCO/300-778--------------------------------------------------------------------------------
MURJ_TREPA/32-489--------------------------------------------------------------------------------
Q9RX17_DEIRA/83-522--------------------------------------------------------------------------------
MURJ_CHLTR/34-482--------------------------------------------------------------------------------
MURJ_HELPY/2-458--------------------------------------------------------------------------------
MVIN_MYCTU/48-521--------------------------------------------------------------------------------

PF01554

O51531_BORBU/22-182--------------------------------------------------------------------------------
YOEA_BACSU/28-189--------------------------------------------------------------------------------
YOEA_BACSU/257-418--------------------------------------------------------------------------------
O66528_AQUAE/245-406--------------------------------------------------------------------------------
YPNP_BACSU/241-402--------------------------------------------------------------------------------
NORM_VIBPA/243-404--------------------------------------------------------------------------------
O80695_ARATH/278-441--------------------------------------------------------------------------------
O26414_METTH/244-409--------------------------------------------------------------------------------
O28801_ARCFU/21-180--------------------------------------------------------------------------------
YISQ_BACSU/27-187--------------------------------------------------------------------------------
Y709_METJA/243-408--------------------------------------------------------------------------------
YPNP_BACSU/21-182--------------------------------------------------------------------------------
O25454_HELPY/214-375--------------------------------------------------------------------------------
NORM_BACSU/20-180--------------------------------------------------------------------------------
HMRM_HAEIN/249-410--------------------------------------------------------------------------------
O49660_ARATH/262-426--------------------------------------------------------------------------------
O82752_ARATH/42-203--------------------------------------------------------------------------------
DINF_ECOLI/35-196--------------------------------------------------------------------------------
Q9ZVH5_ARATH/238-401--------------------------------------------------------------------------------
O28801_ARCFU/239-404--------------------------------------------------------------------------------
Q38956_ARATH/275-438--------------------------------------------------------------------------------
ERC1_YEAST/174-335--------------------------------------------------------------------------------
Q9ZVH5_ARATH/16-176--------------------------------------------------------------------------------
YAO6_SCHPO/17-177--------------------------------------------------------------------------------
O82752_ARATH/264-427--------------------------------------------------------------------------------
O51429_BORBU/27-187--------------------------------------------------------------------------------
O83871_TREPA/32-196--------------------------------------------------------------------------------
O51429_BORBU/248-409--------------------------------------------------------------------------------
YISQ_BACSU/252-413--------------------------------------------------------------------------------
O66528_AQUAE/25-183--------------------------------------------------------------------------------
O51530_BORBU/21-181--------------------------------------------------------------------------------
Y709_METJA/21-181--------------------------------------------------------------------------------
NORM_BACSU/247-408--------------------------------------------------------------------------------
NORM_VIBPA/17-176--------------------------------------------------------------------------------
O26414_METTH/24-183--------------------------------------------------------------------------------
HMRM_HAEIN/22-181--------------------------------------------------------------------------------
YD338_YEAST/238-397--------------------------------------------------------------------------------
MDTK_ECOLI/17-177--------------------------------------------------------------------------------
Q38956_ARATH/55-215--------------------------------------------------------------------------------
P71616_MYCTU/19-179--------------------------------------------------------------------------------
O49660_ARATH/40-200--------------------------------------------------------------------------------
O80695_ARATH/57-217--------------------------------------------------------------------------------
MDTK_ECOLI/244-405--------------------------------------------------------------------------------
F4IHU9_ARATH/37-197--------------------------------------------------------------------------------
O25796_HELPY/23-184--------------------------------------------------------------------------------
YEEO_ECOLI/48-208--------------------------------------------------------------------------------
Q8DNG1_STRR6/24-183--------------------------------------------------------------------------------

PF07260

G1KED7_ANOCA/1-345--------------------------------------------------------------------------------
I3JFW4_ORENI/1-349--------------------------------------------------------------------------------
F1Q528_DANRE/1-344--------------------------------------------------------------------------------

PF01943

SP5B_BACSU/6-308--------------------------------------------------------------------------------
EXOT_RHIME/10-277--------------------------------------------------------------------------------
TUAB_BACSU/10-277--------------------------------------------------------------------------------
RFBX_ECOLI/8-279--------------------------------------------------------------------------------
O26447_METTH/15-286--------------------------------------------------------------------------------
YTGP_BACSU/5-320--------------------------------------------------------------------------------
Y1068_METJA/7-302--------------------------------------------------------------------------------
Y1375_METJA/3-283--------------------------------------------------------------------------------
O26479_METTH/10-276--------------------------------------------------------------------------------
O29660_ARCFU/6-285--------------------------------------------------------------------------------
O26467_METTH/18-289--------------------------------------------------------------------------------
O26442_METTH/7-278--------------------------------------------------------------------------------
YABM_BACSU/12-309--------------------------------------------------------------------------------
WZXC_ECOLI/9-276--------------------------------------------------------------------------------
Q2K5A6_RHIEC/11-272--------------------------------------------------------------------------------
Q32EG2_SHIDS/2-269--------------------------------------------------------------------------------
Q8DZE2_STRA5/6-273--------------------------------------------------------------------------------
Q8P805_XANCP/25-289--------------------------------------------------------------------------------

PF13440

A8UQ25_9FLAO/16-256--------------------------------------------------------------------------------
B5JNG5_9BACT/22-272--------------------------------------------------------------------------------
D0YZQ3_LISDA/18-261--------------------------------------------------------------------------------
D2BRK8_DICD5/18-261--------------------------------------------------------------------------------
B1IZZ3_ECOLC/18-261--------------------------------------------------------------------------------
D0I1Y2_VIBCL/18-260--------------------------------------------------------------------------------
D0HB98_VIBMI/18-260--------------------------------------------------------------------------------
A9AXJ4_HERA2/36-280--------------------------------------------------------------------------------
A4EAS6_9ACTN/45-291--------------------------------------------------------------------------------
Q2YCG5_NITMU/22-272--------------------------------------------------------------------------------
B9JQS0_AGRRK/94-340--------------------------------------------------------------------------------
C2KV49_9FIRM/32-288--------------------------------------------------------------------------------
C8XCC3_NAKMY/40-272--------------------------------------------------------------------------------
Q3K9H6_PSEPF/12-266--------------------------------------------------------------------------------
O58733_PYRHO/24-253--------------------------------------------------------------------------------
C8KY87_9PAST/18-266--------------------------------------------------------------------------------
C5RZU1_9PAST/18-266--------------------------------------------------------------------------------
Q1D7B4_MYXXD/29-283--------------------------------------------------------------------------------
C4WNX8_9RHIZ/31-284--------------------------------------------------------------------------------
A6X6T8_OCHA4/16-269--------------------------------------------------------------------------------
B1M5Z3_METRJ/17-264--------------------------------------------------------------------------------
A1UCH8_MYCSK/30-289--------------------------------------------------------------------------------
A3PW68_MYCSJ/30-289--------------------------------------------------------------------------------
Q89SM5_BRADU/14-269--------------------------------------------------------------------------------
Q2CIK8_OCEGH/14-260--------------------------------------------------------------------------------
C7LVX3_DESBD/8-264--------------------------------------------------------------------------------
A4FEI7_SACEN/8-256--------------------------------------------------------------------------------
C5ATW3_METEA/42-293--------------------------------------------------------------------------------
A9VW94_METEP/42-293--------------------------------------------------------------------------------
B7KU42_METC4/42-293--------------------------------------------------------------------------------
C7C8V6_METED/42-293--------------------------------------------------------------------------------
C8XCR8_NAKMY/39-289--------------------------------------------------------------------------------
Q0RPT3_FRAAA/322-573--------------------------------------------------------------------------------
D3CWT1_9ACTO/203-455--------------------------------------------------------------------------------
Q0RCF1_FRAAA/179-430--------------------------------------------------------------------------------
D2PZ16_KRIFD/24-275--------------------------------------------------------------------------------
Q8KN00_9ACTO/40-289--------------------------------------------------------------------------------
D6EG66_STRLI/34-283--------------------------------------------------------------------------------
A8UIN6_9FLAO/18-257--------------------------------------------------------------------------------
M1I249_9CREN/28-278--------------------------------------------------------------------------------
A6Q4F3_NITSB/16-266--------------------------------------------------------------------------------
B8CST1_SHEPW/46-301--------------------------------------------------------------------------------
A6FGK5_9GAMM/27-282--------------------------------------------------------------------------------
Q8EFK4_SHEON/24-279--------------------------------------------------------------------------------
A6WPP6_SHEB8/25-280--------------------------------------------------------------------------------
A1RKH9_SHESW/25-280--------------------------------------------------------------------------------
A4Y617_SHEPC/25-280--------------------------------------------------------------------------------
E6XI49_SHEP2/25-280--------------------------------------------------------------------------------
A6VTF9_MARMS/19-265--------------------------------------------------------------------------------
B9EAW7_MACCJ/18-258--------------------------------------------------------------------------------

PF04506

RFT1_CANGA/9-542AVTANCLVNFTVVYSYEKKL.............ILTSYFDDSERFREGIA.........ILAFALGKLAYAATLLMCYYY
E9IWP9_SOLIN/8-542MIVIRTMTFVPLILYYPENA.......................................LLAFGIAQLVAAVFYTTSHYV
S9VRB9_SCHCR/24-535GIISNTVTSFLISFFSQSENLS.....................................VLPFAVGTLMESIVNFITLYS
C5E2W4_LACTC/16-558AVVVSCIANFSIVYVYENKF.............NGSGIALHDATKQEGIA.........ILAFAVSKLVHSTALLCCYYY
E9EIH0_METAQ/28-566ATFLRCLAVFASTVLASRK..........................RLDIG.........VLPFALGQLTYGVSLLLVYFA
G8BWS7_TETPH/20-558STTVGCVVNFIVVYGLENNW............YKINILAEDLEVSKEGIA.........ILAFSLGKLTHSVALLLCYYI
H2ASC3_KAZAF/14-533GVLLGCLVNFAIITGFERDW...........IIFTSLDNQNSDMIKEGIA.........IFAFAMGKLTHSLTLLCCYFF
RFT1_YARLI/102-645AILVRCVVTFSFTLLAKDT........................DGGLNGG.........VLAFAFGQLAYSLISSAVYIY
RFT1_SCHPO/10-520GTIICSLLSFAISVLGRNKAPS.....................................SLPFALGNLSEKVTIFFTLRY
I2GX14_TETBL/21-581SVTTGCLTNFIVIYAFEKNL.............LFAIPKEDLEINKEGIA.........ILAFAIGKFAHSITLLLCYYY
A7TRS5_VANPO/18-551AVTMGCVINFTVVYAFEKKW..............YSLDTDDLEVSKEGIA.........ILAFSLGKLAHSITLLLCYSY
J7R8K9_KAZNA/27-584AVTMGCVTNFLIVIYCENHN...............VLLDADDEVTRESIA.........ILAFSLGKLVHSLTLLAGYLV
M2PSW7_CERS8/12-528AVVMKTVVAFAALVVLDAEWA......................................LVAFALGQAAYGLTMLVEFAR
RFT1_CAEEL/2-516LICVKRIFVLAGLFMFPGMYH......................................LELFAYAQYIGAIAYLLFNFV
G8ZPN0_TORDC/18-550SVTVGCLLNCAVILAFEKSW..............FFSASDKSESSREGVA.........ILAFALGKLGHSATLLLCYYS
C4R7X1_PICPG/21-528ANVFKCLSQLGMIVWFEHK..........................FKGMSVDKANPDYFIFSYCVSLFIYGGSILSLYLH
H9KBA9_APIME/8-516MIAIRTVTFVPLILHNPENA.......................................LLAFGIAQLVAA.........
U5D209_AMBTC/17-521ATTLRCMTTYFLIINQTNEG...K...................................ELVFALSQVAYGASLFVGYWG
G0W6B8_NAUDC/22-586AITMGCITNFIIVVSFEKNWWNPILKSMIHHNNELMDQEEFMEVSREGIA.........ILAFAVGKLVHSLILLLCYYW
E2AM70_CAMFO/8-540MIAIRTMTFVPLILYYPENA.......................................LLAFGIAQLVAAIFYTTSHYV
E9GUV5_DAPPU/9-536MMFIRVGTLVVSVLYFPAYT.......................................IKTMACGQFVVSTVLVVLYWI
D8M9P3_BLAHO/10-506SLSIRSITNCILLCLFPSLG.......................................LKGFCIGEFVYALCFPLLYAV
F4K836_ARATH/105-602ATLARCVTLYSLLVMQTNME...K...................................VIIFALSQVAYGGSLFIGYWA
U4LAR2_PYROM/52-567ASLTRCLLTCGTTIYFARQ..........................GWDIG.........PLGFALGQLGYGVVLFLVYTA
RFT1_DROME/8-549HILVRSAIFLWIVTGDRSAA.......................................INAFAIAQLSSAVTIVLGQYG
G8BFC9_CANPC/25-545ALIAKCTTTFVAIYFARQR.....................FTGLEYSGIS.........ILSFMFGQLAYSATLFLSYFG
M3BX75_SPHMS/8-530AVVLKTLATAGTVFWSQHE..........................QLELG.........VLPFAAGELAYCSTLTLVYLW
W4Z9M3_STRPU/12-532AIGIRCSLTVFFLIINPQIG.......................................ITAFCIAQIVYSYVCVFLYFL
RFT1_ASHGO/11-543AVAASCLVNFAVIYWYENWV.............NGRGETVHDSYKQEGIA.........VLAFALGKVARAMTLLALYYV
M3K0B3_CANMX/13-532AVVTKCVVTFVSIMIVKSY.....................FSGDIFSGSA.........ICAFALGQFSYSLTLAICYYA
G8JV96_ERECY/11-550SVAASCIVNFCIIYWYENWI.............NGTGETIHDNYKQEGIA.........ILAFSLGKVTRAITVLCLYYV
G0V9M8_NAUCC/17-571AVAIGCIVNFIVVISFENNW...IDFSKLASISSVIDD....EMLREGVA.........ILAFSLGKFAHSLTLLTCYFY
H9J737_BOMMO/8-547HIFVRTLLFLSIIIYDRSLA.......................................LIAFSIAQVGSIFVVVLSYYI
R4XDT4_TAPDE/6-505AILSRCIVTFLVSVYGGPE.............................IG.........ALAFALGQLAYSIILLITYTF
RFT1_YEAST/18-565AVTTGCIVNFIVVYAVQQSR..............YPMGVVTSDIDKEGIA.........ILAFALGKLAHSITLLACYYW

PF14667

Q03SZ7_LACBA/349-498--------------------------------------------------------------------------------
Q38V74_LACSS/358-503--------------------------------------------------------------------------------
B3WAP5_LACCB/356-499--------------------------------------------------------------------------------
A8UAN8_9LACT/362-510--------------------------------------------------------------------------------
D0BM46_9LACT/359-506--------------------------------------------------------------------------------
C8NI78_9LACT/366-514--------------------------------------------------------------------------------
C0WQN7_LACBU/354-501--------------------------------------------------------------------------------
C2EHH6_9LACO/356-502--------------------------------------------------------------------------------
E6LEY4_9ENTE/358-506--------------------------------------------------------------------------------
C9A420_ENTGA/359-508--------------------------------------------------------------------------------
C2HEH9_ENTFC/359-507--------------------------------------------------------------------------------
C0X942_ENTFL/359-507--------------------------------------------------------------------------------
E0RUK9_BUTPB/373-516--------------------------------------------------------------------------------
C5Q1B2_STAAU/332-469--------------------------------------------------------------------------------
E7MM58_9FIRM/379-526--------------------------------------------------------------------------------
E4LZJ6_9CLOT/384-531--------------------------------------------------------------------------------
D4W2K6_9FIRM/377-526--------------------------------------------------------------------------------
D5E4C9_BACMQ/373-523--------------------------------------------------------------------------------
B7JJF5_BACC0/376-524--------------------------------------------------------------------------------
Q8EP19_OCEIH/372-521--------------------------------------------------------------------------------
B1YKH1_EXIS2/386-534--------------------------------------------------------------------------------
D6Y0K7_BACIE/382-530--------------------------------------------------------------------------------
Q5WE75_BACSK/374-522--------------------------------------------------------------------------------
E6U1Q3_BACCJ/375-523--------------------------------------------------------------------------------
D3FXP2_BACPE/374-522--------------------------------------------------------------------------------
A4IRX9_GEOTN/371-520--------------------------------------------------------------------------------
D5DN36_BACMD/374-521--------------------------------------------------------------------------------
A7Z7U6_BACA2/375-524--------------------------------------------------------------------------------
A0RJU4_BACAH/372-520--------------------------------------------------------------------------------
E7RE43_9BACL/368-516--------------------------------------------------------------------------------
A3I8W7_9BACI/372-521--------------------------------------------------------------------------------
A6CQJ8_9BACI/372-520--------------------------------------------------------------------------------
D3UNL4_LISSS/370-518--------------------------------------------------------------------------------
B8DHB8_LISMH/370-518--------------------------------------------------------------------------------
A0A008APY8_STAAU/386-533--------------------------------------------------------------------------------
B9E7H2_MACCJ/374-522--------------------------------------------------------------------------------
D5T1U4_LEUKI/363-511--------------------------------------------------------------------------------
Q03XR0_LEUMM/330-477--------------------------------------------------------------------------------
A0NHL2_OENOE/387-534--------------------------------------------------------------------------------
B1MY12_LEUCK/485-634--------------------------------------------------------------------------------
C2KKY7_LEUMC/498-647--------------------------------------------------------------------------------
C0WLU0_LACBU/374-518--------------------------------------------------------------------------------
C2EP42_9LACO/342-483--------------------------------------------------------------------------------
A0A038C172_ENTFL/370-519--------------------------------------------------------------------------------
C5RB06_WEIPA/501-648--------------------------------------------------------------------------------
A8UCR2_9LACT/391-539--------------------------------------------------------------------------------
A2RMM4_LACLM/390-539--------------------------------------------------------------------------------
C9A2J3_ENTGA/381-529--------------------------------------------------------------------------------
E6LIJ6_9ENTE/381-529--------------------------------------------------------------------------------
A0A037ZTL3_ENTFL/382-530--------------------------------------------------------------------------------
C2H7P1_ENTFC/381-529--------------------------------------------------------------------------------
A4VW05_STRSY/379-527--------------------------------------------------------------------------------
E3CI47_STRDO/375-523--------------------------------------------------------------------------------
A5LCT3_STREE/372-520--------------------------------------------------------------------------------
A3CPL5_STRSV/375-523--------------------------------------------------------------------------------
A2RG74_STRPG/377-525--------------------------------------------------------------------------------
E8K660_STRPA/410-558--------------------------------------------------------------------------------
B1SH45_9STRE/377-525--------------------------------------------------------------------------------
C2LQ70_STRSL/432-580--------------------------------------------------------------------------------
C6SP25_STRMN/377-525--------------------------------------------------------------------------------
B3W6R7_LACCB/364-511--------------------------------------------------------------------------------
A5VL26_LACRD/382-530--------------------------------------------------------------------------------
D2ELV8_PEDAC/393-541--------------------------------------------------------------------------------
C0WUG9_LACBU/378-530--------------------------------------------------------------------------------
Q03RI1_LACBA/378-525--------------------------------------------------------------------------------
C2EED2_9LACO/381-529--------------------------------------------------------------------------------
Q38VP9_LACSS/378-526--------------------------------------------------------------------------------
C8PCY7_9LACO/375-523--------------------------------------------------------------------------------
D0DXL5_9LACO/375-523--------------------------------------------------------------------------------
C2E7U4_LACJH/384-532--------------------------------------------------------------------------------
C2KAZ9_9LACO/380-528--------------------------------------------------------------------------------
B3WCD6_LACCB/380-528--------------------------------------------------------------------------------
D0BKY7_9LACT/390-538--------------------------------------------------------------------------------
C8NE09_9LACT/413-561--------------------------------------------------------------------------------
E4KNA5_9LACT/790-938--------------------------------------------------------------------------------
D4YJ56_9LACT/433-583--------------------------------------------------------------------------------
E0IFR0_9BACL/366-514--------------------------------------------------------------------------------
E0RCM4_PAEP6/382-529--------------------------------------------------------------------------------
C6J0R0_9BACL/364-511--------------------------------------------------------------------------------
E5Z458_9BACL/362-509--------------------------------------------------------------------------------
C0Z9G8_BREBN/364-513--------------------------------------------------------------------------------
C4GB38_9FIRM/387-530--------------------------------------------------------------------------------
A8RUL6_CLOBW/387-539--------------------------------------------------------------------------------
E6LN70_9FIRM/381-525--------------------------------------------------------------------------------
C7GE86_9FIRM/383-527--------------------------------------------------------------------------------
E3GGE0_EUBLK/365-508--------------------------------------------------------------------------------
E6MGM4_9FIRM/373-516--------------------------------------------------------------------------------
B8D0L3_HALOH/359-505--------------------------------------------------------------------------------
C6PQD8_9CLOT/131-275--------------------------------------------------------------------------------
C8VXJ1_DESAS/366-509--------------------------------------------------------------------------------
D9QSV7_ACEAZ/363-507--------------------------------------------------------------------------------
B2A8K9_NATTJ/363-507--------------------------------------------------------------------------------
A8MK38_ALKOO/363-506--------------------------------------------------------------------------------
A5D2G5_PELTS/358-502--------------------------------------------------------------------------------
D5X9J9_THEPJ/361-503--------------------------------------------------------------------------------
B2A2Z4_NATTJ/361-504--------------------------------------------------------------------------------
C7GYH1_9FIRM/373-517--------------------------------------------------------------------------------
A6TN15_ALKMQ/363-506--------------------------------------------------------------------------------
A8MIG9_ALKOO/365-508--------------------------------------------------------------------------------
Q67JD5_SYMTH/384-522--------------------------------------------------------------------------------
C4FNY8_9FIRM/361-503--------------------------------------------------------------------------------
D3LVV9_9FIRM/358-500--------------------------------------------------------------------------------
E2ZD67_9FIRM/360-502--------------------------------------------------------------------------------
C9LLX4_9FIRM/363-506--------------------------------------------------------------------------------
D3LX29_9FIRM/358-500--------------------------------------------------------------------------------
C4FPR1_9FIRM/359-501--------------------------------------------------------------------------------
A1HLQ5_9FIRM/371-513--------------------------------------------------------------------------------
C4V2B6_9FIRM/374-517--------------------------------------------------------------------------------
E8LB44_9FIRM/369-509--------------------------------------------------------------------------------
C0WBK9_9FIRM/378-517--------------------------------------------------------------------------------
B7DPH6_9BACL/373-525--------------------------------------------------------------------------------
C0ZHE2_BREBN/367-517--------------------------------------------------------------------------------
C2YMP0_BACCE/352-495--------------------------------------------------------------------------------
B7GMA5_ANOFW/366-505--------------------------------------------------------------------------------
E7RL93_9BACL/356-500--------------------------------------------------------------------------------
D3FZH8_BACPE/357-501--------------------------------------------------------------------------------
B0MPG6_9FIRM/391-534--------------------------------------------------------------------------------
B0PEA8_9FIRM/441-584--------------------------------------------------------------------------------
A7VWY4_9CLOT/433-577--------------------------------------------------------------------------------
E6TRQ4_BACCJ/362-512--------------------------------------------------------------------------------
D5WSL0_KYRT2/373-521--------------------------------------------------------------------------------
B1YGP9_EXIS2/345-491--------------------------------------------------------------------------------
C5RD31_WEIPA/359-505--------------------------------------------------------------------------------
Q8EU30_OCEIH/362-509--------------------------------------------------------------------------------
B9E8U7_MACCJ/341-481--------------------------------------------------------------------------------
Q49V13_STAS1/337-479--------------------------------------------------------------------------------
B9CVC4_STACP/347-489--------------------------------------------------------------------------------
C2M158_STAHO/360-502--------------------------------------------------------------------------------
D3QG68_STALH/343-485--------------------------------------------------------------------------------
E8SIP0_STAPH/344-486--------------------------------------------------------------------------------
A0A008AT25_STAAU/343-485--------------------------------------------------------------------------------
F2F183_SOLSS/360-508--------------------------------------------------------------------------------
A3IEA1_9BACI/365-514--------------------------------------------------------------------------------
E7RLD1_9BACL/354-503--------------------------------------------------------------------------------
A0AF13_LISW6/361-504--------------------------------------------------------------------------------
D7UUI0_LISGR/356-499--------------------------------------------------------------------------------
A6CR25_9BACI/352-499--------------------------------------------------------------------------------
E5WT44_9BACI/362-510--------------------------------------------------------------------------------
Q2B249_9BACI/362-508--------------------------------------------------------------------------------
A8F924_BACP2/360-506--------------------------------------------------------------------------------
E5WAE4_9BACI/356-502--------------------------------------------------------------------------------
A7Z0I0_BACA2/354-499--------------------------------------------------------------------------------
D4G3E4_BACNB/359-505--------------------------------------------------------------------------------
D5D970_BACMD/362-511--------------------------------------------------------------------------------
B7GFI4_ANOFW/350-497--------------------------------------------------------------------------------
A4IJD3_GEOTN/352-496--------------------------------------------------------------------------------
C5D378_GEOSW/360-505--------------------------------------------------------------------------------
Q5WAF7_BACSK/347-496--------------------------------------------------------------------------------
D3FR13_BACPE/361-509--------------------------------------------------------------------------------
Q9KGJ0_BACHD/361-507--------------------------------------------------------------------------------
D6XV50_BACIE/360-507--------------------------------------------------------------------------------
D3E759_GEOS4/381-532--------------------------------------------------------------------------------
E0RM54_PAEP6/373-525--------------------------------------------------------------------------------
A7GJW7_BACCN/360-506--------------------------------------------------------------------------------
B5UWQ0_BACCE/360-510--------------------------------------------------------------------------------
D2BMG7_LACLK/323-465--------------------------------------------------------------------------------
B8IEZ7_METNO/324-461--------------------------------------------------------------------------------
C7NM90_HALUD/327-463--------------------------------------------------------------------------------
A6DHF1_9BACT/293-436--------------------------------------------------------------------------------
Q47U72_COLP3/338-481--------------------------------------------------------------------------------
B4AGJ7_BACPU/343-486--------------------------------------------------------------------------------
Q1K412_DESAC/351-495--------------------------------------------------------------------------------
C0QCL2_DESAH/352-496--------------------------------------------------------------------------------
Q2YCG5_NITMU/323-466--------------------------------------------------------------------------------
E6QMG7_9ZZZZ/367-517--------------------------------------------------------------------------------
F2G999_ALTMD/323-467--------------------------------------------------------------------------------
C6JQC3_FUSVA/323-462--------------------------------------------------------------------------------
E5X0H2_9BACE/326-464--------------------------------------------------------------------------------
A3DHV8_CLOTH/327-465--------------------------------------------------------------------------------
B5CWR8_BACPM/324-466--------------------------------------------------------------------------------
F1VXT7_9BURK/320-462--------------------------------------------------------------------------------
Q2YCC1_NITMU/331-475--------------------------------------------------------------------------------
Q0AHL3_NITEC/325-466--------------------------------------------------------------------------------
D4YX22_SPHJU/336-476--------------------------------------------------------------------------------
Q1GPL1_SPHAL/342-484--------------------------------------------------------------------------------
B0VF98_CLOAI/326-465--------------------------------------------------------------------------------
A1S103_THEPD/335-472--------------------------------------------------------------------------------
E8R8C0_DESM0/349-487--------------------------------------------------------------------------------
A3DIV8_CLOTH/358-500--------------------------------------------------------------------------------
F2JLQ5_CELLD/355-497--------------------------------------------------------------------------------
A7VPC0_9CLOT/355-497--------------------------------------------------------------------------------
A8SAU1_9FIRM/356-502--------------------------------------------------------------------------------
A6TSY6_ALKMQ/375-519--------------------------------------------------------------------------------
A6NPI5_9FIRM/351-494--------------------------------------------------------------------------------
B0K3R2_THEPX/360-504--------------------------------------------------------------------------------
B7AQB6_9FIRM/351-493--------------------------------------------------------------------------------
D3AN52_9CLOT/376-519--------------------------------------------------------------------------------
B0TAY6_HELMI/361-505--------------------------------------------------------------------------------
Q3ADH7_CARHZ/346-484--------------------------------------------------------------------------------
E0RMQ1_PAEP6/366-508--------------------------------------------------------------------------------
C0ZAP4_BREBN/363-505--------------------------------------------------------------------------------
D7WQC4_9BACI/353-489--------------------------------------------------------------------------------
C8WQG9_ALIAD/361-502--------------------------------------------------------------------------------
B7DPL3_9BACL/356-497--------------------------------------------------------------------------------
D5QEL1_KOMHA/351-483--------------------------------------------------------------------------------
A9WAD6_CHLAA/337-475--------------------------------------------------------------------------------
E1IEK9_9CHLR/380-529--------------------------------------------------------------------------------
B9JKJ2_AGRRK/321-464--------------------------------------------------------------------------------
Q2Y4J6_9ARCH/377-524--------------------------------------------------------------------------------
E8V165_TERSS/339-475--------------------------------------------------------------------------------
B8IGJ3_METNO/336-472--------------------------------------------------------------------------------
D7BDH0_MEISD/336-473--------------------------------------------------------------------------------
F2NKF2_MARHT/337-483--------------------------------------------------------------------------------
D8J725_HALJB/340-478--------------------------------------------------------------------------------
B8D178_HALOH/340-478--------------------------------------------------------------------------------
C4RGH8_9ACTO/364-502--------------------------------------------------------------------------------
Q18GU8_HALWD/357-496--------------------------------------------------------------------------------
Q469G3_METBF/349-484--------------------------------------------------------------------------------
C5A2Y0_THEGJ/342-480--------------------------------------------------------------------------------
F0LLW6_THEBM/342-478--------------------------------------------------------------------------------
F2KQE3_ARCVS/343-481--------------------------------------------------------------------------------
F0LLZ4_THEBM/339-477--------------------------------------------------------------------------------
Q5JDW0_THEKO/345-480--------------------------------------------------------------------------------
A1BJ49_CHLPD/337-476--------------------------------------------------------------------------------
B3EHD9_CHLL2/365-504--------------------------------------------------------------------------------
Q3APG3_CHLCH/338-477--------------------------------------------------------------------------------
B4SBS0_PELPB/338-477--------------------------------------------------------------------------------
Q3B6G9_PELLD/337-476--------------------------------------------------------------------------------
A4SCQ1_PROVI/337-476--------------------------------------------------------------------------------
D8PBA0_9BACT/336-473--------------------------------------------------------------------------------
D3SSH7_NATMM/337-474--------------------------------------------------------------------------------
B6IYF6_RHOCS/343-484--------------------------------------------------------------------------------
D0LQE6_HALO1/374-513--------------------------------------------------------------------------------
D2RVV2_HALTV/336-474--------------------------------------------------------------------------------
D3STC0_NATMM/337-475--------------------------------------------------------------------------------
D8J472_HALJB/339-477--------------------------------------------------------------------------------
D2RXY9_HALTV/340-478--------------------------------------------------------------------------------
E7QQ57_9EURY/339-477--------------------------------------------------------------------------------
C7P069_HALMD/318-461--------------------------------------------------------------------------------
C7NSR3_HALUD/331-469--------------------------------------------------------------------------------
Q5V4U1_HALMA/327-465--------------------------------------------------------------------------------
D8J7W8_HALJB/319-457--------------------------------------------------------------------------------
C7NSL6_HALUD/319-457--------------------------------------------------------------------------------
E4NUG7_HALBP/319-458--------------------------------------------------------------------------------
AGL15_HALVD/319-457--------------------------------------------------------------------------------
Q12VM9_METBU/345-483--------------------------------------------------------------------------------
A3CVY7_METMJ/333-471--------------------------------------------------------------------------------
A2STD2_METLZ/331-469--------------------------------------------------------------------------------
A5UQJ1_ROSS1/330-463--------------------------------------------------------------------------------
D3FFB8_CONWI/338-471--------------------------------------------------------------------------------
D8GMK0_CLOLD/327-460--------------------------------------------------------------------------------
F0KAR0_CLOAE/326-458--------------------------------------------------------------------------------
D5XD05_THEPJ/326-457--------------------------------------------------------------------------------
Q2NIB6_METST/328-458--------------------------------------------------------------------------------
F0T719_METSL/333-463--------------------------------------------------------------------------------
Q2NH55_METST/331-464--------------------------------------------------------------------------------
E3GZ73_METFV/328-459--------------------------------------------------------------------------------
A5UNI7_METS3/328-460--------------------------------------------------------------------------------
F0TC71_METSL/328-460--------------------------------------------------------------------------------
Q12XY4_METBU/326-458--------------------------------------------------------------------------------
Q46FX4_METBF/329-461--------------------------------------------------------------------------------
F0TBQ9_METSL/329-463--------------------------------------------------------------------------------
Q0W809_UNCMA/331-464--------------------------------------------------------------------------------
D1Z261_METPS/328-462--------------------------------------------------------------------------------
O26442_METTH/329-460--------------------------------------------------------------------------------
A5UWW7_ROSS1/374-505--------------------------------------------------------------------------------
E1IAS8_9CHLR/378-523--------------------------------------------------------------------------------
D5UPU7_TSUPD/350-482--------------------------------------------------------------------------------
Q97AA3_THEVO/339-476--------------------------------------------------------------------------------
Q2S953_HAHCH/328-463--------------------------------------------------------------------------------
F2NHK3_DESAR/367-498--------------------------------------------------------------------------------
A3W1Y0_9RHOB/329-468--------------------------------------------------------------------------------
C4XGJ8_DESMR/335-465--------------------------------------------------------------------------------
A9EQ86_SORC5/331-462--------------------------------------------------------------------------------
B9K2D6_AGRVS/332-468--------------------------------------------------------------------------------
E3FNG9_STIAD/347-485--------------------------------------------------------------------------------
B6YVL8_THEON/328-461--------------------------------------------------------------------------------
E0I7A7_9BACL/353-491--------------------------------------------------------------------------------
D5DY76_BACMQ/331-468--------------------------------------------------------------------------------
D7E977_METEZ/332-466--------------------------------------------------------------------------------
A1ASY9_PELPD/345-481--------------------------------------------------------------------------------
D7D534_GEOSC/329-466--------------------------------------------------------------------------------
E8RTH0_ASTEC/331-467--------------------------------------------------------------------------------
Q0AP11_MARMM/327-464--------------------------------------------------------------------------------
E7RZY6_9BURK/339-474--------------------------------------------------------------------------------
Q12TY8_METBU/325-459--------------------------------------------------------------------------------
D9PYX0_METTM/350-483--------------------------------------------------------------------------------
F0TB30_METSL/351-484--------------------------------------------------------------------------------
F0EKD4_ENTCA/327-465--------------------------------------------------------------------------------
Q5M4A4_STRT2/55-193--------------------------------------------------------------------------------
F0HVE0_LACDL/327-469--------------------------------------------------------------------------------
E4SMU5_LACAR/327-469--------------------------------------------------------------------------------
D4LGF1_9FIRM/327-469--------------------------------------------------------------------------------
A5ZUX1_9FIRM/326-464--------------------------------------------------------------------------------
D5TQD2_BACT1/321-460--------------------------------------------------------------------------------
A0A016CGV6_BACFG/328-466--------------------------------------------------------------------------------
E8JWJ5_STRCR/327-467--------------------------------------------------------------------------------
Q4JZ09_STREE/330-470--------------------------------------------------------------------------------
E6MFC3_9FIRM/328-466--------------------------------------------------------------------------------
E9RY62_9FIRM/330-468--------------------------------------------------------------------------------
C5NWI0_9BACL/318-458--------------------------------------------------------------------------------
A1ILY9_STROR/319-458--------------------------------------------------------------------------------
Q4JYJ9_STREE/323-464--------------------------------------------------------------------------------
E0PD92_STREI/325-464--------------------------------------------------------------------------------
C6CSD9_PAESJ/327-465--------------------------------------------------------------------------------
B0N362_9FIRM/290-427--------------------------------------------------------------------------------
A5M4K0_STREE/211-349--------------------------------------------------------------------------------
C9LAR2_BLAHA/325-463--------------------------------------------------------------------------------
Q4K189_STREE/323-460--------------------------------------------------------------------------------
C4FB42_9ACTN/325-467--------------------------------------------------------------------------------
E0S188_BUTPB/322-462--------------------------------------------------------------------------------
C3HRG9_BACTU/323-461--------------------------------------------------------------------------------
A7HKJ9_FERNB/322-460--------------------------------------------------------------------------------
E4L4W5_9STRE/321-459--------------------------------------------------------------------------------
E7S3G0_STRAG/321-459--------------------------------------------------------------------------------
E0NHN4_PEDAC/321-459--------------------------------------------------------------------------------
E6LD53_9ENTE/253-391--------------------------------------------------------------------------------
C2KJQ1_LEUMC/329-467--------------------------------------------------------------------------------
B3XNV8_LACRE/322-460--------------------------------------------------------------------------------
B2GDL9_LACF3/322-460--------------------------------------------------------------------------------
C0WVB1_LACFE/322-460--------------------------------------------------------------------------------
A2RHU4_LACLM/321-459--------------------------------------------------------------------------------
A1YVF6_LACJH/321-459--------------------------------------------------------------------------------
C2D643_LACBR/210-348--------------------------------------------------------------------------------
Q3ZK40_9LACT/322-460--------------------------------------------------------------------------------
D8MET9_LEUGT/321-460--------------------------------------------------------------------------------
A3F4D6_LACLC/321-459--------------------------------------------------------------------------------
D2EJ27_PEDAC/321-459--------------------------------------------------------------------------------
O06039_LACLC/321-459--------------------------------------------------------------------------------
Q8GPE5_STRTR/321-459--------------------------------------------------------------------------------
D7DRX9_METV3/353-490--------------------------------------------------------------------------------
A4FX93_METM5/354-492--------------------------------------------------------------------------------
A6UPA0_METVS/351-488--------------------------------------------------------------------------------
A6UU30_META3/353-490--------------------------------------------------------------------------------
D5VU50_METIM/353-494--------------------------------------------------------------------------------
D4W1F1_9FIRM/338-485--------------------------------------------------------------------------------
B9DSP4_STRU0/342-480--------------------------------------------------------------------------------
F1Z193_9STRE/350-488--------------------------------------------------------------------------------
D4YGG7_9LACT/385-532--------------------------------------------------------------------------------
F2I7P9_AERUA/374-520--------------------------------------------------------------------------------
Q03E00_PEDPA/355-503--------------------------------------------------------------------------------
D2EHX4_PEDAC/355-503--------------------------------------------------------------------------------
A0A021WE79_LACPN/357-507--------------------------------------------------------------------------------
E7FPH6_9LACO/355-501--------------------------------------------------------------------------------

PF03023

MURJ_BORBU/29-473--------------------------------------------------------------------------------
MURJ_RICPR/28-477--------------------------------------------------------------------------------
MURJ_ECOLI/28-479--------------------------------------------------------------------------------
MURJ_SYNY3/36-495--------------------------------------------------------------------------------
MURJ_AQUAE/29-466--------------------------------------------------------------------------------
MURJ_HAEIN/16-479--------------------------------------------------------------------------------
MURJ_THEMA/28-450--------------------------------------------------------------------------------
Q9X8T0_STRCO/300-778--------------------------------------------------------------------------------
MURJ_TREPA/32-489--------------------------------------------------------------------------------
Q9RX17_DEIRA/83-522--------------------------------------------------------------------------------
MURJ_CHLTR/34-482--------------------------------------------------------------------------------
MURJ_HELPY/2-458--------------------------------------------------------------------------------
MVIN_MYCTU/48-521--------------------------------------------------------------------------------

PF01554

O51531_BORBU/22-182--------------------------------------------------------------------------------
YOEA_BACSU/28-189--------------------------------------------------------------------------------
YOEA_BACSU/257-418--------------------------------------------------------------------------------
O66528_AQUAE/245-406--------------------------------------------------------------------------------
YPNP_BACSU/241-402--------------------------------------------------------------------------------
NORM_VIBPA/243-404--------------------------------------------------------------------------------
O80695_ARATH/278-441--------------------------------------------------------------------------------
O26414_METTH/244-409--------------------------------------------------------------------------------
O28801_ARCFU/21-180--------------------------------------------------------------------------------
YISQ_BACSU/27-187--------------------------------------------------------------------------------
Y709_METJA/243-408--------------------------------------------------------------------------------
YPNP_BACSU/21-182--------------------------------------------------------------------------------
O25454_HELPY/214-375--------------------------------------------------------------------------------
NORM_BACSU/20-180--------------------------------------------------------------------------------
HMRM_HAEIN/249-410--------------------------------------------------------------------------------
O49660_ARATH/262-426--------------------------------------------------------------------------------
O82752_ARATH/42-203--------------------------------------------------------------------------------
DINF_ECOLI/35-196--------------------------------------------------------------------------------
Q9ZVH5_ARATH/238-401--------------------------------------------------------------------------------
O28801_ARCFU/239-404--------------------------------------------------------------------------------
Q38956_ARATH/275-438--------------------------------------------------------------------------------
ERC1_YEAST/174-335--------------------------------------------------------------------------------
Q9ZVH5_ARATH/16-176--------------------------------------------------------------------------------
YAO6_SCHPO/17-177--------------------------------------------------------------------------------
O82752_ARATH/264-427--------------------------------------------------------------------------------
O51429_BORBU/27-187--------------------------------------------------------------------------------
O83871_TREPA/32-196--------------------------------------------------------------------------------
O51429_BORBU/248-409--------------------------------------------------------------------------------
YISQ_BACSU/252-413--------------------------------------------------------------------------------
O66528_AQUAE/25-183--------------------------------------------------------------------------------
O51530_BORBU/21-181--------------------------------------------------------------------------------
Y709_METJA/21-181--------------------------------------------------------------------------------
NORM_BACSU/247-408--------------------------------------------------------------------------------
NORM_VIBPA/17-176--------------------------------------------------------------------------------
O26414_METTH/24-183--------------------------------------------------------------------------------
HMRM_HAEIN/22-181--------------------------------------------------------------------------------
YD338_YEAST/238-397--------------------------------------------------------------------------------
MDTK_ECOLI/17-177--------------------------------------------------------------------------------
Q38956_ARATH/55-215--------------------------------------------------------------------------------
P71616_MYCTU/19-179--------------------------------------------------------------------------------
O49660_ARATH/40-200--------------------------------------------------------------------------------
O80695_ARATH/57-217--------------------------------------------------------------------------------
MDTK_ECOLI/244-405--------------------------------------------------------------------------------
F4IHU9_ARATH/37-197--------------------------------------------------------------------------------
O25796_HELPY/23-184--------------------------------------------------------------------------------
YEEO_ECOLI/48-208--------------------------------------------------------------------------------
Q8DNG1_STRR6/24-183--------------------------------------------------------------------------------

PF07260

G1KED7_ANOCA/1-345--------------------------------------------------------------------------------
I3JFW4_ORENI/1-349--------------------------------------------------------------------------------
F1Q528_DANRE/1-344--------------------------------------------------------------------------------

PF01943

SP5B_BACSU/6-308--------------------------------------------------------------------------------
EXOT_RHIME/10-277--------------------------------------------------------------------------------
TUAB_BACSU/10-277--------------------------------------------------------------------------------
RFBX_ECOLI/8-279--------------------------------------------------------------------------------
O26447_METTH/15-286--------------------------------------------------------------------------------
YTGP_BACSU/5-320--------------------------------------------------------------------------------
Y1068_METJA/7-302--------------------------------------------------------------------------------
Y1375_METJA/3-283--------------------------------------------------------------------------------
O26479_METTH/10-276--------------------------------------------------------------------------------
O29660_ARCFU/6-285--------------------------------------------------------------------------------
O26467_METTH/18-289--------------------------------------------------------------------------------
O26442_METTH/7-278--------------------------------------------------------------------------------
YABM_BACSU/12-309--------------------------------------------------------------------------------
WZXC_ECOLI/9-276--------------------------------------------------------------------------------
Q2K5A6_RHIEC/11-272--------------------------------------------------------------------------------
Q32EG2_SHIDS/2-269--------------------------------------------------------------------------------
Q8DZE2_STRA5/6-273--------------------------------------------------------------------------------
Q8P805_XANCP/25-289--------------------------------------------------------------------------------

PF13440

A8UQ25_9FLAO/16-256--------------------------------------------------------------------------------
B5JNG5_9BACT/22-272--------------------------------------------------------------------------------
D0YZQ3_LISDA/18-261--------------------------------------------------------------------------------
D2BRK8_DICD5/18-261--------------------------------------------------------------------------------
B1IZZ3_ECOLC/18-261--------------------------------------------------------------------------------
D0I1Y2_VIBCL/18-260--------------------------------------------------------------------------------
D0HB98_VIBMI/18-260--------------------------------------------------------------------------------
A9AXJ4_HERA2/36-280--------------------------------------------------------------------------------
A4EAS6_9ACTN/45-291--------------------------------------------------------------------------------
Q2YCG5_NITMU/22-272--------------------------------------------------------------------------------
B9JQS0_AGRRK/94-340--------------------------------------------------------------------------------
C2KV49_9FIRM/32-288--------------------------------------------------------------------------------
C8XCC3_NAKMY/40-272--------------------------------------------------------------------------------
Q3K9H6_PSEPF/12-266--------------------------------------------------------------------------------
O58733_PYRHO/24-253--------------------------------------------------------------------------------
C8KY87_9PAST/18-266--------------------------------------------------------------------------------
C5RZU1_9PAST/18-266--------------------------------------------------------------------------------
Q1D7B4_MYXXD/29-283--------------------------------------------------------------------------------
C4WNX8_9RHIZ/31-284--------------------------------------------------------------------------------
A6X6T8_OCHA4/16-269--------------------------------------------------------------------------------
B1M5Z3_METRJ/17-264--------------------------------------------------------------------------------
A1UCH8_MYCSK/30-289--------------------------------------------------------------------------------
A3PW68_MYCSJ/30-289--------------------------------------------------------------------------------
Q89SM5_BRADU/14-269--------------------------------------------------------------------------------
Q2CIK8_OCEGH/14-260--------------------------------------------------------------------------------
C7LVX3_DESBD/8-264--------------------------------------------------------------------------------
A4FEI7_SACEN/8-256--------------------------------------------------------------------------------
C5ATW3_METEA/42-293--------------------------------------------------------------------------------
A9VW94_METEP/42-293--------------------------------------------------------------------------------
B7KU42_METC4/42-293--------------------------------------------------------------------------------
C7C8V6_METED/42-293--------------------------------------------------------------------------------
C8XCR8_NAKMY/39-289--------------------------------------------------------------------------------
Q0RPT3_FRAAA/322-573--------------------------------------------------------------------------------
D3CWT1_9ACTO/203-455--------------------------------------------------------------------------------
Q0RCF1_FRAAA/179-430--------------------------------------------------------------------------------
D2PZ16_KRIFD/24-275--------------------------------------------------------------------------------
Q8KN00_9ACTO/40-289--------------------------------------------------------------------------------
D6EG66_STRLI/34-283--------------------------------------------------------------------------------
A8UIN6_9FLAO/18-257--------------------------------------------------------------------------------
M1I249_9CREN/28-278--------------------------------------------------------------------------------
A6Q4F3_NITSB/16-266--------------------------------------------------------------------------------
B8CST1_SHEPW/46-301--------------------------------------------------------------------------------
A6FGK5_9GAMM/27-282--------------------------------------------------------------------------------
Q8EFK4_SHEON/24-279--------------------------------------------------------------------------------
A6WPP6_SHEB8/25-280--------------------------------------------------------------------------------
A1RKH9_SHESW/25-280--------------------------------------------------------------------------------