Sequence alignment for CL0222

PF01943

SP5B_BACSU/6-308-FLKGTLILIAAGMVTRMLGFVNRVVIAR---------------------------------------------------
EXOT_RHIME/10-277-VTRNVGWSVLSKTGTFGLKFVTVPILAR---------------------------------------------------
TUAB_BACSU/10-277-SGAKWTSISTMCITI..IQIVQFALLGN---------------------------------------------------
RFBX_ECOLI/8-279-LRRNVIYLAVVQGSNYLLPLLTFPYLVR---------------------------------------------------
O26447_METTH/15-286-VLDNIISLTGIQLVQYLLPLITFPYLTR---------------------------------------------------
YTGP_BACSU/5-320-LLRGTFVLTLGTYISRILGMVYLIPFSI---------------------------------------------------
Y1068_METJA/7-302-AVKGVSWHLLSYFLAAPIAYLVRVLYAN---------------------------------------------------
Y1375_METJA/3-283-LCKDSIYILMSNLYSKGMAYLFYFITAF---------------------------------------------------
O26479_METTH/10-276-LARNTAFLLVATLFTNLAAFVWNVYLAR---------------------------------------------------
O29660_ARCFU/6-285-VLKNVIYNSSSVLIGNLAGLVISIYVAR---------------------------------------------------
O26467_METTH/18-289-LAENFLSLSTLQVLVYIIPFITLPYLTR---------------------------------------------------
O26442_METTH/7-278-IVKNIGVTGSAQILTALMSFVFMIYLAR---------------------------------------------------
YABM_BACSU/12-309-IWQGAFVLILAGVITKILSAVYRVPFQN---------------------------------------------------
WZXC_ECOLI/9-276-SGAKWSAIATVIIIG..LGLVQMTVLAR---------------------------------------------------
Q2K5A6_RHIEC/11-272-...GSMWLSLSRAIVNGLSALSTFVLAW---------------------------------------------------
Q32EG2_SHIDS/2-269-.KKNILLLFLVHGANYLFPFIVLPYQTR---------------------------------------------------
Q8DZE2_STRA5/6-273-LLQSGFIYTLGNLLVQGLAFITLPIYTR---------------------------------------------------
Q8P805_XANCP/25-289-...GAAVTMIGQSAKMIVQFGGIVLLAR---------------------------------------------------

PF13440

I4HBM6_MICAE/6-298-------------------------ILAR---------------------------------------------------
I0T9J8_9BACT/34-326-------------------------ILAR---------------------------------------------------
C4ZJE4_THASP/32-325-------------------------ALSR---------------------------------------------------
K9PM46_9CYAN/51-343-------------------------VLAR---------------------------------------------------
A9KN88_CLOPH/33-329-------------------------ILAR---------------------------------------------------
M0N8I3_9EURY/48-343-------------------------LVAR---------------------------------------------------
E5VCV6_9BACE/28-323-------------------------ILTR---------------------------------------------------
A4A6G8_9GAMM/8-300-------------------------VMAR---------------------------------------------------
R6E9E7_9BACE/31-323-------------------------VLAR---------------------------------------------------
K6YGT5_9ALTE/31-321-------------------------LLAR---------------------------------------------------
F3KH97_9GAMM/34-324-------------------------VLAR---------------------------------------------------
C0CUD1_9FIRM/143-435-------------------------LLAR---------------------------------------------------
R7DCU6_9PORP/33-325-------------------------FMAR---------------------------------------------------
R6YG40_9FIRM/34-326-------------------------VLAR---------------------------------------------------
H1DLG1_9PORP/33-325-------------------------LLAR---------------------------------------------------
M5DLR8_9PROT/54-346-------------------------VLAR---------------------------------------------------
C6LGC8_9FIRM/33-329-------------------------ILAR---------------------------------------------------
K5CQA8_9BACE/33-325-------------------------VLAR---------------------------------------------------
B8HLM4_CYAP4/51-343-------------------------ILAR---------------------------------------------------
G5F456_9ACTN/34-326-------------------------VMAR---------------------------------------------------
R6A4H2_9BACE/33-325-------------------------VLAR---------------------------------------------------
S5C4K3_ALTMA/35-325-------------------------VLVR---------------------------------------------------
L8F559_MYCSM/28-320-------------------------IVAR---------------------------------------------------

PF04506

RFT1_CANGA/9-542KTTRGATFLMMGQLFSKIVTFLLNNTLVR..-------------------------------------------------
E9IWP9_SOLIN/8-542SSLENASFSIIFQIFCRCVTFGLNAFVIR..-------------------------------------------------
S9VRB9_SCHCR/24-535SSSKGLGSSIFFQSISRGLTFVLNQLTIR..-------------------------------------------------
C5E2W4_LACTC/16-558RSAKGVTFLMFSQLFSKIVTFILNTLLVR..-------------------------------------------------
E9EIH0_METAQ/28-566SMVQGASLLILLQLISRLITFVANQLLLR..-------------------------------------------------
G8BWS7_TETPH/20-558KSTKAATFLMMGQLFTKIVTFLLNNLLVR..-------------------------------------------------
H2ASC3_KAZAF/14-533KSAKGATFLVLGQLFTKMSTFLLNSLLIR..-------------------------------------------------
RFT1_YARLI/102-645TSAAGATLLIGIQILSKLASFGLNQMLLL..-------------------------------------------------
RFT1_SCHPO/10-520SSSKGLRSSIFFQGSSRILTFFLNQLTIR..-------------------------------------------------
I2GX14_TETBL/21-581KSTKGATFLMMTQIFTKMITFILNSLLVR..-------------------------------------------------
A7TRS5_VANPO/18-551KSAKGATFLMMGQFFTKLVTFFLNSLLVR..-------------------------------------------------
J7R8K9_KAZNA/27-584.STKGATFLMFGQLFTKLVSFALNSVLIR..-------------------------------------------------
M2PSW7_CERS8/12-528..LTSASFLVLLQLFSRLFTFILNQALVR..-------------------------------------------------
RFT1_CAEEL/2-516SLFSSLVHNVRGQLIARIISFAINMYLLR..-------------------------------------------------
G8ZPN0_TORDC/18-550KSTKGATFLMMGQLFTKLITFVLNNVLVR..-------------------------------------------------
C4R7X1_PICPG/21-528KSASGASFLMLTQLSSKLCTFFINQLLMS..-------------------------------------------------
U5D209_AMBTC/17-521......FYLIASQVISRALSFLLNLLIAR..-------------------------------------------------
G0W6B8_NAUDC/22-586KSTKGATFLMLGQLFTKLITFFLNSLLVR..-------------------------------------------------
E2AM70_CAMFO/8-540SSLENASFSIIFQIFCRCITFLLNAFVVR..-------------------------------------------------
E9GUV5_DAPPU/9-536GSIKSASYNMILQVAFRVITFVLNGLVLH..-------------------------------------------------
D8M9P3_BLAHO/10-506..ARSAGLNMVIQVLNRLFSFLINAILIR..-------------------------------------------------
F4K836_ARATH/105-602......KFSLSRQFISRSIPFVFNSWIVR..-------------------------------------------------
U4LAR2_PYROM/52-567.SAAGARYLILLSISSRLLTFLVNNLLLR..-------------------------------------------------
RFT1_DROME/8-549SSLLGAGFSIIFQILCRILTFGINAYIVR..-------------------------------------------------
G8BFC9_CANPC/25-545.SAKGISSLIFVQVITKLFTFILNQALIR..-------------------------------------------------
M3BX75_SPHMS/8-530SSARGAGFLILLQVSSRALTFALNQLLLR..-------------------------------------------------
W4Z9M3_STRPU/12-532SSARSASYNMVLQVMFRVLTFMLNAFIIKYG-------------------------------------------------
RFT1_ASHGO/11-543KSTQGATFLMMGQLFGKLVTFVLHNVLVR..-------------------------------------------------
M3K0B3_CANMX/13-532QSAKGVTYLILVQIITKLFTFILNQLIIR..-------------------------------------------------
G8JV96_ERECY/11-550KSTKGATFLMLGQLFTKVVTFILNTLLVR..-------------------------------------------------
G0V9M8_NAUCC/17-571KSTKGATFLMLGQLFTKAITFFLNSILVR..-------------------------------------------------
H9J737_BOMMO/8-547SSLENASFNILIQILFRCITFIINAWVIR..-------------------------------------------------
R4XDT4_TAPDE/6-505SSLKGTTYLILLQAVSRVLTFTLNQLILR..-------------------------------------------------
RFT1_YEAST/18-565RSTTGATFLMMGQLFTKLVTFILNNLLIR..-------------------------------------------------

PF14667

Q03SZ7_LACBA/349-498--------------------------------------------------------------------------------
Q38V74_LACSS/358-503--------------------------------------------------------------------------------
Q034V3_LACC3/356-499--------------------------------------------------------------------------------
A8UAN8_9LACT/362-510--------------------------------------------------------------------------------
D0BM46_9LACT/359-506--------------------------------------------------------------------------------
C8NI78_9LACT/366-514--------------------------------------------------------------------------------
C0WQN7_LACBU/354-501--------------------------------------------------------------------------------
C2EHH6_9LACO/356-502--------------------------------------------------------------------------------
E6LEY4_9ENTE/358-506--------------------------------------------------------------------------------
C9A420_ENTGA/359-508--------------------------------------------------------------------------------
C2HEH9_ENTFC/359-507--------------------------------------------------------------------------------
C0X942_ENTFL/359-507--------------------------------------------------------------------------------
E0RUK9_BUTPB/373-516--------------------------------------------------------------------------------
E7MM58_9FIRM/379-526--------------------------------------------------------------------------------
E4LZJ6_9CLOT/384-531--------------------------------------------------------------------------------
D4W2K6_9FIRM/377-526--------------------------------------------------------------------------------
D5E4C9_BACMQ/373-523--------------------------------------------------------------------------------
B7JJF5_BACC0/376-524--------------------------------------------------------------------------------
Q8EP19_OCEIH/372-521--------------------------------------------------------------------------------
B1YKH1_EXIS2/386-534--------------------------------------------------------------------------------
D6Y0K7_BACIE/382-530--------------------------------------------------------------------------------
Q5WE75_BACSK/374-522--------------------------------------------------------------------------------
E6U1Q3_BACCJ/375-523--------------------------------------------------------------------------------
D3FXP2_BACPE/374-522--------------------------------------------------------------------------------
A4IRX9_GEOTN/371-520--------------------------------------------------------------------------------
D5DN36_BACMD/374-521--------------------------------------------------------------------------------
A7Z7U6_BACA2/375-524--------------------------------------------------------------------------------
A0RJU4_BACAH/372-520--------------------------------------------------------------------------------
E7RE43_9BACL/368-516--------------------------------------------------------------------------------
A3I8W7_9BACI/372-521--------------------------------------------------------------------------------
A6CQJ8_9BACI/372-520--------------------------------------------------------------------------------
A0A0E0UWL5_LISMM/370-518--------------------------------------------------------------------------------
Q2FXH6_STAA8/386-533--------------------------------------------------------------------------------
B9E7H2_MACCJ/374-522--------------------------------------------------------------------------------
D5T1U4_LEUKI/363-511--------------------------------------------------------------------------------
Q03XR0_LEUMM/330-477--------------------------------------------------------------------------------
A0NHL2_OENOE/387-534--------------------------------------------------------------------------------
B1MY12_LEUCK/485-634--------------------------------------------------------------------------------
C2KKY7_LEUMC/498-647--------------------------------------------------------------------------------
C0WLU0_LACBU/374-518--------------------------------------------------------------------------------
C2EP42_9LACO/342-483--------------------------------------------------------------------------------
H7C726_ENTFA/370-519--------------------------------------------------------------------------------
C5RB06_WEIPA/501-648--------------------------------------------------------------------------------
A8UCR2_9LACT/391-539--------------------------------------------------------------------------------
A2RMM4_LACLM/390-539--------------------------------------------------------------------------------
T0UE48_9ENTE/381-529--------------------------------------------------------------------------------
E6LIJ6_9ENTE/381-529--------------------------------------------------------------------------------
Q838A3_ENTFA/382-530--------------------------------------------------------------------------------
C2H7P1_ENTFC/381-529--------------------------------------------------------------------------------
A4VW05_STRSY/379-527--------------------------------------------------------------------------------
E3CI47_STRDO/375-523--------------------------------------------------------------------------------
A3CPL5_STRSV/375-523--------------------------------------------------------------------------------
E8K660_STRPA/410-558--------------------------------------------------------------------------------
B1SH45_9STRE/377-525--------------------------------------------------------------------------------
C2LQ70_STRSL/432-580--------------------------------------------------------------------------------
A5VL26_LACRD/382-530--------------------------------------------------------------------------------
D2ELV8_PEDAC/393-541--------------------------------------------------------------------------------
C0WUG9_LACBU/378-530--------------------------------------------------------------------------------
Q03RI1_LACBA/378-525--------------------------------------------------------------------------------
Q1WUT1_LACS1/381-529--------------------------------------------------------------------------------
Q38VP9_LACSS/378-526--------------------------------------------------------------------------------
C8PCY7_9LACO/375-523--------------------------------------------------------------------------------
C2E7U4_LACJH/384-532--------------------------------------------------------------------------------
C2KAZ9_9LACO/380-528--------------------------------------------------------------------------------
Q03AT6_LACC3/380-528--------------------------------------------------------------------------------
D0BKY7_9LACT/390-538--------------------------------------------------------------------------------
C8NE09_9LACT/413-561--------------------------------------------------------------------------------
E4KNA5_9LACT/790-938--------------------------------------------------------------------------------
D4YJ56_9LACT/433-583--------------------------------------------------------------------------------
E0IFR0_9BACL/366-514--------------------------------------------------------------------------------
E0RCM4_PAEP6/382-529--------------------------------------------------------------------------------
C6J0R0_9BACL/364-511--------------------------------------------------------------------------------
C0Z9G8_BREBN/364-513--------------------------------------------------------------------------------
C4GB38_9FIRM/387-530--------------------------------------------------------------------------------
R5F1U8_9CLOT/387-539--------------------------------------------------------------------------------
E6LN70_9FIRM/381-525--------------------------------------------------------------------------------
D4KXJ4_9FIRM/383-527--------------------------------------------------------------------------------
E3GGE0_EUBLK/365-508--------------------------------------------------------------------------------
E6MGM4_9FIRM/373-516--------------------------------------------------------------------------------
B8D0L3_HALOH/359-505--------------------------------------------------------------------------------
C6PQD8_9CLOT/131-275--------------------------------------------------------------------------------
C8VXJ1_DESAS/366-509--------------------------------------------------------------------------------
D9QSV7_ACEAZ/363-507--------------------------------------------------------------------------------
B2A8K9_NATTJ/363-507--------------------------------------------------------------------------------
A8MK38_ALKOO/363-506--------------------------------------------------------------------------------
A5D2G5_PELTS/358-502--------------------------------------------------------------------------------
D5X9J9_THEPJ/361-503--------------------------------------------------------------------------------
B2A2Z4_NATTJ/361-504--------------------------------------------------------------------------------
C7GYH1_9FIRM/373-517--------------------------------------------------------------------------------
A6TN15_ALKMQ/363-506--------------------------------------------------------------------------------
A8MIG9_ALKOO/365-508--------------------------------------------------------------------------------
Q67JD5_SYMTH/384-522--------------------------------------------------------------------------------
C4FNY8_9FIRM/361-503--------------------------------------------------------------------------------
D3LVV9_9FIRM/358-500--------------------------------------------------------------------------------
E2ZD67_9FIRM/360-502--------------------------------------------------------------------------------
R5TDG3_9FIRM/363-506--------------------------------------------------------------------------------
D3LX29_9FIRM/358-500--------------------------------------------------------------------------------
C4FPR1_9FIRM/359-501--------------------------------------------------------------------------------
A1HLQ5_9FIRM/371-513--------------------------------------------------------------------------------
C4V2B6_9FIRM/374-517--------------------------------------------------------------------------------
E8LB44_9FIRM/369-509--------------------------------------------------------------------------------
C0WBK9_9FIRM/378-517--------------------------------------------------------------------------------
B7DPH6_9BACL/373-525--------------------------------------------------------------------------------
C0ZHE2_BREBN/367-517--------------------------------------------------------------------------------
C2YMP0_BACCE/352-495--------------------------------------------------------------------------------
B7GMA5_ANOFW/366-505--------------------------------------------------------------------------------
E7RL93_9BACL/356-500--------------------------------------------------------------------------------
D3FZH8_BACPE/357-501--------------------------------------------------------------------------------
B0MPG6_9FIRM/391-534--------------------------------------------------------------------------------
B0PEA8_9FIRM/441-584--------------------------------------------------------------------------------
A7VWY4_9FIRM/433-577--------------------------------------------------------------------------------
E6TRQ4_BACCJ/362-512--------------------------------------------------------------------------------
D5WSL0_KYRT2/373-521--------------------------------------------------------------------------------
B1YGP9_EXIS2/345-491--------------------------------------------------------------------------------
C5RD31_WEIPA/359-505--------------------------------------------------------------------------------
Q8EU30_OCEIH/362-509--------------------------------------------------------------------------------
B9E8U7_MACCJ/341-481--------------------------------------------------------------------------------
Q49V13_STAS1/337-479--------------------------------------------------------------------------------
E8SIP0_STAPH/344-486--------------------------------------------------------------------------------
Q2G0R7_STAA8/343-485--------------------------------------------------------------------------------
F2F183_SOLSS/360-508--------------------------------------------------------------------------------
A3IEA1_9BACI/365-514--------------------------------------------------------------------------------
E7RLD1_9BACL/354-503--------------------------------------------------------------------------------
A0AF13_LISW6/361-504--------------------------------------------------------------------------------
D7UUI0_LISGR/356-499--------------------------------------------------------------------------------
A6CR25_9BACI/352-499--------------------------------------------------------------------------------
E5WT44_9BACI/362-510--------------------------------------------------------------------------------
U5L445_9BACI/362-508--------------------------------------------------------------------------------
A8F924_BACP2/360-506--------------------------------------------------------------------------------
T5HW26_BACLI/356-502--------------------------------------------------------------------------------
A7Z0I0_BACA2/354-499--------------------------------------------------------------------------------
D4G3E4_BACNB/359-505--------------------------------------------------------------------------------
D5D970_BACMD/362-511--------------------------------------------------------------------------------
B7GFI4_ANOFW/350-497--------------------------------------------------------------------------------
A4IJD3_GEOTN/352-496--------------------------------------------------------------------------------
C5D378_GEOSW/360-505--------------------------------------------------------------------------------
Q5WAF7_BACSK/347-496--------------------------------------------------------------------------------
D3FR13_BACPE/361-509--------------------------------------------------------------------------------
Q9KGJ0_BACHD/361-507--------------------------------------------------------------------------------
D6XV50_BACIE/360-507--------------------------------------------------------------------------------
D3E759_GEOS4/381-532--------------------------------------------------------------------------------
E0RM54_PAEP6/373-525--------------------------------------------------------------------------------
A7GJW7_BACCN/360-506--------------------------------------------------------------------------------
B5UWQ0_BACCE/360-510--------------------------------------------------------------------------------
D2BMG7_LACLK/323-465--------------------------------------------------------------------------------
B8IEZ7_METNO/324-461--------------------------------------------------------------------------------
C7NM90_HALUD/327-463--------------------------------------------------------------------------------
A6DHF1_9BACT/293-436--------------------------------------------------------------------------------
Q47U72_COLP3/338-481--------------------------------------------------------------------------------
B4AGJ7_BACPU/343-486--------------------------------------------------------------------------------
Q1K412_DESAC/351-495--------------------------------------------------------------------------------
C0QCL2_DESAH/352-496--------------------------------------------------------------------------------
Q2YCG5_NITMU/323-466--------------------------------------------------------------------------------
E6QMG7_9ZZZZ/367-517--------------------------------------------------------------------------------
F2G999_ALTMD/323-467--------------------------------------------------------------------------------
C6JQC3_FUSVA/323-462--------------------------------------------------------------------------------
E5X0H2_9BACE/326-464--------------------------------------------------------------------------------
A3DHV8_CLOTH/327-465--------------------------------------------------------------------------------
B5CWR8_BACPM/324-466--------------------------------------------------------------------------------
F1VXT7_9BURK/320-462--------------------------------------------------------------------------------
Q2YCC1_NITMU/331-475--------------------------------------------------------------------------------
Q0AHL3_NITEC/325-466--------------------------------------------------------------------------------
D4YX22_SPHJU/336-476--------------------------------------------------------------------------------
Q1GPL1_SPHAL/342-484--------------------------------------------------------------------------------
B0VF98_CLOAI/326-465--------------------------------------------------------------------------------
A1S103_THEPD/335-472--------------------------------------------------------------------------------
E8R8C0_DESM0/349-487--------------------------------------------------------------------------------
A3DIV8_CLOTH/358-500--------------------------------------------------------------------------------
F2JLQ5_CELLD/355-497--------------------------------------------------------------------------------
A7VPC0_9FIRM/355-497--------------------------------------------------------------------------------
A8SAU1_9FIRM/356-502--------------------------------------------------------------------------------
A6TSY6_ALKMQ/375-519--------------------------------------------------------------------------------
A6NPI5_9FIRM/351-494--------------------------------------------------------------------------------
B0KBP6_THEP3/360-504--------------------------------------------------------------------------------
B7AQB6_9FIRM/351-493--------------------------------------------------------------------------------
D3AN52_9CLOT/376-519--------------------------------------------------------------------------------
B0TAY6_HELMI/361-505--------------------------------------------------------------------------------
Q3ADH7_CARHZ/346-484--------------------------------------------------------------------------------
E0RMQ1_PAEP6/366-508--------------------------------------------------------------------------------
C0ZAP4_BREBN/363-505--------------------------------------------------------------------------------
D7WQC4_9BACI/353-489--------------------------------------------------------------------------------
C8WQG9_ALIAD/361-502--------------------------------------------------------------------------------
B7DPL3_9BACL/356-497--------------------------------------------------------------------------------
D5QEL1_KOMHA/351-483--------------------------------------------------------------------------------
A9WAD6_CHLAA/337-475--------------------------------------------------------------------------------
E1IEK9_9CHLR/380-529--------------------------------------------------------------------------------
B9JKJ2_AGRRK/321-464--------------------------------------------------------------------------------
Q2Y4J6_9ARCH/377-524--------------------------------------------------------------------------------
E8V165_TERSS/339-475--------------------------------------------------------------------------------
B8IGJ3_METNO/336-472--------------------------------------------------------------------------------
D7BDH0_MEISD/336-473--------------------------------------------------------------------------------
F2NKF2_MARHT/337-483--------------------------------------------------------------------------------
D8J725_HALJB/340-478--------------------------------------------------------------------------------
B8D178_HALOH/340-478--------------------------------------------------------------------------------
C4RGH8_9ACTN/364-502--------------------------------------------------------------------------------
Q18GU8_HALWD/357-496--------------------------------------------------------------------------------
Q469G3_METBF/349-484--------------------------------------------------------------------------------
C5A2Y0_THEGJ/342-480--------------------------------------------------------------------------------
F0LLW6_THEBM/342-478--------------------------------------------------------------------------------
F2KQE3_ARCVS/343-481--------------------------------------------------------------------------------
F0LLZ4_THEBM/339-477--------------------------------------------------------------------------------
Q5JDW0_THEKO/345-480--------------------------------------------------------------------------------
A1BJ49_CHLPD/337-476--------------------------------------------------------------------------------
B3EHD9_CHLL2/365-504--------------------------------------------------------------------------------
Q3APG3_CHLCH/338-477--------------------------------------------------------------------------------
B4SBS0_PELPB/338-477--------------------------------------------------------------------------------
Q3B6G9_PELLD/337-476--------------------------------------------------------------------------------
A4SCQ1_PROVI/337-476--------------------------------------------------------------------------------
D8PBA0_9BACT/336-473--------------------------------------------------------------------------------
D3SSH7_NATMM/337-474--------------------------------------------------------------------------------
B6IYF6_RHOCS/343-484--------------------------------------------------------------------------------
D0LQE6_HALO1/374-513--------------------------------------------------------------------------------
D2RVV2_HALTV/336-474--------------------------------------------------------------------------------
D3STC0_NATMM/337-475--------------------------------------------------------------------------------
D8J472_HALJB/339-477--------------------------------------------------------------------------------
D2RXY9_HALTV/340-478--------------------------------------------------------------------------------
E7QQ57_9EURY/339-477--------------------------------------------------------------------------------
C7P069_HALMD/318-461--------------------------------------------------------------------------------
C7NSR3_HALUD/331-469--------------------------------------------------------------------------------
Q5V4U1_HALMA/327-465--------------------------------------------------------------------------------
D8J7W8_HALJB/319-457--------------------------------------------------------------------------------
C7NSL6_HALUD/319-457--------------------------------------------------------------------------------
E4NUG7_HALBP/319-458--------------------------------------------------------------------------------
AGL15_HALVD/319-457--------------------------------------------------------------------------------
Q12VM9_METBU/345-483--------------------------------------------------------------------------------
A3CVY7_METMJ/333-471--------------------------------------------------------------------------------
A2STD2_METLZ/331-469--------------------------------------------------------------------------------
A5UQJ1_ROSS1/330-463--------------------------------------------------------------------------------
D3FFB8_CONWI/338-471--------------------------------------------------------------------------------
D8GMK0_CLOLD/327-460--------------------------------------------------------------------------------
Q97GQ2_CLOAB/326-458--------------------------------------------------------------------------------
D5XD05_THEPJ/326-457--------------------------------------------------------------------------------
Q2NIB6_METST/328-458--------------------------------------------------------------------------------
F0T719_METLA/333-463--------------------------------------------------------------------------------
Q2NH55_METST/331-464--------------------------------------------------------------------------------
E3GZ73_METFV/328-459--------------------------------------------------------------------------------
A5UNI7_METS3/328-460--------------------------------------------------------------------------------
F0TC71_METLA/328-460--------------------------------------------------------------------------------
Q12XY4_METBU/326-458--------------------------------------------------------------------------------
Q46FX4_METBF/329-461--------------------------------------------------------------------------------
F0TBQ9_METLA/329-463--------------------------------------------------------------------------------
Q0W809_METAR/331-464--------------------------------------------------------------------------------
D1Z261_METPS/328-462--------------------------------------------------------------------------------
O26442_METTH/329-460--------------------------------------------------------------------------------
A5UWW7_ROSS1/374-505--------------------------------------------------------------------------------
E1IAS8_9CHLR/378-523--------------------------------------------------------------------------------
D5UPU7_TSUPD/350-482--------------------------------------------------------------------------------
Q97AA3_THEVO/339-476--------------------------------------------------------------------------------
Q2S953_HAHCH/328-463--------------------------------------------------------------------------------
F2NHK3_DESAR/367-498--------------------------------------------------------------------------------
A3W1Y0_9RHOB/329-468--------------------------------------------------------------------------------
C4XGJ8_DESMR/335-465--------------------------------------------------------------------------------
A9EQ86_SORC5/331-462--------------------------------------------------------------------------------
B9K2D6_AGRVS/332-468--------------------------------------------------------------------------------
E3FNG9_STIAD/347-485--------------------------------------------------------------------------------
B6YVL8_THEON/328-461--------------------------------------------------------------------------------
E0I7A7_9BACL/353-491--------------------------------------------------------------------------------
D5DY76_BACMQ/331-468--------------------------------------------------------------------------------
D7E977_METEZ/332-466--------------------------------------------------------------------------------
A1ASY9_PELPD/345-481--------------------------------------------------------------------------------
E8RTH0_ASTEC/331-467--------------------------------------------------------------------------------
Q0AP11_MARMM/327-464--------------------------------------------------------------------------------
E7RZY6_9BURK/339-474--------------------------------------------------------------------------------
Q12TY8_METBU/325-459--------------------------------------------------------------------------------
D9PYX0_METTM/350-483--------------------------------------------------------------------------------
F0TB30_METLA/351-484--------------------------------------------------------------------------------
F0EKD4_ENTCA/327-465--------------------------------------------------------------------------------
Q5M4A4_STRT2/55-193--------------------------------------------------------------------------------
F0HVE0_LACDL/327-469--------------------------------------------------------------------------------
E4SMU5_LACAR/327-469--------------------------------------------------------------------------------
D4LGF1_9FIRM/327-469--------------------------------------------------------------------------------
A5ZUX1_9FIRM/326-464--------------------------------------------------------------------------------
D5TQD2_BACT1/321-460--------------------------------------------------------------------------------
Q5LFL1_BACFN/328-466--------------------------------------------------------------------------------
E8JWJ5_STRCR/327-467--------------------------------------------------------------------------------
Q4JZ09_STREE/330-470--------------------------------------------------------------------------------
E6MFC3_9FIRM/328-466--------------------------------------------------------------------------------
E9RY62_9FIRM/330-468--------------------------------------------------------------------------------
C5NWI0_9BACL/318-458--------------------------------------------------------------------------------
A1ILY9_STROR/319-458--------------------------------------------------------------------------------
Q4JYJ9_STREE/323-464--------------------------------------------------------------------------------
E0PD92_STREI/325-464--------------------------------------------------------------------------------
C6CSD9_PAESJ/327-465--------------------------------------------------------------------------------
B0N362_9FIRM/290-427--------------------------------------------------------------------------------
A5M4K0_STREE/211-349--------------------------------------------------------------------------------
C9LAR2_BLAHA/325-463--------------------------------------------------------------------------------
Q4K189_STREE/323-460--------------------------------------------------------------------------------
C4FB42_9ACTN/325-467--------------------------------------------------------------------------------
E0S188_BUTPB/322-462--------------------------------------------------------------------------------
C3HRG9_BACTU/323-461--------------------------------------------------------------------------------
A7HKJ9_FERNB/322-460--------------------------------------------------------------------------------
G5K6T2_9STRE/321-459--------------------------------------------------------------------------------
E7S3G0_STRAG/321-459--------------------------------------------------------------------------------
E0NHN4_PEDAC/321-459--------------------------------------------------------------------------------
E6LD53_9ENTE/253-391--------------------------------------------------------------------------------
C2KJQ1_LEUMC/329-467--------------------------------------------------------------------------------
B3XNV8_LACRE/322-460--------------------------------------------------------------------------------
B2GDL9_LACF3/322-460--------------------------------------------------------------------------------
C0WVB1_LACFE/322-460--------------------------------------------------------------------------------
A2RHU4_LACLM/321-459--------------------------------------------------------------------------------
A1YVF6_LACJH/321-459--------------------------------------------------------------------------------
C2D643_LACBR/210-348--------------------------------------------------------------------------------
Q3ZK40_9LACT/322-460--------------------------------------------------------------------------------
D8MET9_LEUGG/321-460--------------------------------------------------------------------------------
A3F4D6_LACLC/321-459--------------------------------------------------------------------------------
D2EJ27_PEDAC/321-459--------------------------------------------------------------------------------
O06039_LACLC/321-459--------------------------------------------------------------------------------
Q8GPE5_STRTR/321-459--------------------------------------------------------------------------------
D7DRX9_METV3/353-490--------------------------------------------------------------------------------
A4FX93_METM5/354-492--------------------------------------------------------------------------------
A6UPA0_METVS/351-488--------------------------------------------------------------------------------
A6UU30_META3/353-490--------------------------------------------------------------------------------
D5VU50_METIM/353-494--------------------------------------------------------------------------------
D4W1F1_9FIRM/338-485--------------------------------------------------------------------------------
B9DSP4_STRU0/342-480--------------------------------------------------------------------------------
F1Z193_9STRE/350-488--------------------------------------------------------------------------------
D4YGG7_9LACT/385-532--------------------------------------------------------------------------------
F2I7P9_AERUA/374-520--------------------------------------------------------------------------------
Q03E00_PEDPA/355-503--------------------------------------------------------------------------------
D2EHX4_PEDAC/355-503--------------------------------------------------------------------------------
A0A023M9A5_LACPN/357-507--------------------------------------------------------------------------------
E7FPH6_9LACO/355-501--------------------------------------------------------------------------------

PF03023

MURJ_BORBU/29-473FSYYFGANLDADIFNYVFNIPNNLRKILS..EGAMTSAFLPEFTHEK.N......KSHEKAVSFFRTVITFNIISIGLIV
MURJ_RICPR/28-477IASLFGSTPMGDSMNIAFKLPNLFRRIFA..EGALSSVFIPIYNEKM.L......ISKKAANNFSGKVFTLLSLTLIVII
MURJ_ECOLI/28-479VARIFGAGMATDAFFVAFKLPNLLRRIFA..EGAFSQAFVPILAEYKSK......QGEDATRVFVSYVSGLLTLALAVVT
MURJ_SYNY3/36-495IAAAFGVGTVVTAYAYAYVIPGFLFILLGGINGPFHSALVSVLSKRD..........REEAAPLVETVTTLVSGVLLGVT
MURJ_AQUAE/29-466VAYYFGASAVSDAFFIAFRIPNAFRRIFG..EGGFNAVFIPFYGEAV.........KQNREEEFLRKTFGLLITFSLSVV
MURJ_HAEIN/16-479IAHLIGAGAAADVFLFANRIPNFLRRLFA..EGAFSQAFVPVLAEYQQS......GDMNKTREFIGKVSGTLGGLVSIVT
MURJ_THEMA/28-450LAKTFGASSTLDAYYVSIVFPFFLRRTFA..EGAMSSAFMAIYKKLK.........NKEEKAQFTSAVLTSLGLVTLLIV
Q9X8T0_STRCO/300-778IVSALGVGLLGDTFQVAYQLPTMIYILTV..GGGLNSVFVPQLVRAMKD.......DEDGGEAFANRLLTLVMVALGALT
MURJ_TREPA/32-489KSTLMGTSATADAFTVAFMIPNLFRRLFA..ENAISVAFIPVFTQHYSMPSSAQVPCSSKTKEFLSAIFTLMSSVTASIS
Q9RX17_DEIRA/83-522IN..LFDTTLTDAFNVAIKVPNLMRELLA..EGALVNSFIPVYKTLD..........AAERRKLAQSFSGFLIAINLLLM
MURJ_CHLTR/34-482MATYFGADPLVASFWLAFRTIFFLRKLLG..GPILGLAFIPHFEFLR.A......QNISRATFFFRSFSRFFCYSAILFT
MURJ_HELPY/2-458MANILGAGVYSDIFFVAFKLPNLFRRIFA..EGSFSQSFLPSFIRSS........IKGSFASLVGLIFCIVLFMWCLLVA
MVIN_MYCTU/48-521LAAILGAALASS.FSVANQLPNLVAALVL..EATFTAIFVPVLARAE.Q......DDPDGGAAFVRRLVTLATTLLLGAT

PF01554

O51531_BORBU/22-182--------------------------------------------------------------------------------
YOEA_BACSU/28-189--------------------------------------------------------------------------------
YOEA_BACSU/257-418--------------------------------------------------------------------------------
O66528_AQUAE/245-406--------------------------------------------------------------------------------
YPNP_BACSU/241-402--------------------------------------------------------------------------------
NORM_VIBPA/243-404--------------------------------------------------------------------------------
O80695_ARATH/278-441--------------------------------------------------------------------------------
O26414_METTH/244-409--------------------------------------------------------------------------------
O28801_ARCFU/21-180--------------------------------------------------------------------------------
YISQ_BACSU/27-187--------------------------------------------------------------------------------
Y709_METJA/243-408--------------------------------------------------------------------------------
YPNP_BACSU/21-182--------------------------------------------------------------------------------
O25454_HELPY/214-375--------------------------------------------------------------------------------
NORM_BACSU/20-180--------------------------------------------------------------------------------
HMRM_HAEIN/249-410--------------------------------------------------------------------------------
O49660_ARATH/262-426--------------------------------------------------------------------------------
O82752_ARATH/42-203--------------------------------------------------------------------------------
DINF_ECOLI/35-196--------------------------------------------------------------------------------
Q9ZVH5_ARATH/238-401--------------------------------------------------------------------------------
O28801_ARCFU/239-404--------------------------------------------------------------------------------
Q38956_ARATH/275-438--------------------------------------------------------------------------------
ERC1_YEAST/174-335--------------------------------------------------------------------------------
Q9ZVH5_ARATH/16-176--------------------------------------------------------------------------------
YAO6_SCHPO/17-177--------------------------------------------------------------------------------
O82752_ARATH/264-427--------------------------------------------------------------------------------
O51429_BORBU/27-187--------------------------------------------------------------------------------
O83871_TREPA/32-196--------------------------------------------------------------------------------
O51429_BORBU/248-409--------------------------------------------------------------------------------
YISQ_BACSU/252-413--------------------------------------------------------------------------------
O66528_AQUAE/25-183--------------------------------------------------------------------------------
O51530_BORBU/21-181--------------------------------------------------------------------------------
Y709_METJA/21-181--------------------------------------------------------------------------------
NORM_BACSU/247-408--------------------------------------------------------------------------------
NORM_VIBPA/17-176--------------------------------------------------------------------------------
O26414_METTH/24-183--------------------------------------------------------------------------------
HMRM_HAEIN/22-181--------------------------------------------------------------------------------
YD338_YEAST/238-397--------------------------------------------------------------------------------
MDTK_ECOLI/17-177--------------------------------------------------------------------------------
Q38956_ARATH/55-215--------------------------------------------------------------------------------
P71616_MYCTU/19-179--------------------------------------------------------------------------------
O49660_ARATH/40-200--------------------------------------------------------------------------------
O80695_ARATH/57-217--------------------------------------------------------------------------------
MDTK_ECOLI/244-405--------------------------------------------------------------------------------
F4IHU9_ARATH/37-197--------------------------------------------------------------------------------
O25796_HELPY/23-184--------------------------------------------------------------------------------
YEEO_ECOLI/48-208--------------------------------------------------------------------------------
Q8DNG1_STRR6/24-183--------------------------------------------------------------------------------

PF07260

G1KED7_ANOCA/1-345MVKFPALTNYW---------------------------------------------------------------------
I3JFW4_ORENI/1-349MVEFPSLSPYW---------------------------------------------------------------------
F1Q528_DANRE/1-344MKDCLSETAYW---------------------------------------------------------------------

PF01943

SP5B_BACSU/6-308-------------------------------------FIGEEGVGLYMMAAPTFFLATTL----TQF-GLPVAISKLVAE
EXOT_RHIME/10-277-------------------------------------ILSPEEFGAVAVALTVVQFLAMI----GGA-GLTSALVIQQHE
TUAB_BACSU/10-277-------------------------------------MMTLTEFGLVGMITTVTVFAQIV----LDM-GFGAALIQRDDA
RFBX_ECOLI/8-279-------------------------------------TLGPENFGIFGFCQATMLYMIMF----VEY-GFNLTATQSIAK
O26447_METTH/15-286-------------------------------------VLGPANFGKVAFAVAFITYFQIL----TDY-GFNFSATREISI
YTGP_BACSU/5-320-------------------------------------MVGATGGALFQYGYNQYTLFLNI----ATM-GFPAAVSKFVSK
Y1068_METJA/7-302-------------------------------------EIPKLDVGLFYAVLDFFSMLVVF----RAF-GLDQALIRYIPK
Y1375_METJA/3-283-------------------------------------LLGTEAFGILKGLMPIADTLTIF----FSS-GIPPAIAKFLAE
O26479_METTH/10-276-------------------------------------YLGTAGFGILSTALALTGIFSIL----ADL-GIGTYITREIAR
O29660_ARCFU/6-285-------------------------------------VLKPELFGIYSLAISVAFLLMTF----TDL-GINATLVRYVAH
O26467_METTH/18-289-------------------------------------VLGVYNYGLVNFAIAFNTYFIII----TDY-GFNLSAVREISV
O26442_METTH/7-278-------------------------------------FLGEAGFGKYNFAFSLTTLLVTF----TDL-GVNQLLVREIAR
YABM_BACSU/12-309-------------------------------------IVGDVGFYIYQQVYPFLGIAVML----STS-GFPVIISKLMND
WZXC_ECOLI/9-276-------------------------------------IIDNHQFGLLTVSLVIIALADTL----SDF-GIANSIIQRKEI
Q2K5A6_RHIEC/11-272-------------------------------------YLVPADFGLVAIATTIQVILSSV----TEL-SLNQALIRHESP
Q32EG2_SHIDS/2-269-------------------------------------ILSIETFADVAKIQAAVMLLSLI----VNY-GYNLSSTRAIAR
Q8DZE2_STRA5/6-273-------------------------------------VISTEVYGQYSLYVAWMGIITLF----IGL-QTSGSLSSARVK
Q8P805_XANCP/25-289-------------------------------------LLTPYDYGLMAMVTAIVGAAEIL----RDF-GLSAAAVQAKHV

PF13440

I4HBM6_MICAE/6-298-------------------------------------LLTPEAFGLVALSNVLINFMQIF----LNQ-GFAQLLIQKQ.D
I0T9J8_9BACT/34-326-------------------------------------LLSPSDYGIIAMVTIFFAVAQSF----VDS-GFSNALVRKT.D
C4ZJE4_THASP/32-325-------------------------------------LLTPSEFGQVTAALTVVSLSTIF----SQM-GVGQALVQSE.S
K9PM46_9CYAN/51-343-------------------------------------LLTPQDYGIVGMVTAITGFVTLF----KDL-GLSTATVQKE.E
A9KN88_CLOPH/33-329-------------------------------------ILTPEAFGVVASITMITSLADIF----SDA-GFQSFLVQHEFK
M0N8I3_9EURY/48-343-------------------------------------LIGPDSYGVMALALVVMSALTKL----SRL-GIDAALIQREAD
E5VCV6_9BACE/28-323-------------------------------------FLRKEDFGLIAIAVLVISFTEIF----MDM-GISSAVLHKQ.D
A4A6G8_9GAMM/8-300-------------------------------------FLSPADFGAYAIVMMFINFALIF----GSA-GVSQILIMKR.D
R6E9E7_9BACE/31-323-------------------------------------LVSPEEFGIVSLASVMIAFFSIC----TSM-GIVPAIIQRN.D
K6YGT5_9ALTE/31-321-------------------------------------LLSVEEFGLIAFSFLILELGNLF----VGF-GINQNLIQKN.E
F3KH97_9GAMM/34-324-------------------------------------LLTPEDFGFVAIAMALFALLSLV----KDF-GFDTVIIQMK.S
C0CUD1_9FIRM/143-435-------------------------------------LLTPAEYGLVGIVMIFITLANVT----VQS-GFSTALIQKK.N
R7DCU6_9PORP/33-325-------------------------------------ILQPSDYGMVGMLSIFLTISNML----ITS-GFYRALIQKK.D
R6YG40_9FIRM/34-326-------------------------------------LLSPSDFGVIVLITVFIDIANVF----VSS-GFGSALIQKK.E
H1DLG1_9PORP/33-325-------------------------------------LLSPNDFGCMGILLVFVTIADVL----VDG-GLGLSLIQKQ.R
M5DLR8_9PROT/54-346-------------------------------------FLGPAEFGYYALCFMVVGVGYLL----AEM-GLSSALIQTR.S
C6LGC8_9FIRM/33-329-------------------------------------LLSPSEFGVVASITIITSFADIF----TDA-GFQKFVIQHEFD
K5CQA8_9BACE/33-325-------------------------------------LLSPDDFGIVAIATVIIAFFNLF----TDM-GVSPAIVQHK.T
B8HLM4_CYAP4/51-343-------------------------------------LLTPQDFGLIAMVATVTNLVTLF----KDM-GLSMATVQKA.E
G5F456_9ACTN/34-326-------------------------------------LLSPAEFGVLAIMLVFVNVGNVI----VQS-GLNTAIIQVP.D
R6A4H2_9BACE/33-325-------------------------------------LLSPDDFGCIAMLLVFISVSDAI----IDG-GFGSALIQKK.N
S5C4K3_ALTMA/35-325-------------------------------------LLSPQDFGVAAIAMSVYAFVSLF----GEF-GLNTALIQKT.N
L8F559_MYCSM/28-320-------------------------------------IISPAELGVYALAIAVYGFVVCL----AAW-GVCSAIGRSDLD

PF04506

RFT1_CANGA/9-542-------------------------------------YLSPRIFG.ITAFLEFIVGTVLF----FSREAIRLSTQRIADG
E9IWP9_SOLIN/8-542-------------------------------------HVGQAILGVINVRLLLLESMILF----LSREPFMKACLT....
S9VRB9_SCHCR/24-535-------------------------------------FTSPQAYAYSSIHFEILRSTILF----ISRESVRLAMQRMPSQ
C5E2W4_LACTC/16-558-------------------------------------YLSPRVFG.INAFLEFLLSTVLF----FSREAIRMSTLRIKSP
E9EIH0_METAQ/28-566-------------------------------------FLTPRLVG.LSSQLEVYYLSVLF----FARESLRVAIQRQGSS
G8BWS7_TETPH/20-558-------------------------------------YLSPRIFG.ITAFLEFLLGTVLF----FSREAIRISTLRIKDN
H2ASC3_KAZAF/14-533-------------------------------------FLSPRIFG.ITTFLEFLLNTILF----FSREAIRLSVWRISDS
RFT1_YARLI/102-645-------------------------------------VATPALFG.ANAQLEFVLNTVLF----FSREAVRLALQRLTLA
RFT1_SCHPO/10-520-------------------------------------LTSPSAYAFSSIHFEILQSTILF----LSRESVRLAMQRIPSE
I2GX14_TETBL/21-581-------------------------------------FLSPRIFG.ITAFLEFILGTVLF----FSREAIRLSTLRIKEN
A7TRS5_VANPO/18-551-------------------------------------FLSPRIFG.IIAFLEFILGTILF----FSREAIRLSTLRIKEN
J7R8K9_KAZNA/27-584-------------------------------------HLSPRIFG.ITSFLEFILGTTLF----FSREAMRLSILRISST
M2PSW7_CERS8/12-528-------------------------------------LVSPQVFGTAAIQFELLLSTILF----LSREGVRNALLRAPSS
RFT1_CAEEL/2-516-------------------------------------RINNDVLGLVNVRLTLLYSSILF----LTREPLRKA.......
G8ZPN0_TORDC/18-550-------------------------------------FLSPRIFG.ITAFLDFIVGTVLF----FSREAIRLSTLRIKDH
C4R7X1_PICPG/21-528-------------------------------------YISARILG.ATSYIDFLVATSLF----FSREAVRLSCQRIKLP
U5D209_AMBTC/17-521-------------------------------------QLTEVDYALYAIQFHLLVTTILF----LSREGFRRACMRTELW
G0W6B8_NAUDC/22-586-------------------------------------FLSPRIFG.ITAFLEFIVNTVLF----FSREAIRLSTLRITED
E2AM70_CAMFO/8-540-------------------------------------HVGQAILGVINVRLLLLESMILF----LSREPFMKACLT....
E9GUV5_DAPPU/9-536-------------------------------------NVDKDVLGILNVRLMLLIMTILF----VSREAFRRACMS....
D8M9P3_BLAHO/10-506-------------------------------------FVSIELIGVVNVRLSLFATTVVF----LSREPIRKACL.....
F4K836_ARATH/105-602-------------------------------------HLTERDYALYAIQFHLFVTCVLF----LSREGFRRACLRAGTK
U4LAR2_PYROM/52-567-------------------------------------YLSPSLLG.ISVQLELLSISILY----FSRESLRTALQRQSQN
RFT1_DROME/8-549-------------------------------------HVGREVLGIMNVRLLLLESTLLF----LSREAINRAALSANAQ
G8BFC9_CANPC/25-545-------------------------------------FVSPDVFG.LIVYLEFLQSSVLF----ISRESVRLAVQRIAHD
M3BX75_SPHMS/8-530-------------------------------------FLSPTLLG.ASVQLELFVISAHH----FARESLRVACQRQPEG
W4Z9M3_STRPU/12-532-------------------------------------YVHEDMLGVVNVRLMLLYSTILF----IAREAFRRACLS....
RFT1_ASHGO/11-543-------------------------------------FLSPRIFG.ITSFLDFLSSTVLF----FSREAIRLATLRIKTG
M3K0B3_CANMX/13-532-------------------------------------YLTPSIIG.ITTYLDFIYSTILF----FSRESIRLSIQRIQSK
G8JV96_ERECY/11-550-------------------------------------FLSPRIFG.ITSFLEFLSSTVLF----FSREAIRIATLRINGS
G0V9M8_NAUCC/17-571-------------------------------------FLSPRIFG.ITAFLEFILGTVLF----FSREAVRLSTLRIDDN
H9J737_BOMMO/8-547-------------------------------------NVGHEILGIMNVRLLLLESTILF----LSREPFNRACLG....
R4XDT4_TAPDE/6-505-------------------------------------YTTPSIFGFATIQLELLLSTILF----LCREGFRTAVQRLPVQ
RFT1_YEAST/18-565-------------------------------------FLSPRIFG.ITAFLEFIQGTVLF----FSRDAIRLSTLRISDS

PF14667

Q03SZ7_LACBA/349-498-------------------------------------MLDIYMLSIILATLI.QTYNSVL----QSQ-------------
Q38V74_LACSS/358-503-------------------------------------ALVWYMLSIVIIALI.NACNSVL----QSL-------------
Q034V3_LACC3/356-499-------------------------------------ALQLYAVAIVVVAMI.NAYNAIL----QSL-------------
A8UAN8_9LACT/362-510-------------------------------------VLSLYSVAILFASFI.GAYNAIF----QSQ-------------
D0BM46_9LACT/359-506-------------------------------------VLSIYIISIILASMM.MAYHGIL----QST-------------
C8NI78_9LACT/366-514-------------------------------------VLLVYITSIFFASVI.MSLHGIF----QSQ-------------
C0WQN7_LACBU/354-501-------------------------------------TIAVYCFSIVLTTII.LTYNMVL----QAH-------------
C2EHH6_9LACO/356-502-------------------------------------VIGIYLLGIILMTVI.NSYSSIL----QSI-------------
E6LEY4_9ENTE/358-506-------------------------------------TLLLFVFAIALMAII.QAFQSIE----QSR-------------
C9A420_ENTGA/359-508-------------------------------------ALVLFVFAVALMAAI.QAYQSIQ----QSR-------------
C2HEH9_ENTFC/359-507-------------------------------------ALVLFVFSIAFTAVI.QAYQSIA----QSK-------------
C0X942_ENTFL/359-507-------------------------------------VLGVYVLSIAFMAII.QAYQSIE----QSR-------------
E0RUK9_BUTPB/373-516-------------------------------------IFRLAAILIVLLSIG.VLVSWLL----NHM-------------
E7MM58_9FIRM/379-526-------------------------------------ALFWSSILAFGTTVT.PVLLSIL----LSL-------------
E4LZJ6_9CLOT/384-531-------------------------------------ILSWFSIEAFLNTIG.PIFTALL----MAV-------------
D4W2K6_9FIRM/377-526-------------------------------------IFLLGSLLGLFMALY.SIVTAIL----QGI-------------
D5E4C9_BACMQ/373-523-------------------------------------ILQWYAPMAILFALF.TVTASIL----QGI-------------
B7JJF5_BACC0/376-524-------------------------------------YLISFAPSAILSAIF.TVSAAIL----QGI-------------
Q8EP19_OCEIH/372-521-------------------------------------LMAWYAPVALLFGFI.TVTAGML----QGI-------------
B1YKH1_EXIS2/386-534-------------------------------------YLLSYAPSALFLALY.SVTAAVL----QGI-------------
D6Y0K7_BACIE/382-530-------------------------------------ILQFYAPVAILFSVF.AVTAALL----QGL-------------
Q5WE75_BACSK/374-522-------------------------------------TLGFYAPATVFFSIY.AVTGSIL----QGM-------------
E6U1Q3_BACCJ/375-523-------------------------------------MLKYYAPVAILFSIF.AVTSSLL----QGI-------------
D3FXP2_BACPE/374-522-------------------------------------VLQYYGPMTLLFSLF.AVTAAIL----QGM-------------
A4IRX9_GEOTN/371-520-------------------------------------VLRWYAPAAILYALF.SVTSAIM----QGI-------------
D5DN36_BACMD/374-521-------------------------------------VLLYYAPVALLFSFF.TVNGAIL----QGI-------------
A7Z7U6_BACA2/375-524-------------------------------------ILFWYAPVAILFSLF.TVNAAIL----QGI-------------
A0RJU4_BACAH/372-520-------------------------------------VLMWYAPVALLFALF.TVTAAIL----QGI-------------
E7RE43_9BACL/368-516-------------------------------------ILAHYLPVAILFSAF.PVTASIL----QGI-------------
A3I8W7_9BACI/372-521-------------------------------------ILAHYAPVAILFALF.QVTAALL----QGI-------------
A6CQJ8_9BACI/372-520-------------------------------------VLRTYAPVAILFALF.AVTAAIL----QGI-------------
A0A0E0UWL5_LISMM/370-518-------------------------------------LLQLFAPIAILFSLF.SVSAAVL----QGI-------------
Q2FXH6_STAA8/386-533-------------------------------------LLFYYAPVAILISLL.SVTASML----QGI-------------
B9E7H2_MACCJ/374-522-------------------------------------LLFYYAPVAILLALV.SVSSAML----QGI-------------
D5T1U4_LEUKI/363-511-------------------------------------MTQISAITSIFMGGA.TVLAMIM----QSL-------------
Q03XR0_LEUMM/330-477-------------------------------------MVQISAVIALFMGLT.SVLAMIL----QGL-------------
A0NHL2_OENOE/387-534-------------------------------------LLKVSAIVAIFFGHF.TILSFII----QGL-------------
B1MY12_LEUCK/485-634-------------------------------------LLQYSTVLAVVFSLF.MLLSFIL----QAL-------------
C2KKY7_LEUMC/498-647-------------------------------------MLQYSTILALVFSLF.MLLAFVL----QAL-------------
C0WLU0_LACBU/374-518-------------------------------------YLFWNIIQSLILGLA.INSLTLL----QAL-------------
C2EP42_9LACO/342-483-------------------------------------YLVENIVQSLLAGLV.MNSLTLL----LAL-------------
H7C726_ENTFA/370-519-------------------------------------YLSATIISTSLLGIF.TIVLSIL----QAL-------------
C5RB06_WEIPA/501-648-------------------------------------ILQFASYSAIFLSLY.MVVLAIY----QGL-------------
A8UCR2_9LACT/391-539-------------------------------------SLQVASFMSLFLGLF.VLMGSTM----QAA-------------
A2RMM4_LACLM/390-539-------------------------------------LFVFAILQTFLLGLY.MIVYPPL----TVM-------------
T0UE48_9ENTE/381-529-------------------------------------VLVAACISGLILGLF.MLTSSML----QGM-------------
E6LIJ6_9ENTE/381-529-------------------------------------VLIEASLSGLVLGFF.MLTASML----QGM-------------
Q838A3_ENTFA/382-530-------------------------------------LLVQACYASLFLGLY.MLVSNML----MGM-------------
C2H7P1_ENTFC/381-529-------------------------------------VLIQASFVGLFLGLY.MLVSNML----QGM-------------
A4VW05_STRSY/379-527-------------------------------------LFIWNLFLILPLGLY.SVISVVI----QAI-------------
E3CI47_STRDO/375-523-------------------------------------LFVFVMAETILLALY.SLMAPML----QAL-------------
A3CPL5_STRSV/375-523-------------------------------------LFIFAMLQTIILSLY.TVLAPMI----QAL-------------
E8K660_STRPA/410-558-------------------------------------LFIVAMLQTVILGLY.TVLSPMI----QAL-------------
B1SH45_9STRE/377-525-------------------------------------LFVVALIQVIFLALY.SLLAPML----QAL-------------
C2LQ70_STRSL/432-580-------------------------------------LFVASLIQVIFLALY.SVLAPML----QAI-------------
A5VL26_LACRD/382-530-------------------------------------VLQFAAYISIMLGLY.TVAAAMM----QGI-------------
D2ELV8_PEDAC/393-541-------------------------------------ILQFNSYVAIVLGLF.TVISAVM----QGI-------------
C0WUG9_LACBU/378-530-------------------------------------ILTFSSMISIPMGMF.VVISAVM----QGL-------------
Q03RI1_LACBA/378-525-------------------------------------ILAFSSYLSILLGLY.TVVAALM----QGI-------------
Q1WUT1_LACS1/381-529-------------------------------------VLAFSSYIALALGLF.MVLAALL----QGI-------------
Q38VP9_LACSS/378-526-------------------------------------VLQFSSYISILLGLF.TVLGAIL----QGL-------------
C8PCY7_9LACO/375-523-------------------------------------ILFLSGIAAMFLGAF.TILMAIL----QGL-------------
C2E7U4_LACJH/384-532-------------------------------------VLYLSSFTAISLGLF.TVLMAIL----QGL-------------
C2KAZ9_9LACO/380-528-------------------------------------VLYISAFTAISLGLF.TVLMAIL----QGL-------------
Q03AT6_LACC3/380-528-------------------------------------LLQISSLLAIMLGLF.TVLAAIL----QGL-------------
D0BKY7_9LACT/390-538-------------------------------------LLMVSCVLCIFMGAF.TVFTSIQ----QSM-------------
C8NE09_9LACT/413-561-------------------------------------LLVVSCVMCVFLGLF.VTFTYIL----QSM-------------
E4KNA5_9LACT/790-938-------------------------------------LLITGSLSSIFLGAY.TVLSTIL----QSM-------------
D4YJ56_9LACT/433-583-------------------------------------LLQLSAAVAVTMGLF.SVLVAML----QAM-------------
E0IFR0_9BACL/366-514-------------------------------------IVAALTAGTIFQISM.MTSNSIL----YGF-------------
E0RCM4_PAEP6/382-529-------------------------------------IIAVLTLGTIFQITM.MTSNSIL----IGM-------------
C6J0R0_9BACL/364-511-------------------------------------IVALLTYATIFQITM.MTSNSIL----LGV-------------
C0Z9G8_BREBN/364-513-------------------------------------AMAILGITAIPLSLL.LATNGIL----QGI-------------
C4GB38_9FIRM/387-530-------------------------------------MMVVGGLTIVFVCLS.TLSNSLL----QGI-------------
R5F1U8_9CLOT/387-539-------------------------------------LSMAGSLAVVFYSLS.TVTNAVL----QGL-------------
E6LN70_9FIRM/381-525-------------------------------------LMIIGSGIVVLYSVS.TVTNAIL----QGT-------------
D4KXJ4_9FIRM/383-527-------------------------------------MLQVGAVTILFFSLS.TLSNGLL----QGI-------------
E3GGE0_EUBLK/365-508-------------------------------------ILKYYAYATIFMMLS.NTFQSIL----QAI-------------
E6MGM4_9FIRM/373-516-------------------------------------MLRVFAYATMFMMLS.NIFQSIL----QSI-------------
B8D0L3_HALOH/359-505-------------------------------------ILSAMALTATFIYYL.HVSSGML----NGL-------------
C6PQD8_9CLOT/131-275-------------------------------------ILQYSAISIPFIILA.QTSTAIL----QGV-------------
C8VXJ1_DESAS/366-509-------------------------------------PLAYVAFSIVFWSIH.LVTTGVL----QGI-------------
D9QSV7_ACEAZ/363-507-------------------------------------PLRYVSWGVIFVCLQ.QTSSSIL----QGI-------------
B2A8K9_NATTJ/363-507-------------------------------------PLRFLAAGTIFLSFQ.QVSASAL----QGT-------------
A8MK38_ALKOO/363-506-------------------------------------VLLFLSFATFSLCMV.QTLTGIL----QGL-------------
A5D2G5_PELTS/358-502-------------------------------------SLEVLAVGGPFLYVQ.QTTTGIL----QGL-------------
D5X9J9_THEPJ/361-503-------------------------------------PLSILAPAAVFLGLH.QTTSGVL----QGL-------------
B2A2Z4_NATTJ/361-504-------------------------------------PLRYLSPSVIFLLLK.FATTGVL----QGL-------------
C7GYH1_9FIRM/373-517-------------------------------------ILAIMSLGVFFLAMI.LTLSAVL----QGI-------------
A6TN15_ALKMQ/363-506-------------------------------------ILSVLAINVVFISLA.QSLTSIL----QGI-------------
A8MIG9_ALKOO/365-508-------------------------------------ILRILSFNVIFISIG.QILGSIL----QGM-------------
Q67JD5_SYMTH/384-522-------------------------------------ALEAMAWSVLPIMLQ.QTTSGVL----QGM-------------
C4FNY8_9FIRM/361-503-------------------------------------VIAVISLSIIFLGWQ.QITAGIL----QGL-------------
D3LVV9_9FIRM/358-500-------------------------------------AICVLSISVFLVGVQ.QITGALL----QGM-------------
E2ZD67_9FIRM/360-502-------------------------------------AIRVLALATFLIGLQ.QITNGLL----QGM-------------
R5TDG3_9FIRM/363-506-------------------------------------CIAVMSFGVFLLGVQ.QVTTGVL----QGM-------------
D3LX29_9FIRM/358-500-------------------------------------ATRTIAIAIFFLGMH.QITTAIL----QGL-------------
C4FPR1_9FIRM/359-501-------------------------------------ATQITAFSIFFLGVH.QVTTGIL----QGL-------------
A1HLQ5_9FIRM/371-513-------------------------------------VVSVLAVSVYLLGLH.QTTTGVL----QGL-------------
C4V2B6_9FIRM/374-517-------------------------------------AVMISAVSIILLGLH.QVSTGIL----QGL-------------
E8LB44_9FIRM/369-509-------------------------------------AIQTMSIGILFLGMH.QISTGIL----QGL-------------
C0WBK9_9FIRM/378-517-------------------------------------AIEIMSWAIFLLGLH.QVSTGIL----QGL-------------
B7DPH6_9BACL/373-525-------------------------------------IISTVSFMSIFASME.LISTYVL----QGL-------------
C0ZHE2_BREBN/367-517-------------------------------------ALAVQSFTIIFATVS.IASAGIL----QGL-------------
C2YMP0_BACCE/352-495-------------------------------------MLAILIGSSYFTSLM.VLSIGIL----QGI-------------
B7GMA5_ANOFW/366-505-------------------------------------TMAIVLASSVFTSLA.LLGTGIL----QGV-------------
E7RL93_9BACL/356-500-------------------------------------VLAIVSFSSLFTSLT.VLGTGVL----QGI-------------
D3FZH8_BACPE/357-501-------------------------------------VIFILSVSALFTSFS.VLTTGML----QGA-------------
B0MPG6_9FIRM/391-534-------------------------------------SLFILGLGGVFLTLS.STFISIF----QVI-------------
B0PEA8_9FIRM/441-584-------------------------------------ALRFMGLSAIFVAVS.LPVNAIL----QAI-------------
A7VWY4_9FIRM/433-577-------------------------------------VLVILGIAAIFTSTS.TPLCSML----QAV-------------
E6TRQ4_BACCJ/362-512-------------------------------------ALQILSTTVLFAALF.MTIAALL----HAI-------------
D5WSL0_KYRT2/373-521-------------------------------------AIAILALSTVFSTLE.SVSSSVL----QGM-------------
B1YGP9_EXIS2/345-491-------------------------------------ALSWLAATAFTASLS.MIIVSCL----QSV-------------
C5RD31_WEIPA/359-505-------------------------------------ALMVFVLTIIPATLI.LIITSVL----QSL-------------
Q8EU30_OCEIH/362-509-------------------------------------ELRVLMLSIVFATLA.IIGSTVL----QGF-------------
B9E8U7_MACCJ/341-481-------------------------------------ALAIYMLSVIFVSLI.IMFTAML----QIY-------------
Q49V13_STAS1/337-479-------------------------------------TLAVYMLTVIFVSLI.MMDIALL----QVK-------------
E8SIP0_STAPH/344-486-------------------------------------TLSLYMLTVICVSLI.MMYIALL----EVH-------------
Q2G0R7_STAA8/343-485-------------------------------------TLSVYMITVICVSLI.MMDMALL----QAQ-------------
F2F183_SOLSS/360-508-------------------------------------VLKLYSFQIVPLSII.LTFTAIL----QGY-------------
A3IEA1_9BACI/365-514-------------------------------------VLIVYVFQIVPLSII.LTFTAIL----QGY-------------
E7RLD1_9BACL/354-503-------------------------------------TLIIFSWQIVWMSLL.LIMTAML----HGL-------------
A0AF13_LISW6/361-504-------------------------------------VLQLFMPAVFLSSLI.VMLSSIL----QGF-------------
D7UUI0_LISGR/356-499-------------------------------------ELQLFMPAVLLSSLI.VMFASIL----QGF-------------
A6CR25_9BACI/352-499-------------------------------------VIAVFCLSILFSSVI.LTISAIL----QGI-------------
E5WT44_9BACI/362-510-------------------------------------VLAILSLLILLSSLI.ITITGIL----QGL-------------
U5L445_9BACI/362-508-------------------------------------VLAVLSLFIFFASII.MTLAAIL----QGL-------------
A8F924_BACP2/360-506-------------------------------------ALQIFCISIAFTSIA.ITQAALL----QGL-------------
T5HW26_BACLI/356-502-------------------------------------ALQIFSASILFASLA.MTMTAVL----QGL-------------
A7Z0I0_BACA2/354-499-------------------------------------TLQIFSLSIFFASIA.LTAAAIL----QGA-------------
D4G3E4_BACNB/359-505-------------------------------------ALQVFSCSILFASMA.VTAAAVL----QGA-------------
D5D970_BACMD/362-511-------------------------------------VLQILSLLVIFTTVA.ATAGAVL----QGM-------------
B7GFI4_ANOFW/350-497-------------------------------------ELTILAVSILFTSLT.LTFIAIL----QGL-------------
A4IJD3_GEOTN/352-496-------------------------------------VLAVLSASVFFTTMA.LTSSAML----QGM-------------
C5D378_GEOSW/360-505-------------------------------------PLAILAASIFFTTLA.LTLSALL----QGM-------------
Q5WAF7_BACSK/347-496-------------------------------------ILQVVAVSIFPASLY.LTAAAIL----QGY-------------
D3FR13_BACPE/361-509-------------------------------------VLAVLAFAIFFSSIY.LTTAAIL----QGY-------------
Q9KGJ0_BACHD/361-507-------------------------------------VLQVYGFSIFFASLF.VVTAALL----QGS-------------
D6XV50_BACIE/360-507-------------------------------------ALRIAGLGVLPGSLF.MTAAVLW----HAV-------------
D3E759_GEOS4/381-532-------------------------------------TMQVIAFTAAGGTLS.TITAALL----QGI-------------
E0RM54_PAEP6/373-525-------------------------------------VMRWMALTAVGGTLS.IISAALL----QGL-------------
A7GJW7_BACCN/360-506-------------------------------------VLAILAISILFSSLS.ITTASIL----QGL-------------
B5UWQ0_BACCE/360-510-------------------------------------VLSILSLSILFSSLS.ITTASIL----QGL-------------
D2BMG7_LACLK/323-465-------------------------------------PLSILSLSICPQMLS.....QSM----SAI-------------
B8IEZ7_METNO/324-461-------------------------------------YTLILLPGLFAGALMNFALNPIF----QIR-------------
C7NM90_HALUD/327-463-------------------------------------PLVVLLAGRIPYSLS.RILVQLG----YSY-------------
A6DHF1_9BACT/293-436-------------------------------------ICALLCLNFFMSGLI.NLVGTFM----NSL-------------
Q47U72_COLP3/338-481-------------------------------------LAPILGFAYICRTVS.RPISSLL----LAK-------------
B4AGJ7_BACPU/343-486-------------------------------------LLMIHAAYLCLTLMF.LPLTYVP----TAF-------------
Q1K412_DESAC/351-495-------------------------------------VMAVLALSKIPTLYL.LPCINVL----SAM-------------
C0QCL2_DESAH/352-496-------------------------------------VMAILSCAKLLLLLG.QFSRSLL----AAT-------------
Q2YCG5_NITMU/323-466-------------------------------------IFSALSIGMIAFSLS.LLSGAIL----TAT-------------
E6QMG7_9ZZZZ/367-517-------------------------------------LFVAFSISMQFHMLT.GPGTSIL----RGI-------------
F2G999_ALTMD/323-467-------------------------------------YMTISAFSIFPLVVA.NFLPNLL----ISQ-------------
C6JQC3_FUSVA/323-462-------------------------------------ILRILSGLLIFSFIAVFLDTNIS----IPH-------------
E5X0H2_9BACE/326-464-------------------------------------LLQILCFDWMFDHLS.IINLNLL----YVK-------------
A3DHV8_CLOTH/327-465-------------------------------------FLQIFCMSYMFMPFH.TANLEAI----KAL-------------
B5CWR8_BACPM/324-466-------------------------------------VFQILALSLPLQMIL.STTGAIY----QAA-------------
F1VXT7_9BURK/320-462-------------------------------------ILAWLAAVGFIQSLT.STTGSVF----MAT-------------
Q2YCC1_NITMU/331-475-------------------------------------PLALLSTVMPFRMTT.SFLRPVL----ASM-------------
Q0AHL3_NITEC/325-466-------------------------------------PLQLLALMMPLRMIA.NFLPSAV----DAL-------------
D4YX22_SPHJU/336-476-------------------------------------FVAILALAMPFMTLQ.VMFAPVS----NAV-------------
Q1GPL1_SPHAL/342-484-------------------------------------YIQLFALALILMTVQ.ILFAPVT----NAL-------------
B0VF98_CLOAI/326-465-------------------------------------YFRIYLFLLPLRI...ATYGILF----QAF-------------
A1S103_THEPD/335-472-------------------------------------YLSLYSASLLLSGLGTAALPSFF----QGV-------------
E8R8C0_DESM0/349-487-------------------------------------YLALTATGALGVGLGAYVLGGLF----AGI-------------
A3DIV8_CLOTH/358-500-------------------------------------ILYLLSFTGIFIYLQ.QTLLGIM----NGL-------------
F2JLQ5_CELLD/355-497-------------------------------------LLKWLAIICPFLYLQ.NILTGAM----NGL-------------
A7VPC0_9FIRM/355-497-------------------------------------YLSVLAPVIPLMYLD.SVVDGML----KGL-------------
A8SAU1_9FIRM/356-502-------------------------------------YLETLAPAMPLMYLE.SMVDGAM----KGI-------------
A6TSY6_ALKMQ/375-519-------------------------------------YLSIISYGTLFLCMQ.HTISGIL----HGL-------------
A6NPI5_9FIRM/351-494-------------------------------------YMVPLSVGVLLSCYQ.SVLSGVL----SGI-------------
B0KBP6_THEP3/360-504-------------------------------------FVRVISMGSIFAFLE.AVVASIL----HGL-------------
B7AQB6_9FIRM/351-493-------------------------------------FMRVLAWLCPFLYIN.TTLTGIL----NGL-------------
D3AN52_9CLOT/376-519-------------------------------------FIMTLAWLCPFLYLV.TTMGSIL----NGL-------------
B0TAY6_HELMI/361-505-------------------------------------TIQILAWGAPFFYLQ.STTGGIL----QGL-------------
Q3ADH7_CARHZ/346-484-------------------------------------LLVILAVSGPFLYWY.QTVTGIF----QGL-------------
E0RMQ1_PAEP6/366-508-------------------------------------MLKLMAPFALFMYIQ.APLQAAL----QAL-------------
C0ZAP4_BREBN/363-505-------------------------------------LLKELAPFSVFLFFQ.APLAAAL----QGL-------------
D7WQC4_9BACI/353-489-------------------------------------YVKILAPIFYFYYIQ.SPLHSIL----QAI-------------
C8WQG9_ALIAD/361-502-------------------------------------MLAIMAPFVFMLCLQ.SPLTGIL----QGL-------------
B7DPL3_9BACL/356-497-------------------------------------LLAYLAPSCLFFYLS.DPLFAVL----QGL-------------
D5QEL1_KOMHA/351-483-------------------------------------IMKCLSIGVFVFGMD.AVAAGFL----DGI-------------
A9WAD6_CHLAA/337-475-------------------------------------VLAVLGLVLICTYLN.TVLSQLL----IAA-------------
E1IEK9_9CHLR/380-529-------------------------------------IVWVLVPCLFIECLL.TTAHNAL----IVH-------------
B9JKJ2_AGRRK/321-464-------------------------------------LLSMLSLAVIPIPYF.QTLYSAS----LAL-------------
Q2Y4J6_9ARCH/377-524-------------------------------------TLAMLTIYVFVLSLT.RPYSSLI----IGI-------------
E8V165_TERSS/339-475-------------------------------------VLIVASILSIPRAFQ.EIPDILL----RAA-------------
B8IGJ3_METNO/336-472-------------------------------------PAVILIASSCLGGNS.MLFAGLI----IGM-------------
D7BDH0_MEISD/336-473-------------------------------------VAQILFLGLIPSLLV.TVTGLTL----GAI-------------
F2NKF2_MARHT/337-483-------------------------------------AAYILFAGLVPAMTL.SVFGLAL----SAI-------------
D8J725_HALJB/340-478-------------------------------------AVVILAVGITISATCGGPDGGLL----QGL-------------
B8D178_HALOH/340-478-------------------------------------ALVLISIGQVVNAGV.GSAGYIN----VMT-------------
C4RGH8_9ACTN/364-502-------------------------------------VTVFLALTMLVATGC.GMVDTVL----NMA-------------
Q18GU8_HALWD/357-496-------------------------------------YLVILAISYFVMAVT.GPNQRAL----SAF-------------
Q469G3_METBF/349-484-------------------------------------TLRILALGFIANSYF.GFNYHTL----LAS-------------
C5A2Y0_THEGJ/342-480-------------------------------------TLQILAIGFMFHSAL.GPNGLTL----TVI-------------
F0LLW6_THEBM/342-478-------------------------------------ALQILALGFMFHTFL.GLNGLSL----VVI-------------
F2KQE3_ARCVS/343-481-------------------------------------ALRALALGFFTHVML.GPNGLTL----IAA-------------
F0LLZ4_THEBM/339-477-------------------------------------ALRILAVGFIVHVLF.GLNGMSL----VII-------------
Q5JDW0_THEKO/345-480-------------------------------------ALRILALGFMFHVVM.GLNAMSL----VAV-------------
A1BJ49_CHLPD/337-476-------------------------------------VLTILAATALVQALT.GISGTVF----AMT-------------
B3EHD9_CHLL2/365-504-------------------------------------ALALLAAAAFAQSFG.GIAGTVL----SMA-------------
Q3APG3_CHLCH/338-477-------------------------------------ALQLLSAAYFVQCVF.GIASTLL----AMS-------------
B4SBS0_PELPB/338-477-------------------------------------ALLLLTVASFLQASF.GLSATVL----AMT-------------
Q3B6G9_PELLD/337-476-------------------------------------VLGLLTAGAFLQALF.GISATLL----AMA-------------
A4SCQ1_PROVI/337-476-------------------------------------ALVLLSGAALLQAFF.GMAATLL----AMT-------------
D8PBA0_9BACT/336-473-------------------------------------GLRLLVPGALCYAVA.RVLWPVI----QAG-------------
D3SSH7_NATMM/337-474-------------------------------------PLLLLLPGALGFALA.RPVLAIS----QGN-------------
B6IYF6_RHOCS/343-484-------------------------------------VLRWLALGGIPTIIG.SMSGTVL----RGV-------------
D0LQE6_HALO1/374-513-------------------------------------ALMALALGNVGFCLF.AIAGTIL----NGA-------------
D2RVV2_HALTV/336-474-------------------------------------VVQILSLFVFFEALE.NISGPAL----DYL-------------
D3STC0_NATMM/337-475-------------------------------------VIQIFAFFIVFQAID.KITNDAL----DYL-------------
D8J472_HALJB/339-477-------------------------------------VIQVLSGFVVLQAID.KITNDGL----DFL-------------
D2RXY9_HALTV/340-478-------------------------------------VLQVLAAFIILQAIT.NLTSDSL----DYL-------------
E7QQ57_9EURY/339-477-------------------------------------VVQVFSGYVVLEAVT.LITSDAL----DYL-------------
C7P069_HALMD/318-461-------------------------------------VLWLLIVAVLVYGYQ.SQIVNAL----SGI-------------
C7NSR3_HALUD/331-469-------------------------------------VLVILVGAYTADVYA.NQLLNTV----NAV-------------
Q5V4U1_HALMA/327-465-------------------------------------VLLILIAAYLADAFA.SQFTNVI----NGV-------------
D8J7W8_HALJB/319-457-------------------------------------VLVVLMLEKVFQSVN.DVLGSTL----RGI-------------
C7NSL6_HALUD/319-457-------------------------------------VLIILMGEKLLQSVH.TILGRSL----QAL-------------
E4NUG7_HALBP/319-458-------------------------------------VLVILTGEKILQSVH.IILGRAL----QGI-------------
AGL15_HALVD/319-457-------------------------------------VLIILAGEKILQSVH.VIIGRSL----QAL-------------
Q12VM9_METBU/345-483-------------------------------------LLVILLAVQIVNVFQ.YFFTMYL----NAI-------------
A3CVY7_METMJ/333-471-------------------------------------ALAILLLVQVAHVFM.FLQTMCL----NAL-------------
A2STD2_METLZ/331-469-------------------------------------VCSILFIMQIISVFT.LLLGVAL----TAS-------------
A5UQJ1_ROSS1/330-463-------------------------------------VLQILIWSFVFTTLL.VPGGRLI----LAA-------------
D3FFB8_CONWI/338-471-------------------------------------PFMLLIWSAVIALLQ.VNYTNGV----LAL-------------
D8GMK0_CLOLD/327-460-------------------------------------VFTILIAYVSIFYIR.EIYGYEL----TAW-------------
Q97GQ2_CLOAB/326-458-------------------------------------PFSILLIYSLILFIR.EIYAYGL----NAW-------------
D5XD05_THEPJ/326-457-------------------------------------SLQILLIATGIIFIS.APLNLSL----LAC-------------
Q2NIB6_METST/328-458-------------------------------------VLELIIWALPAIFLS.YILGTSI----ASI-------------
F0T719_METLA/333-463-------------------------------------VLQILIWTVPITFLN.YIFGSIL----PAM-------------
Q2NH55_METST/331-464-------------------------------------ALTILIWAGIFMFLS.GLTSTLL----GAI-------------
E3GZ73_METFV/328-459-------------------------------------AFQILIWTIVFIFTN.GIFANLL----NSS-------------
A5UNI7_METS3/328-460-------------------------------------VLKILIWTVCFLFIN.GACSMIL----NAS-------------
F0TC71_METLA/328-460-------------------------------------ALQALIFVVPVIFIT.YLFGNIL----GAI-------------
Q12XY4_METBU/326-458-------------------------------------ALQILIWATSIMFIN.ILLSFTY----ISS-------------
Q46FX4_METBF/329-461-------------------------------------ALQILIWASVLSFIN.YAPSTYF----SST-------------
F0TBQ9_METLA/329-463-------------------------------------TLQILVWAIVFTFAG.ASYIQLL----QST-------------
Q0W809_METAR/331-464-------------------------------------VLQIIIWAALFIFLS.SAYGCLF----MST-------------
D1Z261_METPS/328-462-------------------------------------VMQIVIWSVFLSFVY.TPFLQTF----SST-------------
O26442_METTH/329-460-------------------------------------AFQILALFIPIRLVS.TITGTLL----SSI-------------
A5UWW7_ROSS1/374-505-------------------------------------ALAILIWYLPLSYAN.GVTQYVL----IAL-------------
E1IAS8_9CHLR/378-523-------------------------------------VLAILAWFLPLSFVN.GLLQYVL----IAL-------------
D5UPU7_TSUPD/350-482-------------------------------------ALGLLFIAVALRFVN.AVLSQAL----FAA-------------
Q97AA3_THEVO/339-476-------------------------------------AISIIMVFSALFVTS.NVMTQLI----AAV-------------
Q2S953_HAHCH/328-463-------------------------------------ILQALAVAIFFIFPS.SIMIYVY----SAM-------------
F2NHK3_DESAR/367-498-------------------------------------VFKILSLALIFSFWN.YLGDNML----IAR-------------
A3W1Y0_9RHOB/329-468-------------------------------------LLSILAVAAAVSAPL.YFNQPLL----IAV-------------
C4XGJ8_DESMR/335-465-------------------------------------VMRLLALALPLLALD.MLVNNLL----VAI-------------
A9EQ86_SORC5/331-462-------------------------------------VLRILACSVPVTFAF.QVVTLPL----LAA-------------
B9K2D6_AGRVS/332-468-------------------------------------MLTLLALSVPVAVAC.QVATQYL----FAL-------------
E3FNG9_STIAD/347-485-------------------------------------VLRLQAPILALTYVA.MVCASVL----TVT-------------
B6YVL8_THEON/328-461-------------------------------------VLRIFGLTLIFIFFR.TAFERVL----EAS-------------
E0I7A7_9BACL/353-491-------------------------------------ILPYMMFGLIMWNFG.MYGHKGF----EIK-------------
D5DY76_BACMQ/331-468-------------------------------------TLIISALGMVIYGIT.FYYNKTW----ELS-------------
D7E977_METEZ/332-466-------------------------------------ITPFVALSALVFGVF.IIFEKVI----YLE-------------
A1ASY9_PELPD/345-481-------------------------------------LVPYVSLSVLVAGII.YKYKLGI----MAM-------------
E8RTH0_ASTEC/331-467-------------------------------------VTALISVGALLSGFNTYYFLQAF----TLS-------------
Q0AP11_MARMM/327-464-------------------------------------ILPWIALSGLMKGMMTYYFHEAF----TLM-------------
E7RZY6_9BURK/339-474-------------------------------------IIPWVIGGVALQGLF.PVASAGL----QIQ-------------
Q12TY8_METBU/325-459-------------------------------------ALAIVAIGMGFLVMT.MVFTNIF----QAR-------------
D9PYX0_METTM/350-483-------------------------------------ALSILVVGMSFYTLF.MISSSIA----QGI-------------
F0TB30_METLA/351-484-------------------------------------ALQILAAGMLFFTLY.TISSSIS----QGL-------------
F0EKD4_ENTCA/327-465-------------------------------------SLSILSLASVFSLLSSFYVYAIL----LPF-------------
Q5M4A4_STRT2/55-193-------------------------------------SLRILCLALICSIISWIFNDGVL----IPT-------------
F0HVE0_LACDL/327-469-------------------------------------SLRILAFAMVGSGISGIFGQCAL----MPA-------------
E4SMU5_LACAR/327-469-------------------------------------SLQILCFALIISAFSRIFSDCIL----IPA-------------
D4LGF1_9FIRM/327-469-------------------------------------SLQILSISLIFAIYGGLITSVYN----ITQ-------------
A5ZUX1_9FIRM/326-464-------------------------------------IMRILSPNIIFAVMNGFLAYQIF----IPF-------------
D5TQD2_BACT1/321-460-------------------------------------LIILMSPVIVFVGLANIFGLQIL----IPT-------------
Q5LFL1_BACFN/328-466-------------------------------------TLKLVAPIVLFIGLSGIIGMQIL----YPQ-------------
E8JWJ5_STRCR/327-467-------------------------------------SMQILMPILVISGFSNITGNQIL----IPM-------------
Q4JZ09_STREE/330-470-------------------------------------AMQILMPILVISGFSNITGNQIL----IPT-------------
E6MFC3_9FIRM/328-466-------------------------------------PMQLIMPTLLFIGLTNILGLQML----VPL-------------
E9RY62_9FIRM/330-468-------------------------------------PMQIIMPTLLLIGLTNIMGIQIL----VPL-------------
C5NWI0_9BACL/318-458-------------------------------------VLYVIVFNIMFVGWTNILGFQVL----VVR-------------
A1ILY9_STROR/319-458-------------------------------------AIAIMIFRMFFIGWTNIMGIQIL----IPH-------------
Q4JYJ9_STREE/323-464-------------------------------------ALNIVVFSLIPIAFSEIVGRQTL----IPT-------------
E0PD92_STREI/325-464-------------------------------------MLIGLSISIPIWTIGEVIRNQFL----LPT-------------
C6CSD9_PAESJ/327-465-------------------------------------IMQGLAITIPFIAFANVIRTQYL----IPN-------------
B0N362_9FIRM/290-427-------------------------------------IITILVLSSIFISWANVIRTQYL----IPN-------------
A5M4K0_STREE/211-349-------------------------------------LIAAMAPVFVFSVPGNIIRTQYL----IPR-------------
C9LAR2_BLAHA/325-463-------------------------------------LIACMAPAVLFSVFGNVIRTQYL----IPR-------------
Q4K189_STREE/323-460-------------------------------------IIAGMTPALVFSAFGNVIRTQFL----IPR-------------
C4FB42_9ACTN/325-467-------------------------------------IMTFLVVIIPVISMTNVIGKQYL----LPL-------------
E0S188_BUTPB/322-462-------------------------------------LIILLSVVMIFKSLSNIIQNQYL----IPY-------------
C3HRG9_BACTU/323-461-------------------------------------LMFWVSFIIIFIPIGGVFANQYA----LAF-------------
A7HKJ9_FERNB/322-460-------------------------------------LIVYITPIILFISWSNLFGIQIM----VPM-------------
G5K6T2_9STRE/321-459-------------------------------------LMAIQSFMIIFISYGNALGTQYL----LAS-------------
E7S3G0_STRAG/321-459-------------------------------------LMAVESLMIICISYGNALGTQYL----LAS-------------
E0NHN4_PEDAC/321-459-------------------------------------LMIVESAVIFLIGWGVMLGNQYL----IPT-------------
E6LD53_9ENTE/253-391-------------------------------------LIPILSIVIILIGWSNVLGMQYL----LPT-------------
C2KJQ1_LEUMC/329-467-------------------------------------VIVLLSPIIIFIGWSTVIGTQYL----VPT-------------
B3XNV8_LACRE/322-460-------------------------------------LMMIEAPIILFIGWSNVTGTQYL----MPI-------------
B2GDL9_LACF3/322-460-------------------------------------IIFFEAPAIIFIAWSNVTGTQYL----MPV-------------
C0WVB1_LACFE/322-460-------------------------------------IIFFEAPAIVFIAWSNVTGDQYL----MPI-------------
A2RHU4_LACLM/321-459-------------------------------------LLMMEAPIIIFIAWSNVLGIQYL----LPL-------------
A1YVF6_LACJH/321-459-------------------------------------AMMIESIVILIIAWSNVIGVQYL----LPI-------------
C2D643_LACBR/210-348-------------------------------------AMFIESIVILMIGWSNVIGTQYL----LPV-------------
Q3ZK40_9LACT/322-460-------------------------------------LIFVQSPFLIFISWNYIIGGQYL----LAT-------------
D8MET9_LEUGG/321-460-------------------------------------LIILESPIIILISWSIAITNQYL----IPS-------------
A3F4D6_LACLC/321-459-------------------------------------VLMIESIAIIFIAWSNAIGTQYL----LPT-------------
D2EJ27_PEDAC/321-459-------------------------------------LMMLESVVILLIAWSNALGTQYL----LPT-------------
O06039_LACLC/321-459-------------------------------------LLVLSSPIVVLVTWSNVLGQQYL----IPL-------------
Q8GPE5_STRTR/321-459-------------------------------------ILSILVFELIFMGWSSIIGNQYL----VAI-------------
D7DRX9_METV3/353-490-------------------------------------AVRILMISAIFSSLN.VISSDIL----VGV-------------
A4FX93_METM5/354-492-------------------------------------PMKILSIGAIFLTLN.TIGFSVL----NGI-------------
A6UPA0_METVS/351-488-------------------------------------PMSILSFGIVFLSMN.NIVFNVF----NGI-------------
A6UU30_META3/353-490-------------------------------------AIRILSLGTVFMTLN.GIGFTVL----NGI-------------
D5VU50_METIM/353-494-------------------------------------AMRILSFGIIFMSLN.RVGFTIL----NGI-------------
D4W1F1_9FIRM/338-485-------------------------------------ALKILTIQILFYPFI.FLSTAVM----QQE-------------
B9DSP4_STRU0/342-480-------------------------------------ALEIYLGTIALSSFI.QFFHQKM----FIE-------------
F1Z193_9STRE/350-488-------------------------------------ALEVYLLMILLASLI.QYCHQKF----FIE-------------
D4YGG7_9LACT/385-532-------------------------------------VLVVYVLMVIFASLI.LGQNNIL----QAQ-------------
F2I7P9_AERUA/374-520-------------------------------------VLEQYLLMIVLASWV.LIYHNIF----LGQ-------------
Q03E00_PEDPA/355-503-------------------------------------ALAVYNLSVIFAALI.FVYNSIL----QSA-------------
D2EHX4_PEDAC/355-503-------------------------------------ALAIYNLSVILAALI.FVNNSVL----QSM-------------
A0A023M9A5_LACPN/357-507-------------------------------------ALRIYIISILFAALI.TTYTSVL----QSL-------------
E7FPH6_9LACO/355-501-------------------------------------TISAYVVSIVFISLI.STYNSIL----QSM-------------

PF03023

MURJ_BORBU/29-473LVMIIFAKPIMYFISYYR..........GENLIFASSVFGYLVLYILLISLS-SIFVSVL----NSY-------------
MURJ_RICPR/28-477ALMQIFMPQLILCIAPGFY.......AKKEKFELTVFLCRITIPYLIFVSLT-ALLGGIL----NSV-------------
MURJ_ECOLI/28-479VAGMLAAPWVIMVTAPGFA.......DTADKFALTSQLLKITFPYILLISLA-SLVGAIL----NTW-------------
MURJ_SYNY3/36-495IILVLGAGIFIDLLAPGL.........EPETRRMAVQQLQIMAPMALLSGLI-GIGFGTL----NAA-------------
MURJ_AQUAE/29-466IIGLLFPEEIISVISPGI........KEKETFSYAVEFLKFTILYLPLVSFY-AYSMAIL----LVQ-------------
MURJ_HAEIN/16-479ILAMVGSPHVAALFGMGWFTDWMNDGPDAHKFEQASLLLKITFPYLWFVTFV-AFSGAVL----NTI-------------
MURJ_THEMA/28-450FLSEVFPYFMASIFATGA.........DEEVKSLAADLIRLTAPFITIVFVW-AVFYSVH----NAS-------------
Q9X8T0_STRCO/300-778VITVFAAPLLIRLLSNPVA.......SDPAANEVGITFVRYFLPSIFFMGLH-VVMGQVL----NAR-------------
MURJ_TREPA/32-489LIGILGAPYIVRLFDTDQ..............SLTVSLTRLMFPYLWMISLA-AFFQGML----HSI-------------
Q9RX17_DEIRA/83-522ALGIFAAPWVVGLLTSTH.........ANIDRAIAIYMTQLVMPFLTLISLS-AVAMGLL----NAD-------------
MURJ_CHLTR/34-482LI.IELGLCVWCSCVTGS.........LFDTLLLT....IILLPSGIFLMMY-TVNSTLL----HCE-------------
MURJ_HELPY/2-458LN....PLWLAKLLAYGF.........DEETLKLCAPIVAINFWYLLLVFIT-TFLGALL----QYK-------------
MVIN_MYCTU/48-521TLSVLAAPLLVRLMLGTN.........PQVNEPLTTAFAYLLLPQVLVYGLS-SVFMAIL----NTR-------------

PF01554

O51531_BORBU/22-182-------------------------------------PTAIEFFLFNFISLTDNAMVAYL..GDYPV-------------
YOEA_BACSU/28-189-------------------------------------PLLLSNVLQSVGQLVGMMAVGRW.LGVDAV-------------
YOEA_BACSU/257-418-------------------------------------PASINMILVSLSEIAVISFVNHY..GSNAT-------------
O66528_AQUAE/245-406-------------------------------------PTALERAITTLSFNVFVGFLAKF..GDKVL-------------
YPNP_BACSU/241-402-------------------------------------PAGLQMMVITGGMMAIMSVVNSY..GDHVV-------------
NORM_VIBPA/243-404-------------------------------------PVAAALFFEVTLFAVVALLVSPL..GPIIV-------------
O80695_ARATH/278-441-------------------------------------ASAVMLCLESWYSQILVLLAGLLKNPELAL-------------
O26414_METTH/244-409-------------------------------------PASAEFLVMSMVTALLNWILTSV.AGTSAV-------------
O28801_ARCFU/21-180-------------------------------------PMVVSNLIFTLYNLVDGIWVAGL..GPDAL-------------
YISQ_BACSU/27-187-------------------------------------PIFIEVSLYMFMGNADTLMLSQY..SDNSV-------------
Y709_METJA/243-408-------------------------------------PSALIEITVAVSFFIMTSIIMMV.GDSRGL-------------
YPNP_BACSU/21-182-------------------------------------PIMLGNALQVSFQFIDSLWIGNL.LGAKAL-------------
O25454_HELPY/214-375-------------------------------------PAGFERLLSLFSLILLSKFVASY..GDKVL-------------
NORM_BACSU/20-180-------------------------------------PIFITQAGLSLITFLDTVMSGKV..SPADL-------------
HMRM_HAEIN/249-410-------------------------------------PIAIAICCEVALYALTSLMLSPL..GATIV-------------
O49660_ARATH/262-426-------------------------------------PCCLTVCLEWWCYEILVLLTGRLPNPVQAV-------------
O82752_ARATH/42-203-------------------------------------PLILTGLLLYSRSMISMLFLGRL.NDLSAL-------------
DINF_ECOLI/35-196-------------------------------------PMIFSNITVPLLGLVDTAVIGHL.DSPVYL-------------
Q9ZVH5_ARATH/238-401-------------------------------------PSAISVCLEYWWYEIMLFLCGLLGNPKASV-------------
O28801_ARCFU/239-404-------------------------------------PASLSMLTMSVAFMLINRVVIET.GGSEGL-------------
Q38956_ARATH/275-438-------------------------------------ASAVMLCLEVWYFMAIILFAGYLKNAEISV-------------
ERC1_YEAST/174-335-------------------------------------PLIFTFILQNSLSLASIFSVSHL..GTKEL-------------
Q9ZVH5_ARATH/16-176-------------------------------------PIVMTSLLIFSRSIISMWFLSHL..GKVEL-------------
YAO6_SCHPO/17-177-------------------------------------PVILGYALQNSLQTSSVIVTGRL..GPSEL-------------
O82752_ARATH/264-427-------------------------------------PSCVSVCLEWWWYEIMILLCGLLLNPQATV-------------
O51429_BORBU/27-187-------------------------------------PIVITNIIQAFYDLTDMFYVGKL..GAMPL-------------
O83871_TREPA/32-196-------------------------------------PVMLHSFIQTGISFLDNVMVSRL..GDVKM-------------
O51429_BORBU/248-409-------------------------------------PSTFGQIMVSLSFFIFNYIVIEI..SPKFL-------------
YISQ_BACSU/252-413-------------------------------------PSAGEQLSYNLSQMIVTYFIAIM..GAQAL-------------
O66528_AQUAE/25-183-------------------------------------PIIVVNLLYTVENMISMILVSSI..SPSAV-------------
O51530_BORBU/21-181-------------------------------------PTAFESLLFQMVTFFDNFMISYL..GSFHV-------------
Y709_METJA/21-181-------------------------------------PIIVATFIESIYSLVDSIWVSGL..GADAL-------------
NORM_BACSU/247-408-------------------------------------PIGFAVFFETSIFAAVTLLMSHF..HTVTI-------------
NORM_VIBPA/17-176-------------------------------------PVLIASVAQTGMGFVDTVMAGGV..SATDM-------------
O26414_METTH/24-183-------------------------------------PLIVAMLLTSIYNLVDAVWVAGL..GGEAL-------------
HMRM_HAEIN/22-181-------------------------------------PILLAQIAQNSMGLADTIMAGRV..SSTDM-------------
YD338_YEAST/238-397-------------------------------------PLIFTFLLEQIFPMVCSLTVGHL..GKNEL-------------
MDTK_ECOLI/17-177-------------------------------------PVILAQIAQTAMGFVDTVMAGGY..SATDM-------------
Q38956_ARATH/55-215-------------------------------------PAIFTSVNQYSLGAITQVFAGHI..STIAL-------------
P71616_MYCTU/19-179-------------------------------------PALGVLAAEPLYLLFDIAVVGRL..GAISL-------------
O49660_ARATH/40-200-------------------------------------PLVVMNLL.WFGKMTTTSVFLGR.QGELNL-------------
O80695_ARATH/57-217-------------------------------------PAIFVYVINNGMSILTRIFAGHV..GSFEL-------------
MDTK_ECOLI/244-405-------------------------------------PIALALFFEVTLFAVVALLVSPL..GIVDV-------------
F4IHU9_ARATH/37-197-------------------------------------PLIAVSLLQFCLQIISVMFVGHL..GSLPL-------------
O25796_HELPY/23-184-------------------------------------PLAFSMISLSTYSMIDGMFVGKK.LGKEAI-------------
YEEO_ECOLI/48-208-------------------------------------PIFMENACVLLMGVLSTFLVSWL..GKDAM-------------
Q8DNG1_STRR6/24-183-------------------------------------PILLSNIFQQLYNTADVLIVGRF.LGQESL-------------

PF07260

G1KED7_ANOCA/1-345-------------------------------------PLIRFLVPLGITNIAIDFGEQALNRGIAAV-------------
I3JFW4_ORENI/1-349-------------------------------------PLIRFLVPLAITNVAIDLGEQALNRGIATV-------------
F1Q528_DANRE/1-344-------------------------------------PLIRFLLPLAITNIAIDFGEQALNRGIASV-------------

PF01943

SP5B_BACSU/6-308---------------------------------ASARG.....DHQKTKNILVM--------------------------
EXOT_RHIME/10-277---------------------------------EMET.........VHSVFWAN--------------------------
TUAB_BACSU/10-277---------------------------------TER.........QLSTLYWLN--------------------------
RFBX_ECOLI/8-279---------------------------------AADS.......KDKVTSIFWA--------------------------
O26447_METTH/15-286---------------------------------HRDD.......TERVSLIYSS--------------------------
YTGP_BACSU/5-320---------------------------------YNSKG.....DYETSRKMLKA--------------------------
Y1068_METJA/7-302---------------------------------YLAENRLDMLKSSIVFVGILQ--------------------------
Y1375_METJA/3-283---------------------------------EKE.........VDINKYIPI--------------------------
O26479_METTH/10-276---------------------------------NPGG......ARELVAAGLGN--------------------------
O29660_ARCFU/6-285---------------------------------ANIKGDDELVRGYIRSLTKLK--------------------------
O26467_METTH/18-289---------------------------------NRED.......PHRVSEIFSS--------------------------
O26442_METTH/7-278---------------------------------ERD..........LSSYYVNN--------------------------
YABM_BACSU/12-309---------------------------------YSEK........NHHTILKIS--------------------------
WZXC_ECOLI/9-276---------------------------------SHL.........ELTTLYWLN--------------------------
Q2K5A6_RHIEC/11-272---------------------------------SET.........HFSAVWTLS--------------------------
Q32EG2_SHIDS/2-269---------------------------------AVS........QAEINKIYSE--------------------------
Q8DZE2_STRA5/6-273---------------------------------YG..........EEFKSYSGS--------------------------
Q8P805_XANCP/25-289---------------------------------SRE.........QRDNLFWIN--------------------------

PF13440

I4HBM6_MICAE/6-298---------------------------------LKSR...-----DINTVFWTQ--------------------------
I0T9J8_9BACT/34-326---------------------------------RVEE...-----DLSTCFYFN--------------------------
C4ZJE4_THASP/32-325---------------------------------VTVE...-----HKRVAWTLS--------------------------
K9PM46_9CYAN/51-343---------------------------------INHQ...-----QVSTLFWVN--------------------------
A9KN88_CLOPH/33-329---------------------------------SEEELDN-----STTVAFWSN--------------------------
M0N8I3_9EURY/48-343---------------------------------DVDA...-----YLDTAWMMQ--------------------------
E5VCV6_9BACE/28-323---------------------------------ISKN...-----EYSSLYWFN--------------------------
A4A6G8_9GAMM/8-300---------------------------------DSAQ...-----LATSLFYLN--------------------------
R6E9E7_9BACE/31-323---------------------------------LTSK...-----NLDSIFTYT--------------------------
K6YGT5_9ALTE/31-321---------------------------------WDDT...-----FAKTCFWFL--------------------------
F3KH97_9GAMM/34-324---------------------------------PTKV...-----HYDTAWTFN--------------------------
C0CUD1_9FIRM/143-435---------------------------------SDET...-----DFSSVFYFG--------------------------
R7DCU6_9PORP/33-325---------------------------------RTAI...-----DYSTVFYFN--------------------------
R6YG40_9FIRM/34-326---------------------------------ADQL...-----DFSSVFYFS--------------------------
H1DLG1_9PORP/33-325---------------------------------ITPL...-----DISTVFTSN--------------------------
M5DLR8_9PROT/54-346---------------------------------LTSN...-----DIQRVWTLL--------------------------
C6LGC8_9FIRM/33-329---------------------------------NDDTLNK-----YSDVAFTSN--------------------------
K5CQA8_9BACE/33-325---------------------------------LTRE...-----ELSDIFSFT--------------------------
B8HLM4_CYAP4/51-343---------------------------------IDHH...-----QVSTLFWVN--------------------------
G5F456_9ACTN/34-326---------------------------------ASEA...-----DFDTVFWMS--------------------------
R6A4H2_9BACE/33-325---------------------------------TTAT...-----DYSTVFYWN--------------------------
S5C4K3_ALTMA/35-325---------------------------------PVES...-----DYDTAFTIN--------------------------
L8F559_MYCSM/28-320---------------------------------ADEL...-----.GSTVTTFA--------------------------

PF04506

RFT1_CANGA/9-542............NDADNDHDHD...........RDDSALQ-----VCVNFAMIP--------------------------
E9IWP9_SOLIN/8-542.....................N...........TVEHNWA-----QVVNLLWLT--------------------------
S9VRB9_SCHCR/24-535......ENCLEDTFKAPVPDSK...........YRSGRLQ-----LVKNASVIT--------------------------
C5E2W4_LACTC/16-558.......VAASSATEDDPETDD...........AGPGVLQ-----TAINFAYIP--------------------------
E9EIH0_METAQ/28-566.......TAQSAESEKGDEQLL...........VTRRDSQ-----AVVNLGYLA--------------------------
G8BWS7_TETPH/20-558.........NGEMTLDVKKQKN...........SPNNTLQ-----IAVNFAMVP--------------------------
H2ASC3_KAZAF/14-533...................................KTNLQ-----NVFNFGYLS--------------------------
RFT1_YARLI/102-645......GKKPDVYVFGGGVVQD...........TVSGTSQ-----AVINMGYIS--------------------------
RFT1_SCHPO/10-520.......NAIITSTSTESNKSK...........KLSDQLQ-----LIKNTSLIS--------------------------
I2GX14_TETBL/21-581QESVSETNTYSTGTKHHSHSNNSKDVLTSSNRLSKSPVLQ-----TVVNFAHIP--------------------------
A7TRS5_VANPO/18-551............TSDSSISVSN...........EKTIVLQ-----TAVNFAHIP--------------------------
J7R8K9_KAZNA/27-584HNNDGDDGNGVGDDRNKWENRD...........ADRTVLQ-----TAVNFSHVA--------------------------
M2PSW7_CERS8/12-528.................GQTSE...........KKSDDEA-----LVSNISLLP--------------------------
RFT1_CAEEL/2-516.....................E...........IIRGSLP-----KFINLLWLS--------------------------
G8ZPN0_TORDC/18-550..........DDEESISSEDSK...........GRSDVLQ-----TAVNFAHIS--------------------------
C4R7X1_PICPG/21-528..................................KGKAYQ-----AIFNLSLIP--------------------------
U5D209_AMBTC/17-521..................DEG............SMEENGS-----KLLAVAWIT--------------------------
G0W6B8_NAUDC/22-586.............HTTSSVEKT...........KNSQILQ-----TAVNFAYIP--------------------------
E2AM70_CAMFO/8-540.....................N...........TAEHNWA-----QVVNLLWLT--------------------------
E9GUV5_DAPPU/9-536.....................K...........TRDHNWP-----QVINLLWLT--------------------------
D8M9P3_BLAHO/10-506.....................D...........KGKEEWS-----KVNQLVWLA--------------------------
F4K836_ARATH/105-602..................RDGP...........ESEENVT-----RILKVAWVT--------------------------
U4LAR2_PYROM/52-567..................................TKNSSI-----IITNLALLC--------------------------
RFT1_DROME/8-549.....................Q...........GDRCSWA-----QLINQMWLT--------------------------
G8BFC9_CANPC/25-545.....................Q...........TKTRTLQ-----KVMNFGFIP--------------------------
M3BX75_SPHMS/8-530.....................................GIQ-----AAINLSYLA--------------------------
W4Z9M3_STRPU/12-532.....................Q...........SSKHYWP-----QVINLLWCS--------------------------
RFT1_ASHGO/11-543.........GDGGRGGEMSAE.................LQ-----TAVNFANIP--------------------------
M3K0B3_CANMX/13-532...................................HQTSQ-----KVINFGILG--------------------------
G8JV96_ERECY/11-550.........NEGGHDGEDKDYV...........DDPNVLQ-----AAVNLGYIP--------------------------
G0V9M8_NAUCC/17-571..............NEDEDEEK...........QKSNVLQ-----TLANFAYIP--------------------------
H9J737_BOMMO/8-547.....................R...........TDGFGWS-----HLINQIWLS--------------------------
R4XDT4_TAPDE/6-505.................................GNNDRVQ-----EIINISYIP--------------------------
RFT1_YEAST/18-565.....GNGIIDDDDEEEYQETH...........YKSKVLQ-----TAVNFAYIP--------------------------

PF14667

Q03SZ7_LACBA/349-498---------------------------------------------DTYRLTVVA--------------------------
Q38V74_LACSS/358-503---------------------------------------------DQFHKTTIA--------------------------
Q034V3_LACC3/356-499---------------------------------------------DQYAGISVA--------------------------
A8UAN8_9LACT/362-510---------------------------------------------NKHKVALIG--------------------------
D0BM46_9LACT/359-506---------------------------------------------GKYSITLIA--------------------------
C8NI78_9LACT/366-514---------------------------------------------HQYPKTLLA--------------------------
C0WQN7_LACBU/354-501---------------------------------------------GYYAPTMLA--------------------------
C2EHH6_9LACO/356-502---------------------------------------------DEYRVLLIG--------------------------
E6LEY4_9ENTE/358-506---------------------------------------------NKVLASFKA--------------------------
C9A420_ENTGA/359-508---------------------------------------------NQFRVGIYA--------------------------
C2HEH9_ENTFC/359-507---------------------------------------------NSFRPSLKG--------------------------
C0X942_ENTFL/359-507---------------------------------------------NRFKGPLVA--------------------------
E0RUK9_BUTPB/373-516---------------------------------------------GKKLLTTIN--------------------------
E7MM58_9FIRM/379-526---------------------------------------------KMRRHTLIY--------------------------
E4LZJ6_9CLOT/384-531---------------------------------------------GLRRLNIRN--------------------------
D4W2K6_9FIRM/377-526---------------------------------------------GGQWYGIAF--------------------------
D5E4C9_BACMQ/373-523---------------------------------------------NQQKKVIIG--------------------------
B7JJF5_BACC0/376-524---------------------------------------------DYQRKTMIA--------------------------
Q8EP19_OCEIH/372-521---------------------------------------------DQQNYAVIS--------------------------
B1YKH1_EXIS2/386-534---------------------------------------------NRQYFTIIA--------------------------
D6Y0K7_BACIE/382-530---------------------------------------------NRQKVAVLA--------------------------
Q5WE75_BACSK/374-522---------------------------------------------DRQRNAVLS--------------------------
E6U1Q3_BACCJ/375-523---------------------------------------------NRQRYAVIA--------------------------
D3FXP2_BACPE/374-522---------------------------------------------NRQKQAVLS--------------------------
A4IRX9_GEOTN/371-520---------------------------------------------NQQRFTVIS--------------------------
D5DN36_BACMD/374-521---------------------------------------------NKQKYAVLS--------------------------
A7Z7U6_BACA2/375-524---------------------------------------------NKQKFAVVS--------------------------
A0RJU4_BACAH/372-520---------------------------------------------NQQKHAIIA--------------------------
E7RE43_9BACL/368-516---------------------------------------------NKQKWIIIN--------------------------
A3I8W7_9BACI/372-521---------------------------------------------DFQKWIVFS--------------------------
A6CQJ8_9BACI/372-520---------------------------------------------DKQKFTILS--------------------------
A0A0E0UWL5_LISMM/370-518---------------------------------------------DEQRFTVLG--------------------------
Q2FXH6_STAA8/386-533---------------------------------------------DKQKLTVYV--------------------------
B9E7H2_MACCJ/374-522---------------------------------------------DKQAMTVYI--------------------------
D5T1U4_LEUKI/363-511---------------------------------------------LKTKLILYY--------------------------
Q03XR0_LEUMM/330-477---------------------------------------------SKTGIALRA--------------------------
A0NHL2_OENOE/387-534---------------------------------------------GHARTAMKA--------------------------
B1MY12_LEUCK/485-634---------------------------------------------SEVSIVIKA--------------------------
C2KKY7_LEUMC/498-647---------------------------------------------SEVEIVMKA--------------------------
C0WLU0_LACBU/374-518---------------------------------------------HYSKKAMFY--------------------------
C2EP42_9LACO/342-483---------------------------------------------NMNKLAVIY--------------------------
H7C726_ENTFA/370-519---------------------------------------------SFHKKAMQI--------------------------
C5RB06_WEIPA/501-648---------------------------------------------GRLRYTVRL--------------------------
A8UCR2_9LACT/391-539---------------------------------------------NQTRPALWA--------------------------
A2RMM4_LACLM/390-539---------------------------------------------DHKRLAMRI--------------------------
T0UE48_9ENTE/381-529---------------------------------------------YHNTEAVIF--------------------------
E6LIJ6_9ENTE/381-529---------------------------------------------YENKAAVQY--------------------------
Q838A3_ENTFA/382-530---------------------------------------------YENRDAMRY--------------------------
C2H7P1_ENTFC/381-529---------------------------------------------FENRAAISY--------------------------
A4VW05_STRSY/379-527---------------------------------------------FENRRAIYY--------------------------
E3CI47_STRDO/375-523---------------------------------------------FENRKAIQY--------------------------
A3CPL5_STRSV/375-523---------------------------------------------FQNRKAIIY--------------------------
E8K660_STRPA/410-558---------------------------------------------FQNRKAIRY--------------------------
B1SH45_9STRE/377-525---------------------------------------------FENRKAINY--------------------------
C2LQ70_STRSL/432-580---------------------------------------------FETRKAINY--------------------------
A5VL26_LACRD/382-530---------------------------------------------SENKKMMMF--------------------------
D2ELV8_PEDAC/393-541---------------------------------------------GENVLAVKY--------------------------
C0WUG9_LACBU/378-530---------------------------------------------SQNRRAVKF--------------------------
Q03RI1_LACBA/378-525---------------------------------------------SQNKRAVRY--------------------------
Q1WUT1_LACS1/381-529---------------------------------------------YENTIAIKF--------------------------
Q38VP9_LACSS/378-526---------------------------------------------YQNRLALFY--------------------------
C8PCY7_9LACO/375-523---------------------------------------------SENGLAIKY--------------------------
C2E7U4_LACJH/384-532---------------------------------------------SENGLAIKY--------------------------
C2KAZ9_9LACO/380-528---------------------------------------------SENGLAIKY--------------------------
Q03AT6_LACC3/380-528---------------------------------------------FNNRLAIQE--------------------------
D0BKY7_9LACT/390-538---------------------------------------------QQHMIAIKA--------------------------
C8NE09_9LACT/413-561---------------------------------------------EQHIIAIKA--------------------------
E4KNA5_9LACT/790-938---------------------------------------------DQRRMAIRY--------------------------
D4YJ56_9LACT/433-583---------------------------------------------SFFKDAIMG--------------------------
E0IFR0_9BACL/366-514---------------------------------------------GKPRIPMYN--------------------------
E0RCM4_PAEP6/382-529---------------------------------------------GKPRISMVN--------------------------
C6J0R0_9BACL/364-511---------------------------------------------GKANLSMVH--------------------------
C0Z9G8_BREBN/364-513---------------------------------------------GKEKIPARH--------------------------
C4GB38_9FIRM/387-530---------------------------------------------DHLNLPIIH--------------------------
R5F1U8_9CLOT/387-539---------------------------------------------NHMDVPIRH--------------------------
E6LN70_9FIRM/381-525---------------------------------------------NLINKPVKN--------------------------
D4KXJ4_9FIRM/383-527---------------------------------------------GRMKEPIKN--------------------------
E3GGE0_EUBLK/365-508---------------------------------------------DRFRVPLIN--------------------------
E6MGM4_9FIRM/373-516---------------------------------------------DHFRVPLIT--------------------------
B8D0L3_HALOH/359-505---------------------------------------------GKPQLALLN--------------------------
C6PQD8_9CLOT/131-275---------------------------------------------GEYVMPIVN--------------------------
C8VXJ1_DESAS/366-509---------------------------------------------GKISIPVRN--------------------------
D9QSV7_ACEAZ/363-507---------------------------------------------GKTVIPARN--------------------------
B2A8K9_NATTJ/363-507---------------------------------------------GYPVLPVKN--------------------------
A8MK38_ALKOO/363-506---------------------------------------------GKPEIPVRN--------------------------
A5D2G5_PELTS/358-502---------------------------------------------GEASRPLRN--------------------------
D5X9J9_THEPJ/361-503---------------------------------------------GRTHLPVKN--------------------------
B2A2Z4_NATTJ/361-504---------------------------------------------NKPMIPVKN--------------------------
C7GYH1_9FIRM/373-517---------------------------------------------EKQFRPVRN--------------------------
A6TN15_ALKMQ/363-506---------------------------------------------GKVYIPVRN--------------------------
A8MIG9_ALKOO/365-508---------------------------------------------NRVYIPLRS--------------------------
Q67JD5_SYMTH/384-522---------------------------------------------GRIGAPVRN--------------------------
C4FNY8_9FIRM/361-503---------------------------------------------GRTVIPMVA--------------------------
D3LVV9_9FIRM/358-500---------------------------------------------GRTVIPLVN--------------------------
E2ZD67_9FIRM/360-502---------------------------------------------GHTGIPLLN--------------------------
R5TDG3_9FIRM/363-506---------------------------------------------GKTAVPFIN--------------------------
D3LX29_9FIRM/358-500---------------------------------------------KKPKIPVMN--------------------------
C4FPR1_9FIRM/359-501---------------------------------------------NKPRIPVIN--------------------------
A1HLQ5_9FIRM/371-513---------------------------------------------GHTAIPVVN--------------------------
C4V2B6_9FIRM/374-517---------------------------------------------GHPTIPMVN--------------------------
E8LB44_9FIRM/369-509---------------------------------------------GRTAIPVIN--------------------------
C0WBK9_9FIRM/378-517---------------------------------------------GKTRIPVIN--------------------------
B7DPH6_9BACL/373-525---------------------------------------------GKMYRPVRN--------------------------
C0ZHE2_BREBN/367-517---------------------------------------------GRVMRPARN--------------------------
C2YMP0_BACCE/352-495---------------------------------------------NRSKQAAWI--------------------------
B7GMA5_ANOFW/366-505---------------------------------------------GESKRAAVI--------------------------
E7RL93_9BACL/356-500---------------------------------------------NKARLGAWI--------------------------
D3FZH8_BACPE/357-501---------------------------------------------NREFAAAII--------------------------
B0MPG6_9FIRM/391-534---------------------------------------------GRSDLPVKL--------------------------
B0PEA8_9FIRM/441-584---------------------------------------------GRADLPVKL--------------------------
A7VWY4_9FIRM/433-577---------------------------------------------GRVDLPVKL--------------------------
E6TRQ4_BACCJ/362-512---------------------------------------------NRARDAALL--------------------------
D5WSL0_KYRT2/373-521---------------------------------------------GMTVRPVVN--------------------------
B1YGP9_EXIS2/345-491---------------------------------------------DAEKYAFVG--------------------------
C5RD31_WEIPA/359-505---------------------------------------------DYTRGVSWF--------------------------
Q8EU30_OCEIH/362-509---------------------------------------------GYIKRTALF--------------------------
B9E8U7_MACCJ/341-481---------------------------------------------NAFRIQLVA--------------------------
Q49V13_STAS1/337-479---------------------------------------------NQVRSIFQA--------------------------
E8SIP0_STAPH/344-486---------------------------------------------EEFRMIMKA--------------------------
Q2G0R7_STAA8/343-485---------------------------------------------HAVRPIFVG--------------------------
F2F183_SOLSS/360-508---------------------------------------------SKLKGPAVF--------------------------
A3IEA1_9BACI/365-514---------------------------------------------GKLKKPALF--------------------------
E7RLD1_9BACL/354-503---------------------------------------------GKVRVPAVL--------------------------
A0AF13_LISW6/361-504---------------------------------------------GKIIVPAVG--------------------------
D7UUI0_LISGR/356-499---------------------------------------------GKLYIPVIS--------------------------
A6CR25_9BACI/352-499---------------------------------------------ELIYFPALT--------------------------
E5WT44_9BACI/362-510---------------------------------------------GFIFFPAAA--------------------------
U5L445_9BACI/362-508---------------------------------------------GHTFFPAAV--------------------------
A8F924_BACP2/360-506---------------------------------------------GHTVYPAVV--------------------------
T5HW26_BACLI/356-502---------------------------------------------GNTCLPAVF--------------------------
A7Z0I0_BACA2/354-499---------------------------------------------GHTVFPAVS--------------------------
D4G3E4_BACNB/359-505---------------------------------------------GYTVFPAIA--------------------------
D5D970_BACMD/362-511---------------------------------------------GAVFAPVIA--------------------------
B7GFI4_ANOFW/350-497---------------------------------------------GDVFRPFFV--------------------------
A4IJD3_GEOTN/352-496---------------------------------------------GKEWAAAAG--------------------------
C5D378_GEOSW/360-505---------------------------------------------GYEWIAVAG--------------------------
Q5WAF7_BACSK/347-496---------------------------------------------GKIHIPLYA--------------------------
D3FR13_BACPE/361-509---------------------------------------------GYVHIPAWV--------------------------
Q9KGJ0_BACHD/361-507---------------------------------------------GYVHIPMIA--------------------------
D6XV50_BACIE/360-507---------------------------------------------GKAGKPAVW--------------------------
D3E759_GEOS4/381-532---------------------------------------------GMVKGPAIH--------------------------
E0RM54_PAEP6/373-525---------------------------------------------GAVRAPALA--------------------------
A7GJW7_BACCN/360-506---------------------------------------------GQTLKPALF--------------------------
B5UWQ0_BACCE/360-510---------------------------------------------GQTFKPALF--------------------------
D2BMG7_LACLK/323-465---------------------------------------------WQSRNLTKI--------------------------
B8IEZ7_METNO/324-461---------------------------------------------RRTRPVIAA--------------------------
C7NM90_HALUD/327-463---------------------------------------------NIDKGVARA--------------------------
A6DHF1_9BACT/293-436---------------------------------------------GVFTKGRLV--------------------------
Q47U72_COLP3/338-481---------------------------------------------AQHQLLSVV--------------------------
B4AGJ7_BACPU/343-486---------------------------------------------NRLKVPAVV--------------------------
Q1K412_DESAC/351-495---------------------------------------------GHVRFTAKR--------------------------
C0QCL2_DESAH/352-496---------------------------------------------GHISFSAKM--------------------------
Q2YCG5_NITMU/323-466---------------------------------------------GDQKTVLYS--------------------------
E6QMG7_9ZZZZ/367-517---------------------------------------------GKVWEEFYY--------------------------
F2G999_ALTMD/323-467---------------------------------------------AKTKDAFNI--------------------------
C6JQC3_FUSVA/323-462---------------------------------------------NKEKNTFYG--------------------------
E5X0H2_9BACE/326-464---------------------------------------------GRSDWAFRL--------------------------
A3DHV8_CLOTH/327-465---------------------------------------------GYSDLILKI--------------------------
B5CWR8_BACPM/324-466---------------------------------------------GKTNWLFYG--------------------------
F1VXT7_9BURK/320-462---------------------------------------------GRTDLLLRL--------------------------
Q2YCC1_NITMU/331-475---------------------------------------------GRADLSLKS--------------------------
Q0AHL3_NITEC/325-466---------------------------------------------GRPDVTMRN--------------------------
D4YX22_SPHJU/336-476---------------------------------------------GRPGTTARI--------------------------
Q1GPL1_SPHAL/342-484---------------------------------------------GKPSISMFT--------------------------
B0VF98_CLOAI/326-465---------------------------------------------GKTRFVMYN--------------------------
A1S103_THEPD/335-472---------------------------------------------GDTRANLEA--------------------------
E8R8C0_DESM0/349-487---------------------------------------------GKTQEVFRS--------------------------
A3DIV8_CLOTH/358-500---------------------------------------------GKQGILLRN--------------------------
F2JLQ5_CELLD/355-497---------------------------------------------GMQKQTFKT--------------------------
A7VPC0_9FIRM/355-497---------------------------------------------NEQLSYLSY--------------------------
A8SAU1_9FIRM/356-502---------------------------------------------GEQKAAFRY--------------------------
A6TSY6_ALKMQ/375-519---------------------------------------------GKQVVTTIN--------------------------
A6NPI5_9FIRM/351-494---------------------------------------------GRQAAAARS--------------------------
B0KBP6_THEP3/360-504---------------------------------------------GKQTVVLKN--------------------------
B7AQB6_9FIRM/351-493---------------------------------------------GKTGYTFVC--------------------------
D3AN52_9CLOT/376-519---------------------------------------------GKTSTTFIQ--------------------------
B0TAY6_HELMI/361-505---------------------------------------------GMVVFPLLV--------------------------
Q3ADH7_CARHZ/346-484---------------------------------------------SKPQTPFYI--------------------------
E0RMQ1_PAEP6/366-508---------------------------------------------DRPGSALLN--------------------------
C0ZAP4_BREBN/363-505---------------------------------------------DYAQVVFRN--------------------------
D7WQC4_9BACI/353-489---------------------------------------------GEARAAMMN--------------------------
C8WQG9_ALIAD/361-502---------------------------------------------NRAGTAMVN--------------------------
B7DPL3_9BACL/356-497---------------------------------------------NRAFVSTVI--------------------------
D5QEL1_KOMHA/351-483---------------------------------------------GRAEMNAIL--------------------------
A9WAD6_CHLAA/337-475---------------------------------------------ERTAALNVI--------------------------
E1IEK9_9CHLR/380-529---------------------------------------------ERLGTIIIS--------------------------
B9JKJ2_AGRRK/321-464---------------------------------------------DRPHILFRL--------------------------
Q2Y4J6_9ARCH/377-524---------------------------------------------NRPDIAAKI--------------------------
E8V165_TERSS/339-475---------------------------------------------DRQKKLFLW--------------------------
B8IGJ3_METNO/336-472---------------------------------------------ERSDFSFYL--------------------------
D7BDH0_MEISD/336-473---------------------------------------------RRPWATIPL--------------------------
F2NKF2_MARHT/337-483---------------------------------------------NRPWALIPL--------------------------
D8J725_HALJB/340-478---------------------------------------------GYSRLVLCN--------------------------
B8D178_HALOH/340-478---------------------------------------------GHPHYELYT--------------------------
C4RGH8_9ACTN/364-502---------------------------------------------GRTSWTFYN--------------------------
Q18GU8_HALWD/357-496---------------------------------------------GDTRAIFLV--------------------------
Q469G3_METBF/349-484---------------------------------------------GDSDFLMKC--------------------------
C5A2Y0_THEGJ/342-480---------------------------------------------GNTGFLTVS--------------------------
F0LLW6_THEBM/342-478---------------------------------------------GESKFIMLF--------------------------
F2KQE3_ARCVS/343-481---------------------------------------------GEAKFPTIA--------------------------
F0LLZ4_THEBM/339-477---------------------------------------------GKTTLNLVG--------------------------
Q5JDW0_THEKO/345-480---------------------------------------------GRTSDNLIG--------------------------
A1BJ49_CHLPD/337-476---------------------------------------------GHSRIILLN--------------------------
B3EHD9_CHLL2/365-504---------------------------------------------GHARVTFLN--------------------------
Q3APG3_CHLCH/338-477---------------------------------------------GYAQLSLIN--------------------------
B4SBS0_PELPB/338-477---------------------------------------------GHARLSLLN--------------------------
Q3B6G9_PELLD/337-476---------------------------------------------GHSRLSLLN--------------------------
A4SCQ1_PROVI/337-476---------------------------------------------GHARLSLMN--------------------------
D8PBA0_9BACT/336-473---------------------------------------------GEGGHLVRL--------------------------
D3SSH7_NATMM/337-474---------------------------------------------GTLRYPVAA--------------------------
B6IYF6_RHOCS/343-484---------------------------------------------GHAGRFMLL--------------------------
D0LQE6_HALO1/374-513---------------------------------------------GHTREAILC--------------------------
D2RVV2_HALTV/336-474---------------------------------------------GRARSRAIL--------------------------
D3STC0_NATMM/337-475---------------------------------------------GRAKHRAIS--------------------------
D8J472_HALJB/339-477---------------------------------------------GRARARAVS--------------------------
D2RXY9_HALTV/340-478---------------------------------------------GRARHRAIA--------------------------
E7QQ57_9EURY/339-477---------------------------------------------GRARERAWA--------------------------
C7P069_HALMD/318-461---------------------------------------------DRPGEAFKV--------------------------
C7NSR3_HALUD/331-469---------------------------------------------DRPDASMRV--------------------------
Q5V4U1_HALMA/327-465---------------------------------------------DRPDAAFRV--------------------------
D8J7W8_HALJB/319-457---------------------------------------------DRVDLVARA--------------------------
C7NSL6_HALUD/319-457---------------------------------------------DRPDLAAYA--------------------------
E4NUG7_HALBP/319-458---------------------------------------------DRPDLAAWA--------------------------
AGL15_HALVD/319-457---------------------------------------------NQPGLAARA--------------------------
Q12VM9_METBU/345-483---------------------------------------------DHPKESFKV--------------------------
A3CVY7_METMJ/333-471---------------------------------------------DRPKDSFKV--------------------------
A2STD2_METLZ/331-469---------------------------------------------DHARQAFYA--------------------------
A5UQJ1_ROSS1/330-463---------------------------------------------GQQSAFVPL--------------------------
D3FFB8_CONWI/338-471---------------------------------------------GDEKHYLLA--------------------------
D8GMK0_CLOLD/327-460---------------------------------------------GLQKKYMKI--------------------------
Q97GQ2_CLOAB/326-458---------------------------------------------NMEKKYLRA--------------------------
D5XD05_THEPJ/326-457---------------------------------------------NQQKKLTTI--------------------------
Q2NIB6_METST/328-458---------------------------------------------NKQHETVKA--------------------------
F0T719_METLA/333-463---------------------------------------------NRQTTLLKI--------------------------
Q2NH55_METST/331-464---------------------------------------------NKQVSVTKN--------------------------
E3GZ73_METFV/328-459---------------------------------------------NRQVTVTKT--------------------------
A5UNI7_METS3/328-460---------------------------------------------HRETAVTKI--------------------------
F0TC71_METLA/328-460---------------------------------------------NKQRILLIV--------------------------
Q12XY4_METBU/326-458---------------------------------------------GNQGVMAKL--------------------------
Q46FX4_METBF/329-461---------------------------------------------NRQRALMIF--------------------------
F0TBQ9_METLA/329-463---------------------------------------------NKQLIITKI--------------------------
Q0W809_METAR/331-464---------------------------------------------NRQKTTTNI--------------------------
D1Z261_METPS/328-462---------------------------------------------NHQRLTTVI--------------------------
O26442_METTH/329-460---------------------------------------------DRQGYRMLS--------------------------
A5UWW7_ROSS1/374-505---------------------------------------------RRQQSITVA--------------------------
E1IAS8_9CHLR/378-523---------------------------------------------NRQTAITRA--------------------------
D5UPU7_TSUPD/350-482---------------------------------------------HDQVFLLRL--------------------------
Q97AA3_THEVO/339-476---------------------------------------------RETRVFIYS--------------------------
Q2S953_HAHCH/328-463---------------------------------------------GRQRLFTLI--------------------------
F2NHK3_DESAR/367-498---------------------------------------------NREKRLLRL--------------------------
A3W1Y0_9RHOB/329-468---------------------------------------------GRAKTALQI--------------------------
C4XGJ8_DESMR/335-465---------------------------------------------GRQRYALYY--------------------------
A9EQ86_SORC5/331-462---------------------------------------------KREVAMVKL--------------------------
B9K2D6_AGRVS/332-468---------------------------------------------DKIRQRLFV--------------------------
E3FNG9_STIAD/347-485---------------------------------------------GQGWRVTRT--------------------------
B6YVL8_THEON/328-461---------------------------------------------NRQAIVTRT--------------------------
E0I7A7_9BACL/353-491---------------------------------------------NKTRTMLMF--------------------------
D5DY76_BACMQ/331-468---------------------------------------------KDTKKIFLH--------------------------
D7E977_METEZ/332-466---------------------------------------------KKTKTIGKI--------------------------
A1ASY9_PELPD/345-481---------------------------------------------EKTRSLMYI--------------------------
E8RTH0_ASTEC/331-467---------------------------------------------KKTKLLTVA--------------------------
Q0AP11_MARMM/327-464---------------------------------------------RRTGVMALV--------------------------
E7RZY6_9BURK/339-474---------------------------------------------KRSGRILLA--------------------------
Q12TY8_METBU/325-459---------------------------------------------NVPRIPAIV--------------------------
D9PYX0_METTM/350-483---------------------------------------------GYPRLPMYV--------------------------
F0TB30_METLA/351-484---------------------------------------------GKPRLPMYV--------------------------
F0EKD4_ENTCA/327-465---------------------------------------------KKEKLILYS--------------------------
Q5M4A4_STRT2/55-193---------------------------------------------KREKYALYS--------------------------
F0HVE0_LACDL/327-469---------------------------------------------KRERKNLIS--------------------------
E4SMU5_LACAR/327-469---------------------------------------------KREKMVLKN--------------------------
D4LGF1_9FIRM/327-469---------------------------------------------GREKENLMA--------------------------
A5ZUX1_9FIRM/326-464---------------------------------------------GKELYTCIA--------------------------
D5TQD2_BACT1/321-460---------------------------------------------NQSNKYSIA--------------------------
Q5LFL1_BACFN/328-466---------------------------------------------GREKYVIIS--------------------------
E8JWJ5_STRCR/327-467---------------------------------------------NRERYFMFA--------------------------
Q4JZ09_STREE/330-470---------------------------------------------GNEKYFMRA--------------------------
E6MFC3_9FIRM/328-466---------------------------------------------GKEKVVLYS--------------------------
E9RY62_9FIRM/330-468---------------------------------------------GKERIVLYS--------------------------
C5NWI0_9BACL/318-458---------------------------------------------NKNKEYMLS--------------------------
A1ILY9_STROR/319-458---------------------------------------------NQNKEFMIS--------------------------
Q4JYJ9_STREE/323-464---------------------------------------------DNVRYFTIS--------------------------
E0PD92_STREI/325-464---------------------------------------------GRDKEYTWV--------------------------
C6CSD9_PAESJ/327-465---------------------------------------------NLDSIFVKS--------------------------
B0N362_9FIRM/290-427---------------------------------------------KKDKIYIVS--------------------------
A5M4K0_STREE/211-349---------------------------------------------AKDKDYVLS--------------------------
C9LAR2_BLAHA/325-463---------------------------------------------SKDKEYTIS--------------------------
Q4K189_STREE/323-460---------------------------------------------SFDKEYTVS--------------------------
C4FB42_9ACTN/325-467---------------------------------------------SRDREYTLS--------------------------
E0S188_BUTPB/322-462---------------------------------------------NKEKMLLVS--------------------------
C3HRG9_BACTU/323-461---------------------------------------------EKDKQYVLP--------------------------
A7HKJ9_FERNB/322-460---------------------------------------------KKENYLTIS--------------------------
G5K6T2_9STRE/321-459---------------------------------------------KRTKAYTYS--------------------------
E7S3G0_STRAG/321-459---------------------------------------------RRTKAYTMS--------------------------
E0NHN4_PEDAC/321-459---------------------------------------------NQTNKYTIA--------------------------
E6LD53_9ENTE/253-391---------------------------------------------NQTKYFTIS--------------------------
C2KJQ1_LEUMC/329-467---------------------------------------------KRLNEFTLS--------------------------
B3XNV8_LACRE/322-460---------------------------------------------SRTKEYTIS--------------------------
B2GDL9_LACF3/322-460---------------------------------------------NRVKEYTIS--------------------------
C0WVB1_LACFE/322-460---------------------------------------------DRVKEYTVS--------------------------
A2RHU4_LACLM/321-459---------------------------------------------NRMREFTTS--------------------------
A1YVF6_LACJH/321-459---------------------------------------------HRQKQFTWS--------------------------
C2D643_LACBR/210-348---------------------------------------------NRVKEFTTS--------------------------
Q3ZK40_9LACT/322-460---------------------------------------------NKIKIYSTS--------------------------
D8MET9_LEUGG/321-460---------------------------------------------GLNKEYIGS--------------------------
A3F4D6_LACLC/321-459---------------------------------------------NQNKSYTVS--------------------------
D2EJ27_PEDAC/321-459---------------------------------------------NQNGAYTKS--------------------------
O06039_LACLC/321-459---------------------------------------------NRMKIFTKS--------------------------
Q8GPE5_STRTR/321-459---------------------------------------------NKPTGLTIS--------------------------
D7DRX9_METV3/353-490---------------------------------------------GKPQIATKF--------------------------
A4FX93_METM5/354-492---------------------------------------------GKPALSTKI--------------------------
A6UPA0_METVS/351-488---------------------------------------------GKPYLSTKI--------------------------
A6UU30_META3/353-490---------------------------------------------GKPSLSTKI--------------------------
D5VU50_METIM/353-494---------------------------------------------GKSFLSIKI--------------------------
D4W1F1_9FIRM/338-485---------------------------------------------GQYSRLVMS--------------------------
B9DSP4_STRU0/342-480---------------------------------------------ENQKKSFIY--------------------------
F1Z193_9STRE/350-488---------------------------------------------NHQKRSFII--------------------------
D4YGG7_9LACT/385-532---------------------------------------------GQWYKAGIA--------------------------
F2I7P9_AERUA/374-520---------------------------------------------NQWFYSAMA--------------------------
Q03E00_PEDPA/355-503---------------------------------------------GAVKPTLVA--------------------------
D2EHX4_PEDAC/355-503---------------------------------------------GRLKMTFWA--------------------------
A0A023M9A5_LACPN/357-507---------------------------------------------NEYTAMIIG--------------------------
E7FPH6_9LACO/355-501---------------------------------------------NLFSKAAFS--------------------------

PF03023

MURJ_BORBU/29-473---------------------------------------------KIFFIPSFSPIMLSFGIILSIFLFYGRFG...IY.
MURJ_RICPR/28-477---------------------------------------------KKFAAFAFSPIILSVCVIIFTLIFGNYIE..STI.
MURJ_ECOLI/28-479---------------------------------------------NRFSIPAFAPTLLNISMIGFALFAAPYFN.PPVL.
MURJ_SYNY3/36-495---------------------------------------------DQYLLPSISPLLSSITVILGLGVAVWQLGQQLNTE
MURJ_AQUAE/29-466---------------------------------------------GKFFVPSVSQTLFNLGFILSLVILFHTLG...HY.
MURJ_HAEIN/16-479---------------------------------------------GKFGVMSFSPVLLNIAMIATALFLAPQMD.NPDL.
MURJ_THEMA/28-450---------------------------------------------HRYFLPALTPMFSNVGVIVGCLFGDVRWA......
Q9X8T0_STRCO/300-778---------------------------------------------GRFGAMMWTPVLNNIVIIVTLGLFIWVYGTAETSG
MURJ_TREPA/32-489---------------------------------------------KVFVPSGCTPIFFNVSVIFSMYFLNVSHMNVAIA.
Q9RX17_DEIRA/83-522---------------------------------------------EHFRESSFAPVAFNIASIIALLLLPNNAT......
MURJ_CHLTR/34-482---------------------------------------------KKFFSVGLAPSVVNVSWIGTVFLARNYDPRNRIF.
MURJ_HELPY/2-458---------------------------------------------HSFFASAYSASLLNVCMILALLISKEKTHLEALY.
MVIN_MYCTU/48-521---------------------------------------------NVFGPPAWAPVVNNVVAIATLAVYLAVPGELSVDP

PF01554

O51531_BORBU/22-182---------------------------------------------AGVSLANKF--------------------------
YOEA_BACSU/28-189---------------------------------------------AAVSSFFPL--------------------------
YOEA_BACSU/257-418---------------------------------------------AAYGVVNQV--------------------------
O66528_AQUAE/245-406---------------------------------------------AAHQIGLRI--------------------------
YPNP_BACSU/241-402---------------------------------------------SGFGAVQRL--------------------------
NORM_VIBPA/243-404---------------------------------------------AAHQVAINF--------------------------
O80695_ARATH/278-441---------------------------------------------DSLAICMSI--------------------------
O26414_METTH/244-409---------------------------------------------AVYSAGWRI--------------------------
O28801_ARCFU/21-180---------------------------------------------SAVGLFFPI--------------------------
YISQ_BACSU/27-187---------------------------------------------AAVGVSNQI--------------------------
Y709_METJA/243-408---------------------------------------------AVYTGALRI--------------------------
YPNP_BACSU/21-182---------------------------------------------GAAAVSSTI--------------------------
O25454_HELPY/214-375---------------------------------------------AGMQIGIRV--------------------------
NORM_BACSU/20-180---------------------------------------------AGVAIGSSL--------------------------
HMRM_HAEIN/249-410---------------------------------------------ASHQITLNT--------------------------
O49660_ARATH/262-426---------------------------------------------SILIIVFNF--------------------------
O82752_ARATH/42-203---------------------------------------------SGGSLALGF--------------------------
DINF_ECOLI/35-196---------------------------------------------GGVAVGATA--------------------------
Q9ZVH5_ARATH/238-401---------------------------------------------AAMGILIQT--------------------------
O28801_ARCFU/239-404---------------------------------------------AAYTSAWRL--------------------------
Q38956_ARATH/275-438---------------------------------------------AALSICMNI--------------------------
ERC1_YEAST/174-335---------------------------------------------GGVTLGSMT--------------------------
Q9ZVH5_ARATH/16-176---------------------------------------------AGGALAMGF--------------------------
YAO6_SCHPO/17-177---------------------------------------------SVAAFAYMF--------------------------
O82752_ARATH/264-427---------------------------------------------ASMGILIQT--------------------------
O51429_BORBU/27-187---------------------------------------------SALSLAGPV--------------------------
O83871_TREPA/32-196---------------------------------------------GAVNVVNSL--------------------------
O51429_BORBU/248-409---------------------------------------------AAYGLTNTI--------------------------
YISQ_BACSU/252-413---------------------------------------------TTKVYTQNI--------------------------
O66528_AQUAE/25-183---------------------------------------------AATGFSLSL--------------------------
O51530_BORBU/21-181---------------------------------------------TGVSLANRV--------------------------
Y709_METJA/21-181---------------------------------------------AAVGASFPI--------------------------
NORM_BACSU/247-408---------------------------------------------ASHQAAMNF--------------------------
NORM_VIBPA/17-176---------------------------------------------AAVSVASSI--------------------------
O26414_METTH/24-183---------------------------------------------AAIGFVTPI--------------------------
HMRM_HAEIN/22-181---------------------------------------------AAISIGASI--------------------------
YD338_YEAST/238-397---------------------------------------------AAVSLASMT--------------------------
MDTK_ECOLI/17-177---------------------------------------------AAVAIGTSI--------------------------
Q38956_ARATH/55-215---------------------------------------------AAVSVENSV--------------------------
P71616_MYCTU/19-179---------------------------------------------AGLAIGSLV--------------------------
O49660_ARATH/40-200---------------------------------------------AGGSLGFSF--------------------------
O80695_ARATH/57-217---------------------------------------------AAASLGNSG--------------------------
MDTK_ECOLI/244-405---------------------------------------------AGHQIALNF--------------------------
F4IHU9_ARATH/37-197---------------------------------------------SAASIATSF--------------------------
O25796_HELPY/23-184---------------------------------------------AAVNIAWPI--------------------------
YEEO_ECOLI/48-208---------------------------------------------AGVGLADSF--------------------------
Q8DNG1_STRR6/24-183---------------------------------------------AAVGATTAI--------------------------

PF07260

G1KED7_ANOCA/1-345---------------------------------------------KEDAVEMLASYGLAYSLMKFFTGPMSDFKNVGLVF
I3JFW4_ORENI/1-349---------------------------------------------KEDAVEMLASYGLAYSLMKFFTGPMSDFKNVGLVF
F1Q528_DANRE/1-344---------------------------------------------KEDKVEMLASYGLAYSLMKFFTGPMSDFKNVGLVF

PF01943

SP5B_BACSU/6-308-------------SLTITG---VLSLIF---TPL-----FLFFAPV........MAETMLTDKRTLYPL-LAITPV.VPI
EXOT_RHIME/10-277-------------LAIALM---MALGLF---VFA-----EPLAT............LLGAPEAAYLLRI-MSLLIP..LQ
TUAB_BACSU/10-277-------------IMTGVL---LFVLLY---VSS-----PVIAG............FYQREELVFLVRI-LAIMFL..IA
RFBX_ECOLI/8-279-------------VIFSKI---VLIVIT---LIF-----LTS.M............TLLVPEYNKHAVI-IWSFVP..AL
O26447_METTH/15-286-------------VMVTKT---ILLAVT---FMA-----MLV.T............VFLIDRFRSDYLL-YIFTYG..LV
YTGP_BACSU/5-320-------------GMSVML---VTGMIA---FFI-----LYLSAPMFAEISLGGKDNNGLTIDHVVYVI-RMVSLA.LLV
Y1068_METJA/7-302-------------TILAFI---VAFLVV---IFA-----PYIAEFYIN....NQGQFTGRLDLVINILI-IMAMGY.YFL
Y1375_METJA/3-283-------------LYLMIL---LSVVGF---ILT-----PYIKY............ILGGHYLNLPNIL-YFAVGLCVVA
O26479_METTH/10-276-------------RIILSC---IVFVLI---LLF-----PLT.G............LYSGTAAAVIVFI-AGYMLL....
O29660_ARCFU/6-285-------------ALLVLA---VASMLF---LGS-----DFIAE...........QFFSKPELSLPLRI-MALYIT...F
O26467_METTH/18-289-------------VMLIKG---ILATLS---FCI-----LLL.V............ILNIPRFSVNWQV-YTFAFG..LV
O26442_METTH/7-278-------------AVFLKI---PLSILT---FVL-----IAVLA...........WTFNLSSDASILLY-LFGIYN..IL
YABM_BACSU/12-309-------------ALFLSL---IGILLF---LCL-----YLGAVPI........ALFMGDSHLAVLIQV-AAYAFL..LF
WZXC_ECOLI/9-276-------------VGLGIV---VCVAVF---LLS-----DLIGD............VLNNPDLAPLIKT-LSLAFV..VI
Q2K5A6_RHIEC/11-272-------------VTRSAI---LALLFA---AAS-----YPIAE............FYDEPRLTSVMLA-LSFSLL..LS
Q32EG2_SHIDS/2-269-------------TLIVKL---LLATIC---LAL-----GCV.H............LMYVKEYSLIYPF-IISSIY...L
Q8DZE2_STRA5/6-273-------------AFSVGN---IWFLIV---LLI-----AFLFR............SFLAPLVGFSESI-FLLMVCQSYA
Q8P805_XANCP/25-289-------------SGIGLM---LSVVVF---ATA-----HWIAD............FYHEPALVTISQA-LAVTFL..LN

PF13440

I4HBM6_MICAE/6-298-------------VFTGVF---LTTITF---PSA-----ILISK----------..IFRQPFLIPILQV-LSLVFV--IN
I0T9J8_9BACT/34-326-------------IGVGII---AYIVLF---LIA-----PLVAN----------..FYNQPILSPIIRI-TGLGVI--LN
C4ZJE4_THASP/32-325-------------MLSGAF---ICSGIF---YIS-----DEIQS----------..FYAIDGLGDLVRI-LAFVFP--IV
K9PM46_9CYAN/51-343-------------IALSVA---TAFITV---AIA-----PVLAW----------..FYDQPRLLGITLA-LASGFI--IS
A9KN88_CLOPH/33-329-------------FIISCL---IYLLIF---ITR-----NHIAR----------..MLGSPNLGFAISI-ASLNIL--LT
M0N8I3_9EURY/48-343-------------NARGLV---VAAVLF---VSA-----PIVAS----------PLVFDEPQLAPVLRV-LALSPL--LS
E5VCV6_9BACE/28-323-------------IISGFV---ISVIIC---ILA-----PWVAI----------..YYNQPELVNIISL-LSLNVI--FS
A4A6G8_9GAMM/8-300-------------LVFGAL---AYLLLL---LIS-----PLIAE----------..LFDNAELVPLLNI-AGLVFL--VQ
R6E9E7_9BACE/31-323-------------IILGAI---VALLFF---SCS-----WCISS----------..FYNNVQLIYVCQL-LSLNLF--LS
K6YGT5_9ALTE/31-321-------------LGVSTL---IGTIIA---LVI-----APLSN----------..YYYQAGSGTVLLF-LALVPV--LN
F3KH97_9GAMM/34-324-------------LIFGIG---LSILLV---ACA-----GIIAD----------..FYDSPDLKELVWA-IASLFV--IG
C0CUD1_9FIRM/143-435-------------LCLAAA---MYGALF---FAA-----PAIAR----------..FYRNDVLVPIVRV-LAFVLF--PG
R7DCU6_9PORP/33-325-------------IVVGII---LYLVLF---FSS-----PYIAL----------..FYNVPILEDLTKV-IAIPLI--LN
R6YG40_9FIRM/34-326-------------IVMSWI---FYAIVF---LGA-----PLVAS----------..FYGKEILCPVLRV-LALKIP--LA
H1DLG1_9PORP/33-325-------------LVFSIL---FFLAIL---FSA-----PFIAN----------..YFNYPKIEIYLTV-QSFALI--FR
M5DLR8_9PROT/54-346-------------VISGLF---GAGLLA---AFA-----EQLAF----------..LLGNPEAVAYLRF-AAIPLF--LQ
C6LGC8_9FIRM/33-329-------------AVLSVI---IYCIIF---GWR-----RSLAS----------..AIGCPEAYNGLAT-AALTVL--CT
K5CQA8_9BACE/33-325-------------VWTGIG---ISVLFF---AAS-----WLIAD----------..YYNSDILRTLCQL-LSVNLF--FA
B8HLM4_CYAP4/51-343-------------VGFSAA---IALVIA---ALS-----PSIAW----------..FYREPRLVPITLI-LSVGLG--LS
G5F456_9ACTN/34-326-------------LAISVV---LYVAVF---CLA-----PAVSS----------..FYGMPQAVTPLRV-LVLVLV--VN
R6A4H2_9BACE/33-325-------------LLLSFI---LYAVLY---LCA-----PAIAG----------..FYNIPLLDNVLKV-QGIVLI--IN
S5C4K3_ALTMA/35-325-------------FLFGLS---ASLVFW---ILS-----DSLAA----------..FFEDDRLALVFSV-LGLLFI--IN
L8F559_MYCSM/28-320-------------LCSSLL---TAGMMV---AFA-----GWLAS----------..ALGVPEAATPIRI-LAITVF--FT

PF04506

RFT1_CANGA/9-542-------------LFIGIP---LSIGLI...AWQ..YH.NINGY------------FVTLPFFQWSVFA.IWVGII--LE
E9IWP9_SOLIN/8-542-------------VPICVV---MSFFFG..YIWL..FL.LSTTE------------ALPPY.YTFAVWA.VGLSCV--IE
S9VRB9_SCHCR/24-535-------------VYAGII---VSILVA...FFY.......MYA------------MPIFPYKTICILL.YSFAGF--LY
C5E2W4_LACTC/16-558-------------LCIGVP---LSLVLI...GWQ..YS.NLNEY------------FLSLPYFKLSIAM.IWLSII--FE
E9EIH0_METAQ/28-566-------------IVLGLF---VSTGLG....WI.YLA.CANES------------ILQTPYLVHSLYL.YGLAAM--VE
G8BWS7_TETPH/20-558-------------LMIGIP---LSIVLT...TWQ..YN.NVNSF------------FVSLPYFTTSIFL.IWISIL--IE
H2ASC3_KAZAF/14-533-------------IFIGIP---LSIVLT...VWQ..YN.NINSY------------FVNLPFFNWSILI.IWLSGL--LE
RFT1_YARLI/102-645-------------VLLGVF---FSSVAA............ASHS------------LFSVAYASWAVQL.VCIAAM--VD
RFT1_SCHPO/10-520-------------VYIGIV---ISLLVS...LFY.......FYS------------LPNFPYSKTCIFI.YTVSSF--IE
I2GX14_TETBL/21-581-------------LWIGIP---LSIGLI...SWQ..YR.NVNSY------------FVGLPFFTWSIFL.IWASII--IE
A7TRS5_VANPO/18-551-------------IWIGIP---LSIVLI...TWQ..YT.NVNAY------------FISLPHFQLSIFL.IWISII--IE
J7R8K9_KAZNA/27-584-------------MYIGIP---LSLILT...TWQ..YR.NINEY------------FVQLPHFTMSICI.IWAACI--LE
M2PSW7_CERS8/12-528-------------ILLGVP---TAILAT...LLY..LK.TASST------------TTSQPHFRLAVVI.YALAAL--FE
RFT1_CAEEL/2-516-------------PIISTV---ISVVCV..YLWYAFSS.TSDE.------------......VSWSVLLSFPISAI--IE
G8ZPN0_TORDC/18-550-------------MRIGVP---LSIVLI...TWQ..YR.NISNY------------FIGLPYFTWSIFL.IWLSII--VE
C4R7X1_PICPG/21-528-------------LVIGVP---FSSILI...YTQ.FIR.QQNAA------------VLQSPLFRYSVGF.MWLSVI--IE
U5D209_AMBTC/17-521-------------VPIGFL---LTIAACSFVLWW..QS.LNLSG------------K.....YAQAVLI.HGFACI--LE
G0W6B8_NAUDC/22-586-------------FVIGVP---LSIVLT...TWQ..YK.NINGY------------FINLPFFQVSILL.IWISII--VE
E2AM70_CAMFO/8-540-------------VPICLV---MSFLFG..YIWL..FL.LSTAE------------ALPPY.YTFAVWA.VGLSCI--IE
E9GUV5_DAPPU/9-536-------------VPSVII---CSLTFC..YIWL..HL.LELPA------------DKYVADYKFAVYM.FGASCT--IE
D8M9P3_BLAHO/10-506-------------VPTGVV---ISIVTS..LIWL..YV.LPDP.------------..QVAFYKQSIFV.FALSSI--IA
F4K836_ARATH/105-602-------------VPLGIA---ITIAACIFVLWW..QN.LSYSD------------P.....YAQAIWI.HGFACV--LE
U4LAR2_PYROM/52-567-------------LPLGIC---FSGVLG.WSYWR.......GSE------------VGQLPWGKEAVGL.YVLATI--FE
RFT1_DROME/8-549-------------VPICAV---LCAPCL..YIWL..NW.LSAVD------------AIYASQYEFACYA.VAFSCV--LE
G8BFC9_CANPC/25-545-------------FLIAIP---VTLLVG...YYQGIKSVNFQDF------------FLILPFNKIAIGV.LFSSTI--LE
M3BX75_SPHMS/8-530-------------IAGGIP---IVLALA...QWY......LTTS------------LPDVPYFVESLRI.YQLAAV--IE
W4Z9M3_STRPU/12-532-------------LPLGVV---CATILS..YVWI..AL.LSQPD------------PNIVPHYNTSVLV.FAFSAV--IE
RFT1_ASHGO/11-543-------------MCIGAP---LAVVLA...VWQ..YS.NLNSY------------FTQLPFFSWSIYL.VLLSIL--AE
M3K0B3_CANMX/13-532-------------ILL...---LSVILPIIGYWQFQYS.SVIAS------------LYSLPYHQLTILL.VVLSIV--VE
G8JV96_ERECY/11-550-------------ICIGFP---LALVLM...AWQ..YS.NINEY------------FIELPFFSWSIFF.IFVGIL--AE
G0V9M8_NAUCC/17-571-------------LCIGIP---LSIVLT...TWQ..YR.NINAY------------FVTLPFFTWSILL.IWCSII--IE
H9J737_BOMMO/8-547-------------VPISSL---LSIVFV..YIWL..NW.LPLGN------------PEHAYQYTFGCWS.VAFSCV--LE
R4XDT4_TAPDE/6-505-------------VTAGLF---ISSVLS...AAY..IS.RAPDE------------SRRIDYFTSTVSI.YAFSTI--IE
RFT1_YEAST/18-565-------------FWIGFP---LSIGLI...AWQ..YR.NINAY------------FITLPFFRWSIFL.IWLSII--VE

PF14667

Q03SZ7_LACBA/349-498-------------LMTGFI...VKCLFN--------------------------------------------------RW
Q38V74_LACSS/358-503-------------LLIGLL...VKVVIN--------------------------------------------------QW
Q034V3_LACC3/356-499-------------LLLGIL...LKAVIN--------------------------------------------------QP
A8UAN8_9LACT/362-510-------------LLIGLG...VKIVLN--------------------------------------------------EW
D0BM46_9LACT/359-506-------------LLIGLI...AKGIGN--------------------------------------------------LW
C8NI78_9LACT/366-514-------------LVAGLV...VKAGTN--------------------------------------------------YL
C0WQN7_LACBU/354-501-------------ITCGFV...VKLIIN--------------------------------------------------KW
C2EHH6_9LACO/356-502-------------LGVAFL...TKYILN--------------------------------------------------SY
E6LEY4_9ENTE/358-506-------------VVCGCI...VKFVTT--------------------------------------------------GI
C9A420_ENTGA/359-508-------------AGCGLL...LKGLLT--------------------------------------------------WP
C2HEH9_ENTFC/359-507-------------AGWGLL...VKGLTT--------------------------------------------------SF
C0X942_ENTFL/359-507-------------AGVGLL...VKLLTT--------------------------------------------------GF
E0RUK9_BUTPB/373-516-------------LTVGWA...VHIGLL--------------------------------------------------VL
E7MM58_9FIRM/379-526-------------FLIGFL...VKVVTF--------------------------------------------------YP
E4LZJ6_9CLOT/384-531-------------LAIMMV...VKFSVA--------------------------------------------------YP
D4W2K6_9FIRM/377-526-------------LVVGLL...IKYVGN--------------------------------------------------VI
D5E4C9_BACMQ/373-523-------------MFLGIV...IKLILN--------------------------------------------------FI
B7JJF5_BACC0/376-524-------------FSVGIL...VKVLVN--------------------------------------------------TP
Q8EP19_OCEIH/372-521-------------LLTGLF...VKILLN--------------------------------------------------SQ
B1YKH1_EXIS2/386-534-------------TLAGLL...TKYLLN--------------------------------------------------AP
D6Y0K7_BACIE/382-530-------------LLIGIL...TKLIVN--------------------------------------------------IP
Q5WE75_BACSK/374-522-------------LVVGLL...LKLGLT--------------------------------------------------YV
E6U1Q3_BACCJ/375-523-------------LLAGLI...FKLTFT--------------------------------------------------YL
D3FXP2_BACPE/374-522-------------LVAALL...VKLALN--------------------------------------------------YL
A4IRX9_GEOTN/371-520-------------LAAGLL...VKLSLN--------------------------------------------------TL
D5DN36_BACMD/374-521-------------LLFGLI...VKIVVN--------------------------------------------------VP
A7Z7U6_BACA2/375-524-------------LFIGVI...IKVVLN--------------------------------------------------MP
A0RJU4_BACAH/372-520-------------LIMGVI...LKFVCN--------------------------------------------------VI
E7RE43_9BACL/368-516-------------LSTGLL...LKALLN--------------------------------------------------TP
A3I8W7_9BACI/372-521-------------LLSGIF...VKLALN--------------------------------------------------IP
A6CQJ8_9BACI/372-520-------------LLVGLL...IKLVLN--------------------------------------------------IP
A0A0E0UWL5_LISMM/370-518-------------LLLGLL...AKSVLQ--------------------------------------------------MP
Q2FXH6_STAA8/386-533-------------ILASVV...IKLALN--------------------------------------------------YP
B9E7H2_MACCJ/374-522-------------VVASLL...VKLVIN--------------------------------------------------FP
D5T1U4_LEUKI/363-511-------------FTLGFV...VKLILQ--------------------------------------------------PI
Q03XR0_LEUMM/330-477-------------IGWGIA...VKILCQ--------------------------------------------------PI
A0NHL2_OENOE/387-534-------------LIYGIL...LKMVFQ--------------------------------------------------VP
B1MY12_LEUCK/485-634-------------FVFGLL...VKVALQ--------------------------------------------------VP
C2KKY7_LEUMC/498-647-------------FFVGII...IKIVLQ--------------------------------------------------IP
C0WLU0_LACBU/374-518-------------LIGGLI...VKLVLQ--------------------------------------------------IP
C2EP42_9LACO/342-483-------------MIWGVV...VKLILQ--------------------------------------------------VP
H7C726_ENTFA/370-519-------------TSITLL...LKLIIQ--------------------------------------------------IP
C5RB06_WEIPA/501-648-------------LIFIFA...VKIVLQ--------------------------------------------------VP
A8UCR2_9LACT/391-539-------------LVIGLV...VKLAFQ--------------------------------------------------YP
A2RMM4_LACLM/390-539-------------FTLTLV...IKLVLQ--------------------------------------------------VP
T0UE48_9ENTE/381-529-------------FFIGLL...LKFILQ--------------------------------------------------YP
E6LIJ6_9ENTE/381-529-------------LVIGFI...LKLILQ--------------------------------------------------VP
Q838A3_ENTFA/382-530-------------LGIGLA...VKLIVQ--------------------------------------------------FP
C2H7P1_ENTFC/381-529-------------LVVGFL...VKLLLQ--------------------------------------------------YP
A4VW05_STRSY/379-527-------------FLIGML...VKIVLQ--------------------------------------------------VP
E3CI47_STRDO/375-523-------------FLWGIL...AKLVFQ--------------------------------------------------VP
A3CPL5_STRSV/375-523-------------FLYGVG...VKLVLQ--------------------------------------------------VP
E8K660_STRPA/410-558-------------FLYGVV...VKLVLQ--------------------------------------------------IP
B1SH45_9STRE/377-525-------------FAYGLV...VKIVLQ--------------------------------------------------VP
C2LQ70_STRSL/432-580-------------FAIGVL...VKAILQ--------------------------------------------------LP
A5VL26_LACRD/382-530-------------LAIGIV...IKFILQ--------------------------------------------------FP
D2ELV8_PEDAC/393-541-------------FVVGMI...VKFIFQ--------------------------------------------------FP
C0WUG9_LACBU/378-530-------------FAVGTL...IKFIIQ--------------------------------------------------WP
Q03RI1_LACBA/378-525-------------FLVGTV...VKFIVQ--------------------------------------------------WP
Q1WUT1_LACS1/381-529-------------AVIGMI...VKVIIQ--------------------------------------------------FP
Q38VP9_LACSS/378-526-------------LLIGFI...VKVVAQ--------------------------------------------------YP
C8PCY7_9LACO/375-523-------------LLIGII...IKSIFQ--------------------------------------------------WP
C2E7U4_LACJH/384-532-------------LVLGII...IKFAVQ--------------------------------------------------LP
C2KAZ9_9LACO/380-528-------------LILGLI...LKGILQ--------------------------------------------------YP
Q03AT6_LACC3/380-528-------------MLIGLA...VKVIVQ--------------------------------------------------WP
D0BKY7_9LACT/390-538-------------LVIALV...VKMLWQ--------------------------------------------------PM
C8NE09_9LACT/413-561-------------LGFTVI...IKLLWQ--------------------------------------------------PM
E4KNA5_9LACT/790-938-------------LLIGLL...VKAMAQ--------------------------------------------------YP
D4YJ56_9LACT/433-583-------------MLLGVT...LKLVLQ--------------------------------------------------AP
E0IFR0_9BACL/366-514-------------TLIGIA...VKLVAS--------------------------------------------------VA
E0RCM4_PAEP6/382-529-------------VMVGIV...VKFAAS--------------------------------------------------WL
C6J0R0_9BACL/364-511-------------VAIGIL...VKLAAS--------------------------------------------------YV
C0Z9G8_BREBN/364-513-------------LLYGVI...VKVLAT--------------------------------------------------LV
C4GB38_9FIRM/387-530-------------SLIATG...VQALFL--------------------------------------------------VV
R5F1U8_9CLOT/387-539-------------AVIALV...IHVAVL--------------------------------------------------EV
E6LN70_9FIRM/381-525-------------AFISLI...IHFIIL--------------------------------------------------YI
D4KXJ4_9FIRM/383-527-------------AIIALV...LHLGLL--------------------------------------------------AA
E3GGE0_EUBLK/365-508-------------LAIAIV...IRFVTG--------------------------------------------------WI
E6MGM4_9FIRM/373-516-------------LGLGII...VFSVTG--------------------------------------------------WI
B8D0L3_HALOH/359-505-------------LGIGSA...IKLTGI--------------------------------------------------YF
C6PQD8_9CLOT/131-275-------------LAIGCA...IKTAIT--------------------------------------------------IQ
C8VXJ1_DESAS/366-509-------------LLVGII...FKIGFT--------------------------------------------------YY
D9QSV7_ACEAZ/363-507-------------LFLGGA...LNAVLN--------------------------------------------------YF
B2A8K9_NATTJ/363-507-------------LCYGAL...VNLVIN--------------------------------------------------YY
A8MK38_ALKOO/363-506-------------LLIGAL...LKLVVT--------------------------------------------------YT
A5D2G5_PELTS/358-502-------------LVLASL...FKITGI--------------------------------------------------YF
D5X9J9_THEPJ/361-503-------------LLVGVV...VKLGLN--------------------------------------------------YY
B2A2Z4_NATTJ/361-504-------------LIIGTF...LKAILT--------------------------------------------------YW
C7GYH1_9FIRM/373-517-------------ILIGIV...AKIILT--------------------------------------------------YV
A6TN15_ALKMQ/363-506-------------LMIGVL...VKIIIS--------------------------------------------------YI
A8MIG9_ALKOO/365-508-------------LLIGAI...IKVVVS--------------------------------------------------YY
Q67JD5_SYMTH/384-522-------------FVLGAA...VKIGLT--------------------------------------------------AW
C4FNY8_9FIRM/361-503-------------IFIGLL...AKTFLD--------------------------------------------------YQ
D3LVV9_9FIRM/358-500-------------MAIGAG...IKIFLS--------------------------------------------------WH
E2ZD67_9FIRM/360-502-------------MGISAL...VKIVLS--------------------------------------------------WY
R5TDG3_9FIRM/363-506-------------MVVSAA...VKVFLS--------------------------------------------------WN
D3LX29_9FIRM/358-500-------------MMIAAA...VKVCCN--------------------------------------------------WF
C4FPR1_9FIRM/359-501-------------MGIALV...IKVILN--------------------------------------------------WT
A1HLQ5_9FIRM/371-513-------------MGISAV...VKVVLN--------------------------------------------------WR
C4V2B6_9FIRM/374-517-------------MVLAAA...AKIFLN--------------------------------------------------WH
E8LB44_9FIRM/369-509-------------MIIACI...VKIVMS--------------------------------------------------WY
C0WBK9_9FIRM/378-517-------------MIIAAI...VKVFLN--------------------------------------------------WN
B7DPH6_9BACL/373-525-------------MFLGLG...IKTALN--------------------------------------------------FA
C0ZHE2_BREBN/367-517-------------LFIGVL...VKLILN--------------------------------------------------LA
C2YMP0_BACCE/352-495-------------VVGASF...VKVILN--------------------------------------------------IV
B7GMA5_ANOFW/366-505-------------ILIGCF...VKWGTN--------------------------------------------------IL
E7RL93_9BACL/356-500-------------IIIGVG...IKLFLN--------------------------------------------------LT
D3FZH8_BACPE/357-501-------------VLMCSA...VKFVLN--------------------------------------------------II
B0MPG6_9FIRM/391-534-------------MLPGCA...VKLIFN--------------------------------------------------VF
B0PEA8_9FIRM/441-584-------------LFAGGL...MKLALN--------------------------------------------------FV
A7VWY4_9FIRM/433-577-------------LSVGVI...IKIILN--------------------------------------------------YT
E6TRQ4_BACCJ/362-512-------------LAAGVV...IKIIGN--------------------------------------------------NI
D5WSL0_KYRT2/373-521-------------LFIGLV...LKVVLN--------------------------------------------------LW
B1YGP9_EXIS2/345-491-------------VVAGLL...IKLGLN--------------------------------------------------IY
C5RD31_WEIPA/359-505-------------VLLTMI...VKYILN--------------------------------------------------MI
Q8EU30_OCEIH/362-509-------------IAITFI...IKWIGN--------------------------------------------------LL
B9E8U7_MACCJ/341-481-------------VIAGIL...TKFLLN--------------------------------------------------LL
Q49V13_STAS1/337-479-------------FITGVV...SKAILN--------------------------------------------------VV
E8SIP0_STAPH/344-486-------------LVIGIV...TKGVLN--------------------------------------------------II
Q2G0R7_STAA8/343-485-------------MTAGLV...IKFILN--------------------------------------------------II
F2F183_SOLSS/360-508-------------LGVGIV...LKYIGN--------------------------------------------------II
A3IEA1_9BACI/365-514-------------LMIGFV...LKIILN--------------------------------------------------VR
E7RLD1_9BACL/354-503-------------LISGLV...VKVICN--------------------------------------------------LL
A0AF13_LISW6/361-504-------------VGIGLI...VKWIIG--------------------------------------------------SI
D7UUI0_LISGR/356-499-------------VLIGIV...VKWLAN--------------------------------------------------QF
A6CR25_9BACI/352-499-------------ILGGLA...VKFGLN--------------------------------------------------IL
E5WT44_9BACI/362-510-------------ILMGFA...VKLALN--------------------------------------------------IL
U5L445_9BACI/362-508-------------IIGGFG...IKYILN--------------------------------------------------IL
A8F924_BACP2/360-506-------------VLLSVL...VKWILT--------------------------------------------------LA
T5HW26_BACLI/356-502-------------VCCGIL...VKAVLN--------------------------------------------------EL
A7Z0I0_BACA2/354-499-------------VLAGGA...LKWVLN--------------------------------------------------VW
D4G3E4_BACNB/359-505-------------VGAGVA...VKWVLN--------------------------------------------------TL
D5D970_BACMD/362-511-------------VIAGMA...VKLILN--------------------------------------------------LW
B7GFI4_ANOFW/350-497-------------VCVGMI...AKWGLN--------------------------------------------------VL
A4IJD3_GEOTN/352-496-------------VAVAVA...GKMALM--------------------------------------------------HW
C5D378_GEOSW/360-505-------------VCVAVA...GKTACN--------------------------------------------------WL
Q5WAF7_BACSK/347-496-------------VAVGLA...VKLAGN--------------------------------------------------LL
D3FR13_BACPE/361-509-------------MGLGIL...VKLGLN--------------------------------------------------IL
Q9KGJ0_BACHD/361-507-------------LAVSLL...VKMVAN--------------------------------------------------VV
D6XV50_BACIE/360-507-------------LLAGVG...VKGLGN--------------------------------------------------AV
D3E759_GEOS4/381-532-------------LLAAAG...LKLLLN--------------------------------------------------LL
E0RM54_PAEP6/373-525-------------MLAAAV...AKALLN--------------------------------------------------WL
A7GJW7_BACCN/360-506-------------VVLGSC...LKVVLN--------------------------------------------------YI
B5UWQ0_BACCE/360-510-------------VVFGGC...LKLALN--------------------------------------------------YI
D2BMG7_LACLK/323-465-------------QSVSGF...ISLGII--------------------------------------------------SL
B8IEZ7_METNO/324-461-------------ALIGAA...VNAFGV--------------------------------------------------LT
C7NM90_HALUD/327-463-------------SLSAAV...LNAVVN--------------------------------------------------LF
A6DHF1_9BACT/293-436-------------VIFTAI...FNVVLS--------------------------------------------------VL
Q47U72_COLP3/338-481-------------NLLGAL...LNIGLS--------------------------------------------------LV
B4AGJ7_BACPU/343-486-------------TLILGV...SNVLFA--------------------------------------------------YG
Q1K412_DESAC/351-495-------------AVVEAV...MNVVFS--------------------------------------------------LL
C0QCL2_DESAH/352-496-------------TIVEAM...INLILS--------------------------------------------------IS
Q2YCG5_NITMU/323-466-------------QMACLMVMIFGLSLT--------------------------------------------------IN
E6QMG7_9ZZZZ/367-517-------------SVPNILFLAVTVPLS--------------------------------------------------YL
F2G999_ALTMD/323-467-------------VLINIF...CNILIA--------------------------------------------------SC
C6JQC3_FUSVA/323-462-------------NMGVMI...VSILIS--------------------------------------------------LI
E5X0H2_9BACE/326-464-------------EIIKKT...IATLIL--------------------------------------------------LL
A3DHV8_CLOTH/327-465-------------EIIKKV...LELLIL--------------------------------------------------LI
B5CWR8_BACPM/324-466-------------GVSNTC...FTVLGF--------------------------------------------------II
F1VXT7_9BURK/320-462-------------GIIGTI...LQVTSF--------------------------------------------------FI
Q2YCC1_NITMU/331-475-------------AVFALI.....ILLP--------------------------------------------------LI
Q0AHL3_NITEC/325-466-------------VLLASI...VMPIAF--------------------------------------------------LI
D4YX22_SPHJU/336-476-------------AAVGAV...LMPAAF--------------------------------------------------LI
Q1GPL1_SPHAL/342-484-------------AMSGAM.....LFPA--------------------------------------------------SF
B0VF98_CLOAI/326-465-------------SLFLLI...SNAILN--------------------------------------------------YL
A1S103_THEPD/335-472-------------SLAGLA...VLLPLA--------------------------------------------------AP
E8R8C0_DESM0/349-487-------------WIVNTL...VSLPLT--------------------------------------------------LI
A3DIV8_CLOTH/358-500-------------SIVGYV...IRILFV--------------------------------------------------IY
F2JLQ5_CELLD/355-497-------------NVMGSL...ICIALI--------------------------------------------------LL
A7VPC0_9FIRM/355-497-------------NIIDSV...MRVGLI--------------------------------------------------LF
A8SAU1_9FIRM/356-502-------------SVWDAV...LRIGGV--------------------------------------------------AV
A6TSY6_ALKMQ/375-519-------------YMLGMS...IQLYCT--------------------------------------------------YI
A6NPI5_9FIRM/351-494-------------SLICGA...VQLGCT--------------------------------------------------WV
B0KBP6_THEP3/360-504-------------SIIWLG...VCIIGM--------------------------------------------------YY
B7AQB6_9FIRM/351-493-------------GIISTL...MRIAFI--------------------------------------------------IF
D3AN52_9CLOT/376-519-------------NVTALF...VRLAFV--------------------------------------------------LF
B0TAY6_HELMI/361-505-------------TVATSL...LRVGLF--------------------------------------------------LT
Q3ADH7_CARHZ/346-484-------------LLGASG...VKILSL--------------------------------------------------LL
E0RMQ1_PAEP6/366-508-------------TFIGAV...IKIALI--------------------------------------------------VW
C0ZAP4_BREBN/363-505-------------TLISAI...IKTVAM--------------------------------------------------FF
D7WQC4_9BACI/353-489-------------SIYGGL...GKLFVM--------------------------------------------------FV
C8WQG9_ALIAD/361-502-------------SIVGGV...ARLAVI--------------------------------------------------LV
B7DPL3_9BACL/356-497-------------TFFSSA...VRLACI--------------------------------------------------YE
D5QEL1_KOMHA/351-483-------------SVVEVV...VYIPLL--------------------------------------------------LL
A9WAD6_CHLAA/337-475-------------MIAATV...ATLPLD--------------------------------------------------FV
E1IEK9_9CHLR/380-529-------------RLITLL...VVVPLA--------------------------------------------------IL
B9JKJ2_AGRRK/321-464-------------NAIDLC...FRIVLI--------------------------------------------------SI
Q2Y4J6_9ARCH/377-524-------------GVGICI...ANIGLN--------------------------------------------------YL
E8V165_TERSS/339-475-------------LILTGV...LNIALD--------------------------------------------------AA
B8IGJ3_METNO/336-472-------------NLSGAA...LTLLIG--------------------------------------------------FL
D7BDH0_MEISD/336-473-------------GFAASA...LNIGLD--------------------------------------------------YL
F2NKF2_MARHT/337-483-------------GVATSV...LNLGLD--------------------------------------------------LL
D8J725_HALJB/340-478-------------TAVLVA...VNVGVS--------------------------------------------------VL
B8D178_HALOH/340-478-------------NILVVG...MNVTLN--------------------------------------------------YA
C4RGH8_9ACTN/364-502-------------ALAGTL...VNVVLN--------------------------------------------------VL
Q18GU8_HALWD/357-496-------------NALAAG...VNITLN--------------------------------------------------YF
Q469G3_METBF/349-484-------------SVASAG...INVAVN--------------------------------------------------FM
C5A2Y0_THEGJ/342-480-------------NVLAVI...SDFLLN--------------------------------------------------IL
F0LLW6_THEBM/342-478-------------NLISAM...FNLLLN--------------------------------------------------TL
F2KQE3_ARCVS/343-481-------------GFIAAV...INFVLN--------------------------------------------------LI
F0LLZ4_THEBM/339-477-------------ELTAVL...VNVILN--------------------------------------------------IL
Q5JDW0_THEKO/345-480-------------NLLAAL...LNVALN--------------------------------------------------MA
A1BJ49_CHLPD/337-476-------------AIAGLC...IQAAAT--------------------------------------------------LL
B3EHD9_CHLL2/365-504-------------ALAALA...VQVVLS--------------------------------------------------VL
Q3APG3_CHLCH/338-477-------------AVVALA...LQAGLN--------------------------------------------------WL
B4SBS0_PELPB/338-477-------------ALAALG...LQVALN--------------------------------------------------FL
Q3B6G9_PELLD/337-476-------------ALSALT...LQVALN--------------------------------------------------LL
A4SCQ1_PROVI/337-476-------------AAVALL...LQLLLN--------------------------------------------------LI
D8PBA0_9BACT/336-473-------------IGIIVP...VDVGLC--------------------------------------------------AG
D3SSH7_NATMM/337-474-------------TGVAAL...INVILN--------------------------------------------------AL
B6IYF6_RHOCS/343-484-------------IGLGAA...CNLLLI--------------------------------------------------AL
D0LQE6_HALO1/374-513-------------AAVTLA...ASVLAN--------------------------------------------------AF
D2RVV2_HALTV/336-474-------------KATTST...GNVALN--------------------------------------------------LA
D3STC0_NATMM/337-475-------------KGVTGG...FNFGLN--------------------------------------------------LL
D8J472_HALJB/339-477-------------KGSTAL...LNFLLN--------------------------------------------------LL
D2RXY9_HALTV/340-478-------------KGGTAV...ANFLLN--------------------------------------------------LV
E7QQ57_9EURY/339-477-------------KGATSA...ANFALN--------------------------------------------------LV
C7P069_HALMD/318-461-------------NAVLVV...SNVVLN--------------------------------------------------FA
C7NSR3_HALUD/331-469-------------NAVFIL...VNVVLN--------------------------------------------------VV
Q5V4U1_HALMA/327-465-------------NMVFIV...SNAILN--------------------------------------------------AV
D8J7W8_HALJB/319-457-------------VVVTIA...INLVLN--------------------------------------------------VA
C7NSL6_HALUD/319-457-------------TVASIT...VNLVLN--------------------------------------------------VV
E4NUG7_HALBP/319-458-------------TVVSVA...LNLILN--------------------------------------------------VV
AGL15_HALVD/319-457-------------TVISVV...LNLILN--------------------------------------------------VI
Q12VM9_METBU/345-483-------------TFIGVA...ANIALN--------------------------------------------------FI
A3CVY7_METMJ/333-471-------------TAIAVT...VNIGLN--------------------------------------------------IL
A2STD2_METLZ/331-469-------------AGIAAL...LNIALN--------------------------------------------------VT
A5UQJ1_ROSS1/330-463-------------LIGSLS...LNIVLN--------------------------------------------------LI
D3FFB8_CONWI/338-471-------------VVVAAL...ANVGLD--------------------------------------------------IL
D8GMK0_CLOLD/327-460-------------VLISSM...FNVISN--------------------------------------------------LI
Q97GQ2_CLOAB/326-458-------------VVISSL...FNLIIN--------------------------------------------------LL
D5XD05_THEPJ/326-457-------------VFVGAL...LNTVLN--------------------------------------------------LI
Q2NIB6_METST/328-458-------------TFICLL...FSTIGN--------------------------------------------------FI
F0T719_METLA/333-463-------------TFISMI...FNIVLN--------------------------------------------------LW
Q2NH55_METST/331-464-------------AAIGAI...FSIILN--------------------------------------------------LI
E3GZ73_METFV/328-459-------------TGIAAA...FNVVVN--------------------------------------------------LI
A5UNI7_METS3/328-460-------------YCLAAL...FNVALN--------------------------------------------------FI
F0TC71_METLA/328-460-------------TAINAI...INVALN--------------------------------------------------LV
Q12XY4_METBU/326-458-------------TAFAAF...FNIALN--------------------------------------------------FI
Q46FX4_METBF/329-461-------------TFIGAV...LNICLN--------------------------------------------------FI
F0TBQ9_METLA/329-463-------------SLVCLV...LNVILN--------------------------------------------------LI
Q0W809_METAR/331-464-------------AGVCML...VYLALN--------------------------------------------------II
D1Z261_METPS/328-462-------------IGIGML...VNFALN--------------------------------------------------II
O26442_METTH/329-460-------------VGISAA...FNIVLN--------------------------------------------------MI
A5UWW7_ROSS1/374-505-------------FATGAL...FNLGMN--------------------------------------------------LA
E1IAS8_9CHLR/378-523-------------FVIGAV...ANLCMN--------------------------------------------------LV
D5UPU7_TSUPD/350-482-------------NVVNLI...GNIVLN--------------------------------------------------VI
Q97AA3_THEVO/339-476-------------SAASLA...SNAILS--------------------------------------------------II
Q2S953_HAHCH/328-463-------------SVATLA...TNAILD--------------------------------------------------IL
F2NHK3_DESAR/367-498-------------TWLGAL...IHITAN--------------------------------------------------LL
A3W1Y0_9RHOB/329-468-------------ATIGSI...VQILCV--------------------------------------------------AV
C4XGJ8_DESMR/335-465-------------AGAALV...LAFAAN--------------------------------------------------AF
A9EQ86_SORC5/331-462-------------LALALV...ADVALN--------------------------------------------------LL
B9K2D6_AGRVS/332-468-------------GLGGAF...IMLVGD--------------------------------------------------VL
E3FNG9_STIAD/347-485-------------SVVSMV...LNATLN--------------------------------------------------LT
B6YVL8_THEON/328-461-------------FVEGAV...LNIFLN--------------------------------------------------LI
E0I7A7_9BACL/353-491-------------VICCVV...VNVGLN--------------------------------------------------VL
D5DY76_BACMQ/331-468-------------ALYSGV...INILLN--------------------------------------------------II
D7E977_METEZ/332-466-------------WMFAAV...LNFGLN--------------------------------------------------IL
A1ASY9_PELPD/345-481-------------VIAAGI...FNVILN--------------------------------------------------II
E8RTH0_ASTEC/331-467-------------MAIPAI...ANVGLN--------------------------------------------------LW
Q0AP11_MARMM/327-464-------------MAASAG...LNLALN--------------------------------------------------LL
E7RZY6_9BURK/339-474-------------ILSAAG...LNVLLN--------------------------------------------------LL
Q12TY8_METBU/325-459-------------LPLAVI...IEIILL--------------------------------------------------IL
D9PYX0_METTM/350-483-------------LVAGTV...INLALN--------------------------------------------------VA
F0TB30_METLA/351-484-------------LVAGIT...VDLILS--------------------------------------------------LA
F0EKD4_ENTCA/327-465-------------TISSAL...LNIILN--------------------------------------------------LI
Q5M4A4_STRT2/55-193-------------TIISAI...LNIIAS--------------------------------------------------FL
F0HVE0_LACDL/327-469-------------SATSAV...LNIVLN--------------------------------------------------FA
E4SMU5_LACAR/327-469-------------TVITAV...LNVVLN--------------------------------------------------FI
D4LGF1_9FIRM/327-469-------------TTVSAI...INCGLN--------------------------------------------------LY
A5ZUX1_9FIRM/326-464-------------TFVGAI...LNVVLN--------------------------------------------------SI
D5TQD2_BACT1/321-460-------------VTVGAV...LSLIIN--------------------------------------------------LI
Q5LFL1_BACFN/328-466-------------TMVGAC...INLLIN--------------------------------------------------YL
E8JWJ5_STRCR/327-467-------------VSLGAL...VNLGLN--------------------------------------------------LI
Q4JZ09_STREE/330-470-------------VSIGAI...VNLCLN--------------------------------------------------LL
E6MFC3_9FIRM/328-466-------------EIAGAL...VDLVVN--------------------------------------------------WL
E9RY62_9FIRM/330-468-------------EIAGAV...IDLILN--------------------------------------------------LI
C5NWI0_9BACL/318-458-------------TTIPAF...VSVAVN--------------------------------------------------IA
A1ILY9_STROR/319-458-------------TTAPAI...ISVGLN--------------------------------------------------LL
Q4JYJ9_STREE/323-464-------------VMSGAV...VSILLN--------------------------------------------------FI
E0PD92_STREI/325-464-------------FVAGVV...TNAIVN--------------------------------------------------SI
C6CSD9_PAESJ/327-465-------------VLIGAV...ISVITN--------------------------------------------------II
B0N362_9FIRM/290-427-------------VFLGAI...VNIVIN--------------------------------------------------LL
A5M4K0_STREE/211-349-------------LIIGAL...VNILLN--------------------------------------------------CF
C9LAR2_BLAHA/325-463-------------LIIGAI...VNLCVN--------------------------------------------------LV
Q4K189_STREE/323-460-------------LLYGAV...VNILIN--------------------------------------------------IL
C4FB42_9ACTN/325-467-------------LIVGAA...LNVAVN--------------------------------------------------VL
E0S188_BUTPB/322-462-------------IIIGAF...VNLIIN--------------------------------------------------YT
C3HRG9_BACTU/323-461-------------LVLGAI...ISLILN--------------------------------------------------II
A7HKJ9_FERNB/322-460-------------VIAGAI...TNFTMN--------------------------------------------------LI
G5K6T2_9STRE/321-459-------------AVVGLI...TNVIGN--------------------------------------------------II
E7S3G0_STRAG/321-459-------------AVIGLV...ANVVLN--------------------------------------------------IL
E0NHN4_PEDAC/321-459-------------VSISAL...VNLVLN--------------------------------------------------VP
E6LD53_9ENTE/253-391-------------VTVGAL...VNLFLN--------------------------------------------------VF
C2KJQ1_LEUMC/329-467-------------VTIGAL...ANVLLN--------------------------------------------------FW
B3XNV8_LACRE/322-460-------------VTIGAV...VNVITN--------------------------------------------------FL
B2GDL9_LACF3/322-460-------------VTAGAV...VNIIAN--------------------------------------------------LF
C0WVB1_LACFE/322-460-------------VSIGAV...VNVIAN--------------------------------------------------IL
A2RHU4_LACLM/321-459-------------VTIGAV...LNILLN--------------------------------------------------FA
A1YVF6_LACJH/321-459-------------VTLGAI...VNLSLN--------------------------------------------------VP
C2D643_LACBR/210-348-------------IIVGAV...VNIILN--------------------------------------------------FP
Q3ZK40_9LACT/322-460-------------IIIAAI...VSLITN--------------------------------------------------LI
D8MET9_LEUGG/321-460-------------TFAGAI...SNIILN--------------------------------------------------LL
A3F4D6_LACLC/321-459-------------VIIGAI...VNLMLN--------------------------------------------------IP
D2EJ27_PEDAC/321-459-------------VIIGAI...VNIVIN--------------------------------------------------IP
O06039_LACLC/321-459-------------LICGNL...VNVSLN--------------------------------------------------LI
Q8GPE5_STRTR/321-459-------------VFISVI...ISLGVS--------------------------------------------------FV
D7DRX9_METV3/353-490-------------LYFGAM...VNVILN--------------------------------------------------IL
A4FX93_METM5/354-492-------------LYIGAF...FNLTFN--------------------------------------------------LL
A6UPA0_METVS/351-488-------------LYIGAI...FNLIFN--------------------------------------------------LI
A6UU30_META3/353-490-------------LYFGAT...FNLIFN--------------------------------------------------LL
D5VU50_METIM/353-494-------------LYIGAF...FNLIFN--------------------------------------------------IL
D4W1F1_9FIRM/338-485-------------VLAGIL...VKIGLT--------------------------------------------------AP
B9DSP4_STRU0/342-480-------------LSFGLL...LKIMLT--------------------------------------------------PI
F1Z193_9STRE/350-488-------------LMCGLI...LKLLLT--------------------------------------------------PI
D4YGG7_9LACT/385-532-------------FVVGML...VKGIFT--------------------------------------------------AS
F2I7P9_AERUA/374-520-------------LGLGLL...VKGVFA--------------------------------------------------HM
Q03E00_PEDPA/355-503-------------IITGII...IKVVLN--------------------------------------------------SW
D2EHX4_PEDAC/355-503-------------IAAGLC...VKVICN--------------------------------------------------GW
A0A023M9A5_LACPN/357-507-------------IIAGLA...TKVLAN--------------------------------------------------YI
E7FPH6_9LACO/355-501-------------LLCGIF...VKACTN--------------------------------------------------VW

PF03023

MURJ_BORBU/29-473.........S...AVIGVI---FGGFLQ--------------------------------------------------FL
MURJ_RICPR/28-477.........S...ISVSLI---IAGILQ--------------------------------------------------VV
MURJ_ECOLI/28-479.........A...LAWAVT---VGGVLQ--------------------------------------------------LV
MURJ_SYNY3/36-495PY....WLLGSLLLAGGTT---AGAVLQ--------------------------------------------------WL
MURJ_AQUAE/29-466.........S...LALAVL---IGGLFQ--------------------------------------------------II
MURJ_HAEIN/16-479.........A...LAIGIF---LGGLLQ--------------------------------------------------FL
MURJ_THEMA/28-450.........A.....AGFT---IGGLAA--------------------------------------------------LL
Q9X8T0_STRCO/300-778MKVTSIPPEGERLLGIGVL---LGLIVQ--------------------------------------------------SL
MURJ_TREPA/32-489.........A....AIGVL---IGGCAQ--------------------------------------------------AL
Q9RX17_DEIRA/83-522............WLAFGWL---IGGVAQ--------------------------------------------------LL
MURJ_CHLTR/34-482.........G...LAVVLV---IGFILE--------------------------------------------------WA
MURJ_HELPY/2-458.........Y...LSYGVL---LGGVAQ--------------------------------------------------IL
MVIN_MYCTU/48-521VRMGNAKLLV...LGIGTT---AGVFAQ--------------------------------------------------TA

PF01554

O51531_BORBU/22-182-------------FELFVT.IGFSMAGA--------------------------------------------------YN
YOEA_BACSU/28-189-------------FFLLIS.FTIGIGSG--------------------------------------------------SS
YOEA_BACSU/257-418-------------ASYVQM.PAVSLGIA--------------------------------------------------VS
O66528_AQUAE/245-406-------------ESISFM.IGFGVMIA--------------------------------------------------ST
YPNP_BACSU/241-402-------------DSIITL.PAMAAGTA--------------------------------------------------VN
NORM_VIBPA/243-404-------------SSLVFM.LPMSVGAA--------------------------------------------------VS
O80695_ARATH/278-441-------------SAISFM.VSVGFNAA--------------------------------------------------AS
O26414_METTH/244-409-------------VMLAIV.PVISVATA--------------------------------------------------LV
O28801_ARCFU/21-180-------------FFVFIA.ISFGLSVG--------------------------------------------------AN
YISQ_BACSU/27-187-------------LNLIIVMFSF.IATG--------------------------------------------------TT
Y709_METJA/243-408-------------TEFGFI.PMLGLASG--------------------------------------------------AT
YPNP_BACSU/21-182-------------VLTVLS.FILGLNNA--------------------------------------------------TL
O25454_HELPY/214-375-------------ETFSFM.PGFGFMIA--------------------------------------------------AM
NORM_BACSU/20-180-------------WTPVYT.GLAGILMA--------------------------------------------------VT
HMRM_HAEIN/249-410-------------SSFIFM.FPMSIGMA--------------------------------------------------TT
O49660_ARATH/262-426-------------DYLLYA.VMLSLGTC--------------------------------------------------VA
O82752_ARATH/42-203-------------ANITGYSLLSGLSIG--------------------------------------------------ME
DINF_ECOLI/35-196-------------TSFLFM.LLLFLRMS--------------------------------------------------TT
Q9ZVH5_ARATH/238-401-------------TGILYV.VPFAISSA--------------------------------------------------IA
O28801_ARCFU/239-404-------------IQFGFV.PLFGVSAA--------------------------------------------------LT
Q38956_ARATH/275-438-------------LGWTAM.IAIGMNTA--------------------------------------------------VS
ERC1_YEAST/174-335-------------ANITGLAAIQGLCTC--------------------------------------------------LD
Q9ZVH5_ARATH/16-176-------------GNITGVSVLKGLSVG--------------------------------------------------MD
YAO6_SCHPO/17-177-------------AMSTGWLIALGGTTA--------------------------------------------------FD
O82752_ARATH/264-427-------------TALIYI.FPSSLSIS--------------------------------------------------VS
O51429_BORBU/27-187-------------NFFIIA.IAMGMATG--------------------------------------------------SI
O83871_TREPA/32-196-------------LFLYVT.ALMTVSNA--------------------------------------------------GS
O51429_BORBU/248-409-------------ISFLFL.PAMGIGTG--------------------------------------------------II
YISQ_BACSU/252-413-------------TMFILL.FGTAISQG--------------------------------------------------TQ
O66528_AQUAE/25-183-------------LWFIYS.LMALSYSG--------------------------------------------------TN
O51530_BORBU/21-181-------------TFLFFI.IVFGLGTA--------------------------------------------------LS
Y709_METJA/21-181-------------LISIYA.VSWGLSIG--------------------------------------------------IS
NORM_BACSU/247-408-------------ASLLYM.LPLSVSMA--------------------------------------------------LT
NORM_VIBPA/17-176-------------WLPSIL.FGIGLLMA--------------------------------------------------LV
O26414_METTH/24-183-------------YMILVG.LSNGLGAG--------------------------------------------------AA
HMRM_HAEIN/22-181-------------WMPLMF.FGQGLLLA--------------------------------------------------LP
YD338_YEAST/238-397-------------SNITLA.IFEGIATS--------------------------------------------------LD
MDTK_ECOLI/17-177-------------WLPAIL.FGHGLLLA--------------------------------------------------LT
Q38956_ARATH/55-215-------------VAGFSFGIMLGMGSA--------------------------------------------------LE
P71616_MYCTU/19-179-------------LGLVGS.QATFLSYG--------------------------------------------------TT
O49660_ARATH/40-200-------------ANVTGFSVLYGISAA--------------------------------------------------ME
O80695_ARATH/57-217-------------FNMFTYGLLLGMGSA--------------------------------------------------VE
MDTK_ECOLI/244-405-------------SSLMFV.LPMSLAAA--------------------------------------------------VT
F4IHU9_ARATH/37-197-------------ASVTGFTFLMGTASA--------------------------------------------------MD
O25796_HELPY/23-184-------------FPGLIA.YELLFGFG--------------------------------------------------AA
YEEO_ECOLI/48-208-------------NMVIMA.FFAAIDLG--------------------------------------------------TT
Q8DNG1_STRR6/24-183-------------FDLIVG.FTLGVGNG--------------------------------------------------MG

PF07260

G1KED7_ANOCA/1-345VNSKRDRTKAVLCMVVAGA---IAAIFH--------------------------------------------------TL
I3JFW4_ORENI/1-349VNSKRDRRKAVFCMVAAGA---IAFILH--------------------------------------------------IL
F1Q528_DANRE/1-344VNSKKERSKAILCMAVAGV---IAIILH--------------------------------------------------VL

PF01943

SP5B_BACSU/6-308IAISSVLRGYFQG-------------------------------------------------------------------
EXOT_RHIME/10-277LGGDVAYSLLVRR-------------------------------------------------------------------
TUAB_BACSU/10-277PIGQQYQYMLQKQ-------------------------------------------------------------------
RFBX_ECOLI/8-279VGNLIYPIWLFQG-------------------------------------------------------------------
O26447_METTH/15-286VGNLLFPVWFFQG-------------------------------------------------------------------
YTGP_BACSU/5-320VPIMSLVRGFFQG-------------------------------------------------------------------
Y1068_METJA/7-302DSIVAFFSNILTG-------------------------------------------------------------------
Y1375_METJA/3-283STVIAFSRGILQG-------------------------------------------------------------------
O26479_METTH/10-276TSFSSFFNSIFQG-------------------------------------------------------------------
O29660_ARCFU/6-285FSMAGFINGIFNA-------------------------------------------------------------------
O26467_METTH/18-289IGNVIFPTWFYQG-------------------------------------------------------------------
O26442_METTH/7-278LTVSGTYLSLFQA-------------------------------------------------------------------
YABM_BACSU/12-309PFVALLRGGFQGR-------------------------------------------------------------------
WZXC_ECOLI/9-276PHGQQFRALMQKE-------------------------------------------------------------------
Q2K5A6_RHIEC/11-272GLANPRRVMLQRD-------------------------------------------------------------------
Q32EG2_SHIDS/2-269YGSALFATWLFQG-------------------------------------------------------------------
Q8DZE2_STRA5/6-273NYVVTFFGQYFIQ-------------------------------------------------------------------
Q8P805_XANCP/25-289GMTTQYRAHLSRG-------------------------------------------------------------------

PF13440

I4HBM6_MICAE/6-298ALSQTQVALLRRD-------------------------------------------------------------------
I0T9J8_9BACT/34-326SLCVVQQALFTIK-------------------------------------------------------------------
C4ZJE4_THASP/32-325GFGVVSESSLQRS-------------------------------------------------------------------
K9PM46_9CYAN/51-343GFGVQHTALLNRQ-------------------------------------------------------------------
A9KN88_CLOPH/33-329TFSSIQIARYRRN-------------------------------------------------------------------
M0N8I3_9EURY/48-343GLQNPGLLYLKKD-------------------------------------------------------------------
E5VCV6_9BACE/28-323SISRLQRTFQQKQ-------------------------------------------------------------------
A4A6G8_9GAMM/8-300APLLVQRSIMERD-------------------------------------------------------------------
R6E9E7_9BACE/31-323SINLVPNALMLKN-------------------------------------------------------------------
K6YGT5_9ALTE/31-321GVSLVNSAKLERD-------------------------------------------------------------------
F3KH97_9GAMM/34-324GLGSVGVLDFRKN-------------------------------------------------------------------
C0CUD1_9FIRM/143-435SVISVQTAYVSRK-------------------------------------------------------------------
R7DCU6_9PORP/33-325SLSQVQNAKFAIE-------------------------------------------------------------------
R6YG40_9FIRM/34-326GVNSVQQAYVQKK-------------------------------------------------------------------
H1DLG1_9PORP/33-325AMYAIPSALLNKE-------------------------------------------------------------------
M5DLR8_9PROT/54-346VIASVALALLRKS-------------------------------------------------------------------
C6LGC8_9FIRM/33-329SFSSISIARFRRE-------------------------------------------------------------------
K5CQA8_9BACE/33-325SATIVPGALFYRN-------------------------------------------------------------------
B8HLM4_CYAP4/51-343GLMVQHEALLRRQ-------------------------------------------------------------------
G5F456_9ACTN/34-326AYNSIQEAIVARR-------------------------------------------------------------------
R6A4H2_9BACE/33-325ALVLIQQNILKKQ-------------------------------------------------------------------
S5C4K3_ALTMA/35-325GALNVKTVTFQID-------------------------------------------------------------------
L8F559_MYCSM/28-320GLFAVPTGQNQRA-------------------------------------------------------------------

PF04506

RFT1_CANGA/9-542LVNEPLFVLNQHF-------------------------------------------------------------------
E9IWP9_SOLIN/8-542LSSLVVQLAASAF-------------------------------------------------------------------
S9VRB9_SCHCR/24-535LLSEPYYQILHWR-------------------------------------------------------------------
C5E2W4_LACTC/16-558LLNEPFFVVNQLM-------------------------------------------------------------------
E9EIH0_METAQ/28-566LLSEPCFVLMQRR-------------------------------------------------------------------
G8BWS7_TETPH/20-558LLSEPFYVVNQFM-------------------------------------------------------------------
H2ASC3_KAZAF/14-533LLSEPFFILNQFM-------------------------------------------------------------------
RFT1_YARLI/102-645LASEPYYVLAMQQ-------------------------------------------------------------------
RFT1_SCHPO/10-520LLSEPYYEVLQWR-------------------------------------------------------------------
I2GX14_TETBL/21-581LLSEPFFIVNQFF-------------------------------------------------------------------
A7TRS5_VANPO/18-551LLSEPFFVVNQFM-------------------------------------------------------------------
J7R8K9_KAZNA/27-584LMCEPFLVVTQIA-------------------------------------------------------------------
M2PSW7_CERS8/12-528LLSEPLYVRAQNE-------------------------------------------------------------------
RFT1_CAEEL/2-516SIAEPFSVIS...-------------------------------------------------------------------
G8ZPN0_TORDC/18-550LLSEPLFIVNQFM-------------------------------------------------------------------
C4R7X1_PICPG/21-528LLSEPLYNINQYD-------------------------------------------------------------------
U5D209_AMBTC/17-521ILAEPLYILAQNM-------------------------------------------------------------------
G0W6B8_NAUDC/22-586LLSEPFFIINQFM-------------------------------------------------------------------
E2AM70_CAMFO/8-540LSSLIVQLVANAF-------------------------------------------------------------------
E9GUV5_DAPPU/9-536SFVEPVYIFSQAF-------------------------------------------------------------------
D8M9P3_BLAHO/10-506LCSEVGYVLTQMT-------------------------------------------------------------------
F4K836_ARATH/105-602LMAEPLYILSQTL-------------------------------------------------------------------
U4LAR2_PYROM/52-567LASEPGFALGQAG-------------------------------------------------------------------
RFT1_DROME/8-549LMAESAVFVAQVF-------------------------------------------------------------------
G8BFC9_CANPC/25-545LSIEPIYCVYQYE-------------------------------------------------------------------
M3BX75_SPHMS/8-530LLSEPAFVAVQQN-------------------------------------------------------------------
W4Z9M3_STRPU/12-532LVAEPFWVVGQAM-------------------------------------------------------------------
RFT1_ASHGO/11-543LASEPLYVVNQFM-------------------------------------------------------------------
M3K0B3_CANMX/13-532MVIEPIYCLYQFQ-------------------------------------------------------------------
G8JV96_ERECY/11-550LFSEPLYIVNQFM-------------------------------------------------------------------
G0V9M8_NAUCC/17-571LLSEPFFIVNQFL-------------------------------------------------------------------
H9J737_BOMMO/8-547LCSANLALVAQHF-------------------------------------------------------------------
R4XDT4_TAPDE/6-505LLSEPGYNVALHK-------------------------------------------------------------------
RFT1_YEAST/18-565LLSEPFFIVNQFM-------------------------------------------------------------------

PF14667

Q03SZ7_LACBA/349-498SV..I...HF..G..-----------------------------------------------------------------
Q38V74_LACSS/358-503LV..Q...HF..Q..-----------------------------------------------------------------
Q034V3_LACC3/356-499LV..V...KF..G..-----------------------------------------------------------------
A8UAN8_9LACT/362-510FV..E...HY..G..-----------------------------------------------------------------
D0BM46_9LACT/359-506FI..P...QF..Q..-----------------------------------------------------------------
C8NI78_9LACT/366-514FV..A...MF..G..-----------------------------------------------------------------
C0WQN7_LACBU/354-501LV..A...TF..G..-----------------------------------------------------------------
C2EHH6_9LACO/356-502LI..G...KF..G..-----------------------------------------------------------------
E6LEY4_9ENTE/358-506LT..A...GM..G..-----------------------------------------------------------------
C9A420_ENTGA/359-508LT..Y...LL..G..-----------------------------------------------------------------
C2HEH9_ENTFC/359-507LT..G...LL..G..-----------------------------------------------------------------
C0X942_ENTFL/359-507FT..I...RW..G..-----------------------------------------------------------------
E0RUK9_BUTPB/373-516LS..I...VL..GHD-----------------------------------------------------------------
E7MM58_9FIRM/379-526CC..Y...LF..G..-----------------------------------------------------------------
E4LZJ6_9CLOT/384-531LL..K...YF..G..-----------------------------------------------------------------
D4W2K6_9FIRM/377-526LI..P...MF..Y..-----------------------------------------------------------------
D5E4C9_BACMQ/373-523LL..T...NF..K..-----------------------------------------------------------------
B7JJF5_BACC0/376-524LL..H...LF..G..-----------------------------------------------------------------
Q8EP19_OCEIH/372-521LI..H...MF..G..-----------------------------------------------------------------
B1YKH1_EXIS2/386-534LI..H...WT..G..-----------------------------------------------------------------
D6Y0K7_BACIE/382-530FI..T...WF..G..-----------------------------------------------------------------
Q5WE75_BACSK/374-522FL..K...WF..G..-----------------------------------------------------------------
E6U1Q3_BACCJ/375-523MI..V...WL..G..-----------------------------------------------------------------
D3FXP2_BACPE/374-522ML..L...LM..G..-----------------------------------------------------------------
A4IRX9_GEOTN/371-520LI..M...KW..A..-----------------------------------------------------------------
D5DN36_BACMD/374-521FI..L...MF.....-----------------------------------------------------------------
A7Z7U6_BACA2/375-524LI..K...LF..Q..-----------------------------------------------------------------
A0RJU4_BACAH/372-520FI..R...YF..G..-----------------------------------------------------------------
E7RE43_9BACL/368-516LI..E...RF..E..-----------------------------------------------------------------
A3I8W7_9BACI/372-521LI..R...LL..E..-----------------------------------------------------------------
A6CQJ8_9BACI/372-520LI..K...LL..E..-----------------------------------------------------------------
A0A0E0UWL5_LISMM/370-518LI..M...LF..E..-----------------------------------------------------------------
Q2FXH6_STAA8/386-533LI..M...LF..H..-----------------------------------------------------------------
B9E7H2_MACCJ/374-522LI..Y...LF..H..-----------------------------------------------------------------
D5T1U4_LEUKI/363-511LI..N...AL..G..-----------------------------------------------------------------
Q03XR0_LEUMM/330-477MI..Y...LT..S..-----------------------------------------------------------------
A0NHL2_OENOE/387-534MI..Y...ML..Q..-----------------------------------------------------------------
B1MY12_LEUCK/485-634FI......RYFEG..-----------------------------------------------------------------
C2KKY7_LEUMC/498-647LI......RYFEG..-----------------------------------------------------------------
C0WLU0_LACBU/374-518LV......TWLQG..-----------------------------------------------------------------
C2EP42_9LACO/342-483MT..F...LM..S..-----------------------------------------------------------------
H7C726_ENTFA/370-519CI..Y...LF..K..-----------------------------------------------------------------
C5RB06_WEIPA/501-648LT......IWLQG..-----------------------------------------------------------------
A8UCR2_9LACT/391-539ML..A...IV..G..-----------------------------------------------------------------
A2RMM4_LACLM/390-539MI..L...IF..H..-----------------------------------------------------------------
T0UE48_9ENTE/381-529AI..W...LF..Q..-----------------------------------------------------------------
E6LIJ6_9ENTE/381-529FI..F...LF..E..-----------------------------------------------------------------
Q838A3_ENTFA/382-530AI..R...LF..E..-----------------------------------------------------------------
C2H7P1_ENTFC/381-529AI..R...LF..E..-----------------------------------------------------------------
A4VW05_STRSY/379-527MI..Y...VF..K..-----------------------------------------------------------------
E3CI47_STRDO/375-523ML..Y...VF..G..-----------------------------------------------------------------
A3CPL5_STRSV/375-523LI..Y...IF..K..-----------------------------------------------------------------
E8K660_STRPA/410-558FI..L...VF..R..-----------------------------------------------------------------
B1SH45_9STRE/377-525FI..F...LF..K..-----------------------------------------------------------------
C2LQ70_STRSL/432-580LI..I...FL..G..-----------------------------------------------------------------
A5VL26_LACRD/382-530CI..W...IF..E..-----------------------------------------------------------------
D2ELV8_PEDAC/393-541MV..A...IF..S..-----------------------------------------------------------------
C0WUG9_LACBU/378-530CV..Y...YL..G..-----------------------------------------------------------------
Q03RI1_LACBA/378-525LV..Y...FL..G..-----------------------------------------------------------------
Q1WUT1_LACS1/381-529LT..A...FL..H..-----------------------------------------------------------------
Q38VP9_LACSS/378-526AI..Y...FF..R..-----------------------------------------------------------------
C8PCY7_9LACO/375-523AI..K...LF..Q..-----------------------------------------------------------------
C2E7U4_LACJH/384-532MI..E...FF..K..-----------------------------------------------------------------
C2KAZ9_9LACO/380-528MI..F...LF..K..-----------------------------------------------------------------
Q03AT6_LACC3/380-528MI..F...FF..N..-----------------------------------------------------------------
D0BKY7_9LACT/390-538MI..Y...FF..E..-----------------------------------------------------------------
C8NE09_9LACT/413-561MM..Y...FL..G..-----------------------------------------------------------------
E4KNA5_9LACT/790-938FV..A...VF..Q..-----------------------------------------------------------------
D4YJ56_9LACT/433-583FL..A...MF..S..-----------------------------------------------------------------
E0IFR0_9BACL/366-514LA..P...VL..G..-----------------------------------------------------------------
E0RCM4_PAEP6/382-529LA..G...WL..G..-----------------------------------------------------------------
C6J0R0_9BACL/364-511FA..Q...FW..G..-----------------------------------------------------------------
C0Z9G8_BREBN/364-513FT..S...MF..G..-----------------------------------------------------------------
C4GB38_9FIRM/387-530AMLVF...HL..G..-----------------------------------------------------------------
R5F1U8_9CLOT/387-539FLMVF...KM..G..-----------------------------------------------------------------
E6LN70_9FIRM/381-525LLFTL...KL..N..-----------------------------------------------------------------
D4KXJ4_9FIRM/383-527LM..F...LF..DLN-----------------------------------------------------------------
E3GGE0_EUBLK/365-508CLAVP...AF..N..-----------------------------------------------------------------
E6MGM4_9FIRM/373-516AMSIP...AI..N..-----------------------------------------------------------------
B8D0L3_HALOH/359-505LTPRP...EL..R..-----------------------------------------------------------------
C6PQD8_9CLOT/131-275MVSIP...GI..N..-----------------------------------------------------------------
C8VXJ1_DESAS/366-509LTPSP....L..G..-----------------------------------------------------------------
D9QSV7_ACEAZ/363-507LTAIP...SI..G..-----------------------------------------------------------------
B2A8K9_NATTJ/363-507LTAIP...QI..G..-----------------------------------------------------------------
A8MK38_ALKOO/363-506LAGIP...WL..N..-----------------------------------------------------------------
A5D2G5_PELTS/358-502LTGLP...QF..G..-----------------------------------------------------------------
D5X9J9_THEPJ/361-503LTGLP...VF..G..-----------------------------------------------------------------
B2A2Z4_NATTJ/361-504LTAVP...YL..N..-----------------------------------------------------------------
C7GYH1_9FIRM/373-517LTSIP...SI..N..-----------------------------------------------------------------
A6TN15_ALKMQ/363-506LL.VS...HW..N..-----------------------------------------------------------------
A8MIG9_ALKOO/365-508LLMSS....L..N..-----------------------------------------------------------------
Q67JD5_SYMTH/384-522WT..G...PY..G..-----------------------------------------------------------------
C4FNY8_9FIRM/361-503LTGTI...EL..G..-----------------------------------------------------------------
D3LVV9_9FIRM/358-500LTAVP...AL..G..-----------------------------------------------------------------
E2ZD67_9FIRM/360-502LTAIP...WL..G..-----------------------------------------------------------------
R5TDG3_9FIRM/363-506LTAMP...SW..G..-----------------------------------------------------------------
D3LX29_9FIRM/358-500LVAIP...AF..G..-----------------------------------------------------------------
C4FPR1_9FIRM/359-501LTAIP...WL..G..-----------------------------------------------------------------
A1HLQ5_9FIRM/371-513LVALP...AL..G..-----------------------------------------------------------------
C4V2B6_9FIRM/374-517LTAIP...WL..G..-----------------------------------------------------------------
E8LB44_9FIRM/369-509LTAVP...EL..G..-----------------------------------------------------------------
C0WBK9_9FIRM/378-517LTAMP...TL..G..-----------------------------------------------------------------
B7DPH6_9BACL/373-525LI..L...GLHNA..-----------------------------------------------------------------
C0ZHE2_BREBN/367-517LV..P...FW..G..-----------------------------------------------------------------
C2YMP0_BACCE/352-495LV..S...QF..G..-----------------------------------------------------------------
B7GMA5_ANOFW/366-505FV..S...WY..G..-----------------------------------------------------------------
E7RL93_9BACL/356-500LV..N...LY..G..-----------------------------------------------------------------
D3FZH8_BACPE/357-501LV..A...QY..G..-----------------------------------------------------------------
B0MPG6_9FIRM/391-534TISVP...AI..N..-----------------------------------------------------------------
B0PEA8_9FIRM/441-584LVAIP...QL..N..-----------------------------------------------------------------
A7VWY4_9FIRM/433-577LVGIP...AI..N..-----------------------------------------------------------------
E6TRQ4_BACCJ/362-512AV..P...VL..G..-----------------------------------------------------------------
D5WSL0_KYRT2/373-521WV..P...LW..G..-----------------------------------------------------------------
B1YGP9_EXIS2/345-491LI..P...LY..G..-----------------------------------------------------------------
C5RD31_WEIPA/359-505FI..P...QL..G..-----------------------------------------------------------------
Q8EU30_OCEIH/362-509FI..P...IL..G..-----------------------------------------------------------------
B9E8U7_MACCJ/341-481LI..P...QL..D..-----------------------------------------------------------------
Q49V13_STAS1/337-479LI..P...PF..F..-----------------------------------------------------------------
E8SIP0_STAPH/344-486VI..P...LF..G..-----------------------------------------------------------------
Q2G0R7_STAA8/343-485LI..R...LS..G..-----------------------------------------------------------------
F2F183_SOLSS/360-508FI..P...RY..D..-----------------------------------------------------------------
A3IEA1_9BACI/365-514LI..G...WL..G..-----------------------------------------------------------------
E7RLD1_9BACL/354-503LV..P...AW..G..-----------------------------------------------------------------
A0AF13_LISW6/361-504LI..P...QF..A..-----------------------------------------------------------------
D7UUI0_LISGR/356-499LI..P...RL..G..-----------------------------------------------------------------
A6CR25_9BACI/352-499LV..S...RY..G..-----------------------------------------------------------------
E5WT44_9BACI/362-510LV..P...SY..G..-----------------------------------------------------------------
U5L445_9BACI/362-508LV..P...AA..G..-----------------------------------------------------------------
A8F924_BACP2/360-506LV..P...LL..G..-----------------------------------------------------------------
T5HW26_BACLI/356-502LI..P...GF..G..-----------------------------------------------------------------
A7Z0I0_BACA2/354-499LV..P...GW..G..-----------------------------------------------------------------
D4G3E4_BACNB/359-505LV..P...RY..G..-----------------------------------------------------------------
D5D970_BACMD/362-511LI..P...DF..Q..-----------------------------------------------------------------
B7GFI4_ANOFW/350-497LV..P...LW..H..-----------------------------------------------------------------
A4IJD3_GEOTN/352-496LV..P...PF..G..-----------------------------------------------------------------
C5D378_GEOSW/360-505LI..P...LF..G..-----------------------------------------------------------------
Q5WAF7_BACSK/347-496FI..P...VMASA..-----------------------------------------------------------------
D3FR13_BACPE/361-509LV..P...VI..G..-----------------------------------------------------------------
Q9KGJ0_BACHD/361-507LI..P...AF..T..-----------------------------------------------------------------
D6XV50_BACIE/360-507LV..P...LY..G..-----------------------------------------------------------------
D3E759_GEOS4/381-532LV..P...QF..G..-----------------------------------------------------------------
E0RM54_PAEP6/373-525LV..P...QL..G..-----------------------------------------------------------------
A7GJW7_BACCN/360-506LM..P...YI..G..-----------------------------------------------------------------
B5UWQ0_BACCE/360-510FM..P...YF..G..-----------------------------------------------------------------
D2BMG7_LACLK/323-465CI......FI..G..-----------------------------------------------------------------
B8IEZ7_METNO/324-461LA..G...RF..G..-----------------------------------------------------------------
C7NM90_HALUD/327-463LI..S...WI..G..-----------------------------------------------------------------
A6DHF1_9BACT/293-436FG..L...SW..G..-----------------------------------------------------------------
Q47U72_COLP3/338-481LG..S...QW..G..-----------------------------------------------------------------
B4AGJ7_BACPU/343-486LTHTL...QL..G..-----------------------------------------------------------------
Q1K412_DESAC/351-495FV..M...LFNIG..-----------------------------------------------------------------
C0QCL2_DESAH/352-496FVVVF...DW..G..-----------------------------------------------------------------
Q2YCG5_NITMU/323-466VS..L...VY.....-----------------------------------------------------------------
E6QMG7_9ZZZZ/367-517YL..H...AW..T..-----------------------------------------------------------------
F2G999_ALTMD/323-467TI......WF..G..-----------------------------------------------------------------
C6JQC3_FUSVA/323-462LT..E...KY..G..-----------------------------------------------------------------
E5X0H2_9BACE/326-464SI......PF..G..-----------------------------------------------------------------
A3DHV8_CLOTH/327-465SL......KF..G..-----------------------------------------------------------------
B5CWR8_BACPM/324-466AS..V...YF..K..-----------------------------------------------------------------
F1VXT7_9BURK/320-462GV......NW..G..-----------------------------------------------------------------
Q2YCC1_NITMU/331-475LVG.A...HY..G..-----------------------------------------------------------------
Q0AHL3_NITEC/325-466GC......NW..G..-----------------------------------------------------------------
D4YX22_SPHJU/336-476GI......RF..G..-----------------------------------------------------------------
Q1GPL1_SPHAL/342-484LIGAE....W..G..-----------------------------------------------------------------
B0VF98_CLOAI/326-465LI..I...KF..G..-----------------------------------------------------------------
A1S103_THEPD/335-472LT..Q...RL..G..-----------------------------------------------------------------
E8R8C0_DESM0/349-487LL..P...RL..G..-----------------------------------------------------------------
A3DIV8_CLOTH/358-500FV..P...SY..G..-----------------------------------------------------------------
F2JLQ5_CELLD/355-497MV..P...RR..G..-----------------------------------------------------------------
A7VPC0_9FIRM/355-497LL..P...LM..G..-----------------------------------------------------------------
A8SAU1_9FIRM/356-502LL..P...RY..G..-----------------------------------------------------------------
A6TSY6_ALKMQ/375-519LVPNP...KY..G..-----------------------------------------------------------------
A6NPI5_9FIRM/351-494LMGLP...GV..G..-----------------------------------------------------------------
B0KBP6_THEP3/360-504LTAMP...QL..R..-----------------------------------------------------------------
B7AQB6_9FIRM/351-493LI..P...SY..K..-----------------------------------------------------------------
D3AN52_9CLOT/376-519GI..P...KF..G..-----------------------------------------------------------------
B0TAY6_HELMI/361-505LATLP...SV..G..-----------------------------------------------------------------
Q3ADH7_CARHZ/346-484LT..P...KI..G..-----------------------------------------------------------------
E0RMQ1_PAEP6/366-508LASQP...QY..G..-----------------------------------------------------------------
C0ZAP4_BREBN/363-505FTAHP...SF..G..-----------------------------------------------------------------
D7WQC4_9BACI/353-489LASQP.......GIQ-----------------------------------------------------------------
C8WQG9_ALIAD/361-502LATRP...SL..G..-----------------------------------------------------------------
B7DPL3_9BACL/356-497FVAVG...NQ..G..-----------------------------------------------------------------
D5QEL1_KOMHA/351-483FL..H...WF..G..-----------------------------------------------------------------
A9WAD6_CHLAA/337-475LV..P...WT..D..-----------------------------------------------------------------
E1IEK9_9CHLR/380-529LP..P...WA..G..-----------------------------------------------------------------
B9JKJ2_AGRRK/321-464GF..Y...FF..S..-----------------------------------------------------------------
Q2Y4J6_9ARCH/377-524FI..P...EW..G..-----------------------------------------------------------------
E8V165_TERSS/339-475LI..P...HF..G..-----------------------------------------------------------------
B8IGJ3_METNO/336-472LI..P...HL..G..-----------------------------------------------------------------
D7BDH0_MEISD/336-473LI..P...QY..E..-----------------------------------------------------------------
F2NKF2_MARHT/337-483LI..P...SR..G..-----------------------------------------------------------------
D8J725_HALJB/340-478LV..P...RI..G..-----------------------------------------------------------------
B8D178_HALOH/340-478LI..P...NY..G..-----------------------------------------------------------------
C4RGH8_9ACTN/364-502LI..P...RF..G..-----------------------------------------------------------------
Q18GU8_HALWD/357-496LL..I...LI..G..-----------------------------------------------------------------
Q469G3_METBF/349-484LI..P...EY..G..-----------------------------------------------------------------
C5A2Y0_THEGJ/342-480LI..P...RW..G..-----------------------------------------------------------------
F0LLW6_THEBM/342-478LI..P...VY..G..-----------------------------------------------------------------
F2KQE3_ARCVS/343-481LI..P...LF..G..-----------------------------------------------------------------
F0LLZ4_THEBM/339-477LI..P...KY..Y..-----------------------------------------------------------------
Q5JDW0_THEKO/345-480LI..P...VY..G..-----------------------------------------------------------------
A1BJ49_CHLPD/337-476LI..P...RY..G..-----------------------------------------------------------------
B3EHD9_CHLL2/365-504LI..P...LY..G..-----------------------------------------------------------------
Q3APG3_CHLCH/338-477FI..P...TM..G..-----------------------------------------------------------------
B4SBS0_PELPB/338-477LI..P...KM..G..-----------------------------------------------------------------
Q3B6G9_PELLD/337-476LI..P...RM..G..-----------------------------------------------------------------
A4SCQ1_PROVI/337-476LI..P...RM..G..-----------------------------------------------------------------
D8PBA0_9BACT/336-473LI..P...RW..G..-----------------------------------------------------------------
D3SSH7_NATMM/337-474LI..P...RY..G..-----------------------------------------------------------------
B6IYF6_RHOCS/343-484LI..........D..-----------------------------------------------------------------
D0LQE6_HALO1/374-513VV..P...LFPPGRE-----------------------------------------------------------------
D2RVV2_HALTV/336-474LI..P...IF..G..-----------------------------------------------------------------
D3STC0_NATMM/337-475LI..P...TI..G..-----------------------------------------------------------------
D8J472_HALJB/339-477LI..P...AV..G..-----------------------------------------------------------------
D2RXY9_HALTV/340-478LI..P...TI..G..-----------------------------------------------------------------
E7QQ57_9EURY/339-477LI..P...SL..G..-----------------------------------------------------------------
C7P069_HALMD/318-461LI..W...QY..R..-----------------------------------------------------------------
C7NSR3_HALUD/331-469LVWQF...SW.....-----------------------------------------------------------------
Q5V4U1_HALMA/327-465LIWQL...SW.....-----------------------------------------------------------------
D8J7W8_HALJB/319-457LV..L...SI..G..-----------------------------------------------------------------
C7NSL6_HALUD/319-457LI..L...EF..G..-----------------------------------------------------------------
E4NUG7_HALBP/319-458LI..L...SF..N.D-----------------------------------------------------------------
AGL15_HALVD/319-457LI..L...SF..G..-----------------------------------------------------------------
Q12VM9_METBU/345-483LI..P...LI..G..-----------------------------------------------------------------
A3CVY7_METMJ/333-471LI..P...AY..G..-----------------------------------------------------------------
A2STD2_METLZ/331-469LI..P...IF..G..-----------------------------------------------------------------
A5UQJ1_ROSS1/330-463LQ..P...AL..G..-----------------------------------------------------------------
D3FFB8_CONWI/338-471LI..P...SL..G..-----------------------------------------------------------------
D8GMK0_CLOLD/327-460FI..P...KY..G..-----------------------------------------------------------------
Q97GQ2_CLOAB/326-458LT..P...KF..G..-----------------------------------------------------------------
D5XD05_THEPJ/326-457LI..P...RF..S..-----------------------------------------------------------------
Q2NIB6_METST/328-458LI..K...LF..D..-----------------------------------------------------------------
F0T719_METLA/333-463AI..P...HY..S..-----------------------------------------------------------------
Q2NH55_METST/331-464LI..Y...YL..S..-----------------------------------------------------------------
E3GZ73_METFV/328-459LI..P...KM..S..-----------------------------------------------------------------
A5UNI7_METS3/328-460LI..P...HF..S..-----------------------------------------------------------------
F0TC71_METLA/328-460LI..P...HY..S..-----------------------------------------------------------------
Q12XY4_METBU/326-458FI..P...SF..S..-----------------------------------------------------------------
Q46FX4_METBF/329-461LI..P...RF..S..-----------------------------------------------------------------
F0TBQ9_METLA/329-463LI..P...SY..S..-----------------------------------------------------------------
Q0W809_METAR/331-464LI..D...RF..S..-----------------------------------------------------------------
D1Z261_METPS/328-462LI..P...LL..S..-----------------------------------------------------------------
O26442_METTH/329-460LI..P...YY..S..-----------------------------------------------------------------
A5UWW7_ROSS1/374-505LI..P...VY..G..-----------------------------------------------------------------
E1IAS8_9CHLR/378-523AI..P...VA..T..-----------------------------------------------------------------
D5UPU7_TSUPD/350-482LI..P...PF..G..-----------------------------------------------------------------
Q97AA3_THEVO/339-476LI..P...HF..G..-----------------------------------------------------------------
Q2S953_HAHCH/328-463LI..P...HL..H..-----------------------------------------------------------------
F2NHK3_DESAR/367-498LI..P...LF..G..-----------------------------------------------------------------
A3W1Y0_9RHOB/329-468GA......SF..G..-----------------------------------------------------------------
C4XGJ8_DESMR/335-465LV..P...RY..G..-----------------------------------------------------------------
A9EQ86_SORC5/331-462LL..P...RY..R..-----------------------------------------------------------------
B9K2D6_AGRVS/332-468LV..P...SY..G..-----------------------------------------------------------------
E3FNG9_STIAD/347-485LA.RPFLAWF..G..-----------------------------------------------------------------
B6YVL8_THEON/328-461LI..P...IY..S..-----------------------------------------------------------------
E0I7A7_9BACL/353-491LI..P...KY..A..-----------------------------------------------------------------
D5DY76_BACMQ/331-468LV..P...RY..G..-----------------------------------------------------------------
D7E977_METEZ/332-466II..P...YI..G..-----------------------------------------------------------------
A1ASY9_PELPD/345-481LV..P...FY..G..-----------------------------------------------------------------
E8RTH0_ASTEC/331-467LI..P...LY..G..-----------------------------------------------------------------
Q0AP11_MARMM/327-464LI..P...AF..G..-----------------------------------------------------------------
E7RZY6_9BURK/339-474LI..P...SL..G..-----------------------------------------------------------------
Q12TY8_METBU/325-459LV..P...SY..G..-----------------------------------------------------------------
D9PYX0_METTM/350-483LV..P...LI..G..-----------------------------------------------------------------
F0TB30_METLA/351-484LI..P...PY..G..-----------------------------------------------------------------
F0EKD4_ENTCA/327-465LI..P...YF..Q..-----------------------------------------------------------------
Q5M4A4_STRT2/55-193LI..G...RW..G..-----------------------------------------------------------------
F0HVE0_LACDL/327-469LI..P...FL..S..-----------------------------------------------------------------
E4SMU5_LACAR/327-469LI..P...SM..S..-----------------------------------------------------------------
D4LGF1_9FIRM/327-469MI..P...KY..S..-----------------------------------------------------------------
A5ZUX1_9FIRM/326-464FI..I...TF..G..-----------------------------------------------------------------
D5TQD2_BACT1/321-460LV..P...SY..G..-----------------------------------------------------------------
Q5LFL1_BACFN/328-466LI..P...QY..G..-----------------------------------------------------------------
E8JWJ5_STRCR/327-467LM..P...KL..G..-----------------------------------------------------------------
Q4JZ09_STREE/330-470LM..P...IL..G..-----------------------------------------------------------------
E6MFC3_9FIRM/328-466LI..P...KM..A..-----------------------------------------------------------------
E9RY62_9FIRM/330-468LI..P...HM..A..-----------------------------------------------------------------
C5NWI0_9BACL/318-458VI..P...FF..G..-----------------------------------------------------------------
A1ILY9_STROR/319-458FL..P...KL..G..-----------------------------------------------------------------
Q4JYJ9_STREE/323-464VI..P...FG..G..-----------------------------------------------------------------
E0PD92_STREI/325-464LI..P...QY..G..-----------------------------------------------------------------
C6CSD9_PAESJ/327-465LI..P...HY..Q..-----------------------------------------------------------------
B0N362_9FIRM/290-427LI..P...YF..Q..-----------------------------------------------------------------
A5M4K0_STREE/211-349LI..K...PF..G..-----------------------------------------------------------------
C9LAR2_BLAHA/325-463LI..P...EL..G..-----------------------------------------------------------------
Q4K189_STREE/323-460LI..P...KI..G..-----------------------------------------------------------------
C4FB42_9ACTN/325-467LI..P...RV..G..-----------------------------------------------------------------
E0S188_BUTPB/322-462FI..G...IMGKG..-----------------------------------------------------------------
C3HRG9_BACTU/323-461FI..P...RY..G..-----------------------------------------------------------------
A7HKJ9_FERNB/322-460LI..P...KY..Q..-----------------------------------------------------------------
G5K6T2_9STRE/321-459LI..P...IL..G..-----------------------------------------------------------------
E7S3G0_STRAG/321-459LI..P...IL..G..-----------------------------------------------------------------
E0NHN4_PEDAC/321-459LI..Y...SI..G..-----------------------------------------------------------------
E6LD53_9ENTE/253-391FI..K...LF..G..-----------------------------------------------------------------
C2KJQ1_LEUMC/329-467LIYVA.......G..-----------------------------------------------------------------
B3XNV8_LACRE/322-460FI..A...KW..G..-----------------------------------------------------------------
B2GDL9_LACF3/322-460LI..S...KF..S..-----------------------------------------------------------------
C0WVB1_LACFE/322-460LI..P...FY..S..-----------------------------------------------------------------
A2RHU4_LACLM/321-459LI..P...LL..G..-----------------------------------------------------------------
A1YVF6_LACJH/321-459LI..K...MW..G..-----------------------------------------------------------------
C2D643_LACBR/210-348LI......YF.DG..-----------------------------------------------------------------
Q3ZK40_9LACT/322-460LI..P...TI..G..-----------------------------------------------------------------
D8MET9_LEUGG/321-460FI..R...NY..G..-----------------------------------------------------------------
A3F4D6_LACLC/321-459LI..I...YL..G..-----------------------------------------------------------------
D2EJ27_PEDAC/321-459FI..L...VW..G..-----------------------------------------------------------------
O06039_LACLC/321-459LL..P...KM..G..-----------------------------------------------------------------
Q8GPE5_STRTR/321-459LV..P...IF..G..-----------------------------------------------------------------
D7DRX9_METV3/353-490LI..P...QF..G..-----------------------------------------------------------------
A4FX93_METM5/354-492LI..P...KF..G..-----------------------------------------------------------------
A6UPA0_METVS/351-488LI..P...KF..G..-----------------------------------------------------------------
A6UU30_META3/353-490LI..P...KF..G..-----------------------------------------------------------------
D5VU50_METIM/353-494LI..P...KF..G..-----------------------------------------------------------------
D4W1F1_9FIRM/338-485LT..M...EM..G..-----------------------------------------------------------------
B9DSP4_STRU0/342-480LT..Y...YF..S..-----------------------------------------------------------------
F1Z193_9STRE/350-488MT..F...HF..G..-----------------------------------------------------------------
D4YGG7_9LACT/385-532LV..G...FL..G..-----------------------------------------------------------------
F2I7P9_AERUA/374-520LV..S...RF..G..-----------------------------------------------------------------
Q03E00_PEDPA/355-503AT..Q...WL..G..-----------------------------------------------------------------
D2EHX4_PEDAC/355-503AV..R...HW..S..-----------------------------------------------------------------
A0A023M9A5_LACPN/357-507FV..V...HY..G..-----------------------------------------------------------------
E7FPH6_9LACO/355-501LI..G...QF..G..-----------------------------------------------------------------

PF03023

MURJ_BORBU/29-473IPFAN---CLMIGFA.................WKPTFYFREKVFLNFLTRWLRMIFGFSISIITQQISFALAST......
MURJ_RICPR/28-477FMFIC---VKKADLH.................FPIIFHTNDPDVKKLLINMGPATISSGVQQLNLFISQSISS.......
MURJ_ECOLI/28-479YQLPH---LKKIGML.................VLPRINFHDAGAMRVVKQMGPAILGVSVSQISLIINTIFASF......
MURJ_SYNY3/36-495AQIVP---QAKAGMG................KLRLRFNFALPGVKEVLQVMIPATLSSGMLYINFATNLFFAS.......
MURJ_AQUAE/29-466PNTFL---LFKEKLL.................KIP.KFSLDREIKTFLKKFLFTLGGFSANQLSLFVDTFLASF......
MURJ_HAEIN/16-479FQIPF---MKQAGLL.................VKPKWAWRDEGVTKIRKLMIPALFGVSVSQINLLLDTVIASF......
MURJ_THEMA/28-450VLLPF---GKFRYRP........................TFKGLGEFYRLFFGTFMTMAVSQVTTLIDVNVASF......
Q9X8T0_STRCO/300-778AMIPY---LRETGFR.................LRLRFDWRGHGLGKAITLAKWTVLFVLANQAGAMIVIQLSTAAGKASP
MURJ_TREPA/32-489FQLIF---VYMHGFRF..............TLQSPLKAMHDEGVRRIIALLLPTTVGIATYLLNDLVCTALATS......
Q9RX17_DEIRA/83-522VQLPA---LRRFGLL................P.EPRLGGHPALGRVLKQMAPFTLTAGARQFLNLYVTRLLTDAS....Q
MURJ_CHLTR/34-482VTLPG---VMKFLGQ.................SKEVPQERDS.IRALIAPLSLGLLSMGIFQLNLLCDMWLARY......
MURJ_HELPY/2-458LHFYP---LVKLGLLNLLWKGFLSFKTKNAAKKKYRSKRIKRDLKGFFKQFLPSVLGNSSAQIASFLDTTIASF......
MVIN_MYCTU/48-521VLLVA---IRREHIS.................LRPLWG.IDQRLKRFGAMAAAMVLYVLISQLGLVVGNRIAST......

PF01554

O51531_BORBU/22-182IIATR---QYNQG-------------------------------------------------------------------
YOEA_BACSU/28-189ILIGQ---AYGAK-------------------------------------------------------------------
YOEA_BACSU/257-418IFAAQ---SIGAN-------------------------------------------------------------------
O66528_AQUAE/245-406TLAGQ---NYGAR-------------------------------------------------------------------
YPNP_BACSU/241-402SMAGQ---NIGIG-------------------------------------------------------------------
NORM_VIBPA/243-404IRVGH---RLGEE-------------------------------------------------------------------
O80695_ARATH/278-441VRVSN---ELGAG-------------------------------------------------------------------
O26414_METTH/244-409SVSGV---AYGSR-------------------------------------------------------------------
O28801_ARCFU/21-180SAVSR---RIGAK-------------------------------------------------------------------
YISQ_BACSU/27-187VIISQ---FLGSR-------------------------------------------------------------------
Y709_METJA/243-408SVIGA---TYGAR-------------------------------------------------------------------
YPNP_BACSU/21-182TILSQ---QKGKD-------------------------------------------------------------------
O25454_HELPY/214-375VLTGQ---NLGAN-------------------------------------------------------------------
NORM_BACSU/20-180PIVAQ---LLGAE-------------------------------------------------------------------
HMRM_HAEIN/249-410ILVGQ---ALGAG-------------------------------------------------------------------
O49660_ARATH/262-426TRVSN---ELGAN-------------------------------------------------------------------
O82752_ARATH/42-203PICVQ---AFGAK-------------------------------------------------------------------
DINF_ECOLI/35-196GLTAQ---AYGAK-------------------------------------------------------------------
Q9ZVH5_ARATH/238-401TRVGH---ALGGG-------------------------------------------------------------------
O28801_ARCFU/239-404AVSGA---AYGAR-------------------------------------------------------------------
Q38956_ARATH/275-438VRVSN---ELGAN-------------------------------------------------------------------
ERC1_YEAST/174-335TLCAQ---AYGAK-------------------------------------------------------------------
Q9ZVH5_ARATH/16-176PICGQ---AFGAK-------------------------------------------------------------------
YAO6_SCHPO/17-177TLGSN---LWGAG-------------------------------------------------------------------
O82752_ARATH/264-427TRVGN---ELGAN-------------------------------------------------------------------
O51429_BORBU/27-187SLMSK---CIGEG-------------------------------------------------------------------
O83871_TREPA/32-196VFMTQ---YSGAR-------------------------------------------------------------------
O51429_BORBU/248-409SIVGQ---NLGAK-------------------------------------------------------------------
YISQ_BACSU/252-413ILIGR---YIGGK-------------------------------------------------------------------
O66528_AQUAE/25-183ILIAQ---FVGAK-------------------------------------------------------------------
O51530_BORBU/21-181AYVSQ---AIAKK-------------------------------------------------------------------
Y709_METJA/21-181SGIAR---RVGAK-------------------------------------------------------------------
NORM_BACSU/247-408IVVGF---EAGAA-------------------------------------------------------------------
NORM_VIBPA/17-176PVVAQ---LNGSA-------------------------------------------------------------------
O26414_METTH/24-183SSVSR---CLGAG-------------------------------------------------------------------
HMRM_HAEIN/22-181PTISY---LNGSG-------------------------------------------------------------------
YD338_YEAST/238-397TLCPQ---AYGSG-------------------------------------------------------------------
MDTK_ECOLI/17-177PVIAQ---LNGSG-------------------------------------------------------------------
Q38956_ARATH/55-215TLCGQ---AFGAG-------------------------------------------------------------------
P71616_MYCTU/19-179ARAAR---RYGAG-------------------------------------------------------------------
O49660_ARATH/40-200PICGQ---AFGAK-------------------------------------------------------------------
O80695_ARATH/57-217TLCGQ---AHGAH-------------------------------------------------------------------
MDTK_ECOLI/244-405IRVGY---RLGQG-------------------------------------------------------------------
F4IHU9_ARATH/37-197TVCGQ---SYGAK-------------------------------------------------------------------
O25796_HELPY/23-184SIVGY---FLGQN-------------------------------------------------------------------
YEEO_ECOLI/48-208VVVAF---SLGKR-------------------------------------------------------------------
Q8DNG1_STRR6/24-183IVIAR---YYGAR-------------------------------------------------------------------

PF07260

G1KED7_ANOCA/1-345IAYSDLGYYI----------------------------------------------------------------------
I3JFW4_ORENI/1-349IAYTDLGYYI----------------------------------------------------------------------
F1Q528_DANRE/1-344IAYTDLGYYI----------------------------------------------------------------------

PF01943

SP5B_BACSU/6-308KQNMNP--------LAMSQVLEQVV-RISLVAVCTTIFLPY...G-----------------------------------
EXOT_RHIME/10-277MNFRKD--------AVWSMISESLG-AVIAVLLALLGFG......-----------------------------------
TUAB_BACSU/10-277LHFNTL--------SKIEIFSNVLS-FG.YLAIAVFMMDA.....-----------------------------------
RFBX_ECOLI/8-279KEKMKW--------LTLSSILSRLA-IIPLTFIFVNTKSD.....-----------------------------------
O26447_METTH/15-286VERMRY--------ISILRIVSSLI-YTALIFLAVRGPGD.....-----------------------------------
YTGP_BACSU/5-320HQMMGP--------TAVSQVVEQIV-RIIFLLSATFLILKVFNGG-----------------------------------
Y1068_METJA/7-302FQLQNY--------ASSTRVVRILS-VFIFSLIFIYLFNVH..NA-----------------------------------
Y1375_METJA/3-283LLKMKY--------LSLTWIVEYTA-KVILVFILTLYLG......-----------------------------------
O26479_METTH/10-276FQRMEY--------QTVWNILNSLF-ILVGVIAVVWLGGS.....-----------------------------------
O29660_ARCFU/6-285FNDFKA--------NFVRALVYEIS-RATLIFLLLYLGLS.....-----------------------------------
O26467_METTH/18-289MERMKY--------ITVLNVLTNLI-FLAAIFIFIRRPSD.....-----------------------------------
O26442_METTH/7-278WERMEY--------VALFQIIERLF-IVTLGLGVLIMGYG.....-----------------------------------
YABM_BACSU/12-309HEMLPS--------ALSQMTEQFLR-VAVLLGLSFWLVKKG..AS-----------------------------------
WZXC_ECOLI/9-276LEFNKI--------GMIETSAVLAG-FTCTVVSAHFWPLA.....-----------------------------------
Q2K5A6_RHIEC/11-272LIFWQE--------FVLNVSQKLVG-FVVTVGIAAIYHS......-----------------------------------
Q32EG2_SHIDS/2-269LEKMKA--------VVIATTIAKLT-GVILTFILVKSPND.....-----------------------------------
Q8DZE2_STRA5/6-273QQRSLA--------NLILSLANAVS-SVALSLFLIFHWSD....D-----------------------------------
Q8P805_XANCP/25-289LRFGQV--------ALSDVGSQVLG-LGAAVAAALAGWG......-----------------------------------

PF13440

I4HBM6_MICAE/6-298FKFKIM--------TIRSLLGILIA.GIVGVGMALLGYG-----------------------------------------
I0T9J8_9BACT/34-326IDFKSQ--------AKITLSATVIS.GIVGILLAYQGYG-----------------------------------------
C4ZJE4_THASP/32-325LRFKEL--------MGARVTSYLFGYGLVSLVLAYAGLG-----------------------------------------
K9PM46_9CYAN/51-343MQYKAL--------MFNDLLSMALG.IVAAIAAALFGLG-----------------------------------------
A9KN88_CLOPH/33-329FDYKTL--------FYVRIVSSGVP.FLVTIPMAMIYKN-----------------------------------------
M0N8I3_9EURY/48-343LRFDKQ--------FAYTLSGTVFY.VAVAVVVAFLTRS-----------------------------------------
E5VCV6_9BACE/28-323MQFSVI--------AKIDMTASVLM.VIFSIVLVYIGLG-----------------------------------------
A4A6G8_9GAMM/8-300LKFEAL--------VKAETVTILIA.TCLGIGCAFMGFG-----------------------------------------
R6E9E7_9BACE/31-323QRFKLI--------AIRTLVIQIVG.CSLAIWAAYTGWG-----------------------------------------
K6YGT5_9ALTE/31-321FKNKQL--------SAITLISVTVG.GIVSVSLALNDFG-----------------------------------------
F3KH97_9GAMM/34-324LTFEKE--------FKFKILPKLIG.VPCTLLLAYWLRS-----------------------------------------
C0CUD1_9FIRM/143-435MEFKGL--------FKATICAVVVS.GAASIWMAYTGFG-----------------------------------------
R7DCU6_9PORP/33-325MNFKML--------SKISIITAIIT.GISSLYMAYSGFG-----------------------------------------
R6YG40_9FIRM/34-326MLFKRF--------FFSTLIGTAGS.AVVGIVMAYMGFG-----------------------------------------
H1DLG1_9PORP/33-325LKFKML--------TKIYLLSNFIS.SVSAIIMAYAGFG-----------------------------------------
M5DLR8_9PROT/54-346LDFKRI--------QLAQLTGMIVGQVFVGFTLAAILHT-----------------------------------------
C6LGC8_9FIRM/33-329LNFKPL--------FFIRLASSLIP.LFVTVPLAFALRS-----------------------------------------
K5CQA8_9BACE/33-325KEFKFI--------AVRSFVIQISA.GAAAVTAALCGAG-----------------------------------------
B8HLM4_CYAP4/51-343MRFTDL--------ALVQVASMALG.AGVAIAAAWGGAG-----------------------------------------
G5F456_9ACTN/34-326LEFQKT--------FRATVTAGVVS.GSAGVVAALLGGG-----------------------------------------
R6A4H2_9BACE/33-325IAFKKI--------AKINLTAIVAG.TGMGILLAFLGCG-----------------------------------------
S5C4K3_ALTMA/35-325MDFKQE--------MKLQVFPKLLS.FMSTMGLALCMES-----------------------------------------
L8F559_MYCSM/28-320FRQDVV--------FRADMIAFVAM.NAALLLLVQVIPG-----------------------------------------

PF04506

RFT1_CANGA/9-542LNYGAR........SRYESIAVTAN-CLVNFTVVYSYEKKL.............ILTSYFDDSERFREGIA.........
E9IWP9_SOLIN/8-542LFVRLK........IILDTIMIVIR-TMTFVPLILYYPENA.......................................
S9VRB9_SCHCR/24-535RQFSPT........ASAEGLGIISN-TVTSFLISFFSQSENLS.....................................
C5E2W4_LACTC/16-558LNYKVR........SQLESIAVVVS-CIANFSIVYVYENKF.............NGSGIALHDATKQEGIA.........
E9EIH0_METAQ/28-566LQFGTR........ATAESAATFLR-CLAVFASTVLASRK..........................RLDIG.........
G8BWS7_TETPH/20-558LNFGTR........SKFETISTTVG-CVVNFIVVYGLENNW............YKINILAEDLEVSKEGIA.........
H2ASC3_KAZAF/14-533LNYSKR........SKFESLGVLLG-CLVNFAIITGFERDW...........IIFTSLDNQNSDMIKEGIA.........
RFT1_YARLI/102-645LRFRSR........AAAEAVAILVR-CVVTFSFTLLAKDT........................DGGLNGG.........
RFT1_SCHPO/10-520QKFSKT........ASAEGLGTIIC-SLLSFAISVLGRNKAPS.....................................
I2GX14_TETBL/21-581LNYGTR........SCFESISVTTG-CLTNFIVIYAFEKNL.............LFAIPKEDLEINKEGIA.........
A7TRS5_VANPO/18-551LNYGLR........SRFEGIAVTMG-CVINFTVVYAFEKKW..............YSLDTDDLEVSKEGIA.........
J7R8K9_KAZNA/27-584MDYAKR........SKLESIAVTMG-CVTNFLIVIYCENHN...............VLLDADDEVTRESIA.........
M2PSW7_CERS8/12-528LRVDVR........VRAEGAAVVMK-TVVAFAALVVLDAEWA......................................
RFT1_CAEEL/2-516LRLESKCGSLAQHFAIGQGMLICVK-RIFVLAGLFMFPGMYH......................................
G8ZPN0_TORDC/18-550LNYGKR........SQFESISVTVG-CLLNCAVILAFEKSW..............FFSASDKSESSREGVA.........
C4R7X1_PICPG/21-528LDIKTR........SKIESFANVFK-CLSQLGMIVWFEHK..........................FKGMSVDKANPDYF
U5D209_AMBTC/17-521LLFGLR........LKVETAATTLR-CMTTYFLIINQTNEG...K...................................
G0W6B8_NAUDC/22-586LNYSSR........SRIESLAITMG-CITNFIIVVSFEKNWWNPILKSMIHHNNELMDQEEFMEVSREGIA.........
E2AM70_CAMFO/8-540LFVRLK........IILDTIMIAIR-TMTFVPLILYYPENA.......................................
E9GUV5_DAPPU/9-536QYVRWR........IFVDCVMMFIR-VGTLVVSVLYFPAYT.......................................
D8M9P3_BLAHO/10-506LHTNVK........VFVESTSLSIR-SITNCILLCLFPSLG.......................................
F4K836_ARATH/105-602LKLQLR........LIVETVATLAR-CVTLYSLLVMQTNME...K...................................
U4LAR2_PYROM/52-567LRYKLR........AGAESAASLTR-CLLTCGTTIYFARQ..........................GWDIG.........
RFT1_DROME/8-549CFVKLK........ILLNTLHILVR-SAIFLWIVTGDRSAA.......................................
G8BFC9_CANPC/25-545LEFGKR........SKFEGIALIAK-CTTTFVAIYFARQR.....................FTGLEYSGIS.........
M3BX75_SPHMS/8-530MLYKSR........AAAEASAVVLK-TLATAGTVFWSQHE..........................QLELG.........
W4Z9M3_STRPU/12-532LFVRLK........VVIEGIAIGIR-CSLTVFFLIINPQIG.......................................
RFT1_ASHGO/11-543LNYRKR........SQFEGAAVAAS-CLVNFAVIYWYENWV.............NGRGETVHDSYKQEGIA.........
M3K0B3_CANMX/13-532LDFGKR........SKFEGLAVVTK-CVVTFVSIMIVKSY.....................FSGDIFSGSA.........
G8JV96_ERECY/11-550LNYKTR........SEIEGLSVAAS-CIVNFCIIYWYENWI.............NGTGETIHDNYKQEGIA.........
G0V9M8_NAUCC/17-571LNYSTR........SSFESAAVAIG-CIVNFIVVISFENNW...IDFSKLASISSVIDD....EMLREGVA.........
H9J737_BOMMO/8-547CFIKLK........IVLDTLHIFVR-TLLFLSIIIYDRSLA.......................................
R4XDT4_TAPDE/6-505LRYKVR........ASCEGLAILSR-CIVTFLVSVYGGPE.............................IG.........
RFT1_YEAST/18-565LNYAAR........SRFESIAVTTG-CIVNFIVVYAVQQSR..............YPMGVVTSDIDKEGIA.........

PF14667

Q03SZ7_LACBA/349-498G.....--------....VG.ASWL-TVMSLGVTFAII.-----------------------------------------
Q38V74_LACSS/358-503I.....--------....VG.ASVG-TVISLGVVLALI.-----------------------------------------
Q034V3_LACC3/356-499T.....--------....AG.ASGA-TILSLGLILCLI.-----------------------------------------
A8UAN8_9LACT/362-510T.....--------....LG.SSGA-TVISLVTILMVM.-----------------------------------------
D0BM46_9LACT/359-506T.....--------....LG.ASIA-TILGLFVMLGMI.-----------------------------------------
C8NI78_9LACT/366-514T.....--------....LG.ASLA-TALGLCVMMGVM.-----------------------------------------
C0WQN7_LACBU/354-501I.....--------....IG.ASAA-TLIGLIVMIFLM.-----------------------------------------
C2EHH6_9LACO/356-502I.....--------....IG.ASIA-TTASLLLAAIII.-----------------------------------------
E6LEY4_9ENTE/358-506T.....--------....IG.ASLS-TLLGLAAVLATF.-----------------------------------------
C9A420_ENTGA/359-508T.....--------....TG.ASLS-TLLGLIGTLIYF.-----------------------------------------
C2HEH9_ENTFC/359-507T.....--------....AG.ASLS-TLLGLGVTLWYF.-----------------------------------------
C0X942_ENTFL/359-507T.....--------....LG.ASWS-TILGLLATLFVL.-----------------------------------------
E0RUK9_BUTPB/373-516L.....--------....YT.IIIS-EIVTFLIYDIMC.-----------------------------------------
E7MM58_9FIRM/379-526Y.....--------....SG.AIIS-SILCEITFIALS.-----------------------------------------
E4LZJ6_9CLOT/384-531Y.....--------....QG.VVMS-SILAMGIFIILD.-----------------------------------------
D4W2K6_9FIRM/377-526A.....--------....DG.ATLS-TMLAYTFCIGCS.-----------------------------------------
D5E4C9_BACMQ/373-523......--------...EIG.PVLA-TYGGYMVSVLYN.-----------------------------------------
B7JJF5_BACC0/376-524G.....--------....HG.AVLG-TILGYLISNSIM.-----------------------------------------
Q8EP19_OCEIH/372-521......--------...GKG.AIFG-TALAALIAVMMN.-----------------------------------------
B1YKH1_EXIS2/386-534D.....--------...GTG.AGYA-TILGYVVATGLM.-----------------------------------------
D6Y0K7_BACIE/382-530P.....--------....VG.APLA-TAAGYILAIMVM.-----------------------------------------
Q5WE75_BACSK/374-522P.....--------....YG.AIWT-TYIGFGIGIALN.-----------------------------------------
E6U1Q3_BACCJ/375-523P.....--------....AG.AILA-TGVGYVIAIGVN.-----------------------------------------
D3FXP2_BACPE/374-522P.....--------....AG.AIVS-TYAGYLVGIMIN.-----------------------------------------
A4IRX9_GEOTN/371-520T.....--------....VG.AIVA-TMAGYFVSVAFN.-----------------------------------------
D5DN36_BACMD/374-521H.....--------...EIG.SVLA-TALGYIVSLVYM.-----------------------------------------
A7Z7U6_BACA2/375-524G.....--------....DG.AILA-TALGYIASLLYG.-----------------------------------------
A0RJU4_BACAH/372-520T.....--------....VG.AILA-TAVGFLASVWYT.-----------------------------------------
E7RE43_9BACL/368-516T.....--------....DG.AIAA-TIIGYIAAIGMN.-----------------------------------------
A3I8W7_9BACI/372-521A.....--------....DG.AIVA-TAIGYSVSIIIN.-----------------------------------------
A6CQJ8_9BACI/372-520T.....--------....QG.AVLA-TTLGYLAATVIN.-----------------------------------------
A0A0E0UWL5_LISMM/370-518A.....--------....KG.SIIA-TGIGYAVSCIFM.-----------------------------------------
Q2FXH6_STAA8/386-533T.....--------....PG.AILS-TSIALLFAIGCN.-----------------------------------------
B9E7H2_MACCJ/374-522T.....--------....EG.AVLA-TAIALTVNILCN.-----------------------------------------
D5T1U4_LEUKI/363-511A.....--------....IG.PMYA-SLGSLVLVNYML.-----------------------------------------
Q03XR0_LEUMM/330-477......--------...SLG.ALLS-TFISLVIVTIIM.-----------------------------------------
A0NHL2_OENOE/387-534A.....--------....TG.AMLS-TLIGFVFSSCYL.-----------------------------------------
B1MY12_LEUCK/485-634......--------....MG.ALMS-SVIGMVIAIAFM.-----------------------------------------
C2KKY7_LEUMC/498-647......--------....MG.ALMT-SVIGMFISILYM.-----------------------------------------
C0WLU0_LACBU/374-518......--------....FG.AILA-TAISFGLVCVLS.-----------------------------------------
C2EP42_9LACO/342-483A.....--------....DG.AILS-TDISFLVVILLS.-----------------------------------------
H7C726_ENTFA/370-519......--------...GYG.LSIA-TIICTMFTTIIA.-----------------------------------------
C5RB06_WEIPA/501-648......--------....MG.PLVS-TTIAFLLGMIIA.-----------------------------------------
A8UCR2_9LACT/391-539......--------...TNG.MFVS-NIFGFGVTVFIM.-----------------------------------------
A2RMM4_LACLM/390-539......--------...TYG.PLLA-TTISFLIGVFLF.-----------------------------------------
T0UE48_9ENTE/381-529V.....--------....YG.PLVS-TTLALGVTCWLN.-----------------------------------------
E6LIJ6_9ENTE/381-529V.....--------....YG.PLLS-TTIALSVTCYLN.-----------------------------------------
Q838A3_ENTFA/382-530V.....--------....YG.PLLA-TMIGFTVSCVLI.-----------------------------------------
C2H7P1_ENTFC/381-529V.....--------....YG.PLLA-TMLGFAVSCTLI.-----------------------------------------
A4VW05_STRSY/379-527V.....--------....YG.SFIS-TIFGLGIMLYLF.-----------------------------------------
E3CI47_STRDO/375-523P.....--------....YG.PLVA-TALALWIPIVLM.-----------------------------------------
A3CPL5_STRSV/375-523A.....--------....YG.PLLA-TTVGLIIPILLM.-----------------------------------------
E8K660_STRPA/410-558S.....--------....YG.PLLS-TTIALMVPIVLM.-----------------------------------------
B1SH45_9STRE/377-525A.....--------....YG.PLLS-TAIGLMIPIILM.-----------------------------------------
C2LQ70_STRSL/432-580A.....--------....LG.PVIS-TAIGLGVPIALM.-----------------------------------------
A5VL26_LACRD/382-530......--------...GLG.PLVS-TGISMFVINYLI.-----------------------------------------
D2ELV8_PEDAC/393-541......--------...AVG.SLIS-TAIGFAVVNWLI.-----------------------------------------
C0WUG9_LACBU/378-530......--------...AFG.PLLS-TAIGLTISDWLI.-----------------------------------------
Q03RI1_LACBA/378-525A.....--------....FG.PLIA-TGIGFTVTCYLI.-----------------------------------------
Q1WUT1_LACS1/381-529V.....--------....YG.PLAA-TGIGMTVSNVLI.-----------------------------------------
Q38VP9_LACSS/378-526V.....--------....YG.PLVS-TGLAFATSSILM.-----------------------------------------
C8PCY7_9LACO/375-523V.....--------....YG.PLIS-TIIGLIFTISFA.-----------------------------------------
C2E7U4_LACJH/384-532V.....--------....YG.PLLA-TNIGLIITIWLS.-----------------------------------------
C2KAZ9_9LACO/380-528I.....--------....YG.PLVA-TNLGLLVIVFLS.-----------------------------------------
Q03AT6_LACC3/380-528V.....--------....YG.PVLS-TMLGMTVSSLLM.-----------------------------------------
D0BKY7_9LACT/390-538......--------...GAG.PLWA-TSLGFILATVYM.-----------------------------------------
C8NE09_9LACT/413-561G.....--------....AG.PLIA-SSVAFFVATLYM.-----------------------------------------
E4KNA5_9LACT/790-938A.....--------....HG.ALAA-TLFAFLVASLLM.-----------------------------------------
D4YJ56_9LACT/433-583......--------...TSG.ALLA-TGTAFIGIAVFY.-----------------------------------------
E0IFR0_9BACL/366-514M.....--------....YG.MIIG-STLCYIVVTMLN.-----------------------------------------
E0RCM4_PAEP6/382-529I.....--------....YG.IIAA-TGLCFLVITLLN.-----------------------------------------
C6J0R0_9BACL/364-511I.....--------....YG.IIIA-TGLCFFVITLLN.-----------------------------------------
C0Z9G8_BREBN/364-513M.....--------....DG.LSLS-WLVATAFVCVLN.-----------------------------------------
C4GB38_9FIRM/387-530I.....--------....YG.LIMA-YTVDALLISYLN.-----------------------------------------
R5F1U8_9CLOT/387-539I.....--------....YS.VVFA-NIIFALVMCLLN.-----------------------------------------
E6LN70_9FIRM/381-525I.....--------....IG.LVFG-NMVFALSMCILN.-----------------------------------------
D4KXJ4_9FIRM/383-527I.....--------....FA.VVIA-NAAFGLIMCILN.-----------------------------------------
E3GGE0_EUBLK/365-508I.....--------....YG.IVIS-SMITFVYLTISN.-----------------------------------------
E6MGM4_9FIRM/373-516I.....--------....YG.MGLD-YMLTFIYLTVAN.-----------------------------------------
B8D0L3_HALOH/359-505I.....--------....IG.SIIS-ITLGYIAAAILN.-----------------------------------------
C6PQD8_9CLOT/131-275I.....--------....YG.AVIG-SICGYIIASMLN.-----------------------------------------
C8VXJ1_DESAS/366-509I.....--------....RA.AAIS-QVIMFVISSTLN.-----------------------------------------
D9QSV7_ACEAZ/363-507I.....--------....RG.AAVA-TASGFCLAALLN.-----------------------------------------
B2A8K9_NATTJ/363-507I.....--------....IG.GAIG-TCTGFLVASIFN.-----------------------------------------
A8MK38_ALKOO/363-506V.....--------....RG.AALG-TVTAYTVATALN.-----------------------------------------
A5D2G5_PELTS/358-502I.....--------....RG.AAIA-IVAGYIITAWLN.-----------------------------------------
D5X9J9_THEPJ/361-503I.....--------....KG.PALG-TLAGFCVSSVLN.-----------------------------------------
B2A2Z4_NATTJ/361-504V.....--------....NG.AAIG-TLISYAVSSMFN.-----------------------------------------
C7GYH1_9FIRM/373-517V.....--------....VG.AAIG-TVCAYGIAMLLN.-----------------------------------------
A6TN15_ALKMQ/363-506I.....--------....LG.AVIG-SICGYVIVMLLN.-----------------------------------------
A8MIG9_ALKOO/365-508I.....--------....LG.AVMG-SIAGYCVVMVLN.-----------------------------------------
Q67JD5_SYMTH/384-522I.....--------....AG.AAWA-TAVGFGVAALLN.-----------------------------------------
C4FNY8_9FIRM/361-503I.....--------....NG.AAWA-TNLNFAIAALIN.-----------------------------------------
D3LVV9_9FIRM/358-500I.....--------....VG.AAWA-TNAGLLAAALLN.-----------------------------------------
E2ZD67_9FIRM/360-502E.....--------....VG.AAWA-TNADIALATALN.-----------------------------------------
R5TDG3_9FIRM/363-506V.....--------....LG.AAWA-TNADFGVAALLN.-----------------------------------------
D3LX29_9FIRM/358-500I.....--------....RG.AACA-TVADIGVAALLN.-----------------------------------------
C4FPR1_9FIRM/359-501......--------....IGGAAWA-TVADIGFAALLN.-----------------------------------------
A1HLQ5_9FIRM/371-513I.....--------....KG.AAWA-TAADMGVAAFLN.-----------------------------------------
C4V2B6_9FIRM/374-517I.....--------....MG.AAWA-TAADMGVAALIN.-----------------------------------------
E8LB44_9FIRM/369-509I.....--------....RG.ASMA-TVADFAVAAIIN.-----------------------------------------
C0WBK9_9FIRM/378-517I.....--------....KG.SSWA-TVADIGIAALLN.-----------------------------------------
B7DPH6_9BACL/373-525......--------....LG.AALA-TTFGYIVSSLLN.-----------------------------------------
C0ZHE2_BREBN/367-517I.....--------....SG.AAVS-TVLAYLVAMGLN.-----------------------------------------
C2YMP0_BACCE/352-495I.....--------....TG.AAYS-TLIIYIMICIVN.-----------------------------------------
B7GMA5_ANOFW/366-505L.....--------....IG.AGIS-TLVTYAFITWAN.-----------------------------------------
E7RL93_9BACL/356-500L.....--------....VG.AAIS-TAAIYLILFILN.-----------------------------------------
D3FZH8_BACPE/357-501M.....--------....IG.AAIS-TLIVYVAITILN.-----------------------------------------
B0MPG6_9FIRM/391-534I.....--------....NG.AAVS-TVIMYAAVALGG.-----------------------------------------
B0PEA8_9FIRM/441-584I.....--------....QA.APIG-TLVCYCFVLFVS.-----------------------------------------
A7VWY4_9FIRM/433-577I.....--------....QG.AGVG-TLVCYVFITFFA.-----------------------------------------
E6TRQ4_BACCJ/362-512I.....--------....EG.AALS-SAISFLIIACCA.-----------------------------------------
D5WSL0_KYRT2/373-521......--------....IGGAAAA-SVVSYWVAAELN.-----------------------------------------
B1YGP9_EXIS2/345-491M.....--------....VG.AGMA-TFGGFAVMAAAQ.-----------------------------------------
C5RD31_WEIPA/359-505I.....--------....VG.ASLA-TLLALVPMLYFV.-----------------------------------------
Q8EU30_OCEIH/362-509M.....--------....MG.AAVA-TVCSLFCLFLLI.-----------------------------------------
B9E8U7_MACCJ/341-481I.....--------....KG.ASIA-TVAGLVTYTLCL.-----------------------------------------
Q49V13_STAS1/337-479M.....--------....LG.GSLS-TVLSLILFAAIL.-----------------------------------------
E8SIP0_STAPH/344-486I.....--------....LG.ASVA-TVSSLVVFVVVL.-----------------------------------------
Q2G0R7_STAA8/343-485I.....--------....IG.ASIS-TVVSLIIFGTII.-----------------------------------------
F2F183_SOLSS/360-508V.....--------....MG.AAIA-SNIGLIFTAAAL.-----------------------------------------
A3IEA1_9BACI/365-514V.....--------....LG.AAIA-NDIGLLLTAFLL.-----------------------------------------
E7RLD1_9BACL/354-503I.....--------....AG.AAVA-GNIGLALIVFCL.-----------------------------------------
A0AF13_LISW6/361-504T.....--------....IG.ASIS-TCIGLFIICIIC.-----------------------------------------
D7UUI0_LISGR/356-499I.....--------....AG.ASIA-TCLGLLIILGCC.-----------------------------------------
A6CR25_9BACI/352-499T.....--------....MG.ASIS-TVIALGIIALIL.-----------------------------------------
E5WT44_9BACI/362-510T.....--------....AG.AAAA-SCLALAAVLIFL.-----------------------------------------
U5L445_9BACI/362-508T.....--------....MG.AAIA-ACAALAVVLLVL.-----------------------------------------
A8F924_BACP2/360-506I.....--------....YG.AAWS-TVCGFLAAALLN.-----------------------------------------
T5HW26_BACLI/356-502I.....--------....SG.AAFA-TMMSFAAVAGLN.-----------------------------------------
A7Z0I0_BACA2/354-499I.....--------....TG.AALA-TVLAFAAVACLN.-----------------------------------------
D4G3E4_BACNB/359-505I.....--------....EG.ASLA-TAASFAAVAGLN.-----------------------------------------
D5D970_BACMD/362-511T.....--------....IG.AAIA-SSAGFAIVAAIN.-----------------------------------------
B7GFI4_ANOFW/350-497T.....--------....VG.AAVA-TLIAYVVMCAIA.-----------------------------------------
A4IJD3_GEOTN/352-496V.....--------....LG.AALA-TTGAYALMACFL.-----------------------------------------
C5D378_GEOSW/360-505T.....--------....TG.AAAA-TTLSYAAMACFL.-----------------------------------------
Q5WAF7_BACSK/347-496......--------....MG.GAYA-SLFAFLAMAALA.-----------------------------------------
D3FR13_BACPE/361-509T.....--------....LG.SAVS-TVAAIACMALVQ.-----------------------------------------
Q9KGJ0_BACHD/361-507T.....--------....VG.AAIG-TIAAYATMATIN.-----------------------------------------
D6XV50_BACIE/360-507I.....--------....TG.AAVA-SLAGFTLMAVAV.-----------------------------------------
D3E759_GEOS4/381-532I.....--------....TG.AAIA-GVAAHLTAAALN.-----------------------------------------
E0RM54_PAEP6/373-525T.....--------....AG.AAIA-GAVAYLLAAVIN.-----------------------------------------
A7GJW7_BACCN/360-506I.....--------....AG.AAIA-TVLALLSIALLN.-----------------------------------------
B5UWQ0_BACCE/360-510V.....--------....KG.AAFA-TLCALIIISGLN.-----------------------------------------
D2BMG7_LACLK/323-465I.....--------....LG.GNLT-SVSIAVSGAYFL.-----------------------------------------
B8IEZ7_METNO/324-461A.....--------....SG.IAAA-QSLGLIAACGFL.-----------------------------------------
C7NM90_HALUD/327-463I.....--------....VG.AAIS-SLISYIVLAMLL.-----------------------------------------
A6DHF1_9BACT/293-436I.....--------....SG.VLAA-TAVARLVTN....-----------------------------------------
Q47U72_COLP3/338-481L.....--------....LG.IAIA-TACSFFVSDVIL.-----------------------------------------
B4AGJ7_BACPU/343-486L.....--------....YGIASAG-AIVLLIKNIVFL.-----------------------------------------
Q1K412_DESAC/351-495L.....--------....VG.VAAG-TLTARLLISAVA.-----------------------------------------
C0QCL2_DESAH/352-496L.....--------....TGIAAGT-LGSHLLIQTILV.-----------------------------------------
Q2YCG5_NITMU/323-466......--------....VG...LA-ITVAYTVRLSLQ.-----------------------------------------
E6QMG7_9ZZZZ/367-517T.....--------....LG.IGIA-VAVATVCSACVL.-----------------------------------------
F2G999_ALTMD/323-467......--------....ITVMLYS-IVIGNFLATPVR.-----------------------------------------
C6JQC3_FUSVA/323-462G.....--------....IG.SAIA-ITLGEFIGILIQ.-----------------------------------------
E5X0H2_9BACE/326-464I.....--------....EG.MCWG-RVLYSLIAAYLN.-----------------------------------------
A3DHV8_CLOTH/327-465V.....--------....YA.IAFG-AFITSLISTIIN.-----------------------------------------
B5CWR8_BACPM/324-466T.....--------...IEA.MAWA-WDITLFFNTIIS.-----------------------------------------
F1VXT7_9BURK/320-462I.....--------....ES.VAIC-YLIANIVNLFPC.-----------------------------------------
Q2YCC1_NITMU/331-475V.....--------....MG.LVMA-MVVTELIVVFLT.-----------------------------------------
Q0AHL3_NITEC/325-466L.....--------....EG.VALS-WVIAYPLVFFIN.-----------------------------------------
D4YX22_SPHJU/336-476A.....--------....IG.LAWA-WLFAFPILTLIT.-----------------------------------------
Q1GPL1_SPHAL/342-484L.....--------....IG.MAWA-WLVAAPLLLVVT.-----------------------------------------
B0VF98_CLOAI/326-465M.....--------....KG.AAFA-TVIVTWLSVIIY.-----------------------------------------
A1S103_THEPD/335-472L.....--------....YG.LVAS-LVASSASSAAYG.-----------------------------------------
E8R8C0_DESM0/349-487M.....--------....VG.AIVA-GLIGGYASTVYL.-----------------------------------------
A3DIV8_CLOTH/358-500I.....--------....AG.YIAG-MVVSSICVCILD.-----------------------------------------
F2JLQ5_CELLD/355-497I.....--------....IG.FVIA-MLIQSGFVCSML.-----------------------------------------
A7VPC0_9FIRM/355-497L.....--------....NG.LIVV-IFASEILNSTLS.-----------------------------------------
A8SAU1_9FIRM/356-502M.....--------....RG.FLTV-ILLSSFYTCAANT-----------------------------------------
A6TSY6_ALKMQ/375-519I.....--------....NG.FFIG-FLLSTFIIFVLN.-----------------------------------------
A6NPI5_9FIRM/351-494......--------....LGGYVAG-FVLSSALGALLN.-----------------------------------------
B0KBP6_THEP3/360-504L.....--------....FG.YIYS-FIFADALILMLN.-----------------------------------------
B7AQB6_9FIRM/351-493I.....--------....TG.YMWG-LLVSQCFLTGAY.-----------------------------------------
D3AN52_9CLOT/376-519I.....--------....MA.YLIG-MLASELLLALMH.-----------------------------------------
B0TAY6_HELMI/361-505L.....--------....NG.IAYG-FTISNILAALLH.-----------------------------------------
Q3ADH7_CARHZ/346-484I.....--------....TG.TCLS-FALYHFLLFILS.-----------------------------------------
E0RMQ1_PAEP6/366-508I.....--------....YG.AVIA-ICINSAIVTLLH.-----------------------------------------
C0ZAP4_BREBN/363-505I.....--------....HG.AVIA-LNIGITLGTLLH.-----------------------------------------
D7WQC4_9BACI/353-489E.....--------....KG.AVVA-IGFGVLLTSFLH.-----------------------------------------
C8WQG9_ALIAD/361-502I.....--------....LG.VSIA-TAFSFTLTAALH.-----------------------------------------
B7DPL3_9BACL/356-497I.....--------....RG.LASA-VATSGIVAAVLA.-----------------------------------------
D5QEL1_KOMHA/351-483V.....--------....DG.AAFA-WASRSVMDCVVR.-----------------------------------------
A9WAD6_CHLAA/337-475Q.....--------...VFGNGALG-GALAYTVTELGI.-----------------------------------------
E1IEK9_9CHLR/380-529L.....--------....VG.MALA-FGVARLASGFWV.-----------------------------------------
B9JKJ2_AGRRK/321-464......--------....TGGVSVA-RVLLSAIMFAFY.-----------------------------------------
Q2Y4J6_9ARCH/377-524LLSPIG--------INGPVG.AAAA-TALSQLVGFVGL.-----------------------------------------
E8V165_TERSS/339-475A.....--------....VG.AAWG-NGLSQAFGIVAM.-----------------------------------------
B8IGJ3_METNO/336-472T.....--------....VG.AAFG-RALVQLYLFVLS.-----------------------------------------
D7BDH0_MEISD/336-473A.....--------....IG.AAFA-NTGSQVFYTLGA.-----------------------------------------
F2NKF2_MARHT/337-483A.....--------....VG.GAMA-NT