Sequence alignment for CL0222

PF14667

A0AF13_LISW6/361-504--------------------------------------------------------------------------------
A0NHL2_OENOE/387-534--------------------------------------------------------------------------------
A0RJU4_BACAH/372-520--------------------------------------------------------------------------------
A1ASY9_PELPD/345-481--------------------------------------------------------------------------------
A1BJ49_CHLPD/337-476--------------------------------------------------------------------------------
A1HLQ5_9FIRM/371-513--------------------------------------------------------------------------------
A1ILY9_STROR/319-458--------------------------------------------------------------------------------
A1S103_THEPD/335-472--------------------------------------------------------------------------------
A1YVF6_LACJH/321-459--------------------------------------------------------------------------------
A2RG74_STRPG/377-525--------------------------------------------------------------------------------
A2RHU4_LACLM/321-459--------------------------------------------------------------------------------
A2RMM4_LACLM/390-539--------------------------------------------------------------------------------
A2STD2_METLZ/331-469--------------------------------------------------------------------------------
A3CPL5_STRSV/375-523--------------------------------------------------------------------------------
A3CVY7_METMJ/333-471--------------------------------------------------------------------------------
A3DHV8_CLOTH/327-465--------------------------------------------------------------------------------
A3DIV8_CLOTH/358-500--------------------------------------------------------------------------------
A3F4D6_LACLC/321-459--------------------------------------------------------------------------------
A3I8W7_9BACI/372-521--------------------------------------------------------------------------------
A3IEA1_9BACI/365-514--------------------------------------------------------------------------------
A3W1Y0_9RHOB/329-468--------------------------------------------------------------------------------
A4FX93_METM5/354-492--------------------------------------------------------------------------------
A4IJD3_GEOTN/352-496--------------------------------------------------------------------------------
A4IRX9_GEOTN/371-520--------------------------------------------------------------------------------
A4SCQ1_PROVI/337-476--------------------------------------------------------------------------------
A4VW05_STRSY/379-527--------------------------------------------------------------------------------
A5D2G5_PELTS/358-502--------------------------------------------------------------------------------
A5ITS6_STAA9/386-533--------------------------------------------------------------------------------
A5LCT3_STRPN/372-520--------------------------------------------------------------------------------
A5M4K0_STRPN/211-349--------------------------------------------------------------------------------
A5UNI7_METS3/328-460--------------------------------------------------------------------------------
A5UQJ1_ROSS1/330-463--------------------------------------------------------------------------------
A5UWW7_ROSS1/374-505--------------------------------------------------------------------------------
A5VL26_LACRD/382-530--------------------------------------------------------------------------------
A5ZUX1_9FIRM/326-464--------------------------------------------------------------------------------
A6CQJ8_9BACI/372-520--------------------------------------------------------------------------------
A6CR25_9BACI/352-499--------------------------------------------------------------------------------
A6DHF1_9BACT/293-436--------------------------------------------------------------------------------
A6NPI5_9FIRM/351-494--------------------------------------------------------------------------------
A6QEF7_STAAE/343-485--------------------------------------------------------------------------------
A6TN15_ALKMQ/363-506--------------------------------------------------------------------------------
A6TSY6_ALKMQ/375-519--------------------------------------------------------------------------------
A6UPA0_METVS/351-488--------------------------------------------------------------------------------
A6UU30_META3/353-490--------------------------------------------------------------------------------
A7GJW7_BACCN/360-506--------------------------------------------------------------------------------
A7HKJ9_FERNB/322-460--------------------------------------------------------------------------------
A7VPC0_9CLOT/355-497--------------------------------------------------------------------------------
A7VWY4_9CLOT/433-577--------------------------------------------------------------------------------
A7Z0I0_BACA2/354-499--------------------------------------------------------------------------------
A7Z7U6_BACA2/375-524--------------------------------------------------------------------------------
A8F924_BACP2/360-506--------------------------------------------------------------------------------
A8MIG9_ALKOO/365-508--------------------------------------------------------------------------------
A8MK38_ALKOO/363-506--------------------------------------------------------------------------------
A8RUL6_9CLOT/387-539--------------------------------------------------------------------------------
A8SAU1_9FIRM/356-502--------------------------------------------------------------------------------
A8UAN8_9LACT/362-510--------------------------------------------------------------------------------
A8UCR2_9LACT/391-539--------------------------------------------------------------------------------
A9EQ86_SORC5/331-462--------------------------------------------------------------------------------
A9WAD6_CHLAA/337-475--------------------------------------------------------------------------------
B0K3R2_THEPX/360-504--------------------------------------------------------------------------------
B0MPG6_9FIRM/391-534--------------------------------------------------------------------------------
B0N362_9FIRM/290-427--------------------------------------------------------------------------------
B0PEA8_9FIRM/441-584--------------------------------------------------------------------------------
B0TAY6_HELMI/361-505--------------------------------------------------------------------------------
B0VF98_CLOAI/326-465--------------------------------------------------------------------------------
B1MY12_LEUCK/485-634--------------------------------------------------------------------------------
B1SH45_9STRE/377-525--------------------------------------------------------------------------------
B1YGP9_EXIS2/345-491--------------------------------------------------------------------------------
B1YKH1_EXIS2/386-534--------------------------------------------------------------------------------
B2A2Z4_NATTJ/361-504--------------------------------------------------------------------------------
B2A8K9_NATTJ/363-507--------------------------------------------------------------------------------
B2GDL9_LACF3/322-460--------------------------------------------------------------------------------
B3EHD9_CHLL2/365-504--------------------------------------------------------------------------------
B3EP69_CHLPB/337-475--------------------------------------------------------------------------------
B3W6R7_LACCB/364-511--------------------------------------------------------------------------------
B3WAP5_LACCB/356-499--------------------------------------------------------------------------------
B3WCD6_LACCB/380-528--------------------------------------------------------------------------------
B3XNV8_LACRE/322-460--------------------------------------------------------------------------------
B4AGJ7_BACPU/343-486--------------------------------------------------------------------------------
B4SBS0_PELPB/338-477--------------------------------------------------------------------------------
B5CWR8_9BACE/324-466--------------------------------------------------------------------------------
B5UWQ0_BACCE/360-510--------------------------------------------------------------------------------
B6IYF6_RHOCS/343-484--------------------------------------------------------------------------------
B6YVL8_THEON/328-461--------------------------------------------------------------------------------
B7AQB6_9FIRM/351-493--------------------------------------------------------------------------------
B7DPH6_9BACL/373-525--------------------------------------------------------------------------------
B7DPL3_9BACL/356-497--------------------------------------------------------------------------------
B7GFI4_ANOFW/350-497--------------------------------------------------------------------------------
B7GMA5_ANOFW/366-505--------------------------------------------------------------------------------
B7JJF5_BACC0/376-524--------------------------------------------------------------------------------
B8D0L3_HALOH/359-505--------------------------------------------------------------------------------
B8D178_HALOH/340-478--------------------------------------------------------------------------------
B8DHB8_LISMH/370-518--------------------------------------------------------------------------------
B8IEZ7_METNO/324-461--------------------------------------------------------------------------------
B8IGJ3_METNO/336-472--------------------------------------------------------------------------------
B9CVC4_STACP/347-489--------------------------------------------------------------------------------
B9DSP4_STRU0/342-480--------------------------------------------------------------------------------
B9E7H2_MACCJ/374-522--------------------------------------------------------------------------------
B9E8U7_MACCJ/341-481--------------------------------------------------------------------------------
B9JKJ2_AGRRK/321-464--------------------------------------------------------------------------------
B9K2D6_AGRVS/332-468--------------------------------------------------------------------------------
C0QCL2_DESAH/352-496--------------------------------------------------------------------------------
C0WBK9_9FIRM/378-517--------------------------------------------------------------------------------
C0WLU0_LACBU/374-518--------------------------------------------------------------------------------
C0WQN7_LACBU/354-501--------------------------------------------------------------------------------
C0WUG9_LACBU/378-530--------------------------------------------------------------------------------
C0WVB1_LACFE/322-460--------------------------------------------------------------------------------
C0X1V9_ENTFL/370-519--------------------------------------------------------------------------------
C0X279_ENTFL/382-530--------------------------------------------------------------------------------
C0X942_ENTFL/359-507--------------------------------------------------------------------------------
C0Z9G8_BREBN/364-513--------------------------------------------------------------------------------
C0ZAP4_BREBN/363-505--------------------------------------------------------------------------------
C0ZHE2_BREBN/367-517--------------------------------------------------------------------------------
C1I2F0_9CLOT/325-463--------------------------------------------------------------------------------
C1IAW5_9CLOT/354-498--------------------------------------------------------------------------------
C2D643_LACBR/210-348--------------------------------------------------------------------------------
C2E7U4_LACJH/384-532--------------------------------------------------------------------------------
C2EED2_9LACO/381-529--------------------------------------------------------------------------------
C2EHH6_9LACO/356-502--------------------------------------------------------------------------------
C2EP42_9LACO/342-483--------------------------------------------------------------------------------
C2H7P1_ENTFC/381-529--------------------------------------------------------------------------------
C2HEH9_ENTFC/359-507--------------------------------------------------------------------------------
C2KAZ9_9LACO/380-528--------------------------------------------------------------------------------
C2KJQ1_LEUMC/329-467--------------------------------------------------------------------------------
C2KKY7_LEUMC/498-647--------------------------------------------------------------------------------
C2LQ70_STRSL/432-580--------------------------------------------------------------------------------
C2M158_STAHO/360-502--------------------------------------------------------------------------------
C2YMP0_BACCE/352-495--------------------------------------------------------------------------------
C3HRG9_BACTU/323-461--------------------------------------------------------------------------------
C4FB42_9ACTN/325-467--------------------------------------------------------------------------------
C4FNY8_9FIRM/361-503--------------------------------------------------------------------------------
C4FPR1_9FIRM/359-501--------------------------------------------------------------------------------
C4FUC9_9FIRM/947-1095--------------------------------------------------------------------------------
C4G0V0_ABIDE/374-518--------------------------------------------------------------------------------
C4GB38_9FIRM/387-530--------------------------------------------------------------------------------
C4RGH8_9ACTO/364-502--------------------------------------------------------------------------------
C4V2B6_9FIRM/374-517--------------------------------------------------------------------------------
C4XGJ8_DESMR/335-465--------------------------------------------------------------------------------
C5A2Y0_THEGJ/342-480--------------------------------------------------------------------------------
C5D378_GEOSW/360-505--------------------------------------------------------------------------------
C5NWI0_9BACL/318-458--------------------------------------------------------------------------------
C5Q1B2_STAAU/332-469--------------------------------------------------------------------------------
C5RB06_WEIPA/501-648--------------------------------------------------------------------------------
C5RD31_WEIPA/359-505--------------------------------------------------------------------------------
C6A0B5_THESM/328-456--------------------------------------------------------------------------------
C6CSD9_PAESJ/327-465--------------------------------------------------------------------------------
C6J0R0_9BACL/364-511--------------------------------------------------------------------------------
C6JQC3_FUSVA/323-462--------------------------------------------------------------------------------
C6PQD8_9CLOT/131-275--------------------------------------------------------------------------------
C6SP25_STRMN/377-525--------------------------------------------------------------------------------
C6VKW0_LACPJ/357-507--------------------------------------------------------------------------------
C7GE86_9FIRM/383-527--------------------------------------------------------------------------------
C7GYH1_9FIRM/373-517--------------------------------------------------------------------------------
C7NM90_HALUD/327-463--------------------------------------------------------------------------------
C7NSL6_HALUD/319-457--------------------------------------------------------------------------------
C7NSR3_HALUD/331-469--------------------------------------------------------------------------------
C7P069_HALMD/318-461--------------------------------------------------------------------------------
C7XZJ3_9LACO/375-523--------------------------------------------------------------------------------
C8NE09_9LACT/413-561--------------------------------------------------------------------------------
C8NI78_9LACT/366-514--------------------------------------------------------------------------------
C8PCY7_9LACO/375-523--------------------------------------------------------------------------------
C8VXJ1_DESAS/366-509--------------------------------------------------------------------------------
C8WQG9_ALIAD/361-502--------------------------------------------------------------------------------
C9A2J3_ENTGA/381-529--------------------------------------------------------------------------------
C9A420_ENTGA/359-508--------------------------------------------------------------------------------
C9L817_RUMHA/12-160--------------------------------------------------------------------------------
C9LAR2_RUMHA/325-463--------------------------------------------------------------------------------
C9LLX4_9FIRM/363-506--------------------------------------------------------------------------------
D0BKY7_9LACT/382-530--------------------------------------------------------------------------------
D0BM46_9LACT/352-499--------------------------------------------------------------------------------
D0BME9_9LACT/319-458--------------------------------------------------------------------------------
D0LQE6_HALO1/374-513--------------------------------------------------------------------------------
D1Z261_METPS/328-462--------------------------------------------------------------------------------
D2BMG7_LACLK/323-465--------------------------------------------------------------------------------
D2EHX4_PEDAC/355-503--------------------------------------------------------------------------------
D2EJ27_PEDAC/321-459--------------------------------------------------------------------------------
D2ELV8_PEDAC/393-541--------------------------------------------------------------------------------
D2RVV2_HALTV/336-474--------------------------------------------------------------------------------
D2RXY9_HALTV/340-478--------------------------------------------------------------------------------
D3AN52_9CLOT/376-519--------------------------------------------------------------------------------
D3E759_GEOS4/381-532--------------------------------------------------------------------------------
D3FFB8_CONWI/338-471--------------------------------------------------------------------------------
D3FR13_BACPE/361-509--------------------------------------------------------------------------------
D3FXP2_BACPE/374-522--------------------------------------------------------------------------------
D3FZH8_BACPE/357-501--------------------------------------------------------------------------------
D3LVV9_9FIRM/358-500--------------------------------------------------------------------------------
D3LX29_9FIRM/358-500--------------------------------------------------------------------------------
D3QG68_STALH/343-485--------------------------------------------------------------------------------
D3SSH7_NATMM/337-474--------------------------------------------------------------------------------
D3STC0_NATMM/337-475--------------------------------------------------------------------------------
D3UNL4_LISSS/370-518--------------------------------------------------------------------------------
D4G1Q3_BACNA/318-464--------------------------------------------------------------------------------
D4G3E4_BACNA/359-505--------------------------------------------------------------------------------
D4GU68_HALVD/319-457--------------------------------------------------------------------------------
D4LGF1_9FIRM/327-469--------------------------------------------------------------------------------
D4W1F1_9FIRM/338-485--------------------------------------------------------------------------------
D4W2K6_9FIRM/377-526--------------------------------------------------------------------------------
D4YGG7_9LACT/385-532--------------------------------------------------------------------------------
D4YJ56_9LACT/433-583--------------------------------------------------------------------------------
D4YX22_SPHJU/336-476--------------------------------------------------------------------------------
D5D970_BACMD/362-511--------------------------------------------------------------------------------
D5DN36_BACMD/374-521--------------------------------------------------------------------------------
D5DY76_BACMQ/331-468--------------------------------------------------------------------------------
D5E4C9_BACMQ/373-523--------------------------------------------------------------------------------
D5QEL1_GLUHA/351-483--------------------------------------------------------------------------------
D5T1U4_LEUKI/363-511--------------------------------------------------------------------------------
D5TQD2_BACT1/321-460--------------------------------------------------------------------------------
D5UPU7_TSUPD/350-482--------------------------------------------------------------------------------
D5VU50_METIM/353-494--------------------------------------------------------------------------------
D5WSL0_BACT2/373-521--------------------------------------------------------------------------------
D5X9J9_THEPJ/361-503--------------------------------------------------------------------------------
D5XD05_THEPJ/326-457--------------------------------------------------------------------------------
D6KSV4_SCAIO/332-470--------------------------------------------------------------------------------
D6XV50_BACIE/360-507--------------------------------------------------------------------------------
D6Y0K7_BACIE/382-530--------------------------------------------------------------------------------
D7BDH0_MEISD/336-473--------------------------------------------------------------------------------
D7D534_GEOSC/329-466--------------------------------------------------------------------------------
D7DRX9_METV3/353-490--------------------------------------------------------------------------------
D7E977_METEZ/332-466--------------------------------------------------------------------------------
D7UUI0_LISGR/356-499--------------------------------------------------------------------------------
D7WQC4_9BACI/353-489--------------------------------------------------------------------------------
D8GMK0_CLOLD/327-460--------------------------------------------------------------------------------
D8ILC9_LACSC/25-170--------------------------------------------------------------------------------
D8J472_HALJB/339-477--------------------------------------------------------------------------------
D8J725_HALJB/340-478--------------------------------------------------------------------------------
D8J7W8_HALJB/319-457--------------------------------------------------------------------------------
D8MET9_LEUGT/321-460--------------------------------------------------------------------------------
D8PBA0_9BACT/336-473--------------------------------------------------------------------------------
D9PYX0_METTM/350-483--------------------------------------------------------------------------------
D9QSV7_ACEAZ/363-507--------------------------------------------------------------------------------
E0I7A7_9BACL/353-491--------------------------------------------------------------------------------
E0IFR0_9BACL/366-514--------------------------------------------------------------------------------
E0NHN4_PEDAC/321-459--------------------------------------------------------------------------------
E0PD92_STREI/325-464--------------------------------------------------------------------------------
E0RCM4_PAEP6/382-529--------------------------------------------------------------------------------
E0RM54_PAEP6/373-525--------------------------------------------------------------------------------
E0RMQ1_PAEP6/366-508--------------------------------------------------------------------------------
E0RUK9_BUTPB/373-516--------------------------------------------------------------------------------
E0S188_BUTPB/322-462--------------------------------------------------------------------------------
E1IAS8_9CHLR/378-523--------------------------------------------------------------------------------
E1IEK9_9CHLR/380-529--------------------------------------------------------------------------------
E2ZD67_9FIRM/360-502--------------------------------------------------------------------------------
E3CI47_STRDO/375-523--------------------------------------------------------------------------------
E3FNG9_STIAD/347-485--------------------------------------------------------------------------------
E3GGE0_EUBLK/365-508--------------------------------------------------------------------------------
E3GZ73_METFV/328-459--------------------------------------------------------------------------------
E4KNA5_9LACT/790-938--------------------------------------------------------------------------------
E4L4W5_9STRE/321-459--------------------------------------------------------------------------------
E4LZJ6_9CLOT/384-531--------------------------------------------------------------------------------
E4MLQ7_9FIRM/372-517--------------------------------------------------------------------------------
E4NUG7_HALBP/319-458--------------------------------------------------------------------------------
E4SMU5_LACAR/327-469--------------------------------------------------------------------------------
E5WAE4_9BACI/356-502--------------------------------------------------------------------------------
E5WT44_9BACI/362-510--------------------------------------------------------------------------------
E5X0H2_9BACE/326-464--------------------------------------------------------------------------------
E5Z458_9BACL/362-509--------------------------------------------------------------------------------
E6LD53_9ENTE/253-391--------------------------------------------------------------------------------
E6LEY4_9ENTE/358-506--------------------------------------------------------------------------------
E6LIJ6_9ENTE/381-529--------------------------------------------------------------------------------
E6LN70_9FIRM/381-525--------------------------------------------------------------------------------
E6MFC3_9FIRM/328-466--------------------------------------------------------------------------------
E6MGM4_9FIRM/373-516--------------------------------------------------------------------------------
E6QMG7_9ZZZZ/367-517--------------------------------------------------------------------------------
E6TRQ4_BACCJ/362-512--------------------------------------------------------------------------------
E6U1Q3_BACCJ/375-523--------------------------------------------------------------------------------
E7FPH6_9LACO/355-501--------------------------------------------------------------------------------
E7MM58_9FIRM/379-526--------------------------------------------------------------------------------
E7QQ57_9EURY/339-477--------------------------------------------------------------------------------
E7RE43_9BACL/368-516--------------------------------------------------------------------------------
E7RL93_9BACL/356-500--------------------------------------------------------------------------------
E7RLD1_9BACL/354-503--------------------------------------------------------------------------------
E7RZY6_9BURK/339-474--------------------------------------------------------------------------------
E7S3G0_STRAG/321-467--------------------------------------------------------------------------------
E8JWJ5_STRCR/327-467--------------------------------------------------------------------------------
E8K660_STRPA/410-558--------------------------------------------------------------------------------
E8LB44_9FIRM/369-509--------------------------------------------------------------------------------
E8R8C0_DESM0/349-487--------------------------------------------------------------------------------
E8RTH0_ASTEC/331-467--------------------------------------------------------------------------------
E8SIP0_STAPH/344-486--------------------------------------------------------------------------------
E8V165_TERSS/339-475--------------------------------------------------------------------------------
E9RY62_9FIRM/330-468--------------------------------------------------------------------------------
F0DJ09_9FIRM/357-499--------------------------------------------------------------------------------
F0EKD4_ENTCA/327-465--------------------------------------------------------------------------------
F0HVE0_LACDL/327-469--------------------------------------------------------------------------------
F0KAR0_CLOAE/326-458--------------------------------------------------------------------------------
F0LLW6_THEBM/342-478--------------------------------------------------------------------------------
F0LLZ4_THEBM/339-477--------------------------------------------------------------------------------
F0T719_METSL/333-463--------------------------------------------------------------------------------
F0TB30_METSL/351-484--------------------------------------------------------------------------------
F0TBQ9_METSL/329-463--------------------------------------------------------------------------------
F0TC71_METSL/328-460--------------------------------------------------------------------------------
F1VXT7_9BURK/320-462--------------------------------------------------------------------------------
F1Z193_9STRE/350-488--------------------------------------------------------------------------------
F2F183_SOLSS/360-508--------------------------------------------------------------------------------
F2G999_ALTMD/323-469--------------------------------------------------------------------------------
F2I7P9_AERUA/374-520--------------------------------------------------------------------------------
F2JLQ5_CELLD/355-497--------------------------------------------------------------------------------
F2KQE3_ARCVS/343-481--------------------------------------------------------------------------------
F2NHK3_DESAR/367-498--------------------------------------------------------------------------------
F2NKF2_MARHT/337-483--------------------------------------------------------------------------------
O06039_LACLC/321-459--------------------------------------------------------------------------------
O26442_METTH/329-460--------------------------------------------------------------------------------
Q03E00_PEDPA/355-503--------------------------------------------------------------------------------
Q03RI1_LACBA/378-525--------------------------------------------------------------------------------
Q03SZ7_LACBA/349-498--------------------------------------------------------------------------------
Q03XR0_LEUMM/330-477--------------------------------------------------------------------------------
Q0AHL3_NITEC/325-466--------------------------------------------------------------------------------
Q0AP11_MARMM/327-464--------------------------------------------------------------------------------
Q0W809_UNCMA/331-464--------------------------------------------------------------------------------
Q12TY8_METBU/325-459--------------------------------------------------------------------------------
Q12VM9_METBU/345-483--------------------------------------------------------------------------------
Q12XY4_METBU/326-458--------------------------------------------------------------------------------
Q18GU8_HALWD/357-496--------------------------------------------------------------------------------
Q1GPL1_SPHAL/342-484--------------------------------------------------------------------------------
Q1K412_DESAC/351-495--------------------------------------------------------------------------------
Q2B249_9BACI/362-508--------------------------------------------------------------------------------
Q2NH55_METST/331-464--------------------------------------------------------------------------------
Q2NIB6_METST/328-458--------------------------------------------------------------------------------
Q2S953_HAHCH/328-463--------------------------------------------------------------------------------
Q2Y4J6_9ARCH/377-524--------------------------------------------------------------------------------
Q2YCC1_NITMU/331-475--------------------------------------------------------------------------------
Q2YCG5_NITMU/323-466--------------------------------------------------------------------------------
Q38V74_LACSS/358-503--------------------------------------------------------------------------------
Q38VP9_LACSS/378-526--------------------------------------------------------------------------------
Q3ADH7_CARHZ/346-484--------------------------------------------------------------------------------
Q3APG3_CHLCH/338-477--------------------------------------------------------------------------------
Q3B6G9_PELLD/337-476--------------------------------------------------------------------------------
Q3ZK40_9LACT/322-460--------------------------------------------------------------------------------
Q469G3_METBF/349-484--------------------------------------------------------------------------------
Q46FX4_METBF/329-461--------------------------------------------------------------------------------
Q47U72_COLP3/338-482--------------------------------------------------------------------------------
Q49V13_STAS1/337-479--------------------------------------------------------------------------------
Q4JYJ9_STRPN/323-464--------------------------------------------------------------------------------
Q4JZ09_STRPN/330-470--------------------------------------------------------------------------------
Q4K189_STRPN/323-460--------------------------------------------------------------------------------
Q5JDW0_PYRKO/345-480--------------------------------------------------------------------------------
Q5LFL1_BACFN/328-466--------------------------------------------------------------------------------
Q5M4A4_STRT2/55-193--------------------------------------------------------------------------------
Q5V4U1_HALMA/327-465--------------------------------------------------------------------------------
Q5WAF7_BACSK/347-496--------------------------------------------------------------------------------
Q5WE75_BACSK/374-522--------------------------------------------------------------------------------
Q67JD5_SYMTH/384-522--------------------------------------------------------------------------------
Q8EP19_OCEIH/372-521--------------------------------------------------------------------------------
Q8EU30_OCEIH/362-509--------------------------------------------------------------------------------
Q8GPE5_STRTR/321-459--------------------------------------------------------------------------------
Q97AA3_THEVO/339-476--------------------------------------------------------------------------------
Q9KGJ0_BACHD/361-507--------------------------------------------------------------------------------

PF03023

MURJ_BORBU/29-473FSYYFGANLDADIFNYVFNIPNNLRKILS..EGAMTSAFLPEFTHEK.N......KSHEKAVSFFRTVITFNIISIGLIV
MURJ_RICPR/28-477IASLFGSTPMGDSMNIAFKLPNLFRRIFA..EGALSSVFIPIYNEKM.L......ISKKAANNFSGKVFTLLSLTLIVII
MURJ_ECOLI/28-479VARIFGAGMATDAFFVAFKLPNLLRRIFA..EGAFSQAFVPILAEYKSK......QGEDATRVFVSYVSGLLTLALAVVT
MURJ_RHITR/28-484MAAALGTGPMADVFYAAFRFPNLFRRLFA..EGAFNAAFVPLFAKEIEA......NGIDGAKRFSEEVFGVLFSVLLLIT
MURJ_CHLPN/35-484MATYFGADPIVAAFWLGFRTVFFLRKILG..GLILEQAFIPHFEFLR.A......QSLDRAAFFFRRFSRLIKGSTIIFT
MURJ_SYNY3/36-495IAAAFGVGTVVTAYAYAYVIPGFLFILLGGINGPFHSALVSVLSKRD..........REEAAPLVETVTTLVSGVLLGVT
MURJ_AQUAE/29-466VAYYFGASAVSDAFFIAFRIPNAFRRIFG..EGGFNAVFIPFYGEAV.........KQNREEEFLRKTFGLLITFSLSVV
MURJ_HAEIN/16-479IAHLIGAGAAADVFLFANRIPNFLRRLFA..EGAFSQAFVPVLAEYQQS......GDMNKTREFIGKVSGTLGGLVSIVT
MURJ_THEMA/28-450LAKTFGASSTLDAYYVSIVFPFFLRRTFA..EGAMSSAFMAIYKKLK.........NKEEKAQFTSAVLTSLGLVTLLIV
MURJ_HELPJ/1-458MANILGAGVYSDIFFVAFKLPNLFRRIFA..EGSFSQSFLPSFIRSS........IKGGFASLVGLIFCGVLFMWCLLVA
Q9X8T0_STRCO/300-778IVSALGVGLLGDTFQVAYQLPTMIYILTV..GGGLNSVFVPQLVRAMKD.......DEDGGEAFANRLLTLVMVALGALT
MURJ_TREPA/32-489KSTLMGTSATADAFTVAFMIPNLFRRLFA..ENAISVAFIPVFTQHYSMPSSAQVPCSSKTKEFLSAIFTLMSSVTASIS
Q9RX17_DEIRA/83-522IN..LFDTTLTDAFNVAIKVPNLMRELLA..EGALVNSFIPVYKTLD..........AAERRKLAQSFSGFLIAINLLLM
MURJ_CHLTR/34-482MATYFGADPLVASFWLAFRTIFFLRKLLG..GPILGLAFIPHFEFLR.A......QNISRATFFFRSFSRFFCYSAILFT
O05435_MYCTU/48-522LAAILGAALASS.FSVANQLPNLVAALVL..EATFTAIFVPVLARAEQD.......DPDGGAAFVRRLVTLATTLLLGAT

PF13440

D0I1Y2_VIBCL/18-260--------------------------------------------------------------------------------
D0HB98_VIBMI/18-260--------------------------------------------------------------------------------
A8UQ25_9FLAO/16-256--------------------------------------------------------------------------------
Q4JBJ6_SULAC/28-278--------------------------------------------------------------------------------
Q2YCG5_NITMU/22-272--------------------------------------------------------------------------------
C8XCC3_NAKMY/40-272--------------------------------------------------------------------------------
Q3K9H6_PSEPF/12-267--------------------------------------------------------------------------------
O58733_PYRHO/24-254--------------------------------------------------------------------------------
Q1D7B4_MYXXD/29-283--------------------------------------------------------------------------------
C4WNX8_9RHIZ/31-284--------------------------------------------------------------------------------
A6X6T8_OCHA4/16-269--------------------------------------------------------------------------------
B1M5Z3_METRJ/17-264--------------------------------------------------------------------------------
A1UCH8_MYCSK/30-289--------------------------------------------------------------------------------
Q1BCG5_MYCSS/30-289--------------------------------------------------------------------------------
A3PW68_MYCSJ/30-289--------------------------------------------------------------------------------
Q0RPT3_FRAAA/322-573--------------------------------------------------------------------------------
Q0RCF1_FRAAA/179-430--------------------------------------------------------------------------------
D3CWT1_9ACTO/203-455--------------------------------------------------------------------------------
Q8KN00_9ACTO/40-289--------------------------------------------------------------------------------
Q9RJJ1_STRCO/34-283--------------------------------------------------------------------------------
D2PZ16_KRIFD/24-275--------------------------------------------------------------------------------
C8XCR8_NAKMY/39-289--------------------------------------------------------------------------------
A4FEI7_SACEN/8-256--------------------------------------------------------------------------------
A9VW94_METEP/42-293--------------------------------------------------------------------------------
B7KU42_METC4/42-293--------------------------------------------------------------------------------
C7C8V6_METED/42-293--------------------------------------------------------------------------------
C5ATW3_METEA/42-293--------------------------------------------------------------------------------
C7LVX3_DESBD/8-264--------------------------------------------------------------------------------
Q2CIK8_9RHOB/14-260--------------------------------------------------------------------------------
Q89SM5_BRAJA/14-270--------------------------------------------------------------------------------
C8KY87_9PAST/18-266--------------------------------------------------------------------------------
C5RZU1_9PAST/18-266--------------------------------------------------------------------------------
A9AXJ4_HERA2/36-280--------------------------------------------------------------------------------
D0YZQ3_LISDA/18-261--------------------------------------------------------------------------------
D2BRK8_DICD5/18-261--------------------------------------------------------------------------------
B1IZZ3_ECOLC/18-261--------------------------------------------------------------------------------
B9JQS0_AGRRK/94-340--------------------------------------------------------------------------------
Q676G9_RHIRD/94-340--------------------------------------------------------------------------------
B5JNG5_9BACT/22-272--------------------------------------------------------------------------------
A6VTF9_MARMS/19-265--------------------------------------------------------------------------------
B9EAW7_MACCJ/18-258--------------------------------------------------------------------------------
C2KV49_9FIRM/32-288--------------------------------------------------------------------------------
A4EAS6_9ACTN/45-291--------------------------------------------------------------------------------
A6Q4F3_NITSB/16-266--------------------------------------------------------------------------------
Q8EFK4_SHEON/26-281--------------------------------------------------------------------------------
A6WPP6_SHEB8/25-280--------------------------------------------------------------------------------
A1RKH9_SHESW/25-280--------------------------------------------------------------------------------
A4Y617_SHEPC/25-280--------------------------------------------------------------------------------
E6XI49_SHEP2/25-280--------------------------------------------------------------------------------
A6FGK5_9GAMM/27-282--------------------------------------------------------------------------------
B8CST1_SHEPW/46-301--------------------------------------------------------------------------------
A8UIN6_9FLAO/18-257--------------------------------------------------------------------------------

PF01943

SP5B_BACSU/6-308--------------------------------------------------------------------------------
CAPF_STAAU/1-264--------------------------------------------------------------------------------
O87185_STRAG/6-275--------------------------------------------------------------------------------
EXOT_RHIME/10-277--------------------------------------------------------------------------------
TUAB_BACSU/10-277--------------------------------------------------------------------------------
O06039_LACLC/3-269--------------------------------------------------------------------------------
RFBX_ECOLI/8-279--------------------------------------------------------------------------------
YCP11_KLEPN/9-277--------------------------------------------------------------------------------
RFBE_SHIFL/3-283--------------------------------------------------------------------------------
O58158_PYRHO/7-277--------------------------------------------------------------------------------
O26447_METTH/15-286--------------------------------------------------------------------------------
YTGP_BACSU/5-320--------------------------------------------------------------------------------
Y1068_METJA/7-302--------------------------------------------------------------------------------
Q56865_YEREN/18-287--------------------------------------------------------------------------------
Q56913_YEREN/4-274--------------------------------------------------------------------------------
O07870_STRPN/6-276--------------------------------------------------------------------------------
O58127_PYRHO/9-279--------------------------------------------------------------------------------
O86895_STRPN/3-267--------------------------------------------------------------------------------
O07342_STRPN/5-273--------------------------------------------------------------------------------
Y1375_METJA/3-283--------------------------------------------------------------------------------
O52526_RHILT/10-273--------------------------------------------------------------------------------
Q56776_XANCA/21-288--------------------------------------------------------------------------------
O26479_METTH/10-276--------------------------------------------------------------------------------
P74815_9SPHN/37-317--------------------------------------------------------------------------------
O29660_ARCFU/6-285--------------------------------------------------------------------------------
O26467_METTH/18-289--------------------------------------------------------------------------------
O26442_METTH/7-278--------------------------------------------------------------------------------
YABM_BACSU/12-309--------------------------------------------------------------------------------
WZXC_ECOLI/9-276--------------------------------------------------------------------------------
O85002_STRPN/7-276--------------------------------------------------------------------------------
RFBX_SHIDY/1-270--------------------------------------------------------------------------------

PF01554

C5W5G6_ECOBD/100-262--------------------------------------------------------------------------------
C5W5G6_ECOBD/330-491--------------------------------------------------------------------------------
O51531_BORBU/22-182--------------------------------------------------------------------------------
YOEA_BACSU/28-189--------------------------------------------------------------------------------
YOEA_BACSU/257-418--------------------------------------------------------------------------------
O66528_AQUAE/245-406--------------------------------------------------------------------------------
YPNP_BACSU/241-402--------------------------------------------------------------------------------
NORM_VIBPA/243-404--------------------------------------------------------------------------------
O80695_ARATH/278-441--------------------------------------------------------------------------------
O26414_METTH/244-409--------------------------------------------------------------------------------
O33729_STRPN/24-185--------------------------------------------------------------------------------
O59471_PYRHO/14-174--------------------------------------------------------------------------------
O28801_ARCFU/21-180--------------------------------------------------------------------------------
YISQ_BACSU/27-187--------------------------------------------------------------------------------
Y709_METJA/243-408--------------------------------------------------------------------------------
YPNP_BACSU/21-182--------------------------------------------------------------------------------
O25454_HELPY/214-375--------------------------------------------------------------------------------
NORM_BACSU/20-180--------------------------------------------------------------------------------
HMRM_HAEIN/249-410--------------------------------------------------------------------------------
O49713_ARATH/195-358--------------------------------------------------------------------------------
O49660_ARATH/262-426--------------------------------------------------------------------------------
O82752_ARATH/42-203--------------------------------------------------------------------------------
DINF_ECOLI/35-196--------------------------------------------------------------------------------
O23067_ARATH/280-459--------------------------------------------------------------------------------
Q9ZK32_HELPJ/23-184--------------------------------------------------------------------------------
Q9ZVH5_ARATH/238-401--------------------------------------------------------------------------------
O28801_ARCFU/239-404--------------------------------------------------------------------------------
O58340_PYRHO/26-186--------------------------------------------------------------------------------
Q38956_ARATH/275-438--------------------------------------------------------------------------------
O58340_PYRHO/247-408--------------------------------------------------------------------------------
O33729_STRPN/246-408--------------------------------------------------------------------------------
ERC1_YEAST/174-335--------------------------------------------------------------------------------
Q9ZVH5_ARATH/16-176--------------------------------------------------------------------------------
O80785_ARATH/37-197--------------------------------------------------------------------------------
O73981_PYRHO/41-201--------------------------------------------------------------------------------
O59471_PYRHO/238-404--------------------------------------------------------------------------------
YAO6_SCHPO/17-177--------------------------------------------------------------------------------
O82752_ARATH/264-427--------------------------------------------------------------------------------
O51429_BORBU/27-187--------------------------------------------------------------------------------
O83871_TREPA/32-196--------------------------------------------------------------------------------
O51429_BORBU/248-409--------------------------------------------------------------------------------
O23067_ARATH/98-258--------------------------------------------------------------------------------
YISQ_BACSU/252-413--------------------------------------------------------------------------------
O66528_AQUAE/25-183--------------------------------------------------------------------------------
O51530_BORBU/21-181--------------------------------------------------------------------------------
Y709_METJA/21-181--------------------------------------------------------------------------------
NORM_BACSU/247-408--------------------------------------------------------------------------------
NORM_VIBPA/17-176--------------------------------------------------------------------------------
O26414_METTH/24-183--------------------------------------------------------------------------------
HMRM_HAEIN/22-181--------------------------------------------------------------------------------
YD338_YEAST/238-397--------------------------------------------------------------------------------
O73981_PYRHO/262-424--------------------------------------------------------------------------------
MDTK_ECOLI/17-177--------------------------------------------------------------------------------
Q38956_ARATH/55-215--------------------------------------------------------------------------------
P71616_MYCTU/19-179--------------------------------------------------------------------------------
O49660_ARATH/40-200--------------------------------------------------------------------------------
O80695_ARATH/57-217--------------------------------------------------------------------------------
MDTK_ECOLI/244-405--------------------------------------------------------------------------------

PF04506

RFT1_SCHPO/9-527QSSSKGLRSSIFFQGSSRILTFFLNQLTIRLTSPSAYAFSSIHFEILQSTILFLSRESVRLAMQRIPSEN..AIITSTST
RFT1_DROME/7-556ESSLLGAGFSIIFQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAINRAALSANAQQ...GDRCSWA
RFT1_CAEEL/1-519MSLFSSLVHNVRGQLIARIISFAINMYLLRRINNDVLGLVNVRLTLLYSSILFLTREPLRKAEIIRGSLP..........
RFT1_YEAST/17-572ERSTTGATFLMMGQLFTKLVTFILNNLLIRFLSPRIFGIT.AFLEFIQGTVLFFSRDAIRLSTLRISDSGNGIIDDDDEE

PF14667

A0AF13_LISW6/361-504--------------------------------------VLQLFMPAVF----------LS.SLI.V.M.L.S.-...S.I
A0NHL2_OENOE/387-534--------------------------------------LLKVSAIVAI----------FF.GHF.T.I.L.S.-...F.I
A0RJU4_BACAH/372-520--------------------------------------VLMWYAPVAL----------LF.ALF.T.V.T.A.-...A.I
A1ASY9_PELPD/345-481--------------------------------------LVPYVSLSVL----------VA.GII.Y.K.Y.K.-...L.G
A1BJ49_CHLPD/337-476--------------------------------------VLTILAATAL----------VQ.ALT.G.I.S.G.-...T.V
A1HLQ5_9FIRM/371-513--------------------------------------VVSVLAVSVY----------LL.GLH.Q.T.T.T.-...G.V
A1ILY9_STROR/319-458--------------------------------------AIAIMIFRMF----------FI.GWT.N.I.M.G.-..IQ.I
A1S103_THEPD/335-472--------------------------------------YLSLYSASLL----------LS.GLG.T.AAL.P.-...S.F
A1YVF6_LACJH/321-459--------------------------------------AMMIESIVIL----------II.AWS.N.V.I.G.-..VQ.Y
A2RG74_STRPG/377-525--------------------------------------LFVAVLFQTL----------LL.ALY.T.L.F.S.-...P.M
A2RHU4_LACLM/321-459--------------------------------------LLMMEAPIII----------FI.AWS.N.V.L.G.-..IQ.Y
A2RMM4_LACLM/390-539--------------------------------------LFVFAILQTF----------LL.GLY.M.I.V.Y.-...P.P
A2STD2_METLZ/331-469--------------------------------------VCSILFIMQI----------IS.VFT.L.L.L.G.-...V.A
A3CPL5_STRSV/375-523--------------------------------------LFIFAMLQTI----------IL.SLY.T.V.L.A.-...P.M
A3CVY7_METMJ/333-471--------------------------------------ALAILLLVQV----------AH.VFM.F.L.Q.T.-...M.C
A3DHV8_CLOTH/327-465--------------------------------------FLQIFCMSYM----------FM.PFH.T.A.N.L.-...E.A
A3DIV8_CLOTH/358-500--------------------------------------ILYLLSFTGI----------FI.YLQ.Q.T.L.L.-...G.I
A3F4D6_LACLC/321-459--------------------------------------VLMIESIAII----------FI.AWS.NAI.G.T.-...Q.Y
A3I8W7_9BACI/372-521--------------------------------------ILAHYAPVAI----------LF.ALF.Q.V.T.A.-...A.L
A3IEA1_9BACI/365-514--------------------------------------VLIVYVFQIV----------PL.SII.L.T.F.T.-...A.I
A3W1Y0_9RHOB/329-468--------------------------------------LLSILAVAAA----------VS.APL.Y.F.N.Q.-...P.L
A4FX93_METM5/354-492--------------------------------------PMKILSIGAI----------FL.TLN.T.I.G.F.-...S.V
A4IJD3_GEOTN/352-496--------------------------------------VLAVLSASVF----------FT.TMA.L.T.S.S.-...A.M
A4IRX9_GEOTN/371-520--------------------------------------VLRWYAPAAI----------LY.ALF.S.V.T.S.-...A.I
A4SCQ1_PROVI/337-476--------------------------------------ALVLLSGAAL----------LQ.AFF.G.M.A.A.-...T.L
A4VW05_STRSY/379-527--------------------------------------LFIWNLFLIL----------PL.GLY.S.V.I.S.-...V.V
A5D2G5_PELTS/358-502--------------------------------------SLEVLAVGGP----------FL.YVQ.Q.T.T.T.-...G.I
A5ITS6_STAA9/386-533--------------------------------------LLFYYAPVAI----------LI.SLL.S.V.T.A.-...S.M
A5LCT3_STRPN/372-520--------------------------------------LFVFAVLQSI----------IL.GLY.M.V.L.S.-...P.M
A5M4K0_STRPN/211-349--------------------------------------LIAAMAPVFV----------FS.VPG.N.I.IRT.-...Q.Y
A5UNI7_METS3/328-460--------------------------------------VLKILIWTVC----------FL.FIN.G.A.C.S.-...M.I
A5UQJ1_ROSS1/330-463--------------------------------------VLQILIWSFV----------FT.TLL.V.P.G.G.-...R.L
A5UWW7_ROSS1/374-505--------------------------------------ALAILIWYLP----------LS.YAN.G.V.T.Q.-...Y.V
A5VL26_LACRD/382-530--------------------------------------VLQFAAYISI----------ML.GLY.T.V.A.A.-...A.M
A5ZUX1_9FIRM/326-464--------------------------------------IMRILSPNII----------FA.VMN.G.F.L.A.-..YQ.I
A6CQJ8_9BACI/372-520--------------------------------------VLRTYAPVAI----------LF.ALF.A.V.T.A.-...A.I
A6CR25_9BACI/352-499--------------------------------------VIAVFCLSIL----------FS.SVI.L.T.I.S.-...A.I
A6DHF1_9BACT/293-436--------------------------------------ICALLCLNFF----------MS.GLI.N.L.V.G.-...T.F
A6NPI5_9FIRM/351-494--------------------------------------YMVPLSVGVL----------LS.CYQ.S.V.L.S.-...G.V
A6QEF7_STAAE/343-485--------------------------------------TLSVYMITVI----------CV.SLI.M.M.D.M.-...A.L
A6TN15_ALKMQ/363-506--------------------------------------ILSVLAINVV----------FI.SLA.Q.S.L.T.-...S.I
A6TSY6_ALKMQ/375-519--------------------------------------YLSIISYGTL----------FL.CMQ.H.T.I.S.-...G.I
A6UPA0_METVS/351-488--------------------------------------PMSILSFGIV----------FL.SMN.N.I.V.F.-...N.V
A6UU30_META3/353-490--------------------------------------AIRILSLGTV----------FM.TLN.G.I.G.F.-...T.V
A7GJW7_BACCN/360-506--------------------------------------VLAILAISIL----------FS.SLS.I.T.T.A.-...S.I
A7HKJ9_FERNB/322-460--------------------------------------LIVYITPIIL----------FI.SWS.N.L.F.G.-..IQ.I
A7VPC0_9CLOT/355-497--------------------------------------YLSVLAPVIP----------LM.YLD.S.V.V.D.-...G.M
A7VWY4_9CLOT/433-577--------------------------------------VLVILGIAAI----------FT.STS.T.P.L.C.-...S.M
A7Z0I0_BACA2/354-499--------------------------------------TLQIFSLSIF----------FA.SIA.L.T.A.A.-...A.I
A7Z7U6_BACA2/375-524--------------------------------------ILFWYAPVAI----------LF.SLF.T.V.N.A.-...A.I
A8F924_BACP2/360-506--------------------------------------ALQIFCISIA----------FT.SIA.I.T.Q.A.-...A.L
A8MIG9_ALKOO/365-508--------------------------------------ILRILSFNVI----------FI.SIG.Q.I.L.G.-...S.I
A8MK38_ALKOO/363-506--------------------------------------VLLFLSFATF----------SL.CMV.Q.T.L.T.-...G.I
A8RUL6_9CLOT/387-539--------------------------------------LSMAGSLAVV----------FY.SLS.T.V.T.N.-...A.V
A8SAU1_9FIRM/356-502--------------------------------------YLETLAPAMP----------LM.YLE.S.M.V.D.-...G.A
A8UAN8_9LACT/362-510--------------------------------------VLSLYSVAIL----------FA.SFI.G.A.Y.N.-...A.I
A8UCR2_9LACT/391-539--------------------------------------SLQVASFMSL----------FL.GLF.V.L.M.G.-...S.T
A9EQ86_SORC5/331-462--------------------------------------VLRILACSVP----------VT.FAF.Q.V.V.T.-...L.P
A9WAD6_CHLAA/337-475--------------------------------------VLAVLGLVLI----------CT.YLN.T.V.L.S.-...Q.L
B0K3R2_THEPX/360-504--------------------------------------FVRVISMGSI----------FA.FLE.A.V.V.A.-...S.I
B0MPG6_9FIRM/391-534--------------------------------------SLFILGLGGV----------FL.TLS.S.T.F.I.-...S.I
B0N362_9FIRM/290-427--------------------------------------IITILVLSSI----------FI.SWA.N.V.IRT.-...Q.Y
B0PEA8_9FIRM/441-584--------------------------------------ALRFMGLSAI----------FV.AVS.L.P.V.N.-...A.I
B0TAY6_HELMI/361-505--------------------------------------TIQILAWGAP----------FF.YLQ.S.T.T.G.-...G.I
B0VF98_CLOAI/326-465--------------------------------------YFRIYLFLLP----------LR...I.A.T.Y.G.-...I.L
B1MY12_LEUCK/485-634--------------------------------------LLQYSTVLAV----------VF.SLF.M.L.L.S.-...F.I
B1SH45_9STRE/377-525--------------------------------------LFVVALIQVI----------FL.ALY.S.L.L.A.-...P.M
B1YGP9_EXIS2/345-491--------------------------------------ALSWLAATAF----------TA.SLS.M.I.I.V.-...S.C
B1YKH1_EXIS2/386-534--------------------------------------YLLSYAPSAL----------FL.ALY.S.V.T.A.-...A.V
B2A2Z4_NATTJ/361-504--------------------------------------PLRYLSPSVI----------FL.LLK.F.A.T.T.-...G.V
B2A8K9_NATTJ/363-507--------------------------------------PLRFLAAGTI----------FL.SFQ.Q.V.S.A.-...S.A
B2GDL9_LACF3/322-460--------------------------------------IIFFEAPAII----------FI.AWS.N.V.TGT.-...Q.Y
B3EHD9_CHLL2/365-504--------------------------------------ALALLAAAAF----------AQ.SFG.G.I.A.G.-...T.V
B3EP69_CHLPB/337-475--------------------------------------VLIVLAAAVL----------VQ.SFF.G.L.L.D.-...T.V
B3W6R7_LACCB/364-511--------------------------------------ILELNAAVAN----------LI.GLF.I.L.L.V.-...A.I
B3WAP5_LACCB/356-499--------------------------------------ALQLYAVAIV----------VV.AMI.N.A.Y.N.-...A.I
B3WCD6_LACCB/380-528--------------------------------------LLQISSLLAI----------ML.GLF.T.V.L.A.-...A.I
B3XNV8_LACRE/322-460--------------------------------------LMMIEAPIIL----------FI.GWS.N.V.TGT.-...Q.Y
B4AGJ7_BACPU/343-486--------------------------------------LLMIHAAYLC----------LT.LMF.L.P.L.T.-...Y.V
B4SBS0_PELPB/338-477--------------------------------------ALLLLTVASF----------LQ.ASF.G.L.S.A.-...T.V
B5CWR8_9BACE/324-466--------------------------------------VFQILALSLP----------LQ.MIL.S.T.T.G.-...A.I
B5UWQ0_BACCE/360-510--------------------------------------VLSILSLSIL----------FS.SLS.I.T.T.A.-...S.I
B6IYF6_RHOCS/343-484--------------------------------------VLRWLALGGI----------PT.IIG.S.M.S.G.-...T.V
B6YVL8_THEON/328-461--------------------------------------VLRIFGLTLI----------FI.FFR.T.A.F.E.-...R.V
B7AQB6_9FIRM/351-493--------------------------------------FMRVLAWLCP----------FL.YIN.T.T.L.T.-...G.I
B7DPH6_9BACL/373-525--------------------------------------IISTVSFMSI----------FA.SME.L.I.S.T.-...Y.V
B7DPL3_9BACL/356-497--------------------------------------LLAYLAPSCL----------FF.YLS.D.P.L.F.-...A.V
B7GFI4_ANOFW/350-497--------------------------------------ELTILAVSIL----------FT.SLT.L.T.F.I.-...A.I
B7GMA5_ANOFW/366-505--------------------------------------TMAIVLASSV----------FT.SLA.L.L.G.T.-...G.I
B7JJF5_BACC0/376-524--------------------------------------YLISFAPSAI----------LS.AIF.T.V.S.A.-...A.I
B8D0L3_HALOH/359-505--------------------------------------ILSAMALTAT----------FI.YYL.H.V.S.S.-...G.M
B8D178_HALOH/340-478--------------------------------------ALVLISIGQV----------VN.AGV.G.S.A.G.-...Y.I
B8DHB8_LISMH/370-518--------------------------------------LLQLFAPIAI----------LF.SLF.S.V.S.A.-...A.V
B8IEZ7_METNO/324-461--------------------------------------YTLILLPGLF----------AG.ALM.NFA.L.N.-...P.I
B8IGJ3_METNO/336-472--------------------------------------PAVILIASSC----------LG.GNS.M.L.F.A.-...G.L
B9CVC4_STACP/347-489--------------------------------------TLSIYMITVV----------CV.SLI.M.M.N.I.-...A.L
B9DSP4_STRU0/342-480--------------------------------------ALEIYLGTIA----------LS.SFI.Q.F.F.H.-...Q.K
B9E7H2_MACCJ/374-522--------------------------------------LLFYYAPVAI----------LL.ALV.S.V.S.S.-...A.M
B9E8U7_MACCJ/341-481--------------------------------------ALAIYMLSVI----------FV.SLI.I.M.F.T.-...A.M
B9JKJ2_AGRRK/321-464--------------------------------------LLSMLSLAVI----------PI.PYF.Q.T.L.Y.-...S.A
B9K2D6_AGRVS/332-468--------------------------------------MLTLLALSVP----------VA.VAC.Q.V.A.T.-...Q.Y
C0QCL2_DESAH/352-496--------------------------------------VMAILSCAKL----------LL.LLG.Q.F.S.R.-...S.L
C0WBK9_9FIRM/378-517--------------------------------------AIEIMSWAIF----------LL.GLH.Q.V.S.T.-...G.I
C0WLU0_LACBU/374-518--------------------------------------YLFWNIIQSL----------IL.GLA.I.N.S.L.-...T.L
C0WQN7_LACBU/354-501--------------------------------------TIAVYCFSIV----------LT.TII.L.T.Y.N.-...M.V
C0WUG9_LACBU/378-530--------------------------------------ILTFSSMISI----------PM.GMF.V.V.I.S.-...A.V
C0WVB1_LACFE/322-460--------------------------------------IIFFEAPAIV----------FI.AWS.N.V.T.G.-..DQ.Y
C0X1V9_ENTFL/370-519--------------------------------------YLSATIISTS----------LL.GIF.T.I.V.L.-...S.I
C0X279_ENTFL/382-530--------------------------------------LLVQACYASL----------FL.GLY.M.L.V.S.-...N.M
C0X942_ENTFL/359-507--------------------------------------VLGVYVLSIA----------FM.AII.Q.A.Y.Q.-...S.I
C0Z9G8_BREBN/364-513--------------------------------------AMAILGITAI----------PL.SLL.L.A.T.N.-...G.I
C0ZAP4_BREBN/363-505--------------------------------------LLKELAPFSV----------FL.FFQ.A.P.L.A.-...A.A
C0ZHE2_BREBN/367-517--------------------------------------ALAVQSFTII----------FA.TVS.I.A.S.A.-...G.I
C1I2F0_9CLOT/325-463--------------------------------------YMMVNSLIAI----------II.PIG.L.V.F.T.-..NQ.F
C1IAW5_9CLOT/354-498--------------------------------------ILKYLSLSVP----------FI.IIT.Q.T.T.T.-...S.I
C2D643_LACBR/210-348--------------------------------------AMFIESIVIL----------MI.GWS.N.V.IGT.-...Q.Y
C2E7U4_LACJH/384-532--------------------------------------VLYLSSFTAI----------SL.GLF.T.V.L.M.-...A.I
C2EED2_9LACO/381-529--------------------------------------VLAFSSYIAL----------AL.GLF.M.V.L.A.-...A.L
C2EHH6_9LACO/356-502--------------------------------------VIGIYLLGII----------LM.TVI.N.S.Y.S.-...S.I
C2EP42_9LACO/342-483--------------------------------------YLVENIVQSL----------LA.GLV.M.N.S.L.-...T.L
C2H7P1_ENTFC/381-529--------------------------------------VLIQASFVGL----------FL.GLY.M.L.V.S.-...N.M
C2HEH9_ENTFC/359-507--------------------------------------ALVLFVFSIA----------FT.AVI.Q.A.Y.Q.-...S.I
C2KAZ9_9LACO/380-528--------------------------------------VLYISAFTAI----------SL.GLF.T.V.L.M.-...A.I
C2KJQ1_LEUMC/329-467--------------------------------------VIVLLSPIII----------FI.GWS.T.V.IGT.-...Q.Y
C2KKY7_LEUMC/498-647--------------------------------------MLQYSTILAL----------VF.SLF.M.L.L.A.-...F.V
C2LQ70_STRSL/432-580--------------------------------------LFVASLIQVI----------FL.ALY.S.V.L.A.-...P.M
C2M158_STAHO/360-502--------------------------------------TLSIYTLTVI----------GV.SLI.M.M.D.I.-...A.L
C2YMP0_BACCE/352-495--------------------------------------MLAILIGSSY----------FT.SLM.V.L.S.I.-...G.I
C3HRG9_BACTU/323-461--------------------------------------LMFWVSFIII----------FI.PIG.G.V.F.A.-..NQ.Y
C4FB42_9ACTN/325-467--------------------------------------IMTFLVVIIP----------VI.SMT.N.V.I.G.-..KQ.Y
C4FNY8_9FIRM/361-503--------------------------------------VIAVISLSII----------FL.GWQ.Q.I.T.A.-...G.I
C4FPR1_9FIRM/359-501--------------------------------------ATQITAFSIF----------FL.GVH.Q.V.T.T.-...G.I
C4FUC9_9FIRM/947-1095--------------------------------------LLVTASYMSI----------IL.GLY.T.I.L.S.-...T.I
C4G0V0_ABIDE/374-518--------------------------------------IMLVGSFTIT----------LY.TVS.I.L.F.C.-...T.I
C4GB38_9FIRM/387-530--------------------------------------MMVVGGLTIV----------FV.CLS.T.L.S.N.-...S.L
C4RGH8_9ACTO/364-502--------------------------------------VTVFLALTML----------VA.TGC.G.M.V.D.-...T.V
C4V2B6_9FIRM/374-517--------------------------------------AVMISAVSII----------LL.GLH.Q.V.S.T.-...G.I
C4XGJ8_DESMR/335-465--------------------------------------VMRLLALALP----------LL.ALD.M.L.V.N.-...N.L
C5A2Y0_THEGJ/342-480--------------------------------------TLQILAIGFM----------FH.SAL.G.P.N.G.-...L.T
C5D378_GEOSW/360-505--------------------------------------PLAILAASIF----------FT.TLA.L.T.L.S.-...A.L
C5NWI0_9BACL/318-458--------------------------------------VLYVIVFNIM----------FV.GWT.N.I.L.G.-..FQ.V
C5Q1B2_STAAU/332-469--------------------------------------LMTILAILVL----------II.PLN.MLI.S.R.-...Q.Y
C5RB06_WEIPA/501-648--------------------------------------ILQFASYSAI----------FL.SLY.M.V.V.L.-...A.I
C5RD31_WEIPA/359-505--------------------------------------ALMVFVLTII----------PA.TLI.L.I.I.T.-...S.V
C6A0B5_THESM/328-456--------------------------------------VLEILIWTSA----------VK.YVS.M.F.Q.G.-...N.I
C6CSD9_PAESJ/327-465--------------------------------------IMQGLAITIP----------FI.AFA.N.V.IRT.-...Q.Y
C6J0R0_9BACL/364-511--------------------------------------IVALLTYATI----------FQ.ITM.M.T.S.N.-...S.I
C6JQC3_FUSVA/323-462--------------------------------------ILRILSGLLI----------FS.FIA.V.F.LDT.-...N.I
C6PQD8_9CLOT/131-275--------------------------------------ILQYSAISIP----------FI.ILA.Q.T.S.T.-...A.I
C6SP25_STRMN/377-525--------------------------------------LFIVSLLQTI----------IL.AIY.T.V.L.A.-...P.M
C6VKW0_LACPJ/357-507--------------------------------------ALRIYIISIL----------FA.ALI.T.T.Y.T.-...S.V
C7GE86_9FIRM/383-527--------------------------------------MLQVGAVTIL----------FF.SLS.T.L.S.N.-...G.L
C7GYH1_9FIRM/373-517--------------------------------------ILAIMSLGVF----------FL.AMI.L.T.L.S.-...A.V
C7NM90_HALUD/327-463--------------------------------------PLVVLLAGRI----------PY.SLS.R.I.L.V.-...Q.L
C7NSL6_HALUD/319-457--------------------------------------VLIILMGEKL----------LQ.SVH.T.I.L.G.-...R.S
C7NSR3_HALUD/331-469--------------------------------------VLVILVGAYT----------AD.VYA.N.Q.L.L.-...N.T
C7P069_HALMD/318-461--------------------------------------VLWLLIVAVL----------VY.GYQ.S.Q.I.V.-...N.A
C7XZJ3_9LACO/375-523--------------------------------------VLFIASFTAI----------IL.GLF.T.V.L.M.-...A.V
C8NE09_9LACT/413-561--------------------------------------LLVVSCVMCV----------FL.GLF.V.T.F.T.-...Y.I
C8NI78_9LACT/366-514--------------------------------------VLLVYITSIF----------FA.SVI.M.S.L.H.-...G.I
C8PCY7_9LACO/375-523--------------------------------------ILFLSGIAAM----------FL.GAF.T.I.L.M.-...A.I
C8VXJ1_DESAS/366-509--------------------------------------PLAYVAFSIV----------FW.SIH.L.V.T.T.-...G.V
C8WQG9_ALIAD/361-502--------------------------------------MLAIMAPFVF----------ML.CLQ.S.P.L.T.-...G.I
C9A2J3_ENTGA/381-529--------------------------------------VLVAACISGL----------IL.GLF.M.L.T.S.-...S.M
C9A420_ENTGA/359-508--------------------------------------ALVLFVFAVA----------LM.AAI.Q.A.Y.Q.-...S.I
C9L817_RUMHA/12-160--------------------------------------LMMLGVITVI----------MN.GMS.N.I.S.N.-...G.V
C9LAR2_RUMHA/325-463--------------------------------------LIACMAPAVL----------FS.VFG.N.V.IRT.-...Q.Y
C9LLX4_9FIRM/363-506--------------------------------------CIAVMSFGVF----------LL.GVQ.Q.V.T.T.-...G.V
D0BKY7_9LACT/382-530--------------------------------------LLMVSCVLCI----------FM.GAF.T.V.F.T.-...S.I
D0BM46_9LACT/352-499--------------------------------------VLSIYIISII----------LA.SMM.M.A.Y.H.-...G.I
D0BME9_9LACT/319-458--------------------------------------AIMIMVWNMF----------FI.GWT.N.I.M.G.-..IQ.I
D0LQE6_HALO1/374-513--------------------------------------ALMALALGNV----------GF.CLF.A.I.A.G.-...T.I
D1Z261_METPS/328-462--------------------------------------VMQIVIWSVF----------LS.FVY.T.P.F.L.-...Q.T
D2BMG7_LACLK/323-465--------------------------------------PLSILSLSIC----------PQ.MLS.Q.S.M.S.-...A.I
D2EHX4_PEDAC/355-503--------------------------------------ALAIYNLSVI----------LA.ALI.F.V.N.N.-...S.V
D2EJ27_PEDAC/321-459--------------------------------------LMMLESVVIL----------LI.AWS.N.A.LGT.-...Q.Y
D2ELV8_PEDAC/393-541--------------------------------------ILQFNSYVAI----------VL.GLF.T.V.I.S.-...A.V
D2RVV2_HALTV/336-474--------------------------------------VVQILSLFVF----------FE.ALE.N.I.S.G.-...P.A
D2RXY9_HALTV/340-478--------------------------------------VLQVLAAFII----------LQ.AIT.N.L.T.S.-...D.S
D3AN52_9CLOT/376-519--------------------------------------FIMTLAWLCP----------FL.YLV.T.T.M.G.-...S.I
D3E759_GEOS4/381-532--------------------------------------TMQVIAFTAA----------GG.TLS.T.I.T.A.-...A.L
D3FFB8_CONWI/338-471--------------------------------------PFMLLIWSAV----------IA.LLQ.V.N.Y.T.-...N.G
D3FR13_BACPE/361-509--------------------------------------VLAVLAFAIF----------FS.SIY.L.T.T.A.-...A.I
D3FXP2_BACPE/374-522--------------------------------------VLQYYGPMTL----------LF.SLF.A.V.T.A.-...A.I
D3FZH8_BACPE/357-501--------------------------------------VIFILSVSAL----------FT.SFS.V.L.T.T.-...G.M
D3LVV9_9FIRM/358-500--------------------------------------AICVLSISVF----------LV.GVQ.Q.I.T.G.-...A.L
D3LX29_9FIRM/358-500--------------------------------------ATRTIAIAIF----------FL.GMH.Q.I.T.T.-...A.I
D3QG68_STALH/343-485--------------------------------------TLSVYMITVI----------LV.SLI.M.M.Y.I.-...A.L
D3SSH7_NATMM/337-474--------------------------------------PLLLLLPGAL----------GF.ALA.R.P.V.L.-...A.I
D3STC0_NATMM/337-475--------------------------------------VIQIFAFFIV----------FQ.AID.K.I.T.N.-...D.A
D3UNL4_LISSS/370-518--------------------------------------LLSFFAPFAI----------FF.SLF.S.V.T.A.-...A.I
D4G1Q3_BACNA/318-464--------------------------------------LLFIHAGYLV----------VS.LAF.M.P.L.F.-...Y.I
D4G3E4_BACNA/359-505--------------------------------------ALQVFSCSIL----------FA.SMA.V.T.A.A.-...A.V
D4GU68_HALVD/319-457--------------------------------------VLIILAGEKI----------LQ.SVH.V.I.I.G.-...R.S
D4LGF1_9FIRM/327-469--------------------------------------SLQILSISLI----------FA.IYG.G.L.I.T.-...S.V
D4W1F1_9FIRM/338-485--------------------------------------ALKILTIQIL----------FY.PFI.F.L.S.T.-...A.V
D4W2K6_9FIRM/377-526--------------------------------------IFLLGSLLGL----------FM.ALY.S.I.V.T.-...A.I
D4YGG7_9LACT/385-532--------------------------------------VLVVYVLMVI----------FA.SLI.L.G.Q.N.-...N.I
D4YJ56_9LACT/433-583--------------------------------------LLQLSAAVAV----------TM.GLF.S.V.L.V.-...A.M
D4YX22_SPHJU/336-476--------------------------------------FVAILALAMP----------FM.TLQ.V.M.F.A.-...P.V
D5D970_BACMD/362-511--------------------------------------VLQILSLLVI----------FT.TVA.A.T.A.G.-...A.V
D5DN36_BACMD/374-521--------------------------------------VLLYYAPVAL----------LF.SFF.T.V.N.G.-...A.I
D5DY76_BACMQ/331-468--------------------------------------TLIISALGMV----------IY.GIT.F.Y.Y.N.-...K.T
D5E4C9_BACMQ/373-523--------------------------------------ILQWYAPMAI----------LF.ALF.T.V.T.A.-...S.I
D5QEL1_GLUHA/351-483--------------------------------------IMKCLSIGVF----------VF.GMD.A.V.A.A.-...G.F
D5T1U4_LEUKI/363-511--------------------------------------MTQISAITSI----------FM.GGA.T.V.L.A.-...M.I
D5TQD2_BACT1/321-460--------------------------------------LIILMSPVIV----------FV.GLA.N.I.F.G.-..LQ.I
D5UPU7_TSUPD/350-482--------------------------------------ALGLLFIAVA----------LR.FVN.A.V.L.S.-...Q.A
D5VU50_METIM/353-494--------------------------------------AMRILSFGII----------FM.SLN.R.V.G.F.-...T.I
D5WSL0_BACT2/373-521--------------------------------------AIAILALSTV----------FS.TLE.S.V.S.S.-...S.V
D5X9J9_THEPJ/361-503--------------------------------------PLSILAPAAV----------FL.GLH.Q.T.T.S.-...G.V
D5XD05_THEPJ/326-457--------------------------------------SLQILLIATG----------II.FIS.A.P.L.N.-...L.S
D6KSV4_SCAIO/332-470--------------------------------------LMRILSLVIP----------LI.CIT.N.V.I.G.-..VQ.Y
D6XV50_BACIE/360-507--------------------------------------ALRIAGLGVL----------PG.SLF.M.T.A.A.-...V.L
D6Y0K7_BACIE/382-530--------------------------------------ILQFYAPVAI----------LF.SVF.A.V.T.A.-...A.L
D7BDH0_MEISD/336-473--------------------------------------VAQILFLGLI----------PS.LLV.T.V.T.G.-...L.T
D7D534_GEOSC/329-466--------------------------------------IIPVVAISVL----------LQ.GMK.S.Y.Y.L.-...D.L
D7DRX9_METV3/353-490--------------------------------------AVRILMISAI----------FS.SLN.V.I.S.S.-...D.I
D7E977_METEZ/332-466--------------------------------------ITPFVALSAL----------VF.GVF.I.I.F.E.-...K.V
D7UUI0_LISGR/356-499--------------------------------------ELQLFMPAVL----------LS.SLI.V.M.F.A.-...S.I
D7WQC4_9BACI/353-489--------------------------------------YVKILAPIFY----------FY.YIQ.S.P.L.H.-...S.I
D8GMK0_CLOLD/327-460--------------------------------------VFTILIAYVS----------IF.YIR.E.I.Y.G.-...Y.E
D8ILC9_LACSC/25-170--------------------------------------IIFMVALNLF----------MR.LIR.N.T.F.I.-...M.F
D8J472_HALJB/339-477--------------------------------------VIQVLSGFVV----------LQ.AID.K.I.T.N.-...D.G
D8J725_HALJB/340-478--------------------------------------AVVILAVGIT----------IS.ATC.......GG-PDGG.L
D8J7W8_HALJB/319-457--------------------------------------VLVVLMLEKV----------FQ.SVN.D.V.L.G.-...S.T
D8MET9_LEUGT/321-460--------------------------------------LIILESPIII----------LI.SWS.IAI.T.N.-...Q.Y
D8PBA0_9BACT/336-473--------------------------------------GLRLLVPGAL----------CY.AVA.R.V.L.W.-...P.V
D9PYX0_METTM/350-483--------------------------------------ALSILVVGMS----------FY.TLF.M.I.S.S.-...S.I
D9QSV7_ACEAZ/363-507--------------------------------------PLRYVSWGVI----------FV.CLQ.Q.T.S.S.-...S.I
E0I7A7_9BACL/353-491--------------------------------------ILPYMMFGLI----------MW.NFG.M.Y.G.H.-...K.G
E0IFR0_9BACL/366-514--------------------------------------IVAALTAGTI----------FQ.ISM.M.T.S.N.-...S.I
E0NHN4_PEDAC/321-459--------------------------------------LMIVESAVIF----------LI.GWGVM.L.G.N.-...Q.Y
E0PD92_STREI/325-464--------------------------------------MLIGLSISIP----------IW.TIG.E.V.IRN.-...Q.F
E0RCM4_PAEP6/382-529--------------------------------------IIAVLTLGTI----------FQ.ITM.M.T.S.N.-...S.I
E0RM54_PAEP6/373-525--------------------------------------VMRWMALTAV----------GG.TLS.I.I.S.A.-...A.L
E0RMQ1_PAEP6/366-508--------------------------------------MLKLMAPFAL----------FM.YIQ.A.P.L.Q.-...A.A
E0RUK9_BUTPB/373-516--------------------------------------IFRLAAILIV----------LL.SIG.V.L.V.S.-...W.L
E0S188_BUTPB/322-462--------------------------------------LIILLSVVMI----------FK.SLS.N.I.IQN.-...Q.Y
E1IAS8_9CHLR/378-523--------------------------------------VLAILAWFLP----------LS.FVN.G.L.L.Q.-...Y.V
E1IEK9_9CHLR/380-529--------------------------------------IVWVLVPCLF----------IE.CLL.T.T.A.H.-...N.A
E2ZD67_9FIRM/360-502--------------------------------------AIRVLALATF----------LI.GLQ.Q.I.T.N.-...G.L
E3CI47_STRDO/375-523--------------------------------------LFVFVMAETI----------LL.ALY.S.L.M.A.-...P.M
E3FNG9_STIAD/347-485--------------------------------------VLRLQAPILA----------LT.YVA.M.V.C.A.-...S.V
E3GGE0_EUBLK/365-508--------------------------------------ILKYYAYATI----------FM.MLS.N.T.F.Q.-...S.I
E3GZ73_METFV/328-459--------------------------------------AFQILIWTIV----------FI.FTN.G.I.F.A.-...N.L
E4KNA5_9LACT/790-938--------------------------------------LLITGSLSSI----------FL.GAY.T.V.L.S.-...T.I
E4L4W5_9STRE/321-459--------------------------------------LMAIQSFMII----------FI.SYG.N.A.LGT.-...Q.Y
E4LZJ6_9CLOT/384-531--------------------------------------ILSWFSIEAF----------LN.TIG.P.I.F.T.-...A.L
E4MLQ7_9FIRM/372-517--------------------------------------LLLTGSVFVV----------TD.SFS.I.I.T.G.-...G.V
E4NUG7_HALBP/319-458--------------------------------------VLVILTGEKI----------LQ.SVH.I.I.L.G.-...R.A
E4SMU5_LACAR/327-469--------------------------------------SLQILCFALI----------IS.AFS.R.I.F.S.-..DC.I
E5WAE4_9BACI/356-502--------------------------------------ALQIFSASIL----------FA.SLA.M.T.M.T.-...A.V
E5WT44_9BACI/362-510--------------------------------------VLAILSLLIL----------LS.SLI.I.T.I.T.-...G.I
E5X0H2_9BACE/326-464--------------------------------------LLQILCFDWM----------FD.HLS.I.I.N.L.-...N.L
E5Z458_9BACL/362-509--------------------------------------IIGFLTFGTI----------FQ.ITM.M.T.T.N.-...S.I
E6LD53_9ENTE/253-391--------------------------------------LIPILSIVII----------LI.GWS.N.V.L.G.-..MQ.Y
E6LEY4_9ENTE/358-506--------------------------------------TLLLFVFAIA----------LM.AII.Q.A.F.Q.-...S.I
E6LIJ6_9ENTE/381-529--------------------------------------VLIEASLSGL----------VL.GFF.M.L.T.A.-...S.M
E6LN70_9FIRM/381-525--------------------------------------LMIIGSGIVV----------LY.SVS.T.V.T.N.-...A.I
E6MFC3_9FIRM/328-466--------------------------------------PMQLIMPTLL----------FI.GLT.N.I.L.G.-..LQ.M
E6MGM4_9FIRM/373-516--------------------------------------MLRVFAYATM----------FM.MLS.N.I.F.Q.-...S.I
E6QMG7_9ZZZZ/367-517--------------------------------------LFVAFSISMQ----------FH.MLT.G.P.G.T.-...S.I
E6TRQ4_BACCJ/362-512--------------------------------------ALQILSTTVL----------FA.ALF.M.T.I.A.-...A.L
E6U1Q3_BACCJ/375-523--------------------------------------MLKYYAPVAI----------LF.SIF.A.V.T.S.-...S.L
E7FPH6_9LACO/355-501--------------------------------------TISAYVVSIV----------FI.SLI.S.T.Y.N.-...S.I
E7MM58_9FIRM/379-526--------------------------------------ALFWSSILAF----------GT.TVT.P.V.L.L.-...S.I
E7QQ57_9EURY/339-477--------------------------------------VVQVFSGYVV----------LE.AVT.L.I.T.S.-...D.A
E7RE43_9BACL/368-516--------------------------------------ILAHYLPVAI----------LF.SAF.P.V.T.A.-...S.I
E7RL93_9BACL/356-500--------------------------------------VLAIVSFSSL----------FT.SLT.V.L.G.T.-...G.V
E7RLD1_9BACL/354-503--------------------------------------TLIIFSWQIV----------WM.SLL.L.I.M.T.-...A.M
E7RZY6_9BURK/339-474--------------------------------------IIPWVIGGVA----------LQ.GLF.P.V.A.S.-...A.G
E7S3G0_STRAG/321-467--------------------------------------LMAVESLMII----------CI.SYG.N.A.LGT.-...Q.Y
E8JWJ5_STRCR/327-467--------------------------------------SMQILMPILV----------IS.GFS.N.I.TGN.-...Q.I
E8K660_STRPA/410-558--------------------------------------LFIVAMLQTV----------IL.GLY.T.V.L.S.-...P.M
E8LB44_9FIRM/369-509--------------------------------------AIQTMSIGIL----------FL.GMH.Q.I.S.T.-...G.I
E8R8C0_DESM0/349-487--------------------------------------YLALTATGAL----------GV.GLGAY.V.L.G.-...G.L
E8RTH0_ASTEC/331-467--------------------------------------VTALISVGAL----------LS.GFN.TYY.F.L.-...Q.A
E8SIP0_STAPH/344-486--------------------------------------TLSLYMLTVI----------CV.SLI.M.M.Y.I.-...A.L
E8V165_TERSS/339-475--------------------------------------VLIVASILSI----------PR.AFQ.E.I.P.D.-...I.L
E9RY62_9FIRM/330-468--------------------------------------PMQIIMPTLL----------LI.GLT.N.I.M.G.-..IQ.I
F0DJ09_9FIRM/357-499--------------------------------------ILGSLAFGGP----------FL.YFQ.Q.T.T.T.-...G.I
F0EKD4_ENTCA/327-465--------------------------------------SLSILSLASV----------FS.LLS.S.F.Y.V.-..YA.I
F0HVE0_LACDL/327-469--------------------------------------SLRILAFAMV----------GS.GIS.G.I.F.G.-...QCA
F0KAR0_CLOAE/326-458--------------------------------------PFSILLIYSL----------IL.FIR.E.I.Y.A.-...Y.G
F0LLW6_THEBM/342-478--------------------------------------ALQILALGFM----------FH.TFL.G.L.N.G.-...L.S
F0LLZ4_THEBM/339-477--------------------------------------ALRILAVGFI----------VH.VLF.G.L.N.G.-...M.S
F0T719_METSL/333-463--------------------------------------VLQILIWTVP----------IT.FLN.Y.I.F.G.-...S.I
F0TB30_METSL/351-484--------------------------------------ALQILAAGML----------FF.TLY.T.I.S.S.-...S.I
F0TBQ9_METSL/329-463--------------------------------------TLQILVWAIV----------FT.FAG.A.S.Y.I.-...Q.L
F0TC71_METSL/328-460--------------------------------------ALQALIFVVP----------VI.FIT.Y.L.F.G.-...N.I
F1VXT7_9BURK/320-462--------------------------------------ILAWLAAVGF----------IQ.SLT.S.T.T.G.-...S.V
F1Z193_9STRE/350-488--------------------------------------ALEVYLLMIL----------LA.SLI.Q.Y.C.H.-...Q.K
F2F183_SOLSS/360-508--------------------------------------VLKLYSFQIV----------PL.SII.L.T.F.T.-...A.I
F2G999_ALTMD/323-469--------------------------------------YMTISAFSIF----------PL.VVA.N.F.L.P.-...N.L
F2I7P9_AERUA/374-520--------------------------------------VLEQYLLMIV----------LA.SWV.L.I.Y.H.-...N.I
F2JLQ5_CELLD/355-497--------------------------------------LLKWLAIICP----------FL.YLQ.N.I.L.T.-...G.A
F2KQE3_ARCVS/343-481--------------------------------------ALRALALGFF----------TH.VML.G.P.N.G.-...L.T
F2NHK3_DESAR/367-498--------------------------------------VFKILSLALI----------FS.FWN.Y.L.G.D.-...N.M
F2NKF2_MARHT/337-483--------------------------------------AAYILFAGLV----------PA.MTL.S.V.F.G.-...L.A
O06039_LACLC/321-459--------------------------------------LLVLSSPIVV----------LV.TWS.N.V.LGQ.-...Q.Y
O26442_METTH/329-460--------------------------------------AFQILALFIP----------IR.LVS.T.I.T.G.-...T.L
Q03E00_PEDPA/355-503--------------------------------------ALAVYNLSVI----------FA.ALI.F.V.Y.N.-...S.I
Q03RI1_LACBA/378-525--------------------------------------ILAFSSYLSI----------LL.GLY.T.V.V.A.-...A.L
Q03SZ7_LACBA/349-498--------------------------------------MLDIYMLSII----------LA.TLI.Q.T.Y.N.-...S.V
Q03XR0_LEUMM/330-477--------------------------------------MVQISAVIAL----------FM.GLT.S.V.L.A.-...M.I
Q0AHL3_NITEC/325-466--------------------------------------PLQLLALMMP----------LR.MIA.N.F.L.P.-...S.A
Q0AP11_MARMM/327-464--------------------------------------ILPWIALSGL----------MKGMMT.Y.Y.F.H.-...E.A
Q0W809_UNCMA/331-464--------------------------------------VLQIIIWAAL----------FI.FLS.S.A.Y.G.-...C.L
Q12TY8_METBU/325-459--------------------------------------ALAIVAIGMG----------FL.VMT.M.V.F.T.-...N.I
Q12VM9_METBU/345-483--------------------------------------LLVILLAVQI----------VN.VFQ.Y.F.F.T.-...M.Y
Q12XY4_METBU/326-458--------------------------------------ALQILIWATS----------IM.FIN.I.L.L.S.-...F.T
Q18GU8_HALWD/357-496--------------------------------------YLVILAISYF----------VM.AVT.G.P.N.Q.-...R.A
Q1GPL1_SPHAL/342-484--------------------------------------YIQLFALALI----------LM.TVQ.I.L.F.A.-...P.V
Q1K412_DESAC/351-495--------------------------------------VMAVLALSKI----------PT.LYL.L.P.C.I.-...N.V
Q2B249_9BACI/362-508--------------------------------------VLAVLSLFIF----------FA.SII.M.T.L.A.-...A.I
Q2NH55_METST/331-464--------------------------------------ALTILIWAGI----------FM.FLS.G.L.T.S.-...T.L
Q2NIB6_METST/328-458--------------------------------------VLELIIWALP----------AI.FLS.Y.I.L.G.-...T.S
Q2S953_HAHCH/328-463--------------------------------------ILQALAVAIF----------FI.FPS.S.I.M.I.-...Y.V
Q2Y4J6_9ARCH/377-524--------------------------------------TLAMLTIYVF----------VL.SLT.R.P.Y.S.-...S.L
Q2YCC1_NITMU/331-475--------------------------------------PLALLSTVMP----------FR.MTT.S.F.L.R.-...P.V
Q2YCG5_NITMU/323-466--------------------------------------IFSALSIGMI----------AF.SLS.L.L.S.G.-...A.I
Q38V74_LACSS/358-503--------------------------------------ALVWYMLSIV----------II.ALI.N.A.C.N.-...S.V
Q38VP9_LACSS/378-526--------------------------------------VLQFSSYISI----------LL.GLF.T.V.L.G.-...A.I
Q3ADH7_CARHZ/346-484--------------------------------------LLVILAVSGP----------FL.YWY.Q.T.V.T.-...G.I
Q3APG3_CHLCH/338-477--------------------------------------ALQLLSAAYF----------VQ.CVF.G.I.A.S.-...T.L
Q3B6G9_PELLD/337-476--------------------------------------VLGLLTAGAF----------LQ.ALF.G.I.S.A.-...T.L
Q3ZK40_9LACT/322-460--------------------------------------LIFVQSPFLI----------FI.SWN.Y.I.I.G.-..GQ.Y
Q469G3_METBF/349-484--------------------------------------TLRILALGFI----------AN.SYF.G.F.N.Y.-...H.T
Q46FX4_METBF/329-461--------------------------------------ALQILIWASV----------LS.FIN.Y.A.P.S.-...T.Y
Q47U72_COLP3/338-482--------------------------------------LAPILGFAYI----------CR.TVS.R.P.I.S.-...S.L
Q49V13_STAS1/337-479--------------------------------------TLAVYMLTVI----------FV.SLI.M.M.D.I.-...A.L
Q4JYJ9_STRPN/323-464--------------------------------------ALNIVVFSLI----------PI.AFS.E.I.V.G.-..RQ.T
Q4JZ09_STRPN/330-470--------------------------------------AMQILMPILV----------IS.GFS.N.I.TGN.-...Q.I
Q4K189_STRPN/323-460--------------------------------------IIAGMTPALV----------FS.AFG.N.V.IRT.-...Q.F
Q5JDW0_PYRKO/345-480--------------------------------------ALRILALGFM----------FH.VVM.G.L.N.A.-...M.S
Q5LFL1_BACFN/328-466--------------------------------------TLKLVAPIVL----------FI.GLS.G.I.IGM.-...Q.I
Q5M4A4_STRT2/55-193--------------------------------------SLRILCLALI----------CS.IIS.W.I.F.N.-..DG.V
Q5V4U1_HALMA/327-465--------------------------------------VLLILIAAYL----------AD.AFA.S.Q.F.T.-...N.V
Q5WAF7_BACSK/347-496--------------------------------------ILQVVAVSIF----------PA.SLY.L.T.A.A.-...A.I
Q5WE75_BACSK/374-522--------------------------------------TLGFYAPATV----------FF.SIY.A.V.T.G.-...S.I
Q67JD5_SYMTH/384-522--------------------------------------ALEAMAWSVL----------PI.MLQ.Q.T.T.S.-...G.V
Q8EP19_OCEIH/372-521--------------------------------------LMAWYAPVAL----------LF.GFI.T.V.T.A.-...G.M
Q8EU30_OCEIH/362-509--------------------------------------ELRVLMLSIV----------FA.TLA.I.I.G.S.-...T.V
Q8GPE5_STRTR/321-459--------------------------------------ILSILVFELI----------FM.GWS.S.I.IGN.-...Q.Y
Q97AA3_THEVO/339-476--------------------------------------AISIIMVFSA----------LF.VTS.N.V.M.T.-...Q.L
Q9KGJ0_BACHD/361-507--------------------------------------VLQVYGFSIF----------FA.SLF.V.V.T.A.-...A.L

PF03023

MURJ_BORBU/29-473LVM.IIFAKPIMYFISYYR..........GENLIFASSVFGYLVLYIL----------LI-SLS-S-I-F-V-----S-V
MURJ_RICPR/28-477ALM.QIFMPQLILCIAPGFY.......AKKEKFELTVFLCRITIPYLI----------FV-SLT-A-L-L-G-----G-I
MURJ_ECOLI/28-479VAG.MLAAPWVIMVTAPGFA.......DTADKFALTSQLLKITFPYIL----------LI-SLA-S-L-V-G-----A-I
MURJ_RHITR/28-484IVMELAMPLLVRWVIAPGFA.......DDAEKFDLTVRLAAVMFPYLM----------SM-SLT-A-M-M-S-----G-M
MURJ_CHLPN/35-484LL..IEAVLWVVLQYVEEG.........TYDMILLT....MILLPCGI----------FL-MMY-N-V-N-G-----A-L
MURJ_SYNY3/36-495IIL.VLGAGIFIDLLAPGL.........EPETRRMAVQQLQIMAPMAL----------LS-GLI-G-I-G-F-----G-T
MURJ_AQUAE/29-466IIG.LLFPEEIISVISPGI........KEKETFSYAVEFLKFTILYLP----------LV-SFY-A-Y-S-M-----A-I
MURJ_HAEIN/16-479ILA.MVGSPHVAALFGMGWFTDWMNDGPDAHKFEQASLLLKITFPYLW----------FV-TFV-A-F-S-G-----A-V
MURJ_THEMA/28-450FLS.EVFPYFMASIFATGA.........DEEVKSLAADLIRLTAPFIT----------IV-FVW-A-V-F-Y-----S-V
MURJ_HELPJ/1-458LN....P.LWLTKLLAYGF.........DEETLKLCTPIVAINFWYLL----------LV-FIT-T-F-L-G-----A-L
Q9X8T0_STRCO/300-778VIT.VFAAPLLIRLLSNPVA.......SDPAANEVGITFVRYFLPSIF----------FM-GLH-V-V-M-G-----Q-V
MURJ_TREPA/32-489LIG.ILGAPYIVRLFDTDQ..............SLTVSLTRLMFPYLW----------MI-SLA-A-F-F-Q-----G-M
Q9RX17_DEIRA/83-522ALG.IFAAPWVVGLLTSTH.........ANIDRAIAIYMTQLVMPFLT----------LI-SLS-A-V-A-M-----G-L
MURJ_CHLTR/34-482LI..IELGLCVWCSCVTGS.........LFDTLLLT....IILLPSGI----------FL-MMY-T-V-N-S-----T-L
O05435_MYCTU/48-522TLS.VLAAPLLVRLMLGTN.........PQVNEPLTTAFAYLLLPQVL----------VY-GLS-S-V-F-M-----A-I

PF13440

D0I1Y2_VIBCL/18-260--------------------------------------TVSNIGIFVL----------IGHFYD-NEL-F-SQ.YILM-S
D0HB98_VIBMI/18-260--------------------------------------AISNFGLFFF----------IGHFYD-GVI-F-TQ.YIYI-S
A8UQ25_9FLAO/16-256--------------------------------------HIVTLLSLKY----------ISTYVN-SKT-I-AF.IGNV-D
Q4JBJ6_SULAC/28-278--------------------------------------APISFVFTYL----------VAHYLS-NLQ-N-GQ.IIFA-T
Q2YCG5_NITMU/22-272--------------------------------------IGAQFGAQIL----------IMRQLD-PEL-V-GA.FGYV-L
C8XCC3_NAKMY/40-272--------------------------------------AGVAFITNIL----------ISRELG-PDS-R-GE.VAFV-L
Q3K9H6_PSEPF/12-267--------------------------------------LGAKFLLVLA----------ITHYLG-YEA-L-GF.YGVV-V
O58733_PYRHO/24-254--------------------------------------GGSRFLYNVI----------ISRKFG-VEV-L-GE.INSL-I
Q1D7B4_MYXXD/29-283--------------------------------------AGLTLSIPLV----------LARVLN-LDD-Y-GT.YYQL-F
C4WNX8_9RHIZ/31-284--------------------------------------LVVSLVYFIA----------LANTLP-TGD-F-GI.FATA-S
A6X6T8_OCHA4/16-269--------------------------------------LVVSLVYFIA----------LANTLP-TGD-F-GI.FATA-S
B1M5Z3_METRJ/17-264--------------------------------------AALNMASVAV----------FTRLAP-VES-Y-GT.YLYV-L
A1UCH8_MYCSK/30-289--------------------------------------LLSTLLLTVI----------VYRTLD-ARD-A-AV.FFAI-L
Q1BCG5_MYCSS/30-289--------------------------------------LLSTLLLTVI----------VYRTLD-ARD-A-AV.FFAI-L
A3PW68_MYCSJ/30-289--------------------------------------LLSTLLLTVI----------VYRTLD-ARD-A-AV.FFAI-L
Q0RPT3_FRAAA/322-573--------------------------------------SGTNAVMSFI----------IARSVS-SSE-F-GA.FGVA-F
Q0RCF1_FRAAA/179-430--------------------------------------SATNAAISFL----------IARQVS-DVE-Y-GA.FGIA-Y
D3CWT1_9ACTO/203-455--------------------------------------SATNAAVSIL----------VAHFVG-KTE-Y-AAGFAVP-Y
Q8KN00_9ACTO/40-289--------------------------------------SLSNFAVGVY----------VARSLG-LTA-F-GV.FSLA-W
Q9RJJ1_STRCO/34-283--------------------------------------SLSNFVVGIY----------VARSLG-LTA-F-GV.FSLA-W
D2PZ16_KRIFD/24-275--------------------------------------SLSNLAVGVL----------VARSSS-VAD-F-GV.YALA-F
C8XCR8_NAKMY/39-289--------------------------------------AASNFLLAVL----------VARAVD-AEA-F-GA.FSVA-F
A4FEI7_SACEN/8-256--------------------------------------AGTSLLLQMV----------AARVLG-LAE-F-GA.FAVF-L
A9VW94_METEP/42-293--------------------------------------SACNFATTIV----------LAHALG-LEA-F-GL.FSTA-W
B7KU42_METC4/42-293--------------------------------------SACNFATTIV----------LAHALG-LEA-F-GL.FSTA-W
C7C8V6_METED/42-293--------------------------------------SACNFATTIV----------LAHALG-LEA-F-GL.FSTA-W
C5ATW3_METEA/42-293--------------------------------------SACNFATTIV----------LAHALG-LEA-F-GL.FSTA-W
C7LVX3_DESBD/8-264--------------------------------------AGANFLVSIL----------LARWLE-PAA-Y-GA.FSLA-Y
Q2CIK8_9RHOB/14-260--------------------------------------SGANFLLALT----------LQSAVP-PAA-F-GR.YAFA-L
Q89SM5_BRAJA/14-270--------------------------------------SASAIILIFA----------VSHILS-PAQ-Y-TS.FSLA-L
C8KY87_9PAST/18-266--------------------------------------MGLTVVSSFI----------LARFLS-VDD-R-GA.HQLF-I
C5RZU1_9PAST/18-266--------------------------------------MGLTVVSSFI----------LARFLS-VDD-R-GA.HQLF-I
A9AXJ4_HERA2/36-280--------------------------------------NLGNYGFAIV----------LGRGLG-PQV-Y-AE.VNLI-V
D0YZQ3_LISDA/18-261--------------------------------------QVIGAFTILF----------MSYRFG-MSD-V-GN.YSLI-Y
D2BRK8_DICD5/18-261--------------------------------------QVIGALSIWL----------ISHKYN-MAE-V-GA.YALN-Y
B1IZZ3_ECOLC/18-261--------------------------------------QLIGAFSIWL----------ISYKYD-LAE-V-GL.YALN-Y
B9JQS0_AGRRK/94-340--------------------------------------TGSMYFLAPI----------LSTYID-SKS-L-SK.FLYI-L
Q676G9_RHIRD/94-340--------------------------------------TGSMYFLAPI----------LSTYID-SKS-L-SK.FLYI-L
B5JNG5_9BACT/22-272--------------------------------------TILQFFAISL----------ISHQLT-LKE-R-GT.YILI-I
A6VTF9_MARMS/19-265--------------------------------------SLSQIVIVIF----------IAREGL-MLD-L-SF.YTMA-I
B9EAW7_MACCJ/18-258--------------------------------------GVSQWIILLG----------ILKIFG-VYD-A-GI.YSLG-V
C2KV49_9FIRM/32-288--------------------------------------ALASMVLAFF----------VLRLGG-EEQ-G-GI.FGFG-Y
A4EAS6_9ACTN/45-291--------------------------------------GMAFPLLTIV----------STQLVG-AEE-A-GK.FSIA-F
A6Q4F3_NITSB/16-266--------------------------------------MGINFLFKIY----------LSYKIS-KHE-L-GL.FYTF-M
Q8EFK4_SHEON/26-281--------------------------------------IVVGFLFKLW----------LAQWVA-KAD-L-AL.YHTV-I
A6WPP6_SHEB8/25-280--------------------------------------ISVGFLFKLW----------LAQWVA-KAD-L-AL.YHTV-I
A1RKH9_SHESW/25-280--------------------------------------ISIGFLFKLW----------LAQWVA-KAD-L-AL.YHTV-I
A4Y617_SHEPC/25-280--------------------------------------ISIGFLFKLW----------LAQWVA-KAD-L-AL.YHTV-I
E6XI49_SHEP2/25-280--------------------------------------ISIGFLFKLW----------LAQWVA-KAD-L-AL.YHTV-I
A6FGK5_9GAMM/27-282--------------------------------------IAIGFSFKIW----------LAHWIP-KDD-L-AL.FHSV-V
B8CST1_SHEPW/46-301--------------------------------------ISLGLAFKVW----------LAQWVA-KSD-L-AL.YHTV-V
A8UIN6_9FLAO/18-257--------------------------------------PLFNFFIAII----------GIKFFG-KEN-W-GE.VIDI-L

PF01943

SP5B_BACSU/6-308--------------------------------------FLKGTLILIA----------AG-MVT-RMLGFVNRVVIARFI
CAPF_STAAU/1-264--------------------------------------MVKNFNYMFV----------AN-ILS-ALCKFLILLVIVRLG
O87185_STRAG/6-275--------------------------------------LLQSGFIYTL----------GN-LLV-QGLAFITLPIYTRVI
EXOT_RHIME/10-277--------------------------------------VTRNVGWSVL----------SK-TGT-FGLKFVTVPILARIL
TUAB_BACSU/10-277--------------------------------------SGAKWTSIST----------MC-ITI-..IQIVQFALLGNMM
O06039_LACLC/3-269--------------------------------------LIKNYLMTSS----------YQ-LLI-IILPIITTPYISRVL
RFBX_ECOLI/8-279--------------------------------------LRRNVIYLAV----------VQ-GSN-YLLPLLTFPYLVRTL
YCP11_KLEPN/9-277--------------------------------------KSTKWSALSS----------LT-IIV-..LGFLQMVILSRIL
RFBE_SHIFL/3-283--------------------------------------IIKNSVWNLF----------GY-AIP-TLIAIPSLGFLARGL
O58158_PYRHO/7-277--------------------------------------IAKNMAVLFL----------AR-IVS-MLFGFFYVMYTARHL
O26447_METTH/15-286--------------------------------------VLDNIISLTG----------IQ-LVQ-YLLPLITFPYLTRVL
YTGP_BACSU/5-320--------------------------------------LLRGTFVLTL----------GT-YIS-RILGMVYLIPFSIMV
Y1068_METJA/7-302--------------------------------------AVKGVSWHLL----------SY-FLA-APIAYLVRVLYANEI
Q56865_YEREN/18-287--------------------------------------ALRNSGWLIF----------DK-IAS-LTIGLWVGILLAKYL
Q56913_YEREN/4-274--------------------------------------LRRNIFSLLL----------LQ-GSN-YIIPLLTLPYLTRVL
O07870_STRPN/6-276--------------------------------------IKLNALLNIV----------LT-LSN-IIFPLITFPYISRIL
O58127_PYRHO/9-279--------------------------------------LIKNAAWLFG----------AE-IIS-KLLAYGVIVILSRTL
O86895_STRPN/3-267--------------------------------------ILKNYAYNLS----------YQ-LLV-IILPIITTPYVTRVF
O07342_STRPN/5-273--------------------------------------ISKNLAYNIG----------YQ-LIG-IAFPLITSPYLSRIL
Y1375_METJA/3-283--------------------------------------LCKDSIYILM----------SN-LYS-KGMAYLFYFITAFLL
O52526_RHILT/10-273--------------------------------------QGSMWLSLSR----------AI-VNG-..LSALSTFVLAWYL
Q56776_XANCA/21-288--------------------------------------RAAGAAVTMI----------GQ-SAK-MIVQFGGIVLLARLL
O26479_METTH/10-276--------------------------------------LARNTAFLLV----------AT-LFT-NLAAFVWNVYLARYL
P74815_9SPHN/37-317--------------------------------------LRGQMVVGFG----------VK-GFG-AVTSFAFTWLVARAF
O29660_ARCFU/6-285--------------------------------------VLKNVIYNSS----------SV-LIG-NLAGLVISIYVARVL
O26467_METTH/18-289--------------------------------------LAENFLSLST----------LQ-VLV-YIIPFITLPYLTRVL
O26442_METTH/7-278--------------------------------------IVKNIGVTGS----------AQ-ILT-ALMSFVFMIYLARFL
YABM_BACSU/12-309--------------------------------------IWQGAFVLIL----------AG-VIT-KILSAVYRVPFQNIV
WZXC_ECOLI/9-276--------------------------------------SGAKWSAIAT----------VI-IIG-..LGLVQMTVLARII
O85002_STRPN/7-276--------------------------------------LAKNTGIFAL----------AN-FSS-KILIFLLVPIYTRVL
RFBX_SHIDY/1-270--------------------------------------MKKNILLLFL----------VH-GAN-YLFPFIVLPYQTRIL

PF01554

C5W5G6_ECOBD/100-262--------------------------------------PIFMENACVL..........LMGVLS-TFL-VSWL..GKDAM
C5W5G6_ECOBD/330-491--------------------------------------PASVESVLFT..........SGRLLT-QMF-VAGM..GTSVI
O51531_BORBU/22-182--------------------------------------PTAIEFFLFN..........FISLTD-NAM-VAYL..GDYPV
YOEA_BACSU/28-189--------------------------------------PLLLSNVLQS..........VGQLVG-MMA-VGRW.LGVDAV
YOEA_BACSU/257-418--------------------------------------PASINMILVS..........LSEIAV-ISF-VNHY..GSNAT
O66528_AQUAE/245-406--------------------------------------PTALERAITT..........LSFNVF-VGF-LAKF..GDKVL
YPNP_BACSU/241-402--------------------------------------PAGLQMMVIT..........GGMMAI-MSV-VNSY..GDHVV
NORM_VIBPA/243-404--------------------------------------PVAAALFFEV..........TLFAVV-ALL-VSPL..GPIIV
O80695_ARATH/278-441--------------------------------------ASAVMLCLES..........WYSQIL-VLL-AGLLKNPELAL
O26414_METTH/244-409--------------------------------------PASAEFLVMS..........MVTALL-NWI-LTSV.AGTSAV
O33729_STRPN/24-185--------------------------------------PILLSNIFQQ..........LYNTAD-VLI-VGRF.LGQESL
O59471_PYRHO/14-174--------------------------------------PAIMGNISQT..........LLNLVD-TMI-VGHV..SAVAL
O28801_ARCFU/21-180--------------------------------------PMVVSNLIFT..........LYNLVD-GIW-VAGL..GPDAL
YISQ_BACSU/27-187--------------------------------------PIFIEVSLYM..........FMGNAD-TLM-LSQY..SDNSV
Y709_METJA/243-408--------------------------------------PSALIEITVA..........VSFFIM-TSI-IMMV.GDSRGL
YPNP_BACSU/21-182--------------------------------------PIMLGNALQV..........SFQFID-SLW-IGNL.LGAKAL
O25454_HELPY/214-375--------------------------------------PAGFERLLSL..........FSLILL-SKF-VASY..GDKVL
NORM_BACSU/20-180--------------------------------------PIFITQAGLS..........LITFLD-TVM-SGKV..SPADL
HMRM_HAEIN/249-410--------------------------------------PIAIAICCEV..........ALYALT-SLM-LSPL..GATIV
O49713_ARATH/195-358--------------------------------------GSAVMICLEL..........WYTQIL-VLL-AGLLKDPALSL
O49660_ARATH/262-426--------------------------------------PCCLTVCLEW..........WCYEIL-VLL-TGRLPNPVQAV
O82752_ARATH/42-203--------------------------------------PLILTGLLLY..........SRSMIS-MLF-LGRL.NDLSAL
DINF_ECOLI/35-196--------------------------------------PMIFSNITVP..........LLGLVD-TAV-IGHL.DSPVYL
O23067_ARATH/280-459--------------------------------------GIAIAQVVYVVGWCKDGWKGLSWLAF-QDV-WPFL..KLSFA
Q9ZK32_HELPJ/23-184--------------------------------------PLVFSMISLS..........TYSMVD-GMF-VGKK.LGKEAI
Q9ZVH5_ARATH/238-401--------------------------------------PSAISVCLEY..........WWYEIM-LFL-CGLLGNPKASV
O28801_ARCFU/239-404--------------------------------------PASLSMLTMS..........VAFMLI-NRV-VIET.GGSEGL
O58340_PYRHO/26-186--------------------------------------PLIINNLVQV..........MYNLTD-TFW-LAKL..GRAEL
Q38956_ARATH/275-438--------------------------------------ASAVMLCLEV..........WYFMAI-ILF-AGYLKNAEISV
O58340_PYRHO/247-408--------------------------------------PASISESTNS..........FGFVLL-NRI-IYTY..GTVAF
O33729_STRPN/246-408--------------------------------------AMGLMSSIVS..........IGSVIL-QFS-VNTF..GAVII
ERC1_YEAST/174-335--------------------------------------PLIFTFILQN..........SLSLAS-IFS-VSHL..GTKEL
Q9ZVH5_ARATH/16-176--------------------------------------PIVMTSLLIF..........SRSIIS-MWF-LSHL..GKVEL
O80785_ARATH/37-197--------------------------------------PLIAVSLLQF..........CLQIIS-VMF-VGHL..GSLPL
O73981_PYRHO/41-201--------------------------------------PIIINNLIQV..........LYNITD-TFW-LGKL..GRAAL
O59471_PYRHO/238-404--------------------------------------PTMLERGLFS..........FYNFLY-VSI-VARF..GEIAL
YAO6_SCHPO/17-177--------------------------------------PVILGYALQN..........SLQTSS-VIV-TGRL..GPSEL
O82752_ARATH/264-427--------------------------------------PSCVSVCLEW..........WWYEIM-ILL-CGLLLNPQATV
O51429_BORBU/27-187--------------------------------------PIVITNIIQA..........FYDLTD-MFY-VGKL..GAMPL
O83871_TREPA/32-196--------------------------------------PVMLHSFIQT..........GISFLD-NVM-VSRL..GDVKM
O51429_BORBU/248-409--------------------------------------PSTFGQIMVS..........LSFFIF-NYI-VIEI..SPKFL
O23067_ARATH/98-258--------------------------------------PIAFNILCNY..........GVNSFT-SIF-VGHI..GDLEL
YISQ_BACSU/252-413--------------------------------------PSAGEQLSYN..........LSQMIV-TYF-IAIM..GAQAL
O66528_AQUAE/25-183--------------------------------------PIIVVNLLYT..........VENMIS-MIL-VSSI..SPSAV
O51530_BORBU/21-181--------------------------------------PTAFESLLFQ..........MVTFFD-NFM-ISYL..GSFHV
Y709_METJA/21-181--------------------------------------PIIVATFIES..........IYSLVD-SIW-VSGL..GADAL
NORM_BACSU/247-408--------------------------------------PIGFAVFFET..........SIFAAV-TLL-MSHF..HTVTI
NORM_VIBPA/17-176--------------------------------------PVLIASVAQT..........GMGFVD-TVM-AGGV..SATDM
O26414_METTH/24-183--------------------------------------PLIVAMLLTS..........IYNLVD-AVW-VAGL..GGEAL
HMRM_HAEIN/22-181--------------------------------------PILLAQIAQN..........SMGLAD-TIM-AGRV..SSTDM
YD338_YEAST/238-397--------------------------------------PLIFTFLLEQ..........IFPMVC-SLT-VGHL..GKNEL
O73981_PYRHO/262-424--------------------------------------PSSIGQSANS..........FGFVVL-TRI-IMGF..GDVTY
MDTK_ECOLI/17-177--------------------------------------PVILAQIAQT..........AMGFVD-TVM-AGGY..SATDM
Q38956_ARATH/55-215--------------------------------------PAIFTSVNQY..........SLGAIT-QVF-AGHI..STIAL
P71616_MYCTU/19-179--------------------------------------PALGVLAAEP..........LYLLFD-IAV-VGRL..GAISL
O49660_ARATH/40-200--------------------------------------PLVVMNLL.W..........FGKMTT-TSV-FLGR.QGELNL
O80695_ARATH/57-217--------------------------------------PAIFVYVINN..........GMSILT-RIF-AGHV..GSFEL
MDTK_ECOLI/244-405--------------------------------------PIALALFFEV..........TLFAVV-ALL-VSPL..GIVDV

PF04506

RFT1_SCHPO/9-527ESNKSKKLSDQLQLIKNT..SLISV.YIG---------IVISLLVSLF----------YFYSLP-N......FPYSKTCI
RFT1_DROME/7-556QLINQMWLTVPICAVLCAPCLYIWLNWLS---------AVDAIYASQY----------EFACYA-VAFSCVLELMAESAV
RFT1_CAEEL/1-519KFINLLWLSPIISTVISVVCVYLWYAFSS---------TSDEVSWSVL----------LSFPIS-A....IIESIAEPFS
RFT1_YEAST/17-572EYQETHYKSKVLQTAVNF..AYIPF.WIG---------FPLSIGLIAW----------QYRNIN-AYF..ITLPFFRWSI

PF14667

A0AF13_LISW6/361-504.LQ.--------------GF------------------GKII----VPAVG-----------------------------
A0NHL2_OENOE/387-534.IQ.--------------GL------------------GHAR----TAMKA-----------------------------
A0RJU4_BACAH/372-520.LQ.--------------GI------------------NQQK----HAIIA-----------------------------
A1ASY9_PELPD/345-481.IM.--------------AM------------------EKTR----SLMYI-----------------------------
A1BJ49_CHLPD/337-476.FA.--------------MT------------------GHSR----IILLN-----------------------------
A1HLQ5_9FIRM/371-513.LQ.--------------GL------------------GHTA----IPVVN-----------------------------
A1ILY9_STROR/319-458.LI.--------------PH------------------NQNK----EFMIS-----------------------------
A1S103_THEPD/335-472.FQ.--------------GV------------------GDTR----ANLEA-----------------------------
A1YVF6_LACJH/321-459.LL.--------------PI------------------HRQK----QFTWS-----------------------------
A2RG74_STRPG/377-525.LQ.--------------AL------------------FENR----KAIYY-----------------------------
A2RHU4_LACLM/321-459.LL.--------------PL------------------NRMR----EFTTS-----------------------------
A2RMM4_LACLM/390-539.LT.--------------VM------------------DHKR----LAMRI-----------------------------
A2STD2_METLZ/331-469.LT.--------------AS------------------DHAR----QAFYA-----------------------------
A3CPL5_STRSV/375-523.IQ.--------------AL------------------FQNR----KAIIY-----------------------------
A3CVY7_METMJ/333-471.LN.--------------AL------------------DRPK----DSFKV-----------------------------
A3DHV8_CLOTH/327-465.IK.--------------AL------------------GYSD----LILKI-----------------------------
A3DIV8_CLOTH/358-500.MN.--------------GL------------------GKQG----ILLRN-----------------------------
A3F4D6_LACLC/321-459.LL.--------------PT------------------NQNK----SYTVS-----------------------------
A3I8W7_9BACI/372-521.LQ.--------------GI------------------DFQK----WIVFS-----------------------------
A3IEA1_9BACI/365-514.LQ.--------------GY------------------GKLK----KPALF-----------------------------
A3W1Y0_9RHOB/329-468.LI.--------------AV------------------GRAK----TALQI-----------------------------
A4FX93_METM5/354-492.LN.--------------GI------------------GKPA----LSTKI-----------------------------
A4IJD3_GEOTN/352-496.LQ.--------------GM------------------GKEW----AAAAG-----------------------------
A4IRX9_GEOTN/371-520.MQ.--------------GI------------------NQQR----FTVIS-----------------------------
A4SCQ1_PROVI/337-476.LA.--------------MT------------------GHAR----LSLMN-----------------------------
A4VW05_STRSY/379-527.IQ.--------------AI------------------FENR----RAIYY-----------------------------
A5D2G5_PELTS/358-502.LQ.--------------GL------------------GEAS----RPLRN-----------------------------
A5ITS6_STAA9/386-533.LQ.--------------GI------------------DKQK----LTVYV-----------------------------
A5LCT3_STRPN/372-520.LQ.--------------AM------------------FRNR----KAVLY-----------------------------
A5M4K0_STRPN/211-349.LI.--------------PR------------------AKDK----DYVLS-----------------------------
A5UNI7_METS3/328-460.LN.--------------AS------------------HRET----AVTKI-----------------------------
A5UQJ1_ROSS1/330-463.IL.--------------AA------------------GQQS----AFVPL-----------------------------
A5UWW7_ROSS1/374-505.LI.--------------AL------------------RRQQ----SITVA-----------------------------
A5VL26_LACRD/382-530.MQ.--------------GI------------------SENK----KMMMF-----------------------------
A5ZUX1_9FIRM/326-464.FI.--------------PF------------------GKEL----YTCIA-----------------------------
A6CQJ8_9BACI/372-520.LQ.--------------GI------------------DKQK----FTILS-----------------------------
A6CR25_9BACI/352-499.LQ.--------------GI------------------ELIY----FPALT-----------------------------
A6DHF1_9BACT/293-436.MN.--------------SL------------------GVFT----KGRLV-----------------------------
A6NPI5_9FIRM/351-494.LS.--------------GI------------------GRQA----AAARS-----------------------------
A6QEF7_STAAE/343-485.LQ.--------------AQ------------------HAVR----PIFVG-----------------------------
A6TN15_ALKMQ/363-506.LQ.--------------GI------------------GKVY----IPVRN-----------------------------
A6TSY6_ALKMQ/375-519.LH.--------------GL------------------GKQV----VTTIN-----------------------------
A6UPA0_METVS/351-488.FN.--------------GI------------------GKPY----LSTKI-----------------------------
A6UU30_META3/353-490.LN.--------------GI------------------GKPS----LSTKI-----------------------------
A7GJW7_BACCN/360-506.LQ.--------------GL------------------GQTL----KPALF-----------------------------
A7HKJ9_FERNB/322-460.MV.--------------PM------------------KKEN----YLTIS-----------------------------
A7VPC0_9CLOT/355-497.LK.--------------GL------------------NEQL----SYLSY-----------------------------
A7VWY4_9CLOT/433-577.LQ.--------------AV------------------GRVD----LPVKL-----------------------------
A7Z0I0_BACA2/354-499.LQ.--------------GA------------------GHTV----FPAVS-----------------------------
A7Z7U6_BACA2/375-524.LQ.--------------GI------------------NKQK----FAVVS-----------------------------
A8F924_BACP2/360-506.LQ.--------------GL------------------GHTV----YPAVV-----------------------------
A8MIG9_ALKOO/365-508.LQ.--------------GM------------------NRVY----IPLRS-----------------------------
A8MK38_ALKOO/363-506.LQ.--------------GL------------------GKPE----IPVRN-----------------------------
A8RUL6_9CLOT/387-539.LQ.--------------GL------------------NHMD----VPIRH-----------------------------
A8SAU1_9FIRM/356-502.MK.--------------GI------------------GEQK----AAFRY-----------------------------
A8UAN8_9LACT/362-510.FQ.--------------SQ------------------NKHK----VALIG-----------------------------
A8UCR2_9LACT/391-539.MQ.--------------AA------------------NQTR----PALWA-----------------------------
A9EQ86_SORC5/331-462.LL.--------------AA------------------KREV----AMVKL-----------------------------
A9WAD6_CHLAA/337-475.LI.--------------AA------------------ERTA----ALNVI-----------------------------
B0K3R2_THEPX/360-504.LH.--------------GL------------------GKQT----VVLKN-----------------------------
B0MPG6_9FIRM/391-534.FQ.--------------VI------------------GRSD----LPVKL-----------------------------
B0N362_9FIRM/290-427.LI.--------------PN------------------KKDK----IYIVS-----------------------------
B0PEA8_9FIRM/441-584.LQ.--------------AI------------------GRAD----LPVKL-----------------------------
B0TAY6_HELMI/361-505.LQ.--------------GL------------------GMVV----FPLLV-----------------------------
B0VF98_CLOAI/326-465.FQ.--------------AF------------------GKTR----FVMYN-----------------------------
B1MY12_LEUCK/485-634.LQ.--------------AL------------------SEVS----IVIKA-----------------------------
B1SH45_9STRE/377-525.LQ.--------------AL------------------FENR----KAINY-----------------------------
B1YGP9_EXIS2/345-491.LQ.--------------SV------------------DAEK----YAFVG-----------------------------
B1YKH1_EXIS2/386-534.LQ.--------------GI------------------NRQY----FTIIA-----------------------------
B2A2Z4_NATTJ/361-504.LQ.--------------GL------------------NKPM----IPVKN-----------------------------
B2A8K9_NATTJ/363-507.LQ.--------------GT------------------GYPV----LPVKN-----------------------------
B2GDL9_LACF3/322-460.LM.--------------PV------------------NRVK----EYTIS-----------------------------
B3EHD9_CHLL2/365-504.LS.--------------MA------------------GHAR----VTFLN-----------------------------
B3EP69_CHLPB/337-475.LQ.--------------MT------------------GYPK----LCAIN-----------------------------
B3W6R7_LACCB/364-511.MQ.--------------AV------------------HHSR----LAIKY-----------------------------
B3WAP5_LACCB/356-499.LQ.--------------SL------------------DQYA----GISVA-----------------------------
B3WCD6_LACCB/380-528.LQ.--------------GL------------------FNNR----LAIQE-----------------------------
B3XNV8_LACRE/322-460.LM.--------------PI------------------SRTK----EYTIS-----------------------------
B4AGJ7_BACPU/343-486.PT.--------------AF------------------NRLK----VPAVV-----------------------------
B4SBS0_PELPB/338-477.LA.--------------MT------------------GHAR----LSLLN-----------------------------
B5CWR8_9BACE/324-466.YQ.--------------AA------------------GKTN----WLFYG-----------------------------
B5UWQ0_BACCE/360-510.LQ.--------------GL------------------GQTF----KPALF-----------------------------
B6IYF6_RHOCS/343-484.LR.--------------GV------------------GHAG----RFMLL-----------------------------
B6YVL8_THEON/328-461.LE.--------------AS------------------NRQA----IVTRT-----------------------------
B7AQB6_9FIRM/351-493.LN.--------------GL------------------GKTG----YTFVC-----------------------------
B7DPH6_9BACL/373-525.LQ.--------------GL------------------GKMY----RPVRN-----------------------------
B7DPL3_9BACL/356-497.LQ.--------------GL------------------NRAF----VSTVI-----------------------------
B7GFI4_ANOFW/350-497.LQ.--------------GL------------------GDVF----RPFFV-----------------------------
B7GMA5_ANOFW/366-505.LQ.--------------GV------------------GESK----RAAVI-----------------------------
B7JJF5_BACC0/376-524.LQ.--------------GI------------------DYQR----KTMIA-----------------------------
B8D0L3_HALOH/359-505.LN.--------------GL------------------GKPQ----LALLN-----------------------------
B8D178_HALOH/340-478.NV.--------------MT------------------GHPH----YELYT-----------------------------
B8DHB8_LISMH/370-518.LQ.--------------GI------------------DEQR----FTVLG-----------------------------
B8IEZ7_METNO/324-461.FQ.--------------IR------------------RRTR----PVIAA-----------------------------
B8IGJ3_METNO/336-472.II.--------------GM------------------ERSD----FSFYL-----------------------------
B9CVC4_STACP/347-489.LQ.--------------VL------------------NRIR----PILVG-----------------------------
B9DSP4_STRU0/342-480.MF.--------------IE------------------ENQK----KSFIY-----------------------------
B9E7H2_MACCJ/374-522.LQ.--------------GI------------------DKQA----MTVYI-----------------------------
B9E8U7_MACCJ/341-481.LQ.--------------IY------------------NAFR----IQLVA-----------------------------
B9JKJ2_AGRRK/321-464.SL.--------------AL------------------DRPH----ILFRL-----------------------------
B9K2D6_AGRVS/332-468.LF.--------------AL------------------DKIR----QRLFV-----------------------------
C0QCL2_DESAH/352-496.LA.--------------AT------------------GHIS----FSAKM-----------------------------
C0WBK9_9FIRM/378-517.LQ.--------------GL------------------GKTR----IPVIN-----------------------------
C0WLU0_LACBU/374-518.LQ.--------------AL------------------HYSK----KAMFY-----------------------------
C0WQN7_LACBU/354-501.LQ.--------------AH------------------GYYA----PTMLA-----------------------------
C0WUG9_LACBU/378-530.MQ.--------------GL------------------SQNR----RAVKF-----------------------------
C0WVB1_LACFE/322-460.LM.--------------PI------------------DRVK----EYTVS-----------------------------
C0X1V9_ENTFL/370-519.LQ.--------------AL------------------SFHK----KAMQI-----------------------------
C0X279_ENTFL/382-530.LM.--------------GM------------------YENR----DAMRY-----------------------------
C0X942_ENTFL/359-507.EQ.--------------SR------------------NRFK----GPLVA-----------------------------
C0Z9G8_BREBN/364-513.LQ.--------------GI------------------GKEK----IPARH-----------------------------
C0ZAP4_BREBN/363-505.LQ.--------------GL------------------DYAQ----VVFRN-----------------------------
C0ZHE2_BREBN/367-517.LQ.--------------GL------------------GRVM----RPARN-----------------------------
C1I2F0_9CLOT/325-463.TI.--------------PT------------------SKNR----EYVIP-----------------------------
C1IAW5_9CLOT/354-498.MQ.--------------GI------------------GHYI----RPIIN-----------------------------
C2D643_LACBR/210-348.LL.--------------PV------------------NRVK----EFTTS-----------------------------
C2E7U4_LACJH/384-532.LQ.--------------GL------------------SENG----LAIKY-----------------------------
C2EED2_9LACO/381-529.LQ.--------------GI------------------YENT----IAIKF-----------------------------
C2EHH6_9LACO/356-502.LQ.--------------SI------------------DEYR----VLLIG-----------------------------
C2EP42_9LACO/342-483.LL.--------------AL------------------NMNK----LAVIY-----------------------------
C2H7P1_ENTFC/381-529.LQ.--------------GM------------------FENR----AAISY-----------------------------
C2HEH9_ENTFC/359-507.AQ.--------------SK------------------NSFR----PSLKG-----------------------------
C2KAZ9_9LACO/380-528.LQ.--------------GL------------------SENG----LAIKY-----------------------------
C2KJQ1_LEUMC/329-467.LV.--------------PT------------------KRLN----EFTLS-----------------------------
C2KKY7_LEUMC/498-647.LQ.--------------AL------------------SEVE----IVMKA-----------------------------
C2LQ70_STRSL/432-580.LQ.--------------AI------------------FETR----KAINY-----------------------------
C2M158_STAHO/360-502.LQ.--------------VM------------------NHIR----PIFIG-----------------------------
C2YMP0_BACCE/352-495.LQ.--------------GI------------------NRSK----QAAWI-----------------------------
C3HRG9_BACTU/323-461.AL.--------------AF------------------EKDK----QYVLP-----------------------------
C4FB42_9ACTN/325-467.LL.--------------PL------------------SRDR----EYTLS-----------------------------
C4FNY8_9FIRM/361-503.LQ.--------------GL------------------GRTV----IPMVA-----------------------------
C4FPR1_9FIRM/359-501.LQ.--------------GL------------------NKPR----IPVIN-----------------------------
C4FUC9_9FIRM/947-1095.LQ.--------------AM------------------NFRR----LSIWH-----------------------------
C4G0V0_ABIDE/374-518.IQ.--------------SI------------------YSMM----IPVIL-----------------------------
C4GB38_9FIRM/387-530.LQ.--------------GI------------------DHLN----LPIIH-----------------------------
C4RGH8_9ACTO/364-502.LN.--------------MA------------------GRTS----WTFYN-----------------------------
C4V2B6_9FIRM/374-517.LQ.--------------GL------------------GHPT----IPMVN-----------------------------
C4XGJ8_DESMR/335-465.LV.--------------AI------------------GRQR----YALYY-----------------------------
C5A2Y0_THEGJ/342-480.LT.--------------VI------------------GNTG----FLTVS-----------------------------
C5D378_GEOSW/360-505.LQ.--------------GM------------------GYEW----IAVAG-----------------------------
C5NWI0_9BACL/318-458.LV.--------------VR------------------NKNK----EYMLS-----------------------------
C5Q1B2_STAAU/332-469.LL.--------------IV------------------NKIR----LYNAS-----------------------------
C5RB06_WEIPA/501-648.YQ.--------------GL------------------GRLR----YTVRL-----------------------------
C5RD31_WEIPA/359-505.LQ.--------------SL------------------DYTR----GVSWF-----------------------------
C6A0B5_THESM/328-456.MV.--------------VI------------------NKQK----FTFKV-----------------------------
C6CSD9_PAESJ/327-465.LI.--------------PN------------------NLDS----IFVKS-----------------------------
C6J0R0_9BACL/364-511.LL.--------------GV------------------GKAN----LSMVH-----------------------------
C6JQC3_FUSVA/323-462.SI.--------------PH------------------NKEK----NTFYG-----------------------------
C6PQD8_9CLOT/131-275.LQ.--------------GV------------------GEYV----MPIVN-----------------------------
C6SP25_STRMN/377-525.LQ.--------------AL------------------FENR----KAIRY-----------------------------
C6VKW0_LACPJ/357-507.LQ.--------------SL------------------NEYT----AMIIG-----------------------------
C7GE86_9FIRM/383-527.LQ.--------------GI------------------GRMK----EPIKN-----------------------------
C7GYH1_9FIRM/373-517.LQ.--------------GI------------------EKQF----RPVRN-----------------------------
C7NM90_HALUD/327-463.GY.--------------SY------------------NIDK----GVARA-----------------------------
C7NSL6_HALUD/319-457.LQ.--------------AL------------------DRPD----LAAYA-----------------------------
C7NSR3_HALUD/331-469.VN.--------------AV------------------DRPD----ASMRV-----------------------------
C7P069_HALMD/318-461.LS.--------------GI------------------DRPG----EAFKV-----------------------------
C7XZJ3_9LACO/375-523.QQ.--------------GL------------------SENI----LAIKY-----------------------------
C8NE09_9LACT/413-561.LQ.--------------SM------------------EQHI----IAIKA-----------------------------
C8NI78_9LACT/366-514.FQ.--------------SQ------------------HQYP----KTLLA-----------------------------
C8PCY7_9LACO/375-523.LQ.--------------GL------------------SENG----LAIKY-----------------------------
C8VXJ1_DESAS/366-509.LQ.--------------GI------------------GKIS----IPVRN-----------------------------
C8WQG9_ALIAD/361-502.LQ.--------------GL------------------NRAG----TAMVN-----------------------------
C9A2J3_ENTGA/381-529.LQ.--------------GM------------------YHNT----EAVIF-----------------------------
C9A420_ENTGA/359-508.QQ.--------------SR------------------NQFR----VGIYA-----------------------------
C9L817_RUMHA/12-160.LQ.--------------GI------------------GKAN----IPMIN-----------------------------
C9LAR2_RUMHA/325-463.LI.--------------PR------------------SKDK----EYTIS-----------------------------
C9LLX4_9FIRM/363-506.LQ.--------------GM------------------GKTA----VPFIN-----------------------------
D0BKY7_9LACT/382-530.QQ.--------------SM------------------QQHM----IAIKA-----------------------------
D0BM46_9LACT/352-499.LQ.--------------ST------------------GKYS----ITLIA-----------------------------
D0BME9_9LACT/319-458.LI.--------------PH------------------NKHK----QFMVS-----------------------------
D0LQE6_HALO1/374-513.LN.--------------GA------------------GHTR----EAILC-----------------------------
D1Z261_METPS/328-462.FS.--------------ST------------------NHQR----LTTVI-----------------------------
D2BMG7_LACLK/323-465.WQ.--------------SR------------------NLTK----IQSVS-----------------------------
D2EHX4_PEDAC/355-503.LQ.--------------SM------------------GRLK----MTFWA-----------------------------
D2EJ27_PEDAC/321-459.LL.--------------PT------------------NQNG----AYTKS-----------------------------
D2ELV8_PEDAC/393-541.MQ.--------------GI------------------GENV----LAVKY-----------------------------
D2RVV2_HALTV/336-474.LD.--------------YL------------------GRAR----SRAIL-----------------------------
D2RXY9_HALTV/340-478.LD.--------------YL------------------GRAR----HRAIA-----------------------------
D3AN52_9CLOT/376-519.LN.--------------GL------------------GKTS----TTFIQ-----------------------------
D3E759_GEOS4/381-532.LQ.--------------GI------------------GMVK----GPAIH-----------------------------
D3FFB8_CONWI/338-471.VL.--------------AL------------------GDEK----HYLLA-----------------------------
D3FR13_BACPE/361-509.LQ.--------------GY------------------GYVH----IPAWV-----------------------------
D3FXP2_BACPE/374-522.LQ.--------------GM------------------NRQK----QAVLS-----------------------------
D3FZH8_BACPE/357-501.LQ.--------------GA------------------NREF----AAAII-----------------------------
D3LVV9_9FIRM/358-500.LQ.--------------GM------------------GRTV----IPLVN-----------------------------
D3LX29_9FIRM/358-500.LQ.--------------GL------------------KKPK----IPVMN-----------------------------
D3QG68_STALH/343-485.LQ.--------------VF------------------NEVA----TVMIS-----------------------------
D3SSH7_NATMM/337-474.SQ.--------------GN------------------GTLR----YPVAA-----------------------------
D3STC0_NATMM/337-475.LD.--------------YL------------------GRAK----HRAIS-----------------------------
D3UNL4_LISSS/370-518.LQ.--------------GI------------------DEQR----YTVLS-----------------------------
D4G1Q3_BACNA/318-464.WT.--------------AF------------------NQQK----TPAIV-----------------------------
D4G3E4_BACNA/359-505.LQ.--------------GA------------------GYTV----FPAIA-----------------------------
D4GU68_HALVD/319-457.LQ.--------------AL------------------NQPG----LAARA-----------------------------
D4LGF1_9FIRM/327-469.YNI--------------TQ------------------GREK----ENLMA-----------------------------
D4W1F1_9FIRM/338-485.MQ.--------------QE------------------GQYS----RLVMS-----------------------------
D4W2K6_9FIRM/377-526.LQ.--------------GI------------------GGQW----YGIAF-----------------------------
D4YGG7_9LACT/385-532.LQ.--------------AQ------------------GQWY----KAGIA-----------------------------
D4YJ56_9LACT/433-583.LQ.--------------AM------------------SFFK----DAIMG-----------------------------
D4YX22_SPHJU/336-476.SN.--------------AV------------------GRPG----TTARI-----------------------------
D5D970_BACMD/362-511.LQ.--------------GM------------------GAVF----APVIA-----------------------------
D5DN36_BACMD/374-521.LQ.--------------GI------------------NKQK----YAVLS-----------------------------
D5DY76_BACMQ/331-468.WE.--------------LS------------------KDTK----KIFLH-----------------------------
D5E4C9_BACMQ/373-523.LQ.--------------GI------------------NQQK----KVIIG-----------------------------
D5QEL1_GLUHA/351-483.LD.--------------GI------------------GRAE----MNAIL-----------------------------
D5T1U4_LEUKI/363-511.MQ.--------------SL------------------LKTK----LILYY-----------------------------
D5TQD2_BACT1/321-460.LI.--------------PT------------------NQSN----KYSIA-----------------------------
D5UPU7_TSUPD/350-482.LF.--------------AA------------------HDQV----FLLRL-----------------------------
D5VU50_METIM/353-494.LN.--------------GI------------------GKSF----LSIKI-----------------------------
D5WSL0_BACT2/373-521.LQ.--------------GM------------------GMTV----RPVVN-----------------------------
D5X9J9_THEPJ/361-503.LQ.--------------GL------------------GRTH----LPVKN-----------------------------
D5XD05_THEPJ/326-457.LL.--------------AC------------------NQQK----KLTTI-----------------------------
D6KSV4_SCAIO/332-470.LL.--------------PT------------------HQDN----AYTLS-----------------------------
D6XV50_BACIE/360-507.WH.--------------AV------------------GKAG----KPAVW-----------------------------
D6Y0K7_BACIE/382-530.LQ.--------------GL------------------NRQK----VAVLA-----------------------------
D7BDH0_MEISD/336-473.LG.--------------AI------------------RRPW----ATIPL-----------------------------
D7D534_GEOSC/329-466SFQ.--------------LG------------------KKTT----LQIWP-----------------------------
D7DRX9_METV3/353-490.LV.--------------GV------------------GKPQ----IATKF-----------------------------
D7E977_METEZ/332-466.IY.--------------LE------------------KKTK----TIGKI-----------------------------
D7UUI0_LISGR/356-499.LQ.--------------GF------------------GKLY----IPVIS-----------------------------
D7WQC4_9BACI/353-489.LQ.--------------AI------------------GEAR----AAMMN-----------------------------
D8GMK0_CLOLD/327-460.LT.--------------AW------------------GLQK----KYMKI-----------------------------
D8ILC9_LACSC/25-170.NN.--------------AF------------------GHFV----ELKKK-----------------------------
D8J472_HALJB/339-477.LD.--------------FL------------------GRAR----ARAVS-----------------------------
D8J725_HALJB/340-478.LQ.--------------GL------------------GYSR----LVLCN-----------------------------
D8J7W8_HALJB/319-457.LR.--------------GI------------------DRVD----LVARA-----------------------------
D8MET9_LEUGT/321-460.LI.--------------PS------------------GLNK----EYIGS-----------------------------
D8PBA0_9BACT/336-473.IQ.--------------AG------------------GEGG----HLVRL-----------------------------
D9PYX0_METTM/350-483.AQ.--------------GI------------------GYPR----LPMYV-----------------------------
D9QSV7_ACEAZ/363-507.LQ.--------------GI------------------GKTV----IPARN-----------------------------
E0I7A7_9BACL/353-491.FE.--------------IK------------------NKTR----TMLMF-----------------------------
E0IFR0_9BACL/366-514.LY.--------------GF------------------GKPR----IPMYN-----------------------------
E0NHN4_PEDAC/321-459.LI.--------------PT------------------NQTN----KYTIA-----------------------------
E0PD92_STREI/325-464.LL.--------------PT------------------GRDK----EYTWV-----------------------------
E0RCM4_PAEP6/382-529.LI.--------------GM------------------GKPR----ISMVN-----------------------------
E0RM54_PAEP6/373-525.LQ.--------------GL------------------GAVR----APALA-----------------------------
E0RMQ1_PAEP6/366-508.LQ.--------------AL------------------DRPG----SALLN-----------------------------
E0RUK9_BUTPB/373-516.LN.--------------HM------------------GKKL----LTTIN-----------------------------
E0S188_BUTPB/322-462.LI.--------------PY------------------NKEK----MLLVS-----------------------------
E1IAS8_9CHLR/378-523.LI.--------------AL------------------NRQT----AITRA-----------------------------
E1IEK9_9CHLR/380-529.LI.--------------VH------------------ERLG----TIIIS-----------------------------
E2ZD67_9FIRM/360-502.LQ.--------------GM------------------GHTG----IPLLN-----------------------------
E3CI47_STRDO/375-523.LQ.--------------AL------------------FENR----KAIQY-----------------------------
E3FNG9_STIAD/347-485.LT.--------------VT------------------GQGW----RVTRT-----------------------------
E3GGE0_EUBLK/365-508.LQ.--------------AI------------------DRFR----VPLIN-----------------------------
E3GZ73_METFV/328-459.LN.--------------SS------------------NRQV----TVTKT-----------------------------
E4KNA5_9LACT/790-938.LQ.--------------SM------------------DQRR----MAIRY-----------------------------
E4L4W5_9STRE/321-459.LL.--------------AS------------------KRTK----AYTYS-----------------------------
E4LZJ6_9CLOT/384-531.LM.--------------AV------------------GLRR----LNIRN-----------------------------
E4MLQ7_9FIRM/372-517.LQ.--------------AI------------------GKQN----TALIN-----------------------------
E4NUG7_HALBP/319-458.LQ.--------------GI------------------DRPD----LAAWA-----------------------------
E4SMU5_LACAR/327-469.LI.--------------PA------------------KREK----MVLKN-----------------------------
E5WAE4_9BACI/356-502.LQ.--------------GL------------------GNTC----LPAVF-----------------------------
E5WT44_9BACI/362-510.LQ.--------------GL------------------GFIF----FPAAA-----------------------------
E5X0H2_9BACE/326-464.LY.--------------VK------------------GRSD----WAFRL-----------------------------
E5Z458_9BACL/362-509.LL.--------------GI------------------GKAK----LSMVH-----------------------------
E6LD53_9ENTE/253-391.LL.--------------PT------------------NQTK----YFTIS-----------------------------
E6LEY4_9ENTE/358-506.EQ.--------------SR------------------NKVL----ASFKA-----------------------------
E6LIJ6_9ENTE/381-529.LQ.--------------GM------------------YENK----AAVQY-----------------------------
E6LN70_9FIRM/381-525.LQ.--------------GT------------------NLIN----KPVKN-----------------------------
E6MFC3_9FIRM/328-466.LV.--------------PL------------------GKEK----VVLYS-----------------------------
E6MGM4_9FIRM/373-516.LQ.--------------SI------------------DHFR----VPLIT-----------------------------
E6QMG7_9ZZZZ/367-517.LR.--------------GI------------------GKVW----EEFYY-----------------------------
E6TRQ4_BACCJ/362-512.LH.--------------AI------------------NRAR----DAALL-----------------------------
E6U1Q3_BACCJ/375-523.LQ.--------------GI------------------NRQR----YAVIA-----------------------------
E7FPH6_9LACO/355-501.LQ.--------------SM------------------NLFS----KAAFS-----------------------------
E7MM58_9FIRM/379-526.LL.--------------SL------------------KMRR----HTLIY-----------------------------
E7QQ57_9EURY/339-477.LD.--------------YL------------------GRAR----ERAWA-----------------------------
E7RE43_9BACL/368-516.LQ.--------------GI------------------NKQK----WIIIN-----------------------------
E7RL93_9BACL/356-500.LQ.--------------GI------------------NKAR----LGAWI-----------------------------
E7RLD1_9BACL/354-503.LH.--------------GL------------------GKVR----VPAVL-----------------------------
E7RZY6_9BURK/339-474.LQ.--------------IQ------------------KRSG----RILLA-----------------------------
E7S3G0_STRAG/321-467.LL.--------------AS------------------RRTK----AYTMS-----------------------------
E8JWJ5_STRCR/327-467.LI.--------------PM------------------NRER----YFMFA-----------------------------
E8K660_STRPA/410-558.IQ.--------------AL------------------FQNR----KAIRY-----------------------------
E8LB44_9FIRM/369-509.LQ.--------------GL------------------GRTA----IPVIN-----------------------------
E8R8C0_DESM0/349-487.FA.--------------GI------------------GKTQ----EVFRS-----------------------------
E8RTH0_ASTEC/331-467.FT.--------------LS------------------KKTK----LLTVA-----------------------------
E8SIP0_STAPH/344-486.LE.--------------VH------------------EEFR----MIMKA-----------------------------
E8V165_TERSS/339-475.LR.--------------AA------------------DRQK----KLFLW-----------------------------
E9RY62_9FIRM/330-468.LV.--------------PL------------------GKER----IVLYS-----------------------------
F0DJ09_9FIRM/357-499.LQ.--------------GM------------------GEAV----KPFKN-----------------------------
F0EKD4_ENTCA/327-465.LL.--------------PF------------------KKEK----LILYS-----------------------------
F0HVE0_LACDL/327-469.LM.--------------PA------------------KRER----KNLIS-----------------------------
F0KAR0_CLOAE/326-458.LN.--------------AW------------------NMEK----KYLRA-----------------------------
F0LLW6_THEBM/342-478.LV.--------------VI------------------GESK----FIMLF-----------------------------
F0LLZ4_THEBM/339-477.LV.--------------II------------------GKTT----LNLVG-----------------------------
F0T719_METSL/333-463.LP.--------------AM------------------NRQT----TLLKI-----------------------------
F0TB30_METSL/351-484.SQ.--------------GL------------------GKPR----LPMYV-----------------------------
F0TBQ9_METSL/329-463.LQ.--------------ST------------------NKQL----IITKI-----------------------------
F0TC71_METSL/328-460.LG.--------------AI------------------NKQR----ILLIV-----------------------------
F1VXT7_9BURK/320-462.FM.--------------AT------------------GRTD----LLLRL-----------------------------
F1Z193_9STRE/350-488.FF.--------------IE------------------NHQK----RSFII-----------------------------
F2F183_SOLSS/360-508.LQ.--------------GY------------------SKLK----GPAVF-----------------------------
F2G999_ALTMD/323-469.LI.--------------SQ------------------AKTK----DAFNI-----------------------------
F2I7P9_AERUA/374-520.FL.--------------GQ------------------NQWF----YSAMA-----------------------------
F2JLQ5_CELLD/355-497.MN.--------------GL------------------GMQK----QTFKT-----------------------------
F2KQE3_ARCVS/343-481.LI.--------------AA------------------GEAK----FPTIA-----------------------------
F2NHK3_DESAR/367-498.LI.--------------AR------------------NREK----RLLRL-----------------------------
F2NKF2_MARHT/337-483.LS.--------------AI------------------NRPW----ALIPL-----------------------------
O06039_LACLC/321-459.LI.--------------PL------------------NRMK----IFTKS-----------------------------
O26442_METTH/329-460.LS.--------------SI------------------DRQG----YRMLS-----------------------------
Q03E00_PEDPA/355-503.LQ.--------------SA------------------GAVK----PTLVA-----------------------------
Q03RI1_LACBA/378-525.MQ.--------------GI------------------SQNK----RAVRY-----------------------------
Q03SZ7_LACBA/349-498.LQ.--------------SQ------------------DTYR----LTVVA-----------------------------
Q03XR0_LEUMM/330-477.LQ.--------------GL------------------SKTG----IALRA-----------------------------
Q0AHL3_NITEC/325-466.VD.--------------AL------------------GRPD----VTMRN-----------------------------
Q0AP11_MARMM/327-464.FT.--------------LM------------------RRTG----VMALV-----------------------------
Q0W809_UNCMA/331-464.FM.--------------ST------------------NRQK----TTTNI-----------------------------
Q12TY8_METBU/325-459.FQ.--------------AR------------------NVPR----IPAIV-----------------------------
Q12VM9_METBU/345-483.LN.--------------AI------------------DHPK----ESFKV-----------------------------
Q12XY4_METBU/326-458.YI.--------------SS------------------GNQG----VMAKL-----------------------------
Q18GU8_HALWD/357-496.LS.--------------AF------------------GDTR----AIFLV-----------------------------
Q1GPL1_SPHAL/342-484.TN.--------------AL------------------GKPS----ISMFT-----------------------------
Q1K412_DESAC/351-495.LS.--------------AM------------------GHVR----FTAKR-----------------------------
Q2B249_9BACI/362-508.LQ.--------------GL------------------GHTF----FPAAV-----------------------------
Q2NH55_METST/331-464.LG.--------------AI------------------NKQV----SVTKN-----------------------------
Q2NIB6_METST/328-458.IA.--------------SI------------------NKQH----ETVKA-----------------------------
Q2S953_HAHCH/328-463.YS.--------------AM------------------GRQR----LFTLI-----------------------------
Q2Y4J6_9ARCH/377-524.II.--------------GI------------------NRPD----IAAKI-----------------------------
Q2YCC1_NITMU/331-475.LA.--------------SM------------------GRAD----LSLKS-----------------------------
Q2YCG5_NITMU/323-466.LT.--------------AT------------------GDQK----TVLYS-----------------------------
Q38V74_LACSS/358-503.LQ.--------------SL------------------DQFH----KTTIA-----------------------------
Q38VP9_LACSS/378-526.LQ.--------------GL------------------YQNR----LALFY-----------------------------
Q3ADH7_CARHZ/346-484.FQ.--------------GL------------------SKPQ----TPFYI-----------------------------
Q3APG3_CHLCH/338-477.LA.--------------MS------------------GYAQ----LSLIN-----------------------------
Q3B6G9_PELLD/337-476.LA.--------------MA------------------GHSR----LSLLN-----------------------------
Q3ZK40_9LACT/322-460.LL.--------------AT------------------NKIK----IYSTS-----------------------------
Q469G3_METBF/349-484.LL.--------------AS------------------GDSD----FLMKC-----------------------------
Q46FX4_METBF/329-461.FS.--------------ST------------------NRQR----ALMIF-----------------------------
Q47U72_COLP3/338-482.LL.--------------AK------------------AQHQ----LLSVV-----------------------------
Q49V13_STAS1/337-479.LQ.--------------VK------------------NQVR----SIFQA-----------------------------
Q4JYJ9_STRPN/323-464.LI.--------------PT------------------DNVR----YFTIS-----------------------------
Q4JZ09_STRPN/330-470.LI.--------------PT------------------GNEK----YFMRA-----------------------------
Q4K189_STRPN/323-460.LI.--------------PR------------------SFDK----EYTVS-----------------------------
Q5JDW0_PYRKO/345-480.LV.--------------AV------------------GRTS----DNLIG-----------------------------
Q5LFL1_BACFN/328-466.LY.--------------PQ------------------GREK----YVIIS-----------------------------
Q5M4A4_STRT2/55-193.LI.--------------PT------------------KREK----YALYS-----------------------------
Q5V4U1_HALMA/327-465.IN.--------------GV------------------DRPD----AAFRV-----------------------------
Q5WAF7_BACSK/347-496.LQ.--------------GY------------------GKIH----IPLYA-----------------------------
Q5WE75_BACSK/374-522.LQ.--------------GM------------------DRQR----NAVLS-----------------------------
Q67JD5_SYMTH/384-522.LQ.--------------GM------------------GRIG----APVRN-----------------------------
Q8EP19_OCEIH/372-521.LQ.--------------GI------------------DQQN----YAVIS-----------------------------
Q8EU30_OCEIH/362-509.LQ.--------------GF------------------GYIK----RTALF-----------------------------
Q8GPE5_STRTR/321-459.LV.--------------AI------------------NKPT----GLTIS-----------------------------
Q97AA3_THEVO/339-476.IA.--------------AV------------------RETR----VFIYS-----------------------------
Q9KGJ0_BACHD/361-507.LQ.--------------GS------------------GYVH----IPMIA-----------------------------

PF03023

MURJ_BORBU/29-473-LN---------------SY------------------KIFF----IPSFSPIMLSFGIILSIFLFYGRFG...IY....
MURJ_RICPR/28-477-LN---------------SV------------------KKFA----AFAFSPIILSVCVIIFTLIFGNYIE..STI....
MURJ_ECOLI/28-479-LN---------------TW------------------NRFS----IPAFAPTLLNISMIGFALFAAPYFN.PPVL....
MURJ_RHITR/28-484-LN---------------SL------------------HHFF----AAAVAPIFLNLVMIS.ALFYAIYFGADPLT....
MURJ_CHLPN/35-484-LH---------------CE------------------NKFF----GVGLAPVVVNIIWIFFVIAARHSDPRERII....
MURJ_SYNY3/36-495-LN---------------AA------------------DQYL----LPSISPLLSSITVILGLGVAVWQLGQQLNTEPY.
MURJ_AQUAE/29-466-LL---------------VQ------------------GKFF----VPSVSQTLFNLGFILSLVILFHTLG...HY....
MURJ_HAEIN/16-479-LN---------------TI------------------GKFG----VMSFSPVLLNIAMIATALFLAPQMD.NPDL....
MURJ_THEMA/28-450-HN---------------AS------------------HRYF----LPALTPMFSNVGVIVGCLFGDVRWA.........
MURJ_HELPJ/1-458-LQ---------------YK------------------HSFF----ASAYSASLLNLCMILALLISKEKTHLEALY....
Q9X8T0_STRCO/300-778-LN---------------AR------------------GRFG----AMMWTPVLNNIVIIVTLGLFIWVYGTAETSGMKV
MURJ_TREPA/32-489-LH---------------SI------------------KVFV----PSGCTPIFFNVSVIFSMYFLNVSHMNVAIA....
Q9RX17_DEIRA/83-522-LN---------------AD------------------EHFR----ESSFAPVAFNIASIIALLLLPNNAT.........
MURJ_CHLTR/34-482-LH---------------CE------------------KKFF----SVGLAPSVVNVSWIGTVFLARNYDPRNRIF....
O05435_MYCTU/48-522-LN---------------TR------------------NVFG----PPAWAPVVNNVVAIATLAVYLAVPGELSVDPVR.

PF13440

D0I1Y2_VIBCL/18-260ALAT.FLAFI.A...DF.GY..ATKI.VV....D.FT.A..N.P..VSVA.-----------------------------
D0HB98_VIBMI/18-260AFAA.FLSVV.V...DM.GY..STKI.VI....D.FV...DK.K..QSQA.-----------------------------
A8UQ25_9FLAO/16-256SLTL.LLISI.I...AF.GL..QLSA.TR....N.MA.I.LE.D..WKKE.-----------------------------
Q4JBJ6_SULAC/28-278WQSM.FVLIM.G...YF.TL..PADI.FSLVTSR.FS.VENR.P..VGGI.-----------------------------
Q2YCG5_NITMU/22-272LLHG.ILALI.I...DQ.GY..GWSL.IQ....G.HF.NDKR.E..IAIV.-----------------------------
C8XCC3_NAKMY/40-272QASY.LIVPF.V...LL.GA..ERVA.LR....R.S..GDQG.S..FVPV.-----------------------------
Q3K9H6_PSEPF/12-267AASL.IASKF.Y...SV.GF..SSEI.NRL.ISV.GG.SSRR.V..VDKV.-----------------------------
O58733_PYRHO/24-254SQAF.FLAGF.LAFFSI.GV..GKYT.AE....FLGR.GEKN.R..IKSI.-----------------------------
Q1D7B4_MYXXD/29-283LIAT.TLYYV.L...PF.GV..VQSL.YYF.LPR.AD.AKRP.F..LGQT.-----------------------------
C4WNX8_9RHIZ/31-284GTGV.VLSRI.V...SL.GF..SSPL.YR....I.ST.VKPR....LLGI.-----------------------------
A6X6T8_OCHA4/16-269GTGV.VLSRL.V...SL.GF..SSPL.YR....I.ST.VKPR....LLGI.-----------------------------
B1M5Z3_METRJ/17-264SWAL.VLYG..A...TC.QW..PKFA.FF....A.LY.DEAR.E..PAQV.-----------------------------
A1UCH8_MYCSK/30-289AALS.IGPLM.G...RL.GL..GPNV.IRL..LA.AE.GRQD.R..RRAI.-----------------------------
Q1BCG5_MYCSS/30-289AALS.IGPLM.G...RL.GL..GPNV.IRL..LA.AE.GRQD.R..RRAI.-----------------------------
A3PW68_MYCSJ/30-289AALS.IGPLM.G...RL.GL..GPNV.IRL..LA.AE.GRQD.R..RRAI.-----------------------------
Q0RPT3_FRAAA/322-573AIFS.LMIGF.S..KAA.GT..APLG.IK....F.AD.VSPR.V..FRAA.-----------------------------
Q0RCF1_FRAAA/179-430TLFA.IVIGL.C...RG.AT..CMPL.SM...HY.SG.ATPS.S..FRTA.-----------------------------
D3CWT1_9ACTO/203-455LIFS.VIIGI.S...RS.SCCVPLG..IA....Y.AG.RSAA.A..FRHA.-----------------------------
Q8KN00_9ACTO/40-289VTYG.VVLSV.S..RGV.AT..DPLV.VR....F.SA.VAEA.S..WRQA.-----------------------------
Q9RJJ1_STRCO/34-283VTYG.VVLNV.S..RGL.AT..DPLV.VR....F.SG.VPES.S..WRGA.-----------------------------
D2PZ16_KRIFD/24-275GGYT.IALNV.S...RAVAT..EPLG.VR....Y.SG.QRTP.Q..WHKA.-----------------------------
C8XCR8_NAKMY/39-289LVYS.IVVAV.N...RA.AV..GQPLQIT....F.AA.EGRR.Q..FRSA.-----------------------------
A4FEI7_SACEN/8-256ALLV.SASAL.Y...TG.WV..GDSL.AV....L.DR.HDPD.T..RAAL.-----------------------------
A9VW94_METEP/42-293IAVL.LTVSL.....QL.GL..VVCP.MI....S.IGPGLGD.E..ARPA.-----------------------------
B7KU42_METC4/42-293IAVL.LTVSL.....QL.GL..VVCP.MI....S.IGPGLGD.E..ARPA.-----------------------------
C7C8V6_METED/42-293IAVL.LTVSL.....QL.GL..VVCP.MI....S.IGPGLGD.E..ARPA.-----------------------------
C5ATW3_METEA/42-293IAVL.LTVSL.....QL.GL..VVCP.MI....S.IGPGLGD.E..ARPA.-----------------------------
C7LVX3_DESBD/8-264AIFL.LLGTVHT...GL.WT..EPML.VY....G.SG.RFRE.A..FTSY.-----------------------------
Q2CIK8_9RHOB/14-260VCLQ.LGLSL.S...NA.LF..ASPL.LQS..LL.KA.ADPAPI..VASY.-----------------------------
Q89SM5_BRAJA/14-270AASQ.LFCVF.V...FE.WL..QLAG.VR....FLAA.ASGE.E..AARL.-----------------------------
C8KY87_9PAST/18-266TTVS.YVVTL.S...TG.GV..GFAC.AL....S..M.RNKQ.Y..LGWR.-----------------------------
C5RZU1_9PAST/18-266TTVS.YVVTL.S...TG.GV..GFAC.AL....S..M.RNKQ.Y..LGWR.-----------------------------
A9AXJ4_HERA2/36-280TCFA.LATLL.S...SM..F..QIYA.ANA..SV.RP.NNHA.T..LRRL.-----------------------------
D0YZQ3_LISDA/18-261GIIL.IGAQV.A...LY.GS..HFLL.PK....V.....DQQ.D..LGKA.-----------------------------
D2BRK8_DICD5/18-261SIVL.VGAQV.C...TF.AS..QLLI.PK....Q.P....DD.A..LAQS.-----------------------------
B1IZZ3_ECOLC/18-261SIAV.IGAQV.C...TF.AS..QLLI.PK....Q.....SEE.E..LTQN.-----------------------------
B9JQS0_AGRRK/94-340SIMN.LITPL.C...LI.GL..DTAL.LK....L..D.NAGT.A..LASA.-----------------------------
Q676G9_RHIRD/94-340SIMN.LITPL.C...LI.GL..DTAL.LK....L..D.NAGT.A..LASA.-----------------------------
B5JNG5_9BACT/22-272SILP.ATSSI.L...SL.GL..TNII.PA....S.TN.GCLT.R..LPIA.-----------------------------
A6VTF9_MARMS/19-265SISS.PIYML.C...SF.NL..RLGV.IT....D.QK.NNF..N..FHEY.-----------------------------
B9EAW7_MACCJ/18-258AIIS.PLVLL.F...SL.GL..NTLY.VT....D.KR.FDYK.I..YAYN.-----------------------------
C2KV49_9FIRM/32-288STLGQQFFIV.A...YF.GL..RPFL.ITD..MK.GE.FSFR.Q..YRQF.-----------------------------
A4EAS6_9ACTN/45-291VTGT.LIMIA.C...NY.GV..RNFQ.VS....D....IDEK.T..SFAS.-----------------------------
A6Q4F3_NITSB/16-266DLIA.IGVM..A...FS.GF..KDSL.VK....A....FDEE.Y..FKGV.-----------------------------
Q8EFK4_SHEON/26-281DIIS.LSLIL.....MT.GF..RSSM.VV....T.YS.QTKQ.DVDITNI.-----------------------------
A6WPP6_SHEB8/25-280DIIS.LSLIL.....MT.GF..RSSM.VV....T.YS.QTKQ.DVDITNI.-----------------------------
A1RKH9_SHESW/25-280DIIS.LSLIL.....MT.GF..RSSM.VV....T.YS.QTKQ.DVDITNI.-----------------------------
A4Y617_SHEPC/25-280DIIS.LSLIL.....MT.GF..RSSM.VV....T.YS.QTKQ.DVDITNI.-----------------------------
E6XI49_SHEP2/25-280DIIS.LSLIL.....MT.GF..RSSM.VV....T.YS.QTKQ.DVDITNI.-----------------------------
A6FGK5_9GAMM/27-282DLIS.LSLIL.....MT.GF..RSSM.VVS..YS.QT.QNDR.D..IINV.-----------------------------
B8CST1_SHEPW/46-301DIIS.LSLIL.....LS.GF..RTSM.VVS..FS.QT.KNAQ.D..ITNI.-----------------------------
A8UIN6_9FLAO/18-257LWVY.FILII.A...NW.GN..REYL.IR....T.YS.RLPS.K..IYTLY-----------------------------

PF01943

SP5B_BACSU/6-308GEE---------------GV------------------GLYM----MAAPTFFLATTLTQFGLPVAISKLVAEASARG..
CAPF_STAAU/1-264TPE---------------DV------------------GRYN----YALVITAPIFLFISLKIRSVIVTNDKYSPN....
O87185_STRAG/6-275STE---------------VY------------------GQYS----LYVAWMNIIMLFIGLQTSGSLS.SARVKYG....
EXOT_RHIME/10-277SPE---------------EF------------------GAVA----VALTVVQFLAMIGGAGLTSALVIQQHEEMET...
TUAB_BACSU/10-277TLT---------------EF------------------GLVG----MITTVTVFAQIVLDMGFGAALIQRDDATER....
O06039_LACLC/3-269SPE---------------GI------------------GLYS----YTYTITQYFVLFATLGTVTYGSREIAYYQSN...
RFBX_ECOLI/8-279GPE---------------NF------------------GIFG----FCQATMLYMIMFVEYGFNLTATQSIAKAADS...
YCP11_KLEPN/9-277EPF---------------EF------------------GVLS----IMTVVFLFTDMLADCGLSNAIIQKKNITLD....
RFBE_SHIFL/3-283GPE---------------GF------------------GVYT----IAIALVGYAGIF.DVGLTRSVIREIAIHRDN...
O58158_PYRHO/7-277GPA---------------NY------------------GILS----FALALNGIFGVIANFGLDPLTVREVARDKT....
O26447_METTH/15-286GPA---------------NF------------------GKVA----FAVAFITYFQILTDYGFNFSATREISIHRDD...
YTGP_BACSU/5-320GAT---------------GG------------------ALFQ----YGYNQYTLFLNIATMGFPAAVSKFVSKYNSKGD.
Y1068_METJA/7-302PKL---------------DV------------------GLFY----AVLDFFSMLVVFRAFGLDQALIRYIPKYLAENRL
Q56865_YEREN/18-287GPA---------------NY------------------GQIV----YAVTYVTFFQTISILGLDSIVVRDLSNGVE....
Q56913_YEREN/4-274GVE---------------GF------------------GVYS----LTLSLAQYFVILIDFGFNLSASKKIAEHQDD...
O07870_STRPN/6-276NPN---------------GI------------------GLTS----FFSSIGNYGILLASLGISTYGIKAVASVRDD...
O58127_PYRHO/9-279GPE---------------GL------------------GQYS----FIFYYVGLLGIFSDFGISYYFMREVARDKS....
O86895_STRPN/3-267SSD---------------DL------------------GTYG----YFSSIVTYFTLLATLGVANYGTKEISAHRKE...
O07342_STRPN/5-273GAE---------------NL------------------GIHS----FTISVALYFMMFMLLGIANYGNRTIATVKREG..
Y1375_METJA/3-283GTE---------------AF------------------GILK----GLMPIADTLTIFFSSGIPPAIAKFLAEEKE....
O52526_RHILT/10-273APS---------------DF------------------GLVA----IATTIQVILSSVTELSLNQALIRHEDPSEV....
Q56776_XANCA/21-288TPY---------------DY------------------GLMA----MVTAIVGAAEILRDFGLSAAAVQAKHVSRE....
O26479_METTH/10-276GTA---------------GF------------------GILS----TALALTGIFSILADLGIGTYITREIARNPGGA..
P74815_9SPHN/37-317GPA---------------GV------------------GAFG----TALTTAQMLVILSLIGLDTILVRTVAVCVSQNRT
O29660_ARCFU/6-285KPE---------------LF------------------GIYS----LAISVAFLLMTFTDLGINATLVRYVAHANIKGDD
O26467_METTH/18-289GVY---------------NY------------------GLVN----FAIAFNTYFIIITDYGFNLSAVREISVNRED...
O26442_METTH/7-278GEA---------------GF------------------GKYN----FAFSLTTLLVTFTDLGVNQLLVREIARERD....
YABM_BACSU/12-309GDV---------------GF------------------YIYQ----QVYPFLGIAVMLSTSGFPVIISKLMNDYSEK...
WZXC_ECOLI/9-276DNH---------------QF------------------GLLT----VSLVIIALADTLSDFGIANSIIQRKEISHL....
O85002_STRPN/7-276TTT---------------EY------------------GFYD----LVYTTIQLFVPILTLNISEAVMRFLMKDGVS...
RFBX_SHIDY/1-270SIE---------------TF------------------ADVA----KIQAAVMLLSLIVNYGYNLSSTRAIARAVS....

PF01554

C5W5G6_ECOBD/100-262AGV---------------GL------------------ADSF----NMVIM-----------------------------
C5W5G6_ECOBD/330-491AGN---------------FI------------------AFSI----AALIN-----------------------------
O51531_BORBU/22-182AGV---------------SL------------------ANKF----FELFV-----------------------------
YOEA_BACSU/28-189AAV---------------SS------------------FFPL----FFLLI-----------------------------
YOEA_BACSU/257-418AAY---------------GV------------------VNQV----ASYVQ-----------------------------
O66528_AQUAE/245-406AAH---------------QI------------------GLRI----ESISF-----------------------------
YPNP_BACSU/241-402SGF---------------GA------------------VQRL----DSIIT-----------------------------
NORM_VIBPA/243-404AAH---------------QV------------------AINF----SSLVF-----------------------------
O80695_ARATH/278-441DSL---------------AI------------------CMSI----SAISF-----------------------------
O26414_METTH/244-409AVY---------------SA------------------GWRI----VMLAI-----------------------------
O33729_STRPN/24-185AAV---------------GA------------------TTAI----FDLIV-----------------------------
O59471_PYRHO/14-174GAV---------------GL------------------GGQV----SWFMF-----------------------------
O28801_ARCFU/21-180SAV---------------GL------------------FFPI----FFVFI-----------------------------
YISQ_BACSU/27-187AAV---------------GV------------------SNQI----LNLII-----------------------------
Y709_METJA/243-408AVY---------------TG------------------ALRI----TEFGF-----------------------------
YPNP_BACSU/21-182GAA---------------AV------------------SSTI----VLTVL-----------------------------
O25454_HELPY/214-375AGM---------------QI------------------GIRV----ETFSF-----------------------------
NORM_BACSU/20-180AGV---------------AI------------------GSSL----WTPVY-----------------------------
HMRM_HAEIN/249-410ASH---------------QI------------------TLNT----SSFIF-----------------------------
O49713_ARATH/195-358DSL---------------SI------------------CMSI----SALSF-----------------------------
O49660_ARATH/262-426SIL---------------II------------------VFNF----DYLLY-----------------------------
O82752_ARATH/42-203SGG---------------SL------------------ALGF----ANITG-----------------------------
DINF_ECOLI/35-196GGV---------------AV------------------GATA----TSFLF-----------------------------
O23067_ARATH/280-459SAV---------------ML------------------CLEI----WYFMT-----------------------------
Q9ZK32_HELPJ/23-184AAV---------------NI------------------AWPI----FPGLI-----------------------------
Q9ZVH5_ARATH/238-401AAM---------------GI------------------LIQT----TGILY-----------------------------
O28801_ARCFU/239-404AAY---------------TS------------------AWRL----IQFGF-----------------------------
O58340_PYRHO/26-186SAP---------------GT------------------VWPL----LWFMI-----------------------------
Q38956_ARATH/275-438AAL---------------SI------------------CMNI----LGWTA-----------------------------
O58340_PYRHO/247-408ATY---------------TI------------------TNRL----TNFMF-----------------------------
O33729_STRPN/246-408SAQ---------------TA------------------ARRI----MTFAL-----------------------------
ERC1_YEAST/174-335GGV---------------TL------------------GSMT----ANITG-----------------------------
Q9ZVH5_ARATH/16-176AGG---------------AL------------------AMGF----GNITG-----------------------------
O80785_ARATH/37-197SAA---------------SI------------------ATSF----ASVTG-----------------------------
O73981_PYRHO/41-201SAP---------------GV------------------SWPI----IGTLM-----------------------------
O59471_PYRHO/238-404SAH---------------YI------------------GLRV----ESIAY-----------------------------
YAO6_SCHPO/17-177SVA---------------AF------------------AYMF----AMSTG-----------------------------
O82752_ARATH/264-427ASM---------------GI------------------LIQT----TALIY-----------------------------
O51429_BORBU/27-187SAL---------------SL------------------AGPV----NFFII-----------------------------
O83871_TREPA/32-196GAV---------------NV------------------VNSL----LFLYV-----------------------------
O51429_BORBU/248-409AAY---------------GL------------------TNTI----ISFLF-----------------------------
O23067_ARATH/98-258SAV---------------AI------------------ALSV----VSNFS-----------------------------
YISQ_BACSU/252-413TTK---------------VY------------------TQNI----TMFIL-----------------------------
O66528_AQUAE/25-183AAT---------------GF------------------SLSL----LWFIY-----------------------------
O51530_BORBU/21-181TGV---------------SL------------------ANRV----TFLFF-----------------------------
Y709_METJA/21-181AAV---------------GA------------------SFPI----LISIY-----------------------------
NORM_BACSU/247-408ASH---------------QA------------------AMNF----ASLLY-----------------------------
NORM_VIBPA/17-176AAV---------------SV------------------ASSI----WLPSI-----------------------------
O26414_METTH/24-183AAI---------------GF------------------VTPI----YMILV-----------------------------
HMRM_HAEIN/22-181AAI---------------SI------------------GASI----WMPLM-----------------------------
YD338_YEAST/238-397AAV---------------SL------------------ASMT----SNITL-----------------------------
O73981_PYRHO/262-424AAY---------------VI------------------TTRL----VNFIT-----------------------------
MDTK_ECOLI/17-177AAV---------------AI------------------GTSI----WLPAI-----------------------------
Q38956_ARATH/55-215AAV---------------SV------------------ENSV----VAGFS-----------------------------
P71616_MYCTU/19-179AGL---------------AI------------------GSLV----LGLVG-----------------------------
O49660_ARATH/40-200AGG---------------SL------------------GFSF----ANVTG-----------------------------
O80695_ARATH/57-217AAA---------------SL------------------GNSG----FNMFT-----------------------------
MDTK_ECOLI/244-405AGH---------------QI------------------ALNF----SSLMF-----------------------------

PF04506

RFT1_SCHPO/9-527FIY---------------TVSSFIEL..LSEPYYEVLQWRQK----FSKTASAEGLGTIICSLLSFAISVLG...R....
RFT1_DROME/7-556FVA---------------QVFCFVKLKILLNTLHILVRSAIF----LWIVTGDRSAAINAFAIAQLSSAVTIVLGQYGFF
RFT1_CAEEL/1-519VIS---------------LRLESKCG..SLAQHFAIGQGMLI----CVKRIFVLAGLFMFPGMYHLELFAYAQYIG....
RFT1_YEAST/17-572FLI---------------WLSIIVEL..LSEPFFIVNQFMLN----YAARSRFESIAVTTGCIVNFIVVYAVQQSRYPMG

PF14667

A0AF13_LISW6/361-504----------V...G---------IGL--IV--KWI.IGSIL....I......---------------------------
A0NHL2_OENOE/387-534----------L...I---------YGI--LL--KMV.FQVPMI..YM......---------------------------
A0RJU4_BACAH/372-520----------L...I---------MGV--IL--KFV.CNVIF....I......---------------------------
A1ASY9_PELPD/345-481----------V...I---------AAG--IF--NVI.LNIIL....V......---------------------------
A1BJ49_CHLPD/337-476----------A...I---------AGL--CI--QAA.ATLLL....I......---------------------------
A1HLQ5_9FIRM/371-513----------M...G---------ISA--VV--KVV.LNWRLV..AL......---------------------------
A1ILY9_STROR/319-458----------T...T---------APA--II--SVG.LN..LL..FL......---------------------------
A1S103_THEPD/335-472----------S...L---------AGL--AV--LLP.LAAPL....T......---------------------------
A1YVF6_LACJH/321-459----------V...T---------LGA--IV--NLS.LNVPLI..K.......---------------------------
A2RG74_STRPG/377-525----------F...A---------YGI--LI--KLV.LQIPLI..YL......---------------------------
A2RHU4_LACLM/321-459----------V...T---------IGA--VL--NIL.LNFAL....I......---------------------------
A2RMM4_LACLM/390-539----------F...T---------LTL--VI--KLV.LQVPMI..LI......---------------------------
A2STD2_METLZ/331-469----------A...G---------IAA--LL--NIA.LNVTLI..PI......---------------------------
A3CPL5_STRSV/375-523----------F...L---------YGV--GV--KLV.LQVPLI..YI......---------------------------
A3CVY7_METMJ/333-471----------T...A---------IAV--TV--NIG.LNILL....I......---------------------------
A3DHV8_CLOTH/327-465----------E...I---------IKK--VL--ELL....ILL..IS......---------------------------
A3DIV8_CLOTH/358-500----------S...I---------VGY--VI--RIL.FVIYF....V......---------------------------
A3F4D6_LACLC/321-459----------V...I---------IGA--IV--NLM.LNIPLI..IY......---------------------------
A3I8W7_9BACI/372-521----------L...L---------SGI--FV--KLA.LNIPLI..RL......---------------------------
A3IEA1_9BACI/365-514----------L...M---------IGF--VL--KII.LNVRLI..G.......---------------------------
A3W1Y0_9RHOB/329-468----------A...T---------IGS--IV--QIL.CVA.....VG......---------------------------
A4FX93_METM5/354-492----------L...Y---------IGA--FF--NLT.FNLLL....I......---------------------------
A4IJD3_GEOTN/352-496----------V...A---------VAV--AG--KMA.LMHWL....V......---------------------------
A4IRX9_GEOTN/371-520----------L...A---------AGL--LV--KLS.LNTLL....I......---------------------------
A4SCQ1_PROVI/337-476----------A...A---------VAL--LL--QLL.LNLIL....I......---------------------------
A4VW05_STRSY/379-527----------F...L---------IGM--LV--KIV.LQVPMI..YV......---------------------------
A5D2G5_PELTS/358-502----------L...V---------LAS--LF--KIT.GIYFLT..GL......---------------------------
A5ITS6_STAA9/386-533----------I...L---------ASV--VI--KLA.LNYPLI..ML......---------------------------
A5LCT3_STRPN/372-520----------F...I---------YGS--IA--KLV.LQLPTI..AL......---------------------------
A5M4K0_STRPN/211-349----------L...I---------IGA--LV--NIL.LNCFL....I......---------------------------
A5UNI7_METS3/328-460----------Y...C---------LAA--LF--NVA.LNFIL....I......---------------------------
A5UQJ1_ROSS1/330-463----------L...I---------GSL--SL--NIV.LNLIL....Q......---------------------------
A5UWW7_ROSS1/374-505----------F...A---------TGA--LF--NLG.MNLALI..PV......---------------------------
A5VL26_LACRD/382-530----------L...A---------IGI--VI--KFI.LQFPCI..WI......---------------------------
A5ZUX1_9FIRM/326-464----------T...F---------VGA--IL--NVV.LNSIFI..IT......---------------------------
A6CQJ8_9BACI/372-520----------L...L---------VGL--LI--KLV.LNIPLI..KL......---------------------------
A6CR25_9BACI/352-499----------I...L---------GGL--AV--KFG.LNILL....V......---------------------------
A6DHF1_9BACT/293-436----------V...I---------FTA--IF--NVV.LSVLF....G......---------------------------
A6NPI5_9FIRM/351-494----------S...L---------ICG--AV--QLG.CTWVLM..GL......---------------------------
A6QEF7_STAAE/343-485----------M...T---------AGL--VI--KFI.LNIILI..RL......---------------------------
A6TN15_ALKMQ/363-506----------L...M---------IGV--LV--KII.ISYILL...V......---------------------------
A6TSY6_ALKMQ/375-519----------Y...M---------LGM--SI--QLY.CTYILV..PN......---------------------------
A6UPA0_METVS/351-488----------L...Y---------IGA--IF--NLI.FNLIL....I......---------------------------
A6UU30_META3/353-490----------L...Y---------FGA--TF--NLI.FNLLL....I......---------------------------
A7GJW7_BACCN/360-506----------V...V---------LGS--CL--KVV.LNYIL....M......---------------------------
A7HKJ9_FERNB/322-460----------V...I---------AGA--IT--NFT.MNLIL....I......---------------------------
A7VPC0_9CLOT/355-497----------N...I---------IDS--VM--RVG.LILFL....L......---------------------------
A7VWY4_9CLOT/433-577----------L...S---------VGV--II--KII.LNYTLV..GI......---------------------------
A7Z0I0_BACA2/354-499----------V...L---------AGG--AL--KWV.LNVWL....V......---------------------------
A7Z7U6_BACA2/375-524----------L...F---------IGV--II--KVV.LNMPLI..KL......---------------------------
A8F924_BACP2/360-506----------V...L---------LSV--LV--KWI.LTLAL....V......---------------------------
A8MIG9_ALKOO/365-508----------L...L---------IGA--II--KVV.VSYYLL...M......---------------------------
A8MK38_ALKOO/363-506----------L...L---------IGA--LL--KLV.VTYTLA..GI......---------------------------
A8RUL6_9CLOT/387-539----------A...V---------IAL--VI--HVA.VLEVFL..MV......---------------------------
A8SAU1_9FIRM/356-502----------S...V---------WDA--VL--RIG.GVAVL....L......---------------------------
A8UAN8_9LACT/362-510----------L...L---------IGL--GV--KIV.LNEWF....V......---------------------------
A8UCR2_9LACT/391-539----------L...V---------IGL--VV--KLA.FQYPML..AI......---------------------------
A9EQ86_SORC5/331-462----------L...A---------LAL--VA--DVA.LNLLL....L......---------------------------
A9WAD6_CHLAA/337-475----------M...I---------AAT--VA--TLP.LDFVLV..PWTD...Q---------------------------
B0K3R2_THEPX/360-504----------S...I---------IWL--GV--CII.GMYYLT..AM......---------------------------
B0MPG6_9FIRM/391-534----------M...L---------PGC--AV--KLI.FNVFTI..SV......---------------------------
B0N362_9FIRM/290-427----------V...F---------LGA--IV--NIV.INLLL....I......---------------------------
B0PEA8_9FIRM/441-584----------L...F---------AGG--LM--KLA.LNFVLV..AI......---------------------------
B0TAY6_HELMI/361-505----------T...V---------ATS--LL--RVG.LFLTLA..TL......---------------------------
B0VF98_CLOAI/326-465----------S...L---------FLL--IS--NAI.LNYLLI..........---------------------------
B1MY12_LEUCK/485-634----------F...V---------FGL--LV--KVA.LQVPFI..........---------------------------
B1SH45_9STRE/377-525----------F...A---------YGL--VV--KIV.LQVPFI..FL......---------------------------
B1YGP9_EXIS2/345-491----------V...V---------AGL--LI--KLG.LNIYL....I......---------------------------
B1YKH1_EXIS2/386-534----------T...L---------AGL--LT--KYL.LNAPLI..HW......---------------------------
B2A2Z4_NATTJ/361-504----------L...I---------IGT--FL--KAI.LTYWLT..AV......---------------------------
B2A8K9_NATTJ/363-507----------L...C---------YGA--LV--NLV.INYYLT..AI......---------------------------
B2GDL9_LACF3/322-460----------V...T---------AGA--VV--NII.ANLFL....I......---------------------------
B3EHD9_CHLL2/365-504----------A...L---------AAL--AV--QVV.LSVLL....I......---------------------------
B3EP69_CHLPB/337-475----------A...A---------AGL--VV--HVA.LNLLL....I......---------------------------
B3W6R7_LACCB/364-511----------F...A---------FGV--IA--KML.AEVFCI..WF......---------------------------
B3WAP5_LACCB/356-499----------L...L---------LGI--LL--KAV.INQPL....V......---------------------------
B3WCD6_LACCB/380-528----------M...L---------IGL--AV--KVI.VQWPMI..FF......---------------------------
B3XNV8_LACRE/322-460----------V...T---------IGA--VV--NVI.TNFLF....I......---------------------------
B4AGJ7_BACPU/343-486----------T...L---------ILG--VS--NVL.FAYGLT..HT......---------------------------
B4SBS0_PELPB/338-477----------A...L---------AAL--GL--QVA.LNFLL....I......---------------------------
B5CWR8_9BACE/324-466----------....G---------VSN--TC--FTV.LGFIIA..SV......---------------------------
B5UWQ0_BACCE/360-510----------V...V---------FGG--CL--KLA.LNYIF....M......---------------------------
B6IYF6_RHOCS/343-484----------I...G---------LGA--AC--NLL.LIALLI..........---------------------------
B6YVL8_THEON/328-461----------F...V---------EGA--VL--NIF.LNLILI..PI......---------------------------
B7AQB6_9FIRM/351-493----------G...I---------IST--LM--RIA.FIIFL....I......---------------------------
B7DPH6_9BACL/373-525----------M...F---------LGL--GI--KTA.LNFALI..LG......---------------------------
B7DPL3_9BACL/356-497----------T...F---------FSS--AV--RLA.CIYEFV..AV......---------------------------
B7GFI4_ANOFW/350-497----------V...C---------VGM--IA--KWG.LNVLL....V......---------------------------
B7GMA5_ANOFW/366-505----------I...L---------IGC--FV--KWG.TNILF....V......---------------------------
B7JJF5_BACC0/376-524----------F...S---------VGI--LV--KVL.VNTPLL..HL......---------------------------
B8D0L3_HALOH/359-505----------L...G---------IGS--AI--KLT.GIYFLT..PR......---------------------------
B8D178_HALOH/340-478----------N...I---------LVV--GM--NVT.LNYAL....I......---------------------------
B8DHB8_LISMH/370-518----------L...L---------LGL--LA--KSV.LQMPLI..ML......---------------------------
B8IEZ7_METNO/324-461----------A...L---------IGA--AV--NAF.GVLTL....A......---------------------------
B8IGJ3_METNO/336-472----------N...L---------SGA--AL--TLL.IGFLL....I......---------------------------
B9CVC4_STACP/347-489----------I...V---------LGI--LS--KAI.LNIMC....I......---------------------------
B9DSP4_STRU0/342-480----------L...S---------FGL--LL--KIM.LTPILT..YY......---------------------------
B9E7H2_MACCJ/374-522----------V...V---------ASL--LV--KLV.INFPLI..YL......---------------------------
B9E8U7_MACCJ/341-481----------V...I---------AGI--LT--KFL.LNLLL....I......---------------------------
B9JKJ2_AGRRK/321-464----------N...A---------IDL--CF--RIV.LISIG....F......---------------------------
B9K2D6_AGRVS/332-468----------G...L---------GGA--FI--MLV.GDVLL....V......---------------------------
C0QCL2_DESAH/352-496----------T...I---------VEA--MI--NLI.LSISFV..VV......---------------------------
C0WBK9_9FIRM/378-517----------M...I---------IAA--IV--KVF.LNWNLT..AM......---------------------------
C0WLU0_LACBU/374-518----------L...I---------GGL--IV--KLV.LQIPL....V......---------------------------
C0WQN7_LACBU/354-501----------I...T---------CGF--VV--KLI.INKWLV..A.......---------------------------
C0WUG9_LACBU/378-530----------F...A---------VGT--LI--KFI.IQWPCV..YY......---------------------------
C0WVB1_LACFE/322-460----------V...S---------IGA--VV--NVI.ANILLI..........---------------------------
C0X1V9_ENTFL/370-519----------T...S---------ITL--LL--KLI.IQIPCI..YL......---------------------------
C0X279_ENTFL/382-530----------L...G---------IGL--AV--KLI.VQFPAI..RL......---------------------------
C0X942_ENTFL/359-507----------A...G---------VGL--LV--KLL.TTGFF....T......---------------------------
C0Z9G8_BREBN/364-513----------L...L---------YGV--IV--KVL.AT..LV..FT......---------------------------
C0ZAP4_BREBN/363-505----------T...L---------ISA--II--KTV.AMFFFT..AH......---------------------------
C0ZHE2_BREBN/367-517----------L...F---------IGV--LV--KLI.LNLAL....V......---------------------------
C1I2F0_9CLOT/325-463----------I...V---------LAS--IV--SII.SNLILI..PI......---------------------------
C1IAW5_9CLOT/354-498----------L...F---------IGC--II--KII.LTFVLV..PM......---------------------------
C2D643_LACBR/210-348----------I...I---------VGA--VV--NII.LNFPLI..YF......---------------------------
C2E7U4_LACJH/384-532----------L...V---------LGI--II--KFA.VQLPMI..EF......---------------------------
C2EED2_9LACO/381-529----------A...V---------IGM--IV--KVI.IQFPLT..AF......---------------------------
C2EHH6_9LACO/356-502----------L...G---------VAF--LT--KYI.LNSYLI..........---------------------------
C2EP42_9LACO/342-483----------M...I---------WGV--VV--KLI.LQVPMT..FL......---------------------------
C2H7P1_ENTFC/381-529----------L...V---------VGF--LV--KLL.LQYPAI..RL......---------------------------
C2HEH9_ENTFC/359-507----------A...G---------WGL--LV--KGL.TTSFLT..GL......---------------------------
C2KAZ9_9LACO/380-528----------L...I---------LGL--IL--KGI.LQYPMI..FL......---------------------------
C2KJQ1_LEUMC/329-467----------V...T---------IGA--LA--NVL.LNFWLI..YV......---------------------------
C2KKY7_LEUMC/498-647----------F...F---------VGI--II--KIV.LQIPLI..........---------------------------
C2LQ70_STRSL/432-580----------F...A---------IGV--LV--KAI.LQLPLI..IF......---------------------------
C2M158_STAHO/360-502----------V...M---------SGL--LF--KII.FNVIFI..YF......---------------------------
C2YMP0_BACCE/352-495----------V...V---------GAS--FV--KVI.LNIVL....V......---------------------------
C3HRG9_BACTU/323-461----------L...V---------LGA--II--SLI.LNIIF....I......---------------------------
C4FB42_9ACTN/325-467----------L...I---------VGA--AL--NVA.VNVLL....I......---------------------------
C4FNY8_9FIRM/361-503----------I...F---------IGL--LA--KTF.LDYQLT..GT......---------------------------
C4FPR1_9FIRM/359-501----------M...G---------IAL--VI--KVI.LNWTLT..AI......---------------------------
C4FUC9_9FIRM/947-1095----------L...L---------IGL--VV--KVV.LQFPLV..AL......---------------------------
C4G0V0_ABIDE/374-518----------N...L---------IAM--LI--DII.FTYLLL..MY......---------------------------
C4GB38_9FIRM/387-530----------S...L---------IAT--GV--QAL.FLVVAM..LV......---------------------------
C4RGH8_9ACTO/364-502----------A...L---------AGT--LV--NVV.LNVLL....I......---------------------------
C4V2B6_9FIRM/374-517----------M...V---------LAA--AA--KIF.LNWHLT..AI......---------------------------
C4XGJ8_DESMR/335-465----------A...G---------AAL--VL--AFA.ANAFL....V......---------------------------
C5A2Y0_THEGJ/342-480----------N...V---------LAV--IS--DFL.LNILL....I......---------------------------
C5D378_GEOSW/360-505----------V...C---------VAV--AG--KTA.CNWLL....I......---------------------------
C5NWI0_9BACL/318-458----------T...T---------IPA--FV--SVA.VNIAV....I......---------------------------
C5Q1B2_STAAU/332-469----------I...T---------IGA--VM--NLV.LCLVLI..YF......---------------------------
C5RB06_WEIPA/501-648----------L...I---------FIF--AV--KIV.LQVPLT..I.......---------------------------
C5RD31_WEIPA/359-505----------V...L---------LTM--IV--KYI.LN..MI..FI......---------------------------
C6A0B5_THESM/328-456----------T...V---------IMA--IL--NII.LNLVL....I......---------------------------
C6CSD9_PAESJ/327-465----------V...L---------IGA--VI--SVI.TNIIL....I......---------------------------
C6J0R0_9BACL/364-511----------V...A---------IGI--LV--KLA.ASYVFA..QF......---------------------------
C6JQC3_FUSVA/323-462----------N...M---------GVM--IV--SIL.ISLIL....T......---------------------------
C6PQD8_9CLOT/131-275----------L...A---------IGC--AI--KTA.ITIQMV..SI......---------------------------
C6SP25_STRMN/377-525----------F...I---------YGV--IA--KFV.LQVPLI..YF......---------------------------
C6VKW0_LACPJ/357-507----------I...I---------AGL--AT--KVL.ANYIF....V......---------------------------
C7GE86_9FIRM/383-527----------A...I---------IAL--VL--HLG.LLAALM..FL......---------------------------
C7GYH1_9FIRM/373-517----------I...L---------IGI--VA--KII.LTYVLT..SI......---------------------------
C7NM90_HALUD/327-463----------S...L---------SAA--VL--NAV.VNLFL....I......---------------------------
C7NSL6_HALUD/319-457----------T...V---------ASI--TV--NLV.LNVVL....I......---------------------------
C7NSR3_HALUD/331-469----------N...A---------VFI--LV--NVV.LNVVL....V......---------------------------
C7P069_HALMD/318-461----------N...A---------VLV--VS--NVV.LNFAL....I......---------------------------
C7XZJ3_9LACO/375-523----------L...V---------VGL--II--KCI.IQYPLI..RL......---------------------------
C8NE09_9LACT/413-561----------L...G---------FTV--II--KLL.WQPMMM..YF......---------------------------
C8NI78_9LACT/366-514----------L...V---------AGL--VV--KAG.TNYLFV..AM......---------------------------
C8PCY7_9LACO/375-523----------L...L---------IGI--II--KSI.FQWPAI..KL......---------------------------
C8VXJ1_DESAS/366-509----------L...L---------VGI--IF--KIG.FTYYLT..P.......---------------------------
C8WQG9_ALIAD/361-502----------S...I---------VGG--VA--RLA.VILVLA..TR......---------------------------
C9A2J3_ENTGA/381-529----------F...F---------IGL--LL--KFI.LQYPAI..W.......---------------------------
C9A420_ENTGA/359-508----------A...G---------CGL--LL--KGL.LTWPLT..YL......---------------------------
C9L817_RUMHA/12-160----------A...A---------IAL--VV--DVV.VVTVLM..FV......---------------------------
C9LAR2_RUMHA/325-463----------L...I---------IGA--IV--NLC.VNLVL....I......---------------------------
C9LLX4_9FIRM/363-506----------M...V---------VSA--AV--KVF.LSWNLT..AM......---------------------------
D0BKY7_9LACT/382-530----------L...V---------IAL--VV--KML.WQPMMI..YF......---------------------------
D0BM46_9LACT/352-499----------L...L---------IGL--IA--KGI.GN..LW..FI......---------------------------
D0BME9_9LACT/319-458----------T...T---------IPA--FF--SIA.CNLVL....I......---------------------------
D0LQE6_HALO1/374-513----------A...A---------VTL--AA--SVL.ANAFVV..PL......---------------------------
D1Z261_METPS/328-462----------I...G---------IGM--LV--NFA.LNIIL....I......---------------------------
D2BMG7_LACLK/323-465----------G...F---------ISL--GI--I...SLCIFI..GI......---------------------------
D2EHX4_PEDAC/355-503----------I...A---------AGL--CV--KVI.CNGWA....V......---------------------------
D2EJ27_PEDAC/321-459----------V...I---------IGA--IV--NIV.INIPFI..LV......---------------------------
D2ELV8_PEDAC/393-541----------F...V---------VGM--IV--KFI.FQFPMV..AI......---------------------------
D2RVV2_HALTV/336-474----------K...A---------TTS--TG--NVA.LNLALI..PI......---------------------------
D2RXY9_HALTV/340-478----------K...G---------GTA--VA--NFL.LNLVL....I......---------------------------
D3AN52_9CLOT/376-519----------N...V---------TAL--FV--RLA.FV..LF..GI......---------------------------
D3E759_GEOS4/381-532----------L...L---------AAA--GL--KLL.LNLLL....V......---------------------------
D3FFB8_CONWI/338-471----------V...V---------VAA--LA--NVG.LDILL....I......---------------------------
D3FR13_BACPE/361-509----------M...G---------LGI--LV--KLG.LNILL....V......---------------------------
D3FXP2_BACPE/374-522----------L...V---------AAL--LV--KLA.LNYLML..LL......---------------------------
D3FZH8_BACPE/357-501----------V...L---------MCS--AV--KFV.LNIIL....V......---------------------------
D3LVV9_9FIRM/358-500----------M...A---------IGA--GI--KIF.LSWHLT..AV......---------------------------
D3LX29_9FIRM/358-500----------M...M---------IAA--AV--KVC.CNWFLV..AI......---------------------------
D3QG68_STALH/343-485----------V...G---------IGL--IV--KGL.LNIMLI..Y.......---------------------------
D3SSH7_NATMM/337-474----------T...G---------VAA--LI--NVI.LNALL....I......---------------------------
D3STC0_NATMM/337-475----------K...G---------VTG--GF--NFG.LNLLL....I......---------------------------
D3UNL4_LISSS/370-518----------L...L---------LGL--LT--KSV.LQMPLI..LL......---------------------------
D4G1Q3_BACNA/318-464----------T...L---------LLG--AV--NVV.LAVTLS..GP......---------------------------
D4G3E4_BACNA/359-505----------V...G---------AGV--AV--KWV.LNTLL....V......---------------------------
D4GU68_HALVD/319-457----------T...V---------ISV--VL--NLI.LNVIL....I......---------------------------
D4LGF1_9FIRM/327-469----------T...T---------VSA--II--NCG.LNLYM....I......---------------------------
D4W1F1_9FIRM/338-485----------V...L---------AGI--LV--KIG.LTAPL....T......---------------------------
D4W2K6_9FIRM/377-526----------L...V---------VGL--LI--KYV.GNVIL....I......---------------------------
D4YGG7_9LACT/385-532----------F...V---------VGM--LV--KGI.FTASLV..GF......---------------------------
D4YJ56_9LACT/433-583----------M...L---------LGV--TL--KLV.LQAPFL..AM......---------------------------
D4YX22_SPHJU/336-476----------A...A---------VGA--VL--MPA...AFLI..GI......---------------------------
D5D970_BACMD/362-511----------V...I---------AGM--AV--KLI.LNLWL....I......---------------------------
D5DN36_BACMD/374-521----------L...L---------FGL--IV--KIV.VNVPFI..LM......---------------------------
D5DY76_BACMQ/331-468----------A...L---------YSG--VI--NIL.LNIIL....V......---------------------------
D5E4C9_BACMQ/373-523----------M...F---------LGI--VI--KLI.LNFIL....L......---------------------------
D5QEL1_GLUHA/351-483----------S...V---------VEV--VV--YIP.LLL..L..FL......---------------------------
D5T1U4_LEUKI/363-511----------F...T---------LGF--VV--KLI.LQPIL....I......---------------------------
D5TQD2_BACT1/321-460----------V...T---------VGA--VL--SLI.INLIL....V......---------------------------
D5UPU7_TSUPD/350-482----------N...V---------VNL--IG--NIV.LNVIL....I......---------------------------
D5VU50_METIM/353-494----------L...Y---------IGA--FF--NLI.FNILL....I......---------------------------
D5WSL0_BACT2/373-521----------L...F---------IGL--VL--KVV.LN..LW..WV......---------------------------
D5X9J9_THEPJ/361-503----------L...L---------VGV--VV--KLG.LNYYLT..GL......---------------------------
D5XD05_THEPJ/326-457----------V...F---------VGA--LL--NTV.LNLIL....I......---------------------------
D6KSV4_SCAIO/332-470----------V...V---------FGA--IT--NII.INIFA....I......---------------------------
D6XV50_BACIE/360-507----------L...L---------AGV--GV--KGL.GNAVL....V......---------------------------
D6Y0K7_BACIE/382-530----------L...L---------IGI--LT--KLI.VNIPF....I......---------------------------
D7BDH0_MEISD/336-473----------G...F---------AAS--AL--NIG.LDYLL....I......---------------------------
D7D534_GEOSC/329-466----------V...L---------AGG--VI--NII.LNLVF....I......---------------------------
D7DRX9_METV3/353-490----------L...Y---------FGA--MV--NVI.LNILL....I......---------------------------
D7E977_METEZ/332-466----------W...M---------FAA--VL--NFG.LNILI....I......---------------------------
D7UUI0_LISGR/356-499----------V...L---------IGI--VV--KWL.ANQFL....I......---------------------------
D7WQC4_9BACI/353-489----------S...I---------YGG--LG--KLF.VMFVLA..SQ......---------------------------
D8GMK0_CLOLD/327-460----------V...L---------ISS--MF--NVI.SN..LI..FI......---------------------------
D8ILC9_LACSC/25-170----------N...I---------IEP--II--NIV.ASLLFI..LV......---------------------------
D8J472_HALJB/339-477----------K...G---------STA--LL--NFL.LNLLL....I......---------------------------
D8J725_HALJB/340-478----------T...A---------VLV--AV--NVG.VSVLL....V......---------------------------
D8J7W8_HALJB/319-457----------V...V---------VTI--AI--NLV.LNVAL....V......---------------------------
D8MET9_LEUGT/321-460----------T...F---------AGA--IS--NII.LN..LL..FI......---------------------------
D8PBA0_9BACT/336-473----------I...G---------IIV--PV--DVG.LCAGL....I......---------------------------
D9PYX0_METTM/350-483----------L...V---------AGT--VI--NLA.LNVAL....V......---------------------------
D9QSV7_ACEAZ/363-507----------L...F---------LGG--AL--NAV.LNYFLT..AI......---------------------------
E0I7A7_9BACL/353-491----------V...I---------CCV--VV--NVG.LNVLL....I......---------------------------
E0IFR0_9BACL/366-514----------T...L---------IGI--AV--KLV.ASVALA..PV......---------------------------
E0NHN4_PEDAC/321-459----------V...S---------ISA--LV--NLV.LNVPLI..Y.......---------------------------
E0PD92_STREI/325-464----------F...V---------AGV--VT--NAI.VNSIL....I......---------------------------
E0RCM4_PAEP6/382-529----------V...M---------VGI--VV--KFA.ASWLLA..G.......---------------------------
E0RM54_PAEP6/373-525----------M...L---------AAA--VA--KAL.LNWLL....V......---------------------------
E0RMQ1_PAEP6/366-508----------T...F---------IGA--VI--KIA.LIVWLA..SQ......---------------------------
E0RUK9_BUTPB/373-516----------L...T---------VGW--AV--HIG.LLVLLS..IV......---------------------------
E0S188_BUTPB/322-462----------I...I---------IGA--FV--NLI.INYTFI..GI......---------------------------
E1IAS8_9CHLR/378-523----------F...V---------IGA--VA--NLC.MNLVAI..PVATLVFG---------------------------
E1IEK9_9CHLR/380-529----------R...L---------ITL--LV--VVP.LAILL....P......---------------------------
E2ZD67_9FIRM/360-502----------M...G---------ISA--LV--KIV.LSWYLT..AI......---------------------------
E3CI47_STRDO/375-523----------F...L---------WGI--LA--KLV.FQVPML..YV......---------------------------
E3FNG9_STIAD/347-485----------S...V---------VSM--VL--NAT.LNLTLARPFL......---------------------------
E3GGE0_EUBLK/365-508----------L...A---------IAI--VI--RFV.TGWICL..AV......---------------------------
E3GZ73_METFV/328-459----------T...G---------IAA--AF--NVV.VNLIL....I......---------------------------
E4KNA5_9LACT/790-938----------L...L---------IGL--LV--KAM.AQYPFV..AV......---------------------------
E4L4W5_9STRE/321-459----------A...V---------VGL--IT--NVI.GNIILI..PI......---------------------------
E4LZJ6_9CLOT/384-531----------L...A---------IMM--VV--KFS.VAYPLL..........---------------------------
E4MLQ7_9FIRM/372-517----------A...G---------ISL--LV--NLASLAAMLV..AL......---------------------------
E4NUG7_HALBP/319-458----------T...V---------VSV--AL--NLI.LNVVLI..LS......---------------------------
E4SMU5_LACAR/327-469----------T...V---------ITA--VL--NVV.LNFIL....I......---------------------------
E5WAE4_9BACI/356-502----------V...C---------CGI--LV--KAV.LNELL....I......---------------------------
E5WT44_9BACI/362-510----------I...L---------MGF--AV--KLA.LNILL....V......---------------------------
E5X0H2_9BACE/326-464----------.....---------.EI--IK--KTI.ATLILL..LS......---------------------------
E5Z458_9BACL/362-509----------V...M---------IGI--VV--KLA.ASFLL....A......---------------------------
E6LD53_9ENTE/253-391----------V...T---------VGA--LV--NLF.LNVFFI..K.......---------------------------
E6LEY4_9ENTE/358-506----------V...V---------CGC--IV--KFV.TTGIL....T......---------------------------
E6LIJ6_9ENTE/381-529----------L...V---------IGF--IL--KLI.LQVPFI..FL......---------------------------
E6LN70_9FIRM/381-525----------A...F---------ISL--II--HFI.ILYILL..FT......---------------------------
E6MFC3_9FIRM/328-466----------E...I---------AGA--LV--DLV.VNWLL....I......---------------------------
E6MGM4_9FIRM/373-516----------L...G---------LGI--IV--FSV.TGWIAM..SI......---------------------------
E6QMG7_9ZZZZ/367-517----------SVPNI---------LFL--AV--TVP.LSYLY....L......---------------------------
E6TRQ4_BACCJ/362-512----------L...A---------AGV--VI--KII.GNNIA....V......---------------------------
E6U1Q3_BACCJ/375-523----------L...L---------AGL--IF--KLT.FTYLMI..V.......---------------------------
E7FPH6_9LACO/355-501----------L...L---------CGI--FV--KAC.TNVWLI..G.......---------------------------
E7MM58_9FIRM/379-526----------F...L---------IGF--LV--KVV.TFYPCC..YL......---------------------------
E7QQ57_9EURY/339-477----------K...G---------ATS--AA--NFA.LNLVL....I......---------------------------
E7RE43_9BACL/368-516----------L...S---------TGL--LL--KAL.LNTPL....I......---------------------------
E7RL93_9BACL/356-500----------I...I---------IGV--GI--KLF.LNLTL....V......---------------------------
E7RLD1_9BACL/354-503----------L...I---------SGL--VV--KVI.CNLLL....V......---------------------------
E7RZY6_9BURK/339-474----------I...L---------SAA--GL--NVL.LNLLL....I......---------------------------
E7S3G0_STRAG/321-467----------A...V---------IGL--VA--NVV.LNILLI..PI......---------------------------
E8JWJ5_STRCR/327-467----------V...S---------LGA--LV--NLG.LNLIL....M......---------------------------
E8K660_STRPA/410-558----------F...L---------YGV--VV--KLV.LQIPFI..LV......---------------------------
E8LB44_9FIRM/369-509----------M...I---------IAC--IV--KIV.MSWYLT..AV......---------------------------
E8R8C0_DESM0/349-487----------W...I---------VNT--LV--SLP.LTLIL....L......---------------------------
E8RTH0_ASTEC/331-467----------M...A---------IPA--IA--NVG.LNLWL....I......---------------------------
E8SIP0_STAPH/344-486----------L...V---------IGI--VT--KGV.LNIIV....I......---------------------------
E8V165_TERSS/339-475----------L...I---------LTG--VL--NIA.LDAAL....I......---------------------------
E9RY62_9FIRM/330-468----------E...I---------AGA--VI--DLI.LNLIL....I......---------------------------
F0DJ09_9FIRM/357-499----------L...V---------IAS--VF--KIL.GLYYLT..AV......---------------------------
F0EKD4_ENTCA/327-465----------T...I---------SSA--LL--NII.LNLIL....I......---------------------------
F0HVE0_LACDL/327-469----------S...A---------TSA--VL--NIV.LNFAL....I......---------------------------
F0KAR0_CLOAE/326-458----------V...V---------ISS--LF--NLI.INLLL....T......---------------------------
F0LLW6_THEBM/342-478----------N...L---------ISA--MF--NLL.LNTLLI..PV......---------------------------
F0LLZ4_THEBM/339-477----------E...L---------TAV--LV--NVI.LNILL....I......---------------------------
F0T719_METSL/333-463----------T...F---------ISM--IF--NIV.LN..LW..AI......---------------------------
F0TB30_METSL/351-484----------L...V---------AGI--TV--DLI.LSLAL....I......---------------------------
F0TBQ9_METSL/329-463----------S...L---------VCL--VL--NVI.LNLIL....I......---------------------------
F0TC71_METSL/328-460----------T...A---------INA--II--NVA.LNLVL....I......---------------------------
F1VXT7_9BURK/320-462----------G...I---------IGT--IL--QVT...SFFI..GV......---------------------------
F1Z193_9STRE/350-488----------L...M---------CGL--IL--KLL.LTPIM....T......---------------------------
F2F183_SOLSS/360-508----------L...G---------VGI--VL--KYI.GNIIF....I......---------------------------
F2G999_ALTMD/323-469----------V...L---------INI--FC--NIL.IASCT...........---------------------------
F2I7P9_AERUA/374-520----------L...G---------LGL--LV--KGV.FAHML....V......---------------------------
F2JLQ5_CELLD/355-497----------N...V---------MGS--LI--CIA.LI..LL..MV......---------------------------
F2KQE3_ARCVS/343-481----------G...F---------IAA--VI--NFV.LNLIL....I......---------------------------
F2NHK3_DESAR/367-498----------T...W---------LGA--LI--HIT.ANLLL....I......---------------------------
F2NKF2_MARHT/337-483----------G...V---------ATS--VL--NLG.LDLLL....I......---------------------------
O06039_LACLC/321-459----------L...I---------CGN--LV--NVS.LNLIL....L......---------------------------
O26442_METTH/329-460----------V...G---------ISA--AF--NIV.LNMIL....I......---------------------------
Q03E00_PEDPA/355-503----------I...I---------TGI--II--KVV.LNSWA....T......---------------------------
Q03RI1_LACBA/378-525----------F...L---------VGT--VV--KFI.VQWPLV..YF......---------------------------
Q03SZ7_LACBA/349-498----------L...M---------TGF--IV--KCL.FNRWS....V......---------------------------
Q03XR0_LEUMM/330-477----------I...G---------WGI--AV--KIL.CQPIMI..YL......---------------------------
Q0AHL3_NITEC/325-466----------V...L---------LAS--IV--MPI.A...FL..IG......---------------------------
Q0AP11_MARMM/327-464----------M...A---------ASA--GL--NLA.LNLLL....I......---------------------------
Q0W809_UNCMA/331-464----------A...G---------VCM--LV--YLA.LNIIL....I......---------------------------
Q12TY8_METBU/325-459----------L...P---------LAV--II--EII.LLILL....V......---------------------------
Q12VM9_METBU/345-483----------T...F---------IGV--AA--NIA.LNFIL....I......---------------------------
Q12XY4_METBU/326-458----------T...A---------FAA--FF--NIA.LN..FI..FI......---------------------------
Q18GU8_HALWD/357-496----------N...A---------LAA--GV--NIT.LNYFLL..IL......---------------------------
Q1GPL1_SPHAL/342-484----------A...M---------SGA--ML--FPA.S...FL..IG......---------------------------
Q1K412_DESAC/351-495----------A...V---------VEA--VM--NVV.FSLLFV..ML......---------------------------
Q2B249_9BACI/362-508----------I...I---------GGF--GI--KYI.LNILL....V......---------------------------
Q2NH55_METST/331-464----------A...A---------IGA--IF--SII.LNLILI..YY......---------------------------
Q2NIB6_METST/328-458----------T...F---------ICL--LF--STI.GNFILI..........---------------------------
Q2S953_HAHCH/328-463----------S...V---------ATL--AT--NAI.LDILL....I......---------------------------
Q2Y4J6_9ARCH/377-524----------G...V---------GIC--IA--NIG.LNYLF....I......---------------------------
Q2YCC1_NITMU/331-475----------A...V---------FAL--II--LLP.LI..LV...G......---------------------------
Q2YCG5_NITMU/323-466----------Q...M---------ACL--MV--MIF.GLS.L....T......---------------------------
Q38V74_LACSS/358-503----------L...L---------IGL--LV--KVV.INQWL....V......---------------------------
Q38VP9_LACSS/378-526----------L...L---------IGF--IV--KVV.AQYPAI..YF......---------------------------
Q3ADH7_CARHZ/346-484----------L...L---------GAS--GV--KIL.SLLLL....T......---------------------------
Q3APG3_CHLCH/338-477----------A...V---------VAL--AL--QAG.LNWLF....I......---------------------------
Q3B6G9_PELLD/337-476----------A...L---------SAL--TL--QVA.LNLLL....I......---------------------------
Q3ZK40_9LACT/322-460----------I...I---------IAA--IV--SLI.TNLIL....I......---------------------------
Q469G3_METBF/349-484----------S...V---------ASA--GI--NVA.VNFML....I......---------------------------
Q46FX4_METBF/329-461----------T...F---------IGA--VL--NIC.LNFIL....I......---------------------------
Q47U72_COLP3/338-482----------N...L---------LGA--LL--NIG.LSLVL....G......---------------------------
Q49V13_STAS1/337-479----------F...I---------TGV--VS--KAI.LNVVL....I......---------------------------
Q4JYJ9_STRPN/323-464----------V...M---------SGA--VV--SIL.LN..FI..VI......---------------------------
Q4JZ09_STRPN/330-470----------V...S---------IGA--IV--NLC.LNLLL....M......---------------------------
Q4K189_STRPN/323-460----------L...L---------YGA--VV--NIL.INILL....I......---------------------------
Q5JDW0_PYRKO/345-480----------N...L---------LAA--LL--NVA.LNMALI..PV......---------------------------
Q5LFL1_BACFN/328-466----------T...M---------VGA--CI--NLL.INYLL....I......---------------------------
Q5M4A4_STRT2/55-193----------T...I---------ISA--IL--NII.ASFLLI..........---------------------------
Q5V4U1_HALMA/327-465----------N...M---------VFI--VS--NAI.LNAVL....I......---------------------------
Q5WAF7_BACSK/347-496----------V...A---------VGL--AV--KLA.GNLLFI..PV......---------------------------
Q5WE75_BACSK/374-522----------L...V---------VGL--LL--KLG.LTYVF....L......---------------------------
Q67JD5_SYMTH/384-522----------F...V---------LGA--AV--KIG.LTAWW....T......---------------------------
Q8EP19_OCEIH/372-521----------L...L---------TGL--FV--KIL.LNSQLI..HM......---------------------------
Q8EU30_OCEIH/362-509----------I...A---------ITF--II--KWI.GNLLF....I......---------------------------
Q8GPE5_STRTR/321-459----------V...F---------ISV--II--SLG.VSFVL....V......---------------------------
Q97AA3_THEVO/339-476----------S...A---------ASL--AS--NAI.LSIIL....I......---------------------------
Q9KGJ0_BACHD/361-507----------L...A---------VSL--LV--KMV.ANVVL....I......---------------------------

PF03023

MURJ_BORBU/29-473......S...A---V---------IGV--IF--GGF-LQFLIPFANCLMIGFA.................WKPTFYFREK
MURJ_RICPR/28-477......S...I---S---------VSL--II--AGI-LQVVFMFICVKKADLH.................FPIIFHTNDP
MURJ_ECOLI/28-479......A...L---A---------WAV--TV--GGV-LQLVYQLPHLKKIGML.................VLPRINFHDA
MURJ_RHITR/28-484......TAWYL---S---------WSV--LV--AGV-LQLAVVYIGVRHAGIS.................IGLRFPRFTP
MURJ_CHLPN/35-484......G...L---S---------VAL--VI--GFF-FEWLITVPGVWKFLLE.................AKSPPQEHDS
MURJ_SYNY3/36-495...WLLGSLLL---A---------GGT--TA--GAV-LQWLAQIVPQAKAGMG................KLRLRFNFALP
MURJ_AQUAE/29-466......S...L---A---------LAV--LI--GGL-FQIIPNTFLLFKEKLL.................KIP.KFSLDR
MURJ_HAEIN/16-479......A...L---A---------IGI--FL--GGL-LQFLFQIPFMKQAGLL.................VKPKWAWRDE
MURJ_THEMA/28-450......A....---.---------AGF--TI--GGL-AALLVLLPFGKFRYRP........................TFK
MURJ_HELPJ/1-458......Y...L---S---------YGV--LL--GGV-AQILLHFYPLVKLGLWDLLFKGLLGFKTKNTNKKEYRLNRAKK
Q9X8T0_STRCO/300-778TSIPPEGERLL---G---------IGV--LL--GLI-VQSLAMIPYLRETGFR.................LRLRFDWRGH
MURJ_TREPA/32-489......A....---A---------IGV--LI--GGC-AQALFQLIFVYMHGFRF..............TLQSPLKAMHDE
Q9RX17_DEIRA/83-522.........WL---A---------FGW--LI--GGV-AQLLVQLPALRRFGLL................P.EPRLGGHPA
MURJ_CHLTR/34-482......G...L---A---------VVL--VI--GFI-LEWAVTLPGVMKFLGQ.................SKEVPQERDS
O05435_MYCTU/48-522..MGNAKLLVL---G---------IGT--TA--GVF-AQTAVLLVAIRREHIS.................LRPLWG.IDQ

PF13440

D0I1Y2_VIBCL/18-260----------L---K---------NSF..MT..RFF-VFAVLLAL..---------------------------------
D0HB98_VIBMI/18-260----------M---Y---------ESY..KV..RFL-IVVPVTIFII---------------------------------
A8UQ25_9FLAO/16-256----------Y---Y---------LTQ..SA..RLT-LSLFLFIF..---------------------------------
Q4JBJ6_SULAC/28-278----------L---L---------LNL..IT..GAI-SSLIYVVLTP---------------------------------
Q2YCG5_NITMU/22-272----------F---S---------RIM..LL..SFI-GMLCVFAISY---------------------------------
C8XCC3_NAKMY/40-272----------H---.---------.LT..SL..CLL-VTVAVFAL..---------------------------------
Q3K9H6_PSEPF/12-267----------L---L---------LYL..AV..GLA-LSVLTVVIYS---------------------------------
O58733_PYRHO/24-254----------A---G---------ISF..LS..PLL-GLVLMPIN..---------------------------------
Q1D7B4_MYXXD/29-283----------L---L---------FMS..AM..GLV-GAGAVWALLG---------------------------------
C4WNX8_9RHIZ/31-284----------Y---T---------AGF..LV..AIL-VSLPLFALAS---------------------------------
A6X6T8_OCHA4/16-269----------Y---T---------AGF..LV..ALL-VSLPLFALAS---------------------------------
B1M5Z3_METRJ/17-264----------G---T---------VVR..IL..GGT-LLLAGLGSAL---------------------------------
A1UCH8_MYCSK/30-289----------A---S---------SHL..VA..TAL-LSMASAPAVA---------------------------------
Q1BCG5_MYCSS/30-289----------A---S---------SHL..VA..TAL-LSMASAPAVA---------------------------------
A3PW68_MYCSJ/30-289----------A---S---------SHL..VA..TAL-LSMASAPAVA---------------------------------
Q0RPT3_FRAAA/322-573----------G---A---------AGT..GT..AFV-IGLLSGAVTL---------------------------------
Q0RCF1_FRAAA/179-430----------A---S---------ATT..GS..SFV-FGIGIGVGFV---------------------------------
D3CWT1_9ACTO/203-455----------A---G---------STT..GA..CLA-FGAVLSLPTV---------------------------------
Q8KN00_9ACTO/40-289----------V---A---------RST..GT..SLV-VGAGVGTLCL---------------------------------
Q9RJJ1_STRCO/34-283----------V---A---------RAS..GA..ALL-VGAGIGTVSL---------------------------------
D2PZ16_KRIFD/24-275----------V---R---------AST..AT..AFL-AGVAAMLVGL---------------------------------
C8XCR8_NAKMY/39-289----------V---R---------SAL..GA..TIA-LGVVAGILTA---------------------------------
A4FEI7_SACEN/8-256----------V---S---------SAV..GG..WAL-LFAAGC....---------------------------------
A9VW94_METEP/42-293----------Y---Y---------AIV..LVHEAAF-LTLAGGAVAI---------------------------------
B7KU42_METC4/42-293----------Y---Y---------AIV..LVHEAAF-LTLAGGAVAI---------------------------------
C7C8V6_METED/42-293----------Y---Y---------AIV..LVHEAAF-LTLAGGAVAI---------------------------------
C5ATW3_METEA/42-293----------Y---Y---------AIV..LVHEAAF-LALAGGAVAI---------------------------------
C7LVX3_DESBD/8-264----------Q---R---------ILLRSHW..RFG-GAACLFFLVL---------------------------------
Q2CIK8_9RHOB/14-260----------W---R---------VNV..AF..CFV-GAALLALSMR---------------------------------
Q89SM5_BRAJA/14-270----------R---F---------S.L..FS..AGL-LSALVLLLVG---------------------------------
C8KY87_9PAST/18-266----------F---Y---------FLC..F....LI-LSAVVAALSC---------------------------------
C5RZU1_9PAST/18-266----------F---Y---------FLC..F....LI-LSAVVAALSC---------------------------------
A9AXJ4_HERA2/36-280----------R---Q---------IAW..GI..GAA-SAGVCTGLAA---------------------------------
D0YZQ3_LISDA/18-261----------V---V---------FGL..LQ..SWI-VSAAYIF...---------------------------------
D2BRK8_DICD5/18-261----------V---V---------FST..LQ..SLI-VAVPYAVL..---------------------------------
B1IZZ3_ECOLC/18-261----------V---V---------FCL..LQ..SAI-LALPYALL..---------------------------------
B9JQS0_AGRRK/94-340----------W---R---------HAV..FA..ICV-SGVAGAILD.---------------------------------
Q676G9_RHIRD/94-340----------W---R---------HAV..FA..ICV-SGVAGAILD.---------------------------------
B5JNG5_9BACT/22-272----------I---Q---------KT...FI..KII-LPTIAPI..P---------------------------------
A6VTF9_MARMS/19-265----------L---Y---------LRI..I......-GSVLFLFFVF---------------------------------
B9EAW7_MACCJ/18-258----------R---N---------FYT..VF..MFI-TYFIILVL..---------------------------------
C2KV49_9FIRM/32-288----------R---S---------LTG..GL..ALI-LAVLFLLFQY---------------------------------
A4EAS6_9ACTN/45-291----------Y---Q---------LNR..WL..CGA-LALACG.LVY---------------------------------
A6Q4F3_NITSB/16-266----------V---Y---------WYL..IS..FWG-LFIITCCFEI---------------------------------
Q8EFK4_SHEON/26-281----------F---R---------YSL..IA..MVL-LAWGVVL..P---------------------------------
A6WPP6_SHEB8/25-280----------F---R---------YSL..IA..MVL-LTWGLVL..P---------------------------------
A1RKH9_SHESW/25-280----------F---R---------YSL..IA..MVL-LTWGLVL..P---------------------------------
A4Y617_SHEPC/25-280----------F---R---------YSL..IA..MVL-LTWGLVL..P---------------------------------
E6XI49_SHEP2/25-280----------F---R---------YSL..IA..MVL-LTWGLVL..P---------------------------------
A6FGK5_9GAMM/27-282----------F---R---------YSL..IT..MVL-ITWGVVI..P---------------------------------
B8CST1_SHEPW/46-301----------F---R---------YSL..IL..MVL-LTWGIVL..P---------------------------------
A8UIN6_9FLAO/18-257----------F---K---------STL..SR..SPL-LLLSLLFF..---------------------------------

PF01943

SP5B_BACSU/6-308...DHQKTKNI---L---------VMS--LT--ITG-VLSLIFTPLF---------------------------------
CAPF_STAAU/1-264.........EY---I---------S.A--IL--SLN-IITLIFVAIF---------------------------------
O87185_STRAG/6-275.....EEFKSY---S---------GSA--FS--VGN-IWFLIILLIA---------------------------------
EXOT_RHIME/10-277......VHSVF---W---------ANL--AI--ALM-MALGLFVFAE---------------------------------
TUAB_BACSU/10-277.....QLSTLY---W---------LNI--MT--GVL-LFVLLYVSSP---------------------------------
O06039_LACLC/3-269....KQKRSEI---F---------WGI--TF--LSW-ATGAISLLIF---------------------------------
RFBX_ECOLI/8-279....KDKVTSI---F---------WAV--IF--SKI-VLIVITLIFL---------------------------------
YCP11_KLEPN/9-277.....ELSALY---W---------VNI--FL--GVF-LFVVTIILSY---------------------------------
RFBE_SHIFL/3-283....HHERTKV---I---------STS--TS--FLV-LFSCFGAFLL---------------------------------
O58158_PYRHO/7-277......LARKY---L---------ANG--LV--LKL-LFGTLTFLIV---------------------------------
O26447_METTH/15-286....TERVSLI---Y---------SSV--MV--TKT-ILLAVTFMAM---------------------------------
YTGP_BACSU/5-320....YETSRKM---L---------KAG--MS--VML-VTGMIAFFIL---------------------------------
Y1068_METJA/7-302DMLKSSIVFVG---I---------LQT--IL--AFI-VAFLVVIFAP---------------------------------
Q56865_YEREN/18-287......KCSAI---I---------STI--FT--ARF-LMSMVCLIIA---------------------------------
Q56913_YEREN/4-274....PEYISKI---F---------FET--LI--SKS-ILCLVSIVIV---------------------------------
O07870_STRPN/6-276....RDKLSKV---V---------QEL--MI--INV-AMSIITTAIL---------------------------------
O58127_PYRHO/9-279......KAEEL---L---------PDV--LG--LKI-VLALINFGVI---------------------------------
O86895_STRPN/3-267....IGKNFWG---I---------YSL--QF--GAT-WLSILLYLAL---------------------------------
O07342_STRPN/5-273....KEILSKT---F---------WNI--YY--VQL-LMSVLVTIAY---------------------------------
Y1375_METJA/3-283.....VDINKY---I---------PIL--YL--MIL-LSVVGFILTP---------------------------------
O52526_RHILT/10-273.....HFSAVW---T---------LSV--TR--SAI-LALLFAASSF---------------------------------
Q56776_XANCA/21-288.....QRDNLF---W---------INS--GI--GLM-LSVVVFASAH---------------------------------
O26479_METTH/10-276....RELVAAG---L---------GNR--II--LSC-IVFVLILLFP---------------------------------
P74815_9SPHN/37-317GVARTAVRHAT---R---------VAV--GG--GLV-LMVMILLFHQ---------------------------------
O29660_ARCFU/6-285ELVRGYIRSLT---K---------LKA--LL--VLA-VASMLFLGSD---------------------------------
O26467_METTH/18-289....PHRVSEI---F---------SSV--ML--IKG-ILATLSFCIL---------------------------------
O26442_METTH/7-278......LSSYY---V---------NNA--VF--LKI-PLSILTFVLI---------------------------------
YABM_BACSU/12-309.....NHHTIL---K---------ISA--LF--LSL-IGILLFLCLY---------------------------------
WZXC_ECOLI/9-276.....ELTTLY---W---------LNV--GL--GIV-VCVAVFLLSD---------------------------------
O85002_STRPN/7-276.......KKSV---F---------SIA--VL--DIF-IGSIAFALLL---------------------------------
RFBX_SHIDY/1-270....QAEINKI---Y---------SET--LI--VKL-LLATICLALG---------------------------------

PF01554

C5W5G6_ECOBD/100-262--------------A.........FFA--AI--DLG-TTVVVA-------------------------------------
C5W5G6_ECOBD/330-491--------------L.........PGS--AL--GSA-STIITG-------------------------------------
O51531_BORBU/22-182--------------T.........IGF--SM--AGA-YNIIAT-------------------------------------
YOEA_BACSU/28-189--------------S.........FTI--GI--GSG-SSILIG-------------------------------------
YOEA_BACSU/257-418--------------M.........PAV--SL--GIA-VSIFAA-------------------------------------
O66528_AQUAE/245-406--------------M.........IGF--GV--MIA-STTLAG-------------------------------------
YPNP_BACSU/241-402--------------L.........PAM--AA--GTA-VNSMAG-------------------------------------
NORM_VIBPA/243-404--------------M.........LPM--SV--GAA-VSIRVG-------------------------------------
O80695_ARATH/278-441--------------M.........VSV--GF--NAA-ASVRVS-------------------------------------
O26414_METTH/244-409--------------V.........PVI--SV--ATA-LVSVSG-------------------------------------
O33729_STRPN/24-185--------------G.........FTL--GV--GNG-MGIVIA-------------------------------------
O59471_PYRHO/14-174--------------P.........IMM--AI--STG-TLALVA-------------------------------------
O28801_ARCFU/21-180--------------A.........ISF--GL--SVG-ANSAVS-------------------------------------
YISQ_BACSU/27-187--------------V........MFSF--.I--ATG-TTVIIS-------------------------------------
Y709_METJA/243-408--------------I.........PML--GL--ASG-ATSVIG-------------------------------------
YPNP_BACSU/21-182--------------S.........FIL--GL--NNA-TLTILS-------------------------------------
O25454_HELPY/214-375--------------M.........PGF--GF--MIA-AMVLTG-------------------------------------
NORM_BACSU/20-180--------------T.........GLA--GI--LMA-VTPIVA-------------------------------------
HMRM_HAEIN/249-410--------------M.........FPM--SI--GMA-TTILVG-------------------------------------
O49713_ARATH/195-358--------------M.........VSV--GF--NAA-VSVRTS-------------------------------------
O49660_ARATH/262-426--------------A.........VML--SL--GTC-VATRVS-------------------------------------
O82752_ARATH/42-203--------------Y........SLLS--GL--SIG-MEPICV-------------------------------------
DINF_ECOLI/35-196--------------M.........LLL--FL--RMS-TTGLTA-------------------------------------
O23067_ARATH/280-459--------------IIVLTGHLEDPVI--AV--G.S-LSIWVS-------------------------------------
Q9ZK32_HELPJ/23-184--------------A.........YEL--LF--GFG-AASIVG-------------------------------------
Q9ZVH5_ARATH/238-401--------------V.........VPF--AI--SSA-IATRVG-------------------------------------
O28801_ARCFU/239-404--------------V.........PLF--GV--SAA-LTAVSG-------------------------------------
O58340_PYRHO/26-186--------------S.........IGS--GF--AVA-GFAMVS-------------------------------------
Q38956_ARATH/275-438--------------M.........IAI--GM--NTA-VSVRVS-------------------------------------
O58340_PYRHO/247-408--------------A.........FAD--GI--SQA-MGTMVG-------------------------------------
O33729_STRPN/246-408--------------L.........PMT--AI--SAS-MTTFAS-------------------------------------
ERC1_YEAST/174-335--------------L........AAIQ--GL--CTC-LDTLCA-------------------------------------
Q9ZVH5_ARATH/16-176--------------V........SVLK--GL--SVG-MDPICG-------------------------------------
O80785_ARATH/37-197--------------F........TFLM--GT--ASA-MDTVCG-------------------------------------
O73981_PYRHO/41-201--------------A.........LGI--GF--TMA-GFSIVG-------------------------------------
O59471_PYRHO/238-404--------------M.........PAF--GF--SIA-TSALVG-------------------------------------
YAO6_SCHPO/17-177--------------W........LIAL--GG--TTA-FDTLGS-------------------------------------
O82752_ARATH/264-427--------------I.........FPS--SL--SIS-VSTRVG-------------------------------------
O51429_BORBU/27-187--------------A.........IAM--GM--ATG-SISLMS-------------------------------------
O83871_TREPA/32-196--------------T.........ALM--TV--SNA-GSVFMT-------------------------------------
O51429_BORBU/248-409--------------L.........PAM--GI--GTG-IISIVG-------------------------------------
O23067_ARATH/98-258--------------F........GFLL--GM--ASA-LETLCG-------------------------------------
YISQ_BACSU/252-413--------------L.........FGT--AI--SQG-TQILIG-------------------------------------
O66528_AQUAE/25-183--------------S.........LMA--LS--YSG-TNILIA-------------------------------------
O51530_BORBU/21-181--------------I.........IVF--GL--GTA-LSAYVS-------------------------------------
Y709_METJA/21-181--------------A.........VSW--GL--SIG-ISSGIA-------------------------------------
NORM_BACSU/247-408--------------M.........LPL--SV--SMA-LTIVVG-------------------------------------
NORM_VIBPA/17-176--------------L.........FGI--GL--LMA-LVPVVA-------------------------------------
O26414_METTH/24-183--------------G.........LSN--GL--GAG-AASSVS-------------------------------------
HMRM_HAEIN/22-181--------------F.........FGQ--GL--LLA-LPPTIS-------------------------------------
YD338_YEAST/238-397--------------A.........IFE--GI--ATS-LDTLCP-------------------------------------
O73981_PYRHO/262-424--------------S.........ISR--GI--SMA-MSTMVA-------------------------------------
MDTK_ECOLI/17-177--------------L.........FGH--GL--LLA-LTPVIA-------------------------------------
Q38956_ARATH/55-215--------------F........GIML--GM--GSA-LETLCG-------------------------------------
P71616_MYCTU/19-179--------------S.........QAT--FL--SYG-TTARAA-------------------------------------
O49660_ARATH/40-200--------------F........SVLY--GI--SAA-MEPICG-------------------------------------
O80695_ARATH/57-217--------------Y........GLLL--GM--GSA-VETLCG-------------------------------------
MDTK_ECOLI/244-405--------------V.........LPM--SL--AAA-VTIRVG-------------------------------------

PF04506

RFT1_SCHPO/9-527........NKA---P---------SSL--PF--ALGNLSEKVTIFFTLRYFAKQP......FSIFLHKVGE.....NER.
RFT1_DROME/7-556YFYLKG..FKD---F---------VTQ--QA--KKKPVAPKAWQVSLYEHMDDFP...FKQLSDFLPGVMF.....NPN.
RFT1_CAEEL/1-519..........A---I---------AYL--LF--NFVAFYIYIRNKSIPELEQFST......FSDLFPKFSEG........
RFT1_YEAST/17-572VV.TSDIDKEG---I---------AIL--AF--ALGKLAHSITLLACYYWDYLKNFKPKKLFSTRLTKIKTRENNELKKG

PF14667

A0AF13_LISW6/361-504------------------------------------------------------.PQFA...T.........I--G---A
A0NHL2_OENOE/387-534------------------------------------------------------...LQ...A.........T--G---A
A0RJU4_BACAH/372-520------------------------------------------------------.RYFG...T.........V--G---A
A1ASY9_PELPD/345-481------------------------------------------------------.PFYG...I.........I--G---A
A1BJ49_CHLPD/337-476------------------------------------------------------.PRYG...I.........T--G---A
A1HLQ5_9FIRM/371-513------------------------------------------------------.PALG...I.........K--G---A
A1ILY9_STROR/319-458------------------------------------------------------.PKLG...Y.........I--G---A
A1S103_THEPD/335-472------------------------------------------------------.QRLG...L.........Y--G---L
A1YVF6_LACJH/321-459------------------------------------------------------..MWG...L.........N--G---A
A2RG74_STRPG/377-525------------------------------------------------------...LH...A.........Y--G---P
A2RHU4_LACLM/321-459------------------------------------------------------.PLLG...L.........T--G---A
A2RMM4_LACLM/390-539------------------------------------------------------...FH...T.........Y--G---P
A2STD2_METLZ/331-469------------------------------------------------------...FG...I.........N--G---A
A3CPL5_STRSV/375-523------------------------------------------------------...FK...A.........Y--G---P
A3CVY7_METMJ/333-471------------------------------------------------------.PAYG...I.........V--G---A
A3DHV8_CLOTH/327-465------------------------------------------------------.LKFG...V.........Y--A---I
A3DIV8_CLOTH/358-500------------------------------------------------------.PSYG...I.........A--G---Y
A3F4D6_LACLC/321-459------------------------------------------------------...LG...T.........V--G---A
A3I8W7_9BACI/372-521------------------------------------------------------...LE...A.........D--G---A
A3IEA1_9BACI/365-514------------------------------------------------------..WLG...V.........L--G---A
A3W1Y0_9RHOB/329-468------------------------------------------------------.ASFG...L.........V--G---V
A4FX93_METM5/354-492------------------------------------------------------.PKFG...V.........F--G---A
A4IJD3_GEOTN/352-496------------------------------------------------------.PPFG...V.........L--G---A
A4IRX9_GEOTN/371-520------------------------------------------------------.MKWA...T.........V--G---A
A4SCQ1_PROVI/337-476------------------------------------------------------.PRMG...I.........E--G---A
A4VW05_STRSY/379-527------------------------------------------------------...FK...V.........Y--G---S
A5D2G5_PELTS/358-502------------------------------------------------------.PQFG...I.........R--G---A
A5ITS6_STAA9/386-533------------------------------------------------------...FH...T.........P--G---A
A5LCT3_STRPN/372-520------------------------------------------------------...FH...S.........Y--G---P
A5M4K0_STRPN/211-349------------------------------------------------------.KPFG...A.........M--G---A
A5UNI7_METS3/328-460------------------------------------------------------.PHFS...V.........Y--G---A
A5UQJ1_ROSS1/330-463------------------------------------------------------.PALG...A.........K--G---A
A5UWW7_ROSS1/374-505------------------------------------------------------...YG...Y.........L--A---A
A5VL26_LACRD/382-530------------------------------------------------------...FE...G.........L--G---P
A5ZUX1_9FIRM/326-464------------------------------------------------------...FG...T.........R--G---A
A6CQJ8_9BACI/372-520------------------------------------------------------...LE...T.........Q--G---A
A6CR25_9BACI/352-499------------------------------------------------------.SRYG...T.........M--G---A
A6DHF1_9BACT/293-436------------------------------------------------------.LSWG...I.........S--G---V
A6NPI5_9FIRM/351-494------------------------------------------------------.PGVG...L.........G--G---Y
A6QEF7_STAAE/343-485------------------------------------------------------...SG...I.........I--G---A
A6TN15_ALKMQ/363-506------------------------------------------------------.SHWN...I.........L--G---A
A6TSY6_ALKMQ/375-519------------------------------------------------------.PKYG...I.........N--G---F
A6UPA0_METVS/351-488------------------------------------------------------.PKFG...T.........S--G---A
A6UU30_META3/353-490------------------------------------------------------.PKFG...I.........I--G---A
A7GJW7_BACCN/360-506------------------------------------------------------.PYIG...I.........A--G---A
A7HKJ9_FERNB/322-460------------------------------------------------------.PKYQ...S.........L--G---A
A7VPC0_9CLOT/355-497------------------------------------------------------.PLMG...L.........N--G---L
A7VWY4_9CLOT/433-577------------------------------------------------------.PAIN...I.........Q--G---A
A7Z0I0_BACA2/354-499------------------------------------------------------.PGWG...I.........T--G---A
A7Z7U6_BACA2/375-524------------------------------------------------------...FQ...G.........D--G---A
A8F924_BACP2/360-506------------------------------------------------------.PLLG...I.........Y--G---A
A8MIG9_ALKOO/365-508------------------------------------------------------.SSLN...I.........L--G---A
A8MK38_ALKOO/363-506------------------------------------------------------.PWLN...V.........R--G---A
A8RUL6_9CLOT/387-539------------------------------------------------------.FKMG...I.........Y--S---V
A8SAU1_9FIRM/356-502------------------------------------------------------.PRYG...M.........R--G---F
A8UAN8_9LACT/362-510------------------------------------------------------.EHYG...T.........L--G---S
A8UCR2_9LACT/391-539------------------------------------------------------...VG...T.........N--G---M
A9EQ86_SORC5/331-462------------------------------------------------------.PRYR...A.........M--G---A
A9WAD6_CHLAA/337-475------------------------------------------------------VFGNG...A.........L--G---G
B0K3R2_THEPX/360-504------------------------------------------------------.PQLR...L.........F--G---Y
B0MPG6_9FIRM/391-534------------------------------------------------------.PAIN...I.........N--G---A
B0N362_9FIRM/290-427------------------------------------------------------.PYFQ...A.........L--G---A
B0PEA8_9FIRM/441-584------------------------------------------------------.PQLN...I.........Q--A---A
B0TAY6_HELMI/361-505------------------------------------------------------.PSVG...L.........N--G---I
B0VF98_CLOAI/326-465------------------------------------------------------.IKFG...M.........K--G---A
B1MY12_LEUCK/485-634------------------------------------------------------.RYFE...G.........M--G---A
B1SH45_9STRE/377-525------------------------------------------------------...FK...A.........Y--G---P
B1YGP9_EXIS2/345-491------------------------------------------------------.PLYG...M.........V--G---A
B1YKH1_EXIS2/386-534------------------------------------------------------..TGD...G.........T--G---A
B2A2Z4_NATTJ/361-504------------------------------------------------------.PYLN...V.........N--G---A
B2A8K9_NATTJ/363-507------------------------------------------------------.PQIG...I.........I--G---G
B2GDL9_LACF3/322-460------------------------------------------------------.SKFS...A.........E--G---A
B3EHD9_CHLL2/365-504------------------------------------------------------.PLYG...T.........A--G---A
B3EP69_CHLPB/337-475------------------------------------------------------.PSYG...M.........I--G---A
B3W6R7_LACCB/364-511------------------------------------------------------...FE...S.........Y--G---P
B3WAP5_LACCB/356-499------------------------------------------------------.VKFG...T.........A--G---A
B3WCD6_LACCB/380-528------------------------------------------------------...FN...V.........Y--G---P
B3XNV8_LACRE/322-460------------------------------------------------------.AKWG...A.........N--G---A
B4AGJ7_BACPU/343-486------------------------------------------------------.LQLG...L.........Y--G---I
B4SBS0_PELPB/338-477------------------------------------------------------.PKMG...L.........N--G---A
B5CWR8_9BACE/324-466------------------------------------------------------.YFKT...I.........E--A---M
B5UWQ0_BACCE/360-510------------------------------------------------------.PYFG...V.........K--G---A
B6IYF6_RHOCS/343-484------------------------------------------------------..DRG...L.........V--A---L
B6YVL8_THEON/328-461------------------------------------------------------...YS...L.........N--G---A
B7AQB6_9FIRM/351-493------------------------------------------------------.PSYK...I.........T--G---Y
B7DPH6_9BACL/373-525------------------------------------------------------.L.HN...A.........L--G---A
B7DPL3_9BACL/356-497------------------------------------------------------.GNQG...I.........R--G---L
B7GFI4_ANOFW/350-497------------------------------------------------------.PLWH...T.........V--G---A
B7GMA5_ANOFW/366-505------------------------------------------------------.SWYG...L.........I--G---A
B7JJF5_BACC0/376-524------------------------------------------------------...FG...G.........H--G---A
B8D0L3_HALOH/359-505------------------------------------------------------.PELR...I.........I--G---S
B8D178_HALOH/340-478------------------------------------------------------.PNYG...I.........N--G---A
B8DHB8_LISMH/370-518------------------------------------------------------...FE...A.........K--G---S
B8IEZ7_METNO/324-461------------------------------------------------------.GRFG...A.........S--G---I
B8IGJ3_METNO/336-472------------------------------------------------------.PHLG...T.........V--G---A
B9CVC4_STACP/347-489------------------------------------------------------.SQLS...I.........F--G---A
B9DSP4_STRU0/342-480------------------------------------------------------...FS...V.........I--G---S
B9E7H2_MACCJ/374-522------------------------------------------------------...FH...T.........E--G---A
B9E8U7_MACCJ/341-481------------------------------------------------------.PQLD...I.........K--G---A
B9JKJ2_AGRRK/321-464------------------------------------------------------.YFFS...T.........G--G---V
B9K2D6_AGRVS/332-468------------------------------------------------------.PSYG...G.........E--G---A
C0QCL2_DESAH/352-496------------------------------------------------------.FDWG...L.........T--G---I
C0WBK9_9FIRM/378-517------------------------------------------------------.PTLG...I.........K--G---S
C0WLU0_LACBU/374-518------------------------------------------------------.TWLQ...G.........F--G---A
C0WQN7_LACBU/354-501------------------------------------------------------..TFG...I.........I--G---A
C0WUG9_LACBU/378-530------------------------------------------------------...LG...A.........F--G---P
C0WVB1_LACFE/322-460------------------------------------------------------.PFYS...A.........N--G---A
C0X1V9_ENTFL/370-519------------------------------------------------------...FK...G.........Y--G---L
C0X279_ENTFL/382-530------------------------------------------------------...FE...V.........Y--G---P
C0X942_ENTFL/359-507------------------------------------------------------.IRWG...T.........L--G---A
C0Z9G8_BREBN/364-513------------------------------------------------------.SMFG...M.........D--G---L
C0ZAP4_BREBN/363-505------------------------------------------------------.PSFG...I.........H--G---A
C0ZHE2_BREBN/367-517------------------------------------------------------.PFWG...I.........S--G---A
C1I2F0_9CLOT/325-463------------------------------------------------------...IG...V.........T--G---A
C1IAW5_9CLOT/354-498------------------------------------------------------.ANIN...I.........Y--G---A
C2D643_LACBR/210-348------------------------------------------------------...DG...L.........N--G---A
C2E7U4_LACJH/384-532------------------------------------------------------...FK...V.........Y--G---P
C2EED2_9LACO/381-529------------------------------------------------------...LH...V.........Y--G---P
C2EHH6_9LACO/356-502------------------------------------------------------.GKFG...I.........I--G---A
C2EP42_9LACO/342-483------------------------------------------------------...MS...A.........D--G---A
C2H7P1_ENTFC/381-529------------------------------------------------------...FE...V.........Y--G---P
C2HEH9_ENTFC/359-507------------------------------------------------------...LG...T.........A--G---A
C2KAZ9_9LACO/380-528------------------------------------------------------...FK...I.........Y--G---P
C2KJQ1_LEUMC/329-467------------------------------------------------------...AG...V.........N--G---A
C2KKY7_LEUMC/498-647------------------------------------------------------.RYFE...G.........M--G---A
C2LQ70_STRSL/432-580------------------------------------------------------...LG...A.........L--G---P
C2M158_STAHO/360-502------------------------------------------------------...MG...I.........L--G---A
C2YMP0_BACCE/352-495------------------------------------------------------.SQFG...I.........T--G---A
C3HRG9_BACTU/323-461------------------------------------------------------.PRYG...A.........V--G---A
C4FB42_9ACTN/325-467------------------------------------------------------.PRVG...A.........V--G---A
C4FNY8_9FIRM/361-503------------------------------------------------------.IELG...I.........N--G---A
C4FPR1_9FIRM/359-501------------------------------------------------------.PWLG...I.........G--G---A
C4FUC9_9FIRM/947-1095------------------------------------------------------...FQ...A.........Q--G---T
C4G0V0_ABIDE/374-518------------------------------------------------------.TDLS...V.........F--A---L
C4GB38_9FIRM/387-530------------------------------------------------------.FHLG...I.........Y--G---L
C4RGH8_9ACTO/364-502------------------------------------------------------.PRFG...I.........M--G---A
C4V2B6_9FIRM/374-517------------------------------------------------------.PWLG...I.........M--G---A
C4XGJ8_DESMR/335-465------------------------------------------------------.PRYG...T.........M--G---A
C5A2Y0_THEGJ/342-480------------------------------------------------------.PRWG...I.........E--G---A
C5D378_GEOSW/360-505------------------------------------------------------.PLFG...T.........T--G---A
C5NWI0_9BACL/318-458------------------------------------------------------.PFFG...Y.........I--G---A
C5Q1B2_STAAU/332-469------------------------------------------------------...YG...I.........Y--G---A
C5RB06_WEIPA/501-648------------------------------------------------------..WLQ...G.........M--G---P
C5RD31_WEIPA/359-505------------------------------------------------------.PQLG...I.........V--G---A
C6A0B5_THESM/328-456------------------------------------------------------.SRYS...Y.........V--G---A
C6CSD9_PAESJ/327-465------------------------------------------------------.PHYQ...A.........L--G---S
C6J0R0_9BACL/364-511------------------------------------------------------...WG...I.........Y--G---I
C6JQC3_FUSVA/323-462------------------------------------------------------.EKYG...G.........I--G---S
C6PQD8_9CLOT/131-275------------------------------------------------------.PGIN...I.........Y--G---A
C6SP25_STRMN/377-525------------------------------------------------------...LQ...A.........Y--G---P
C6VKW0_LACPJ/357-507------------------------------------------------------.VHYG...I.........N--G---A
C7GE86_9FIRM/383-527------------------------------------------------------.FDLN...I.........F--A---V
C7GYH1_9FIRM/373-517------------------------------------------------------.PSIN...V.........V--G---A
C7NM90_HALUD/327-463------------------------------------------------------.SWIG...I.........V--G---A
C7NSL6_HALUD/319-457------------------------------------------------------.LEFG...I.........A--G---A
C7NSR3_HALUD/331-469------------------------------------------------------.WQFS...W.........V--G---A
C7P069_HALMD/318-461------------------------------------------------------.WQYR...I.........R--G---A
C7XZJ3_9LACO/375-523------------------------------------------------------...FQ...I.........N--G---P
C8NE09_9LACT/413-561------------------------------------------------------...LG...G.........A--G---P
C8NI78_9LACT/366-514------------------------------------------------------...FG...T.........L--G---A
C8PCY7_9LACO/375-523------------------------------------------------------...FQ...V.........Y--G---P
C8VXJ1_DESAS/366-509------------------------------------------------------.SPLG...I.........R--A---A
C8WQG9_ALIAD/361-502------------------------------------------------------.PSLG...I.........L--G---V
C9A2J3_ENTGA/381-529------------------------------------------------------..LFQ...V.........Y--G---P
C9A420_ENTGA/359-508------------------------------------------------------...LG...T.........T--G---A
C9L817_RUMHA/12-160------------------------------------------------------.TDFG...I.........Y--N---V
C9LAR2_RUMHA/325-463------------------------------------------------------.PELG...A.........M--G---A
C9LLX4_9FIRM/363-506------------------------------------------------------.PSWG...V.........L--G---A
D0BKY7_9LACT/382-530------------------------------------------------------...FE...G.........A--G---P
D0BM46_9LACT/352-499------------------------------------------------------.PQFQ...T.........L--G---A
D0BME9_9LACT/319-458------------------------------------------------------.PYLG...Y.........I--G---A
D0LQE6_HALO1/374-513------------------------------------------------------.FPPGREML.........L--A---A
D1Z261_METPS/328-462------------------------------------------------------.PLLS...Y.........I--G---S
D2BMG7_LACLK/323-465------------------------------------------------------.LGGN...L.........T--S---V
D2EHX4_PEDAC/355-503------------------------------------------------------.RHWS...I.........T--G---A
D2EJ27_PEDAC/321-459------------------------------------------------------...WG...A.........L--G---A
D2ELV8_PEDAC/393-541------------------------------------------------------...FS...A.........V--G---S
D2RVV2_HALTV/336-474------------------------------------------------------...FG...A.........A--G---A
D2RXY9_HALTV/340-478------------------------------------------------------.PTIG...V.........V--G---A
D3AN52_9CLOT/376-519------------------------------------------------------.PKFG...I.........M--A---Y
D3E759_GEOS4/381-532------------------------------------------------------.PQFG...I.........T--G---A
D3FFB8_CONWI/338-471------------------------------------------------------.PSLG...A.........S--G---A
D3FR13_BACPE/361-509------------------------------------------------------.PVIG...T.........L--G---S
D3FXP2_BACPE/374-522------------------------------------------------------...MG...P.........A--G---A
D3FZH8_BACPE/357-501------------------------------------------------------.AQYG...M.........I--G---A
D3LVV9_9FIRM/358-500------------------------------------------------------.PALG...I.........V--G---A
D3LX29_9FIRM/358-500------------------------------------------------------.PAFG...I.........R--G---A
D3QG68_STALH/343-485------------------------------------------------------..QLG...I.........L--G---A
D3SSH7_NATMM/337-474------------------------------------------------------.PRYG...M.........H--G---A
D3STC0_NATMM/337-475------------------------------------------------------.PTIG...I.........A--G---A
D3UNL4_LISSS/370-518------------------------------------------------------...LG...A.........K--G---G
D4G1Q3_BACNA/318-464------------------------------------------------------.AHLG...L.........Y--G---I
D4G3E4_BACNA/359-505------------------------------------------------------.PRYG...I.........E--G---A
D4GU68_HALVD/319-457------------------------------------------------------.LSFG...I.........V--G---A
D4LGF1_9FIRM/327-469------------------------------------------------------.PKYS...L.........Y--G---A
D4W1F1_9FIRM/338-485------------------------------------------------------.MEMG...I.........S--G---A
D4W2K6_9FIRM/377-526------------------------------------------------------.PMFY...A.........D--G---A
D4YGG7_9LACT/385-532------------------------------------------------------...LG...T.........V--G---A
D4YJ56_9LACT/433-583------------------------------------------------------...FS...T.........S--G---A
D4YX22_SPHJU/336-476------------------------------------------------------..RFG...A.........I--G---L
D5D970_BACMD/362-511------------------------------------------------------.PDFQ...T.........I--G---A
D5DN36_BACMD/374-521------------------------------------------------------...FH...E.........I--G---S
D5DY76_BACMQ/331-468------------------------------------------------------.PRYG...Y.........E--A---A
D5E4C9_BACMQ/373-523------------------------------------------------------.TNFK...E.........I--G---P
D5QEL1_GLUHA/351-483------------------------------------------------------.HWFG...V.........D--G---A
D5T1U4_LEUKI/363-511------------------------------------------------------.NALG...A.........I--G---P
D5TQD2_BACT1/321-460------------------------------------------------------.PSYG...S.........I--G---T
D5UPU7_TSUPD/350-482------------------------------------------------------.PPFG...A.........A--G---A
D5VU50_METIM/353-494------------------------------------------------------.PKFG...T.........I--G---A
D5WSL0_BACT2/373-521------------------------------------------------------.PLWG...I.........G--G---A
D5X9J9_THEPJ/361-503------------------------------------------------------.PVFG...I.........K--G---P
D5XD05_THEPJ/326-457------------------------------------------------------.PRFS...L.........N--G---A
D6KSV4_SCAIO/332-470------------------------------------------------------.PHFG...A.........M--G---A
D6XV50_BACIE/360-507------------------------------------------------------.PLYG...I.........T--G---A
D6Y0K7_BACIE/382-530------------------------------------------------------.TWFG...P.........V--G---A
D7BDH0_MEISD/336-473------------------------------------------------------.PQYE...A.........I--G---A
D7D534_GEOSC/329-466------------------------------------------------------.PVYG...I.........N--G---A
D7DRX9_METV3/353-490------------------------------------------------------.PQFG...S.........L--G---A
D7E977_METEZ/332-466------------------------------------------------------.PYIG...I.........I--G---A
D7UUI0_LISGR/356-499------------------------------------------------------.PRLG...I.........A--G---A
D7WQC4_9BACI/353-489------------------------------------------------------.PGIQ...E.........K--G---A
D8GMK0_CLOLD/327-460------------------------------------------------------.PKYG...I.........N--G---A
D8ILC9_LACSC/25-170------------------------------------------------------.FKMG...I.........I--G---V
D8J472_HALJB/339-477------------------------------------------------------.PAVG...V.........V--G---A
D8J725_HALJB/340-478------------------------------------------------------.PRIG...I.........T--G---A
D8J7W8_HALJB/319-457------------------------------------------------------.LSIG...L.........L--G---A
D8MET9_LEUGT/321-460------------------------------------------------------.RNYG...V.........Y--G---A
D8PBA0_9BACT/336-473------------------------------------------------------.PRWG...A.........A--G---A
D9PYX0_METTM/350-483------------------------------------------------------.PLIG...I.........E--G---G
D9QSV7_ACEAZ/363-507------------------------------------------------------.PSIG...I.........R--G---A
E0I7A7_9BACL/353-491------------------------------------------------------.PKYA...Y.........H--G---A
E0IFR0_9BACL/366-514------------------------------------------------------...LG...M.........Y--G---M
E0NHN4_PEDAC/321-459------------------------------------------------------..SIG...V.........M--G---A
E0PD92_STREI/325-464------------------------------------------------------.PQYG...A.........M--G---A
E0RCM4_PAEP6/382-529------------------------------------------------------..WLG...I.........Y--G---I
E0RM54_PAEP6/373-525------------------------------------------------------.PQLG...T.........A--G---A
E0RMQ1_PAEP6/366-508------------------------------------------------------.PQYG...I.........Y--G---A
E0RUK9_BUTPB/373-516------------------------------------------------------.LGHD...L.........Y--T---I
E0S188_BUTPB/322-462