Sequence alignment for CL0226

PF02157

MPRD_BOVIN/2-279MSPLHSSWRTGLLLLLLFSVAVRESWQTEEKTCDLVGEKGKESEKELALLKRLTPLFNKSFES-TVGQSPDMYSYVFRVC

PF09451

Q54CZ8_DICDI/7-251------------ILLVLAIATMAFGQGSPSQCTHNGINYG---------ALSNGSYSALSAVS-GTNP.QGKYRYYWNIC
ATG27_DEBHA/7-277------------ISAALGLIGGVSGIDCGVKELK...EYD---------FESIKGIHSVTTLK-DTPPTQTNVTWYIGIC
ATG27_CANAL/3-247------------LASLLTFATAALAFDCSDKELE...RYN---------FESIKGVHSYTTLK-NTPPSQTNVTWNVGIC
ATG27_ASHGO/7-246------------VLLTGALFNIAAGLKCADSKVLS..RYK---------VSQHAAK..GKFTE-STPPSETTDFWWINLC
ATG27_KLULA/6-280------------ATALVSLLPFSSAVECSKNEILN..KYR---------VNEFSIG..GVSVQ-DTPPSETKESWWLNIC
ATG27_CANGA/6-271------------QVVALAMASSAVALNCKNHNVLS..NYN---------VANKDIL..LKNEL-DTPPSKTSEMWYLAPC
G2WGJ7_YEASK/7-266------------ICGFISIITVVQALSCEKHDVLK..KYQ---------VGKFSSL..TSTER-DTPPSTTIEKWWINVC
Q55NF4_CRYNB/4-269------------TLTFLAFLPLVAAFDCSITAFSI..SYD---------ISPLAGLRTASKDS-STPPTTSEVKVSMNLC
Q4P961_USTMA/31-324------------TDTIAASKQTLSPFDCSNVAVSSKQSFD---------LSKIAYPIRVSSKE-STPPSETKTFIDIDLC
ATG27_YARLI/3-271------------SAIIGYMAVAVAAASCQFTVDSK..NYD---------LSAISGPKSVEYTI-ETPPSKRKMEFVLDPC
Q1K5D2_NEUCR/29-377------------TAAAAAAAAPAEIMRCKEIVVDGH.KYD---------FGELGGPHTVVTNE-YDPPAYYNYTYTLDIC
Q5BF19_EMENI/12-291------------.VSLLPCLSFAVSFDCSSIHVDNY.NYN---------LKALGGVHEIYHAE-QVGDLIVNTTYVLNLC
B0XN71_ASPFC/14-328------------SALFTGLASASGSFDCRNIIAEGI.KYD---------LYGLHGVHTIYHVD-KAEDYIVNTTYVLDIC
B8MZF4_ASPFN/14-321------------.SALLPSLSAASGFDCAHINVDGY.KYD---------LSELGGVHSLYNVE-KTEEHVVNTTYVLNIC

PF00878

MPRI_HUMAN/1031-1178----------------GTADAFIVRFVCNDDVY----------------SG...PLKFLHQDI-DSGQGIRNTYFEFETA
MPRI_HUMAN/423-573----------------GFQRMSVINFECNKTAG----------------NDGKGTPVFTGEV.-.....DCTYFFTWDTE
MPRI_BOVIN/1040-1187----------------GRADAFIIRFVCNDDVY----------------PG...TPKFLHQDI-DSSLGIRDTFFEFETA
MPRI_MOUSE/1315-1455----------------VYQRSTTIYFYCDRTT.----------------.Q...KPVFLKETS-.....DCSYMFEWRTQ
MPRI_BOVIN/1331-1471----------------VYQRSTTIFFYCDRST.----------------.Q...APVFLQETS-.....DCSYLFEWRTQ
MPRI_MOUSE/1024-1171----------------DRGTAFIIRFICNDDIY----------------PG...APKFLHQDI-DSTRGIRNTYFEFETA
F1NVD2_CHICK/503-654----------------GFQRMTVINFECNETAG----------------NDGRGTPVFTGEV.-.....DCTYFFTWYTK
G3V824_RAT/569-708----------------.KKITTNITFVCKPGDL----------------ES...APVLRAAGP-....DGCSYEFEWHTA

PF13015

B6K4H4_SCHJY/349-504LEHQLNEVKYQYDDLQSEQARLFEDMNEPHGWDDI--------------YRVLKGMET-KAKS-G--------DYEYRIR
C5M4M3_CANTT/386-532LTMKIDELEDDIKNIEQKITAIKANLNSDFGPDDI--------------LRAYESRAI-TKKL-G--------GYNYVIN
C4R3S3_PICPG/341-510IQKSIDSHNKEIVKIDSDL....ENSESRYGLEDI--------------FRAYDGRCF-VEKI-G--------DYDYEYC
GLU2B_SCHPO/346-506AQRDLDAAEENEKSLEKEHTKLMHELEYHHGW.DL--------------YRAIKGMET-KREI-G--------GYTYKVV
A5DJ02_PICGU/305-448LEMEDDE...DITAIKQDISIYEEQLNRNYGPDDI--------------LRAIEGTWV-SESL-N--------GYTYKVG

PF07915

A0A023ZAE6_YEASX/537-646------------------------------------------------------SYCL.DDIL.D........NYVYTIC
A0BVD2_PARTE/98-171------------------------------------------------------DQCVQHYTK..........EFVYEYC
A0CKZ0_PARTE/98-170------------------------------------------------------DLCV.HHTT.K........EFLYEYC
A1C3Z3_ASPCL/157-257------------------------------------------------------GKCM.YYIS.G........WWSYSFC
A1CD98_ASPCL/492-561------------------------------------------------------GVCI.SKDS.G........EYTYEHC
A2GK42_TRIVA/71-135------------------------------------------------------GQCF.EFTH.T.......GYWFFKFC
A2R1B3_ASPNC/442-511------------------------------------------------------GVCI.SKDS.G........EYTYEHC
A2R8V3_ASPNC/155-251------------------------------------------------------GKCM.YYIS.G........WWSYSFC
A2VDJ4_HUMAN/56-116------------------------------------------------------GKCF.SLVE.S........TYKYEFC
A2YFJ9_ORYSI/121-201------------------------------------------------------DQCF.YRHE.G........WWSYEFC
A3GGW8_PICST/109-220------------------------------------------------------EVCTFHSGS..........YWIYGYC
A4HEV5_LEIBR/388-454------------------------------------------------------GMEF.KLDN.N........EHTYKII
A4I229_LEIIN/228-294------------------------------------------------------REEF.TIDF.Q........EYTYAVI
A4S612_OSTLU/68-155------------------------------------------------------GRCF.YYGNGD........WWTYELC
A4S717_OSTLU/44-97------------------------------------------------------GLCF.DQKI.E........KYVYKAC
A5DHY4_PICGU/126-247------------------------------------------------------KECVYVYNFNS.......GYWTYAFC
A5E6Q1_LODEL/91-197------------------------------------------------------GDCVFAFNIQG.......AYWTVGFC
A6REP5_AJECN/405-474------------------------------------------------------GSCI.SKDS.G........EYTYELC
A6XPJ8_AJECN/133-209------------------------------------------------------GRCM.YYVA.G........WWSYSFC
A7F2Y5_SCLS1/147-250------------------------------------------------------NNCL.YFVS.G........WWSYSFC
A7S009_NEMVE/46-100------------------------------------------------------AKCS.YRLE.A........YWTYELC
A7S009_NEMVE/245-317------------------------------------------------------DYCL.QGGT.G........WWKYELC
A7SE51_NEMVE/70-130------------------------------------------------------GKCF.SLTEYG.........YKYEFC
A7SG72_NEMVE/77-152------------------------------------------------------NKCL.YHNN.G........WWTYEVC
A7SJQ2_NEMVE/423-480------------------------------------------------------GNCFEFRDR..........EYLYKLC
A7TL63_VANPO/122-195------------------------------------------------------SSCI.NYPN.G........FWTYQFC
A7TM15_VANPO/111-181------------------------------------------------------DICV.VYPN.G........FWNYEYC
A8X7A1_CAEBR/101-181------------------------------------------------------KLCS.YLID.V........YWTYQVC
A8X7A1_CAEBR/339-416------------------------------------------------------EDCI.IAGT.G........WWKYEFC
A9UM90_XENTR/33-91------------------------------------------------------GNCW.LQQG.K...........NGRC
B0YA10_ASPFC/161-256------------------------------------------------------GKCM.YYIS.G........WWSYSFC
B1H2B8_XENTR/100-193------------------------------------------------------SSCS.YRIE.S........YWTYEVC
F5HAI8_CRYNB/146-266------------------------------------------------------GKCL.YSKQ.G........WFTYAYC
G1RCI8_NOMLE/342-421------------------------------------------------------SYCF.HGGV.G........WWKYEFC
GLU2B_MOUSE/406-464------------------------------------------------------SQCY.ELTT.N........EYVYRLC
O65221_ARATH/57-104------------------------------------------------------EKCL.FRQE.G........WWSYEFC
Q00XK8_OSTTA/90-173------------------------------------------------------GRCF.YYSN.G.......DWWTYELC
Q08C06_DANRE/70-143------------------------------------------------------AACL.IKTK.D........WWTYEFC
Q09396_CAEEL/122-193------------------------------------------------------DKCVKLRGN.H........WWSYILC
Q0D1V6_ASPTN/160-264------------------------------------------------------GKCM.YYVS.G........WWSYSFC
Q0UVU1_PHANO/148-261------------------------------------------------------GSCI.YYLS.G........WWSYSFC
Q0V1F7_PHANO/438-509------------------------------------------------------DTCI.EKDS.G........EYTYEHC
OS9_HUMAN/108-181------------------------------------------------------APCL.LKTK.D........WWTYEFC
Q16M80_AEDAE/441-496------------------------------------------------------GECI.NYED.R........EYIYKLC
Q16PW6_AEDAE/29-86------------------------------------------------------GTCW.LRRI.E..........STGKC
Q170H4_AEDAE/98-185------------------------------------------------------HSCS.YRIE.S........YWTYEVC
Q170H4_AEDAE/351-420------------------------------------------------------SYCL.TGGS.G........WWKFELC
Q20CF4_PETMA/30-88------------------------------------------------------GNCW.LQQS.K...........NGRC
Q29LB3_DROPS/439-496------------------------------------------------------GECY.NFED.R........EYVYTLC
Q29NJ4_DROPS/101-190------------------------------------------------------QTCS.YRIE.A........YWSYEIC
Q29NJ4_DROPS/360-434------------------------------------------------------ANCL.TGGN.G........WWRYEFC
Q2GN19_CHAGB/165-263------------------------------------------------------GQCM.YFVA.G........WWSYSFC
Q2UHS2_ASPOR/160-262------------------------------------------------------GKCM.YYVS.G........WWSYSFC
Q2UTA8_ASPOR/443-512------------------------------------------------------GVCI.QKDA.G........EYTYEHC
Q383K9_TRYB2/102-183------------------------------------------------------NMCY.TMEE.S........WWTYRLC
Q38E25_TRYB2/57-160------------------------------------------------------SGCI.SWKT.G........YWTYEVC
Q4CS72_TRYCC/374-438------------------------------------------------------NECF.SLNT.S........THTYEIC
Q4DFG0_TRYCC/99-181------------------------------------------------------KVCI.NLLE.G........WWTYRLC
OS9_GIBZE/149-241------------------------------------------------------DSCL.YFMS.G........WWSYSFC
Q4RHD7_TETNG/423-488------------------------------------------------------TVCV.SLAN.NLVDPFFYR.YVYKLC
Q4RQ71_TETNG/131-225------------------------------------------------------GFSA.LQIE.S........YWTYEVC
Q4RQ71_TETNG/370-475------------------------------------------------------SYCL.HGGV.G........WWKYEFC
Q4WG82_ASPFU/413-482------------------------------------------------------GVCI.SKDS.G........EYTYEHC
Q55BK1_DICDI/419-467------------------------------------------------------SKCF.DLAT.K........EYTYSVC
Q55ZR6_CRYNB/439-501------------------------------------------------------GTCV.DKVV.G........DYTYELC
Q57VU0_TRYB2/375-439------------------------------------------------------DECF.TLDV.K........VYTYKFC
OS9_CANAL/114-193------------------------------------------------------TSCVFSFNLHA.......NYWTIGYC
Q5B183_EMENI/1069-1138------------------------------------------------------GVCI.QKDA.G........EYTYEHC
OS9_EMENI/151-245------------------------------------------------------GKCL.YYIS.G........WWSYSFC
Q5CSG1_CRYPI/286-401------------------------------------------------------NRCQ.NFTD.S.......RFWNYELC
Q5DA66_SCHJA/303-366------------------------------------------------------DGCL.DLDD.R........EYTYSLC
Q5DCH4_SCHJA/94-177------------------------------------------------------HPCV.VRSE.A........YWSYELC
Q5DCH4_SCHJA/372-448------------------------------------------------------KTCL.SINS.G........WWTYEIC
Q5RJX3_XENLA/101-191------------------------------------------------------SSCS.YRIE.S........YWTYEVC
OS9_DEBHA/130-240------------------------------------------------------KDCVFAYGSNG.......GYWTLGYC
OS9_YARLI/111-190------------------------------------------------------GDCL.FYEQ.G........FFSYRFC
Q6C4G9_YARLI/307-374------------------------------------------------------GECV.SSHI.G........EYDYEVC
Q6CK66_KLULA/502-608------------------------------------------------------DFCV.DSEL.N........SYIYRLC
Q6FHE1_HUMAN/30-88------------------------------------------------------GNCW.LRQA............KNGRC
Q6FV48_CANGA/491-608------------------------------------------------------SGCV.SSKV.N........EYSYEIC
OS9_CANGA/106-177------------------------------------------------------NQCL.VSQN.G........FWTYRYC
Q6GLZ2_XENLA/401-459------------------------------------------------------GECY.ELST.S........EYVYSLC
Q6NVN2_XENTR/108-198------------------------------------------------------SSCS.YRIE.S........YWTYEVC
Q6NVN2_XENTR/340-419------------------------------------------------------SYCF.HGGV.G........WWKYEFC
Q6PW72_ICTFU/24-82------------------------------------------------------GNCW..YEQ.G..........KNGRC
Q74ZM0_ASHGO/505-608------------------------------------------------------DFCI.SSKF.D........EYTYHIC
Q7PPE5_ANOGA/445-501------------------------------------------------------GECF.NFED.R........EYVYKLC
Q7QG77_ANOGA/95-183------------------------------------------------------TTCS.YRIE.S........YWSYEVC
Q7QG77_ANOGA/348-417------------------------------------------------------AYCL.PGGS.G........WWKFELC
Q7S6V9_NEUCR/438-509------------------------------------------------------GQCV.SADV.G........EYEYELC
Q86H64_DICDI/159-253------------------------------------------------------QKCIKSANP.G.......LWWSYEFC
Q86NV3_DROME/212-268------------------------------------------------------GTCW.QTHL.G.......S....GKC
OS9_NEUCR/167-265------------------------------------------------------NQCL.HFVS.G........WWSYQYC
ERLEC_HUMAN/111-199------------------------------------------------------SSCS.YRIE.S........YWTYEVC
OS9_YEAST/115-193------------------------------------------------------ERCI.FYQA.G........FWIYEYC
FSTL3_RAT/34-90------------------------------------------------------GVCWLQQGK.E............ATC
PSL4_ARATH/527-579------------------------------------------------------GRCF.ESKQ.G........KYTYKVC
Q9NF22_CAEEL/350-427------------------------------------------------------EDCI.VGGT.G........WWKYEFC
GLU2B_SCHPO/385-431------------------------------------------------------GMET.KREI.G........GYTYKVV
Q9VJD1_DROME/434-491------------------------------------------------------GQCY.NFED.R........EYVYTLC
Q9VKC7_DROME/99-188------------------------------------------------------LTCT.YRIE.A........YWSYEIC
Q9VKC7_DROME/354-428------------------------------------------------------KNCL.TGGN.G........WWKYEFC

PF02157

MPRD_BOVIN/2-279--------------REAG---N----HSSGAGLVQ---INKS---NGKETVV------------GRFNETQI-------F

PF09451

Q54CZ8_DICDI/7-251...........GVATQCK---N----DAAAACQMQ---VGG....TSPPTPVGLITM.......GSWQTVSNLP......
ATG27_DEBHA/7-277.......DTISEKIDHCP---K----NSDLCGITS---INLEKNSNKDAVVSEIVGF.......NTNLQKQYKPFTKDGD
ATG27_CANAL/3-247........QPISAIKDCP---A----NSDICGVTS---ILRK...DEKPVVSEVVSF.......KSDLQKAY.......E
ATG27_ASHGO/7-246......EEHSEPVPDKCK---D----DAMFCHRQQ---VKLD...DGKEYVTQVFDV.......PRNQEVDV.......E
ATG27_KLULA/6-280....DEHDSKSSIPDQCN---V----KDIFCGVTS---VALP...GKESIVTKVMDF.......TSSVALEV.......K
ATG27_CANGA/6-271.....EDGSRRQRPSECS---S----DDLMCAIRH---VKV....DGSDHLTQKLDV.......HKSAKYEV.......E
G2WGJ7_YEASK/7-266......EEHNVEPPEECK---K----NDMLCGLTD---VILP...GKDAITTQIIDF.......DKNIGFNV.......E
Q55NF4_CRYNB/4-269GGEGLGKEDGVADEDQCP---E----NTRVC.LKL---INHKPSSSDPDRVTAVVSFWTVD...TPDSDITATPLG...K
Q4P961_USTMA/31-324..KPLEADANRDEKDQCP---R----GTRIC.ITI---EAIK...DDKAIVTQAIPVAYSDEAEGKKIEAKVEWGEEL.E
ATG27_YARLI/3-271..ASLKQDKKKPADEQCP---D----NTIVCGLGY---ILLPK..EKDFVLSEVMPF.......GNGPAPQYQPLKTGPE
Q1K5D2_NEUCR/29-377..APLKRKGDVKKEEQCG---G----DARVCRLKH---HYSPS..DKKSTFETATTLAG.....GSSFHYEATKLDSSSD
Q5BF19_EMENI/12-291...NTLKGASIRGNLKCG---T----SKNICGFNY---TYGA...DGATENDFAFPIVGLEPMGQGAKDAEITRLKK..E
B0XN71_ASPFC/14-328...KALGKASIRGDLKCG---T----SKNICGFQY---KYTP...DGSEEISHAFPIAGLDPLGHGSKDAEVTRLK...G
B8MZF4_ASPFN/14-321...NILKGASIKGHLKCG---T----SKNICGFQY---KYPV...DGSEETSRAFPIVGLEHLGHGSKDPEITRLKKLDP

PF00878

MPRI_HUMAN/1031-1178--------------LACV...P----SPVDCQVTD---L-------------------------AG.NEYDL--------
MPRI_HUMAN/423-573--------------YACV.KEK----EDLLCGATD---G-------------------------K..KRYDL--------
MPRI_BOVIN/1040-1187--------------LACV...P----SPVDCQVTD---P-------------------------AG.NEYDL--------
MPRI_MOUSE/1315-1455--------------YACP..PF----NVTECSVQD---A-------------------------AG.NSIDL--------
MPRI_BOVIN/1331-1471--------------YACP..PY----DLTECSFKN---E-------------------------AG.ETYDL--------
MPRI_MOUSE/1024-1171--------------LACT...P----SLVDCQVTD---P-------------------------AG.NEYDL--------
F1NVD2_CHICK/503-654--------------YACV.KER----EDLLCRVAD---K-------------------------K..KHYDL--------
G3V824_RAT/569-708--------------AACVLSQT----EGENCTVLD---A-------------------------QAGFSFDL--------

PF13015

B6K4H4_SCHJY/349-504---------------------F----YETVFQ...------------------------------..DDISL--------
C5M4M3_CANTT/386-532---------------------L----LGSIVQ...------------------------------..GDVLI--------
C4R3S3_PICPG/341-510---------------------F----TGSLTQISS------------------------------NGQRVSI--------
GLU2B_SCHPO/346-506---------------------F----YENVFQ...------------------------------..DSILL--------
A5DJ02_PICGU/305-448---------------------L----LASIYQ...------------------------------..EDIHI--------

PF07915

A0A023ZAE6_YEASX/537-646---------------------F....QRPMTEGVI.......................YQAEDKVDGKKVLI--------
A0BVD2_PARTE/98-171---------------------F....KKYIRQFDD....................LNTMLNMRKQYKEDFSL--------
A0CKZ0_PARTE/98-170---------------------F....RKHVRQYDD....................LDTIQNMQKILKEDFSL--------
A1C3Z3_ASPCL/157-257---------------------Y....KKQIKQFHA..............RPFGPGVPNYPPLEDPATHSFVL--------
A1CD98_ASPCL/492-561---------------------F....WDQTKQIPK.............................KGGASVRM--------
A2GK42_TRIVA/71-135---------------------P....FKILNQFRY........................EPLKQIPIDNFIL--------
A2R1B3_ASPNC/442-511---------------------F....LDQTKQIPK.............................KGGGSTRM--------
A2R8V3_ASPNC/155-251---------------------Y....KNQIKQFHA..............LPSGSGIPNYPPMEDHTTHSFIL--------
A2VDJ4_HUMAN/56-116---------------------P....FHNVTQHEQ..........................TFRWNAYSGIL--------
A2YFJ9_ORYSI/121-201---------------------S....YGKIRQVHV..........................EGEKVIQEYVL--------
A3GGW8_PICST/109-220---------------------F....GDKIIQFHP...............DMEHFRLTGKHKPTEPDYVYTL--------
A4HEV5_LEIBR/388-454---------------------M....FDRIEQCDL............................EKVSYSILL--------
A4I229_LEIIN/228-294---------------------M....FDKVYQRNI............................GMTTGGSLL--------
A4S612_OSTLU/68-155---------------------Y....KTRVEQFHR..........................EGTTRVNSYSL--------
A4S717_OSTLU/44-97---------------------P....FGEAKQDNT...................................QL--------
A5DHY4_PICGU/126-247---------------------F....GDKIIQFHE...............NLQRFFKTGQHEPEFPDYVYVL--------
A5E6Q1_LODEL/91-197---------------------F....GDKVIQFHE................DIKDFKSGNHRPQLPNHIYVL--------
A6REP5_AJECN/405-474---------------------W....MEKTKQIPK.............................KGGSTTTM--------
A6XPJ8_AJECN/133-209---------------------Y....MDQIRQFHA..............LAPGNGVPAYPPVEDPAAQSYVL--------
A7F2Y5_SCLS1/147-250---------------------Y....NNEITQFHQ..............LPPQPGKAPYPPQPDPSAQEFIL--------
A7S009_NEMVE/46-100---------------------H....GKHVRQFHD...............................ERSQKI--------
A7S009_NEMVE/245-317---------------------Y....GKRVIQFHV.........................DQDHGGRTDILL--------
A7SE51_NEMVE/70-130---------------------P....FHNVTQREQ..........................SSRWNAFHGIL--------
A7SG72_NEMVE/77-152---------------------F....GKTISQYHE.........................EGNSLKGDRISL--------
A7SJQ2_NEMVE/423-480---------------------P....FDRATQEPK.............................DGGASTSI--------
A7TL63_VANPO/122-195---------------------S....GNSINQIHF.......................GDIIKNDEKLNFTL--------
A7TM15_VANPO/111-181---------------------P....GKEFIQFHG.........................QSKKDNKWVFTL--------
A8X7A1_CAEBR/101-181---------------------H....GRYAIQFHE......................DKMLNGQISRTEYYL--------
A8X7A1_CAEBR/339-416---------------------Y....GKHVIQYHE..........................DANGQRSEILL--------
A9UM90_XENTR/33-91---------------------Q....VLYMPGMSR............................EECCRSGRL--------
B0YA10_ASPFC/161-256---------------------Y....KKQIKQFHA..............LPSGPGVPNYPPIEDSTTHSFVL--------
B1H2B8_XENTR/100-193---------------------H....GKHVRQYHE......................DKETGQKMNIQEYYL--------
F5HAI8_CRYNB/146-266---------------------H....DSYIRQFRA............AANPHTHPTQGYVPQEDPKYEGYTL--------
G1RCI8_NOMLE/342-421---------------------Y....GKHVHQYHE..........................DKDSGKTSVVV--------
GLU2B_MOUSE/406-464---------------------P....FKLVSQKPK.............................HGGSPTSL--------
O65221_ARATH/57-104---------------------H....QKYVRQLHV...............................EDENKV--------
Q00XK8_OSTTA/90-173---------------------Y....KDRASQFHR..........................EGTTRVSSFSL--------
Q08C06_DANRE/70-143---------------------Y....GQHIRQYHL.........................EDSEIKGDVLFL--------
Q09396_CAEEL/122-193---------------------R....GQTIEQVHG.........................EPGQEGYVKNIL--------
Q0D1V6_ASPTN/160-264---------------------Y....KKQVKQFHA..............LPSGSGIPNYPPMEDPTTLSFIL--------
Q0UVU1_PHANO/148-261---------------------Y....KKEVKQFHQ..............LPPSRGVSLYPPVEDTSVHSFVL--------
Q0V1F7_PHANO/438-509---------------------F....LSRTTQKSK.............................KGGGHTGM--------
OS9_HUMAN/108-181---------------------Y....GRHIQQYHM.........................EDSEIKGEVLYL--------
Q16M80_AEDAE/441-496---------------------L....FDKAIQQPK.............................NGGAETRL--------
Q16PW6_AEDAE/29-86---------------------N....KLFTRNVSR...........................ENCCNAGTGL--------
Q170H4_AEDAE/98-185---------------------H....GKYIKQYHE.......................ERHEKTSKLQEYYL--------
Q170H4_AEDAE/351-420---------------------Y....EKHVRQYHE...............................DTSIFL--------
Q20CF4_PETMA/30-88---------------------R......ELLKMNV..........................SQQECCRSGRL--------
Q29LB3_DROPS/439-496---------------------P....FDRASQKPR.............................NGGAETTL--------
Q29NJ4_DROPS/101-190---------------------H....GHHVRQYHE.......................EREGKSVKFQEYYL--------
Q29NJ4_DROPS/360-434---------------------Y....GKHVRQFHK...........................DKNSEIELFL--------
Q2GN19_CHAGB/165-263---------------------Y....GKAVVQYHA................LPGTKATDPPLRDEKDPEYVL--------
Q2UHS2_ASPOR/160-262---------------------Y....KKQIKQFHA..............LPSGSGIPSYPPMEDPATHSFIL--------
Q2UTA8_ASPOR/443-512---------------------F....LDQTKQIPK.............................KGGSTARM--------
Q383K9_TRYB2/102-183---------------------W....GSGVEQFHR..............SAVAGDSKSNAPKQMKEDPHFVL--------
Q38E25_TRYB2/57-160---------------------P....GRWIRQFHK..........................DGNVIVDENFL--------
Q4CS72_TRYCC/374-438---------------------P....LKDAHQYDK.............................GTTHGQCI--------
Q4DFG0_TRYCC/99-181---------------------W....NDAIVQVHL.............PTVILSDGVLLTTEPQGPQTQFLL--------
OS9_GIBZE/149-241---------------------N....NREIVQFHA................LPSIPNGQPPKRDPHTMEFTL--------
Q4RHD7_TETNG/423-488---------------------P....FNRVSQKPK.............................YGGSETSL--------
Q4RQ71_TETNG/131-225---------------------H....GKHVRQYHE......................EKETGQKVSVQEYFL--------
Q4RQ71_TETNG/370-475---------------------Y....GKYVHQYHEVTSVSTTTADVTVARRATPEGDCPLQEKEQGKNIVVI--------
Q4WG82_ASPFU/413-482---------------------F....LGETKQIPK.............................KGGATIRM--------
Q55BK1_DICDI/419-467---------------------P....YEKASQGHT...................................SL--------
Q55ZR6_CRYNB/439-501---------------------F....FGKATQKSN.............................KDKSSNNL--------
Q57VU0_TRYB2/375-439---------------------P....FKDAHQYSK.............................GTEIGNSI--------
OS9_CANAL/114-193---------------------H....GINVIQFHE................NLDDFISGIHKPHSPNHVYTL--------
Q5B183_EMENI/1069-1138---------------------F....LDQTKQIPK.............................KGGSSSRM--------
OS9_EMENI/151-245---------------------Y....MNQIKQFHA..............LPSGGGVPNYPPMEDHTTHSFIL--------
Q5CSG1_CRYPI/286-401---------------------N....LYVVSQFKK.........................DSSTQELRLFNL--------
Q5DA66_SCHJA/303-366---------------------P....FKSVHQKLL..........................GSSKSDPGTSI--------
Q5DCH4_SCHJA/94-177---------------------H....NQYIKQFHE......................ERKSGKSSPVQEYYL--------
Q5DCH4_SCHJA/372-448---------------------F....NDFVRQYHL.........................DANAKKLQEILL--------
Q5RJX3_XENLA/101-191---------------------H....GKYIRQYHE......................EKEAGQKLNIQEYYL--------
OS9_DEBHA/130-240---------------------Y....GDKVVQFHE...............NLQHFVATGKHKPEYPDYIYVL--------
OS9_YARLI/111-190---------------------Y....GSGVVQYRR..............HGDNYFPRIYPPPQADDSPTFVL--------
Q6C4G9_YARLI/307-374---------------------F....GQQCHQRGN...............................NINVSL--------
Q6CK66_KLULA/502-608---------------------YSNDKGGDIVQIEN............................KPDGNKVVI--------
Q6FHE1_HUMAN/30-88---------------------Q....VLYKTELSK............................EECCSTGRL--------
Q6FV48_CANGA/491-608---------------------IERDLNGELTGMLT........................QRSLNDPMRVVRI--------
OS9_CANGA/106-177---------------------G....SGDFTQYHG........................VAPDPNDKLTYTL--------
Q6GLZ2_XENLA/401-459---------------------P....FNRVTQKPK.............................HGGSETNL--------
Q6NVN2_XENTR/108-198---------------------H....GKYIRQYHE......................EKETGQKLSIQEYYL--------
Q6NVN2_XENTR/340-419---------------------Y....GKYVHQYHE..........................DKDTGKTTVVV--------
Q6PW72_ICTFU/24-82---------------------Q....MLYLSEMSR............................EDCCRSERL--------
Q74ZM0_ASHGO/505-608---------------------F....NPDTGRILQ..........................VQDRDRSVVLV--------
Q7PPE5_ANOGA/445-501---------------------P....FDKAIQQPR.............................NGGAETRL--------
Q7QG77_ANOGA/95-183---------------------H....GNYIKQYHE.......................ERHEKTSKLQEYFL--------
Q7QG77_ANOGA/348-417---------------------F....GKHVRQYHK...............................DTSIYL--------
Q7S6V9_NEUCR/438-509---------------------W....FDRTTQKSK.............................KGHGNTNM--------
Q86H64_DICDI/159-253---------------------Y....HDKVRQVHV..........................EKNEVQSEFIL--------
Q86NV3_DROME/212-268---------------------G....QVFSTDISR...........................SECCGSSQSF--------
OS9_NEUCR/167-265---------------------Y....GKSIVQYHA.................VPNPKGGPPLRDKNSQEYIL--------
ERLEC_HUMAN/111-199---------------------H....GKHIRQYHE......................EKETGQKINIHEYYL--------
OS9_YEAST/115-193---------------------P....GIEFVQFHG.................RVNTKTGEIVNRDESLVYRL--------
FSTL3_RAT/34-90---------------------S....LVLKTQVSR............................EECCASGNI--------
PSL4_ARATH/527-579---------------------A....YKEATQEEG...............................YSKTRL--------
Q9NF22_CAEEL/350-427---------------------Y....GKHVIQFHE..........................DANGQRSDILL--------
GLU2B_SCHPO/385-431---------------------F....YENVFQDSI...................................LL--------
Q9VJD1_DROME/434-491---------------------P....FDRASQKSR.............................SGGPETTL--------
Q9VKC7_DROME/99-188---------------------H....GHHVRQYHE.......................EREGKNVKFQEYYL--------
Q9VKC7_DROME/354-428---------------------Y....GRHVRQFHK...........................DKTSEVELFL--------

PF02157

MPRD_BOVIN/2-279NGSN-WIMLIYKGGDEYDNHCGREQR----RAVVMISCNRHT--------------------------------------

PF09451

Q54CZ8_DICDI/7-251.....SLQYTTSSK....CSSGNMRT.....MVVSLQCSQNA......................................
ATG27_DEBHA/7-277NNED.GITIVYKGA....NWGDNLVD.....AELRFVCASSSDKDK..................................
ATG27_CANAL/3-247SSDN.GIKVIYKGA....NWGDVLVN.....AELNFQCDKDS......................................
ATG27_ASHGO/7-246ELRD.GFQVSFTG.....KWGERERK.....VKVRYTCADDK......................................
ATG27_KLULA/6-280ETAE.ALSIRLSGA....AWGSHILN.....ADIYLQCQEK.......................................
ATG27_CANGA/6-271EVESGGFDIRFLGV....KWGSNTID.....ATLSYSCDTNL......................................
G2WGJ7_YEASK/7-266ETES.ALTLTLKGA....TWGANSFD.....AKLEFQCNDNM......................................
Q55NF4_CRYNB/4-269KGEQ.GLEISVKGQ....EYAGVPQH.....LQLTLLCDTSS......................................
Q4P961_USTMA/31-324GGEK.SIELQFPGA....TYAEREQK.....AELELVCDAKA......................................
ATG27_YARLI/3-271GTE..GLSTSYGN.....PWGSEKLD.....IDVNYICSDKE......................................
Q1K5D2_NEUCR/29-377HKDG.GVKLTFSGY....KHQGRQQK.....VVINFVCNKTLTGTEGEVESSEDIQYEKPKLLLATRDDNDKKKEEEGDD
Q5BF19_EMENI/12-291DTEKEGLRVKLSGGGEYPEPGSKKKK..KAGAVIEFECDPGRSGLEGLV...............................
B0XN71_ASPFC/14-328DGQE.GLLVKLAGG....EYIDKDKKKKDARAVIEFQCDPDRSGLEGLSSVEEEEEEEETRRRLVVREDEGDKNKEKDKE
B8MZF4_ASPFN/14-321DEE..GLLVKLSGG....NYVDDEGKQKDAGAVLEFQCDPERSGLEGLKTTDESDGEKKEAERRRAEGGDDKEQPPDE..

PF00878

MPRI_HUMAN/1031-1178-----TGLSTVRK...--PWTAVDTS------------------------------------------------------
MPRI_HUMAN/423-573-----SALVRHAEPEQ--NWEAVDGS------------------------------------------------------
MPRI_BOVIN/1040-1187-----SGLSKARK...--PWTAVDTF------------------------------------------------------
MPRI_MOUSE/1315-1455-----SSLSRYSD...--NWEAVTRT------------------------------------------------------
MPRI_BOVIN/1331-1471-----SSLSRYSD...--NWEAVTGT------------------------------------------------------
MPRI_MOUSE/1024-1171-----SALSMVRK...--PWTAVDTS------------------------------------------------------
F1NVD2_CHICK/503-654-----SPLIRSSESAQ--NWEAVDSN------------------------------------------------------
G3V824_RAT/569-708-----SLLTKKNG...--AYKVETDK------------------------------------------------------

PF13015

B6K4H4_SCHJY/349-504-----G---EF-VEQE..........------------------------------------------------------
C5M4M3_CANTT/386-532-----G---NF-KKYE..........------------------------------------------------------
C4R3S3_PICPG/341-510-----G---TR-DKIEVLEDEQSVGG------------------------------------------------------
GLU2B_SCHPO/346-506-----G---NF-ASQE..........------------------------------------------------------
A5DJ02_PICGU/305-448-----G---SY-KAAE..........------------------------------------------------------

PF07915

A0A023ZAE6_YEASX/537-646-----G...RF...............------------------------------------------------------
A0BVD2_PARTE/98-171-----GISKSY...............------------------------------------------------------
A0CKZ0_PARTE/98-170-----GYSNQF...............------------------------------------------------------
A1C3Z3_ASPCL/157-257-----G...RF...............------------------------------------------------------
A1CD98_ASPCL/492-561-----G...QF...............------------------------------------------------------
A2GK42_TRIVA/71-135-----G....................------------------------------------------------------
A2R1B3_ASPNC/442-511-----G...KY...............------------------------------------------------------
A2R8V3_ASPNC/155-251-----G...KF...............------------------------------------------------------
A2VDJ4_HUMAN/56-116-----G...IW...............------------------------------------------------------
A2YFJ9_ORYSI/121-201-----G...EY...............------------------------------------------------------
A3GGW8_PICST/109-220-----G...RF...............------------------------------------------------------
A4HEV5_LEIBR/388-454-----G...KW...............------------------------------------------------------
A4I229_LEIIN/228-294-----G...SW...............------------------------------------------------------
A4S612_OSTLU/68-155-----G...KF...............------------------------------------------------------
A4S717_OSTLU/44-97-----G...RN...............------------------------------------------------------
A5DHY4_PICGU/126-247-----G...RF.....KNEDNSKWRS------------------------------------------------------
A5E6Q1_LODEL/91-197-----G...KF.........PNTAPY------------------------------------------------------
A6REP5_AJECN/405-474-----G...TF...............------------------------------------------------------
A6XPJ8_AJECN/133-209-----G...RF...............------------------------------------------------------
A7F2Y5_SCLS1/147-250-----G...KA...............------------------------------------------------------
A7S009_NEMVE/46-100-----P....................------------------------------------------------------
A7S009_NEMVE/245-317-----G...TW...............------------------------------------------------------
A7SE51_NEMVE/70-130-----G...VF...............------------------------------------------------------
A7SG72_NEMVE/77-152-----G...LY...............------------------------------------------------------
A7SJQ2_NEMVE/423-480-----G...NW...............------------------------------------------------------
A7TL63_VANPO/122-195-----G....................------------------------------------------------------
A7TM15_VANPO/111-181-----G....................------------------------------------------------------
A8X7A1_CAEBR/101-181-----G...NF...............------------------------------------------------------
A8X7A1_CAEBR/339-416-----G...SF...............------------------------------------------------------
A9UM90_XENTR/33-91-----G..TSW...............------------------------------------------------------
B0YA10_ASPFC/161-256-----G...RF...............------------------------------------------------------
B1H2B8_XENTR/100-193-----G...NM...........NKKD------------------------------------------------------
F5HAI8_CRYNB/146-266-----G...RPYPVSKFKGSRVKAKG------------------------------------------------------
G1RCI8_NOMLE/342-421-----G...TW...............------------------------------------------------------
GLU2B_MOUSE/406-464-----G...TW...............------------------------------------------------------
O65221_ARATH/57-104-----G..FYW...............------------------------------------------------------
Q00XK8_OSTTA/90-173-----G...RF...............------------------------------------------------------
Q08C06_DANRE/70-143-----G...YY...............------------------------------------------------------
Q09396_CAEEL/122-193-----G...LF...............------------------------------------------------------
Q0D1V6_ASPTN/160-264-----G...KF...............------------------------------------------------------
Q0UVU1_PHANO/148-261-----G...RY.....QKEKETKKDA------------------------------------------------------
Q0V1F7_PHANO/438-509-----G...NF...............------------------------------------------------------
OS9_HUMAN/108-181-----G...YY...............------------------------------------------------------
Q16M80_AEDAE/441-496-----G...TW...............------------------------------------------------------
Q16PW6_AEDAE/29-86-----G....................------------------------------------------------------
Q170H4_AEDAE/98-185-----G...KW...............------------------------------------------------------
Q170H4_AEDAE/351-420-----G...YF...............------------------------------------------------------
Q20CF4_PETMA/30-88-----G....................------------------------------------------------------
Q29LB3_DROPS/439-496-----G...RW...............------------------------------------------------------
Q29NJ4_DROPS/101-190-----G...KW...............------------------------------------------------------
Q29NJ4_DROPS/360-434-----G...YF...............------------------------------------------------------
Q2GN19_CHAGB/165-263-----G...RA...............------------------------------------------------------
Q2UHS2_ASPOR/160-262-----G...RF...............------------------------------------------------------
Q2UTA8_ASPOR/443-512-----G...NF...............------------------------------------------------------
Q383K9_TRYB2/102-183-----G....................------------------------------------------------------
Q38E25_TRYB2/57-160-----GVQHRWHLADEIGSKRLRYRD------------------------------------------------------
Q4CS72_TRYCC/374-438-----G...RW...............------------------------------------------------------
Q4DFG0_TRYCC/99-181-----G....................------------------------------------------------------
OS9_GIBZE/149-241-----G...RV...............------------------------------------------------------
Q4RHD7_TETNG/423-488-----G...TW...............------------------------------------------------------
Q4RQ71_TETNG/131-225-----G...NV..............A------------------------------------------------------
Q4RQ71_TETNG/370-475-----G...SW...............------------------------------------------------------
Q4WG82_ASPFU/413-482-----G...KF...............------------------------------------------------------
Q55BK1_DICDI/419-467-----G...KF...............------------------------------------------------------
Q55ZR6_CRYNB/439-501-----GSFNQW...............------------------------------------------------------
Q57VU0_TRYB2/375-439-----G...KW...............------------------------------------------------------
OS9_CANAL/114-193-----G...NF...............------------------------------------------------------
Q5B183_EMENI/1069-1138-----G...RF...............------------------------------------------------------
OS9_EMENI/151-245-----G...RF...............------------------------------------------------------
Q5CSG1_CRYPI/286-401-----G............IHPNTAQI------------------------------------------------------
Q5DA66_SCHJA/303-366-----G...IW...............------------------------------------------------------
Q5DCH4_SCHJA/94-177-----G...HY...............------------------------------------------------------
Q5DCH4_SCHJA/372-448-----G...TW...............------------------------------------------------------
Q5RJX3_XENLA/101-191-----G...KT...............------------------------------------------------------
OS9_DEBHA/130-240-----G...RF.............KG------------------------------------------------------
OS9_YARLI/111-190-----G...SF...............------------------------------------------------------
Q6C4G9_YARLI/307-374-----G...HF...............------------------------------------------------------
Q6CK66_KLULA/502-608-----G...RY...............------------------------------------------------------
Q6FHE1_HUMAN/30-88-----S..TSW...............------------------------------------------------------
Q6FV48_CANGA/491-608-----G...SF...........TGFN------------------------------------------------------
OS9_CANGA/106-177-----G....................------------------------------------------------------
Q6GLZ2_XENLA/401-459-----G...SW...............------------------------------------------------------
Q6NVN2_XENTR/108-198-----G...KM...............------------------------------------------------------
Q6NVN2_XENTR/340-419-----G...TW...............------------------------------------------------------
Q6PW72_ICTFU/24-82-----G..MAW...............------------------------------------------------------
Q74ZM0_ASHGO/505-608-----G...HF...............------------------------------------------------------
Q7PPE5_ANOGA/445-501-----G...TW...............------------------------------------------------------
Q7QG77_ANOGA/95-183-----G...RW...............------------------------------------------------------
Q7QG77_ANOGA/348-417-----G...YF...............------------------------------------------------------
Q7S6V9_NEUCR/438-509-----G...NF...............------------------------------------------------------
Q86H64_DICDI/159-253-----G...TF.............ID------------------------------------------------------
Q86NV3_DROME/212-268-----S....................------------------------------------------------------
OS9_NEUCR/167-265-----G...TS..............L------------------------------------------------------
ERLEC_HUMAN/111-199-----G...NM...............------------------------------------------------------
OS9_YEAST/115-193-----G....................------------------------------------------------------
FSTL3_RAT/34-90-----N..TAW...............------------------------------------------------------
PSL4_ARATH/527-579-----G...EW...............------------------------------------------------------
Q9NF22_CAEEL/350-427-----G...VF...............------------------------------------------------------
GLU2B_SCHPO/385-431-----G...NF...............------------------------------------------------------
Q9VJD1_DROME/434-491-----G...RW...............------------------------------------------------------
Q9VKC7_DROME/99-188-----G...KW...............------------------------------------------------------
Q9VKC7_DROME/354-428-----G...YF...............------------------------------------------------------

PF02157

MPRD_BOVIN/2-279--------LADNFNPVSE---ERGKVQDCFYLFEMDSSLAC---------------------------------------

PF09451

Q54CZ8_DICDI/7-251........NSIQATLVNE........NKCIYSTVMSGKDLC............SGGSGSGDNNNSGSNG...........
ATG27_DEBHA/7-277........DLDKFQLHQW........DDKRLKVSVKTKAAC..........ITDKKDKKKPDNKKDNKK...........
ATG27_CANAL/3-247........QNNEFTLDQW........DGTNLKLSMKTKAAC..........ITSKEDKKKEKHDN...............
ATG27_ASHGO/7-246........AEDEVSAEGA.....FGAHTTPVEVALRGPSGC..........IQATEKS......................
ATG27_KLULA/6-280........GSGSLTESSW.......TDDQNVKLVFSGPFGC.......LKKGNDNKDGNGDDDNNDKDGDDSDKKPHDGD
ATG27_CANGA/6-271........KTDELVTTIW........NSEYVLIEMSGPSGC.......KRDGNSDSGDNGNGNGNGNDPDN.........
G2WGJ7_YEASK/7-266........KQDELTSHTW........ADKSIQLTLKGPSGC......LKSKDDDKKNGDGDNGKDGDSE...........
Q55NF4_CRYNB/4-269........DSPNPTLVSY........TAGLLSLEWATPDAC..........PRSGDSSSPSGSS................
Q4P961_USTMA/31-324........DADEQPSVRS.....YDRAQGKLKLRWATKFACSSA....ATKPGSGSPSKGGSDSDGDK............
ATG27_YARLI/3-271........EGPKLENVGL.......GLNNYYEINWKTPAAC..........INDGSKPKQPVKEPGKTPND.........
Q1K5D2_NEUCR/29-377GYPETQLLKNETATALLWNGYKRVGDDVDQLELTWNTKFACLDASGGDKDKPKDGDDKDKPKDGDKDKPKDGDNKDGGGN
Q5BF19_EMENI/12-291........KEDTKRLLRA..............................REEGLDEGEGDGEGDGNGEDKEPFYD......
B0XN71_ASPFC/14-328KTDPND..GSDPSRSLQFESFGPADDDAYVLKLKWRTRYAC............DNYVRDRKGDG................
B8MZF4_ASPFN/14-321........EKDRSHSLQFKSFGKADDDSYVLKLNWRTKYAC............DHYLEEKKGDS................

PF00878

MPRI_HUMAN/1031-1178--------VD.GRKRTFY-------LSVCN...PLPYIPGC---------------------------------------
MPRI_HUMAN/423-573--------QTETEKKHFF-------INICHRVLQEGKARGC---------------------------------------
MPRI_BOVIN/1040-1187--------DE.GKKRTFY-------LSVCT...PLPYIPGC---------------------------------------
MPRI_MOUSE/1315-1455--------GA...TEHYL-------INVCKSLSPHAGTEPC---------------------------------------
MPRI_BOVIN/1331-1471--------GS...TEHYL-------INVCKSLSPQAGSDPC---------------------------------------
MPRI_MOUSE/1024-1171--------AY.GKRRHFY-------LSVCN...PLPYIPGC---------------------------------------
F1NVD2_CHICK/503-654--------LSEEWRKRYY-------INVCHKVLKRGGASGC---------------------------------------
G3V824_RAT/569-708--------YD......FY-------INVCG....PVSVNLC---------------------------------------

PF13015

B6K4H4_SCHJY/349-504--------.GNILKYANG--------------------------------------------------------------
C5M4M3_CANTT/386-532--------.DGKIYFDRG--------------------------------------------------------------
C4R3S3_PICPG/341-510--------YSYRVYYEKG--------------------------------------------------------------
GLU2B_SCHPO/346-506--------.GNVLKYENG--------------------------------------------------------------
A5DJ02_PICGU/305-448--------.GTKLIYKDG--------------------------------------------------------------

PF07915

A0A023ZAE6_YEASX/537-646--------.KTSGFNVDL--------------------------------------------------------------
A0BVD2_PARTE/98-171--------..........--------------------------------------------------------------
A0CKZ0_PARTE/98-170--------..........--------------------------------------------------------------
A1C3Z3_ASPCL/157-257--------.PSSSGNGGG--------------------------------------------------------------
A1CD98_ASPCL/492-561--------..........--------------------------------------------------------------
A2GK42_TRIVA/71-135--------..........--------------------------------------------------------------
A2R1B3_ASPNC/442-511--------..........--------------------------------------------------------------
A2R8V3_ASPNC/155-251--------....PQGDGD--------------------------------------------------------------
A2VDJ4_HUMAN/56-116--------..........--------------------------------------------------------------
A2YFJ9_ORYSI/121-201--------.....DADAT--------------------------------------------------------------
A3GGW8_PICST/109-220--------.......KGG--------------------------------------------------------------
A4HEV5_LEIBR/388-454--------..........--------------------------------------------------------------
A4I229_LEIIN/228-294--------..........--------------------------------------------------------------
A4S612_OSTLU/68-155--------......DEAA--------------------------------------------------------------
A4S717_OSTLU/44-97--------..........--------------------------------------------------------------
A5DHY4_PICGU/126-247--------NSRANEKIKN--------------------------------------------------------------
A5E6Q1_LODEL/91-197--------KKVRPKNQLG--------------------------------------------------------------
A6REP5_AJECN/405-474--------..........--------------------------------------------------------------
A6XPJ8_AJECN/133-209--------..........--------------------------------------------------------------
A7F2Y5_SCLS1/147-250--------.KKSSKSMSK--------------------------------------------------------------
A7S009_NEMVE/46-100--------..........--------------------------------------------------------------
A7S009_NEMVE/245-317--------......DKQK--------------------------------------------------------------
A7SE51_NEMVE/70-130--------..........--------------------------------------------------------------
A7SG72_NEMVE/77-152--------........SS--------------------------------------------------------------
A7SJQ2_NEMVE/423-480--------..........--------------------------------------------------------------
A7TL63_VANPO/122-195--------........NT--------------------------------------------------------------
A7TM15_VANPO/111-181--------..........--------------------------------------------------------------
A8X7A1_CAEBR/101-181--------..........--------------------------------------------------------------
A8X7A1_CAEBR/339-416--------......DAVI--------------------------------------------------------------
A9UM90_XENTR/33-91--------..........--------------------------------------------------------------
B0YA10_ASPFC/161-256--------.....PNSGD--------------------------------------------------------------
B1H2B8_XENTR/100-193--------GAESETEKSS--------------------------------------------------------------
F5HAI8_CRYNB/146-266--------GKPGSPAKAE--------------------------------------------------------------
G1RCI8_NOMLE/342-421--------......NQEE--------------------------------------------------------------
GLU2B_MOUSE/406-464--------..........--------------------------------------------------------------
O65221_ARATH/57-104--------..........--------------------------------------------------------------
Q00XK8_OSTTA/90-173--------......DRAA--------------------------------------------------------------
Q08C06_DANRE/70-143--------........DT--------------------------------------------------------------
Q09396_CAEEL/122-193--------..........--------------------------------------------------------------
Q0D1V6_ASPTN/160-264--------.PNADHDDED--------------------------------------------------------------
Q0UVU1_PHANO/148-261--------RKTLGSEQGS--------------------------------------------------------------
Q0V1F7_PHANO/438-509--------..........--------------------------------------------------------------
OS9_HUMAN/108-181--------........QS--------------------------------------------------------------
Q16M80_AEDAE/441-496--------..........--------------------------------------------------------------
Q16PW6_AEDAE/29-86--------..........--------------------------------------------------------------
Q170H4_AEDAE/98-185--------..DKEKTVTL--------------------------------------------------------------
Q170H4_AEDAE/351-420--------......NKEK--------------------------------------------------------------
Q20CF4_PETMA/30-88--------..........--------------------------------------------------------------
Q29LB3_DROPS/439-496--------..........--------------------------------------------------------------
Q29NJ4_DROPS/101-190--------..SEEKTELL--------------------------------------------------------------
Q29NJ4_DROPS/360-434--------......SEES--------------------------------------------------------------
Q2GN19_CHAGB/165-263--------....QETVVD--------------------------------------------------------------
Q2UHS2_ASPOR/160-262--------..PRASDDEE--------------------------------------------------------------
Q2UTA8_ASPOR/443-512--------..........--------------------------------------------------------------
Q383K9_TRYB2/102-183--------..........--------------------------------------------------------------
Q38E25_TRYB2/57-160--------GIHTIPERLN--------------------------------------------------------------
Q4CS72_TRYCC/374-438--------..........--------------------------------------------------------------
Q4DFG0_TRYCC/99-181--------..........--------------------------------------------------------------
OS9_GIBZE/149-241--------.PAVPASAAH--------------------------------------------------------------
Q4RHD7_TETNG/423-488--------..........--------------------------------------------------------------
Q4RQ71_TETNG/131-225--------QRSQSAETGS--------------------------------------------------------------
Q4RQ71_TETNG/370-475--------......NANE--------------------------------------------------------------
Q4WG82_ASPFU/413-482--------..........--------------------------------------------------------------
Q55BK1_DICDI/419-467--------..........--------------------------------------------------------------
Q55ZR6_CRYNB/439-501--------..........--------------------------------------------------------------
Q57VU0_TRYB2/375-439--------..........--------------------------------------------------------------
OS9_CANAL/114-193--------..........--------------------------------------------------------------
Q5B183_EMENI/1069-1138--------..........--------------------------------------------------------------
OS9_EMENI/151-245--------....PQEEGQ--------------------------------------------------------------
Q5CSG1_CRYPI/286-401--------LNITDDLEEY--------------------------------------------------------------
Q5DA66_SCHJA/303-366--------..........--------------------------------------------------------------
Q5DCH4_SCHJA/94-177--------......YPSS--------------------------------------------------------------
Q5DCH4_SCHJA/372-448--------......NLDE--------------------------------------------------------------
Q5RJX3_XENLA/101-191--------......VKKS--------------------------------------------------------------
OS9_DEBHA/130-240--------SSKKPTNLDN--------------------------------------------------------------
OS9_YARLI/111-190--------..........--------------------------------------------------------------
Q6C4G9_YARLI/307-374--------..........--------------------------------------------------------------
Q6CK66_KLULA/502-608--------...RGFTIDT--------------------------------------------------------------
Q6FHE1_HUMAN/30-88--------..........--------------------------------------------------------------
Q6FV48_CANGA/491-608--------TLNEHESQAK--------------------------------------------------------------
OS9_CANGA/106-177--------..........--------------------------------------------------------------
Q6GLZ2_XENLA/401-459--------..........--------------------------------------------------------------
Q6NVN2_XENTR/108-198--------......MKKS--------------------------------------------------------------
Q6NVN2_XENTR/340-419--------......KADE--------------------------------------------------------------
Q6PW72_ICTFU/24-82--------..........--------------------------------------------------------------
Q74ZM0_ASHGO/505-608--------....KDFKLV--------------------------------------------------------------
Q7PPE5_ANOGA/445-501--------..........--------------------------------------------------------------
Q7QG77_ANOGA/95-183--------..DKQKTEAL--------------------------------------------------------------
Q7QG77_ANOGA/348-417--------......DVEK--------------------------------------------------------------
Q7S6V9_NEUCR/438-509--------..........--------------------------------------------------------------
Q86H64_DICDI/159-253--------SPQNGAIKGI--------------------------------------------------------------
Q86NV3_DROME/212-268--------..........--------------------------------------------------------------
OS9_NEUCR/167-265--------PPSSHSQKGK--------------------------------------------------------------
ERLEC_HUMAN/111-199--------...LAKNLLF--------------------------------------------------------------
OS9_YEAST/115-193--------..........--------------------------------------------------------------
FSTL3_RAT/34-90--------..........--------------------------------------------------------------
PSL4_ARATH/527-579--------..........--------------------------------------------------------------
Q9NF22_CAEEL/350-427--------......DEVV--------------------------------------------------------------
GLU2B_SCHPO/385-431--------..........--------------------------------------------------------------
Q9VJD1_DROME/434-491--------..........--------------------------------------------------------------
Q9VKC7_DROME/99-188--------..TDEKMEIL--------------------------------------------------------------
Q9VKC7_DROME/354-428--------......SEEA--------------------------------------------------------------

PF02157

MPRD_BOVIN/2-279-----------SPEISHLSVGSILLVTLASLVAVYIIGGFLYQRLVVGAKGM-----EQFPHL-AFWQDLGNLVADGCDF

PF09451

Q54CZ8_DICDI/7-251..GDQPKKG..GIGGGWI.....FIIILLSVTVVYIVGGIIFNAKVKHQHGS.....DMFPNK.EMWVNFGGLIKDGVFF
ATG27_DEBHA/7-277..GNDKDDN..GESWGWFTW...IFIFLVLFLSIYIVGGAWFQYSKGNAIDFQSALREVLENFVSLLKGLPSFVREII..
ATG27_CANAL/3-247...........GESWGWFTW...IFIFLVLFLSIYIIGGAWFQYNKGNAIDFQSALKEVVENFIELLKGLPSFGKEII..
ATG27_ASHGO/7-246...........SGIGGWITW...LVIYAVLLTLIYLLAKSYMSVGHGSMQDFRE...EFVERSTNLVSSLPEFAKEVMGK
ATG27_KLULA/6-280KNGSKPKGG..AGLGSWLVW...LFMYATIFALIYLVVTSYMNTRNGSFNDFRE...EFVDRSTTFATNLPQFAKEVAGK
ATG27_CANGA/6-271..NNNTGKDKKSKKTSWFTW...LFVYAILFTVIYLMVVSYLNTKGGSFQDFRN...EFVERGTEFITSLPTFVKEVVTK
G2WGJ7_YEASK/7-266..GKKPAKK..AGGTSWFTW...LFLYALLFTLIYLMVVSFLNTRGGSFQDFRA...EFIQRSTQFLTSLPEFCKEVVSR
Q55NF4_CRYNB/4-269...........GGGGGFFSFVKTLFWLIIIGLILYFAIGIFYNHQQYSARGW.....DLIPHR.DFWREVPTLGQDLISH
Q4P961_USTMA/31-324..GSDSDGASASGGWGFFHW...LFFLLFVGFVAYMGVGMYNNYNNYGASGW.....DLVPHK.DFWRESPYIARDAATH
ATG27_YARLI/3-271..GDDASNG..NPSWGWFTW...LFIIIVLGVAVYIIGNAWINYDRYGNAGV.....DLLPHA.DSLRDVPYLIRDLIAK
Q1K5D2_NEUCR/29-377KGGNGEEDI..NKSWGFFTW...LVVLLFLGIAAYLIFGSWLNYNRYGARGW.....DLLPHG.DTIRDIPYLLKDWTRR
Q5BF19_EMENI/12-291..GSDPDRSLQYKSFGKADD.....ETFFLCAAAYLIFGSWLNYNRYGARGW.....DLLPHG.DTLRDIPYLFQDWLRR
B0XN71_ASPFC/14-328...........SSHWGFFTW...LIIILFLCVAAYLIFGSWLNYNRYGARGW.....DLLPHG.DTLRDIPYIFQDWLRR
B8MZF4_ASPFN/14-321...........SSHWGFFTW...LIIILFLCIAAYLIFGSWLNYNRYGARGW.....DLLPHG.DTIRDIPYIFQDWLRR

PF00878

MPRI_HUMAN/1031-1178---------------------------------QGSAVGSCLVSE.GNSWNL------------GVVQMSPQAAANGSLS
MPRI_HUMAN/423-573---------------------------------P.EDAAVCAVDK.NGSKNL------------GKFISSPMKE.KGNIQ
MPRI_BOVIN/1040-1187---------------------------------HGTAVGCCLVTE.DSKLNL------------GVVQISPQVGANGSLS
MPRI_MOUSE/1315-1455---------------------------------P.PEAAVCLLNG.SKPVNL------------GKVRDGPQWT.DGVTV
MPRI_BOVIN/1331-1471---------------------------------P.PEAAVCLLGG.PKPVNL------------GRVRDSPQWS.QGLTL
MPRI_MOUSE/1024-1171---------------------------------HGIALGSCMVSE.DNSFNL------------GVVQISPQATGNGSLS
F1NVD2_CHICK/503-654---------------------------------P.DAAAICSVDKKNNSKNL------------GTFVSPPKKV.GENIQ
G3V824_RAT/569-708---------------------------------Q.SNSGACQVAKSGKSWNL------------GLSNTKLTYY.DGMIQ

PF13015

B6K4H4_SCHJY/349-504---------------------------------QKCWNGPPRSAQ---------------VKVECGKSNEIISVLEAQKC
C5M4M3_CANTT/386-532---------------------------------AKCWNGPHRSAI---------------VEFECGDALDLISVSEPEKC
C4R3S3_PICPG/341-510---------------------------------AKCWNGPVRKAI---------------AVVQCGDVEQLVSVSEPEKC
GLU2B_SCHPO/346-506---------------------------------QSCWNGPHRSAI---------------VTVECGVENEIVSVLEAQKC
A5DJ02_PICGU/305-448---------------------------------SKCWNGPRRSAI---------------VELVCGPQNRLLSVAEPEKC

PF07915

A0A023ZAE6_YEASX/537-646---------------------------------NMEKYAEHLKATYDEKSDLISNLAAIQDDDGNMQHYVFGNLNELNNG
A0BVD2_PARTE/98-171---------------------------------..................................LRATDETNGIHQP
A0CKZ0_PARTE/98-170---------------------------------..................................ISKNYSYAGFEPP
A1C3Z3_ASPCL/157-257---------------------------------AEDVEGVAEHKK..................ASTTDIAELQTKGGSRY
A1CD98_ASPCL/492-561---------------------------------.VRIGSVTVDEL........................NEAGEMVPEER
A2GK42_TRIVA/71-135---------------------------------..................................QEDDSKPKSIYNG
A2R1B3_ASPNC/442-511---------------------------------.TGIGSVSVDVL........................NEAGEIVPEDR
A2R8V3_ASPNC/155-251---------------------------------EDEVEGAADQKK...................PVTDVAELQTKGGSRY
A2VDJ4_HUMAN/56-116---------------------------------.HEWEIAN....................................NTF
A2YFJ9_ORYSI/121-201---------------------------------DAYYENQTSDSA......................DEDDNLIDTSKRY
A3GGW8_PICST/109-220---------------------------------PRNEIVKIENEAQKHNNQLDPGDFSIHDDLSTPFSNSLEPKKKSPLV
A4HEV5_LEIBR/388-454---------------------------------.NSFAEST............................YSTWTKDTRDF
A4I229_LEIIN/228-294---------------------------------.KSFAENT............................YSVWAKDAHDL
A4S612_OSTLU/68-155---------------------------------TMELGSERAATM...............GDGAEAGVDSGKLALENQRY
A4S717_OSTLU/44-97---------------------------------...................................SEGVRIDADGKT
A5DHY4_PICGU/126-247---------------------------------QSLWKGNNLDVS..........EFTIIDSDVSPFTNGHLSESRSQRY
A5E6Q1_LODEL/91-197---------------------------------ITKAVEVDPDDF...................TVVDGEFSYFEDNQRF
A6REP5_AJECN/405-474---------------------------------.SAFTTITADEQ........................DSNGKVVPQKK
A6XPJ8_AJECN/133-209---------------------------------.................................RGEKQGNKNGKGSR
A7F2Y5_SCLS1/147-250---------------------------------EDEWGNQIEAHT...............TTKKGDSPKTELQVKGDTRY
A7S009_NEMVE/46-100---------------------------------....................................TRKVEGRDMRY
A7S009_NEMVE/245-317---------------------------------HVEWVAKRSSKS..............................IKLGY
A7SE51_NEMVE/70-130---------------------------------.QGWTIEN....................................NTF
A7SG72_NEMVE/77-152---------------------------------QTDWSKEKVEKS.........................KSKTTVVQRY
A7SJQ2_NEMVE/423-480---------------------------------.....................................GEWNGSPYKY
A7TL63_VANPO/122-195---------------------------------NEEFEKRDHKLL...........................YDTVDGYY
A7TM15_VANPO/111-181---------------------------------...ISASDIKDR.......................EFQLLYNEYGYY
A8X7A1_CAEBR/101-181---------------------------------DASLTASTNENI.....................KPQTRRIENEDYPY
A8X7A1_CAEBR/339-416---------------------------------HKEWVKLDSKNR........................GAIKGTQQIMQ
A9UM90_XENTR/33-91---------------------------------....................................TEEDVPNSTLF
B0YA10_ASPFC/161-256---------------------------------DEDLEGDAEHKK...................TTTDVAELQTKGGSRY
B1H2B8_XENTR/100-193---------------------------------DSEAESPNTNTE......................IPTKNIEGQLTPY
F5HAI8_CRYNB/146-266---------------------------------DRSTAVETTANA................PHTQSSPSVSFGLGASSRY
G1RCI8_NOMLE/342-421---------------------------------HIEWAKKNTARA......................YHLQDDGTQTVRM
GLU2B_MOUSE/406-464---------------------------------.GSWAGPDHDK...................................F
O65221_ARATH/57-104---------------------------------..............................................Y
Q00XK8_OSTTA/90-173---------------------------------TERLESERNATG...................DVEDVDDALLSEDRRY
Q08C06_DANRE/70-143---------------------------------EFDWTNETAKAS...........................KQHKLKRY
Q09396_CAEEL/122-193---------------------------------....DGSLKMPS........................YQESTDDRLLF
Q0D1V6_ASPTN/160-264---------------------------------DAEPERRKSSST..............SSSSSSTTDVAELQTKGGSRY
Q0UVU1_PHANO/148-261---------------------------------KETFDDEGNVKD................ESESALDLPRLESKGSSRY
Q0V1F7_PHANO/438-509---------------------------------.VSITSVTVDEE......................LPADGKGLGSGER
OS9_HUMAN/108-181---------------------------------AFDWDDETAKAS...........................KQHRLKRY
Q16M80_AEDAE/441-496---------------------------------.EKWASSD......................................Y
Q16PW6_AEDAE/29-86---------------------------------...................................YSDRDITDVQLF
Q170H4_AEDAE/98-185---------------------------------KAFYENSDAEGA.....................KMQYKKIDGLNLPY
Q170H4_AEDAE/351-420---------------------------------HLEWLEKNPSIR...........................NKRKNENQ
Q20CF4_PETMA/30-88---------------------------------.................................SAYTGEQVSTATLF
Q29LB3_DROPS/439-496---------------------------------.....................................EQWIGEGYKY
Q29NJ4_DROPS/101-190---------------------------------SRAWESEQKDGG...................KHKYKTIKIDNTRYPY
Q29NJ4_DROPS/360-434---------------------------------HRQWAIANPDKG..........................ARRTGFSSS
Q2GN19_CHAGB/165-263---------------------------------TKAVADQSQPDS...............PTKNVPPPNAQLQVKGDQRY
Q2UHS2_ASPOR/160-262---------------------------------DGEAERKKTAET...............TTTATTTDVAELQTNGGSRY
Q2UTA8_ASPOR/443-512---------------------------------.VRIGSVTIDQL........................NESGEIVPEER
Q383K9_TRYB2/102-183---------------------------------.VAPPADVLDLR.........................YGVNTKGLRY
Q38E25_TRYB2/57-160---------------------------------ASGAPINNTEAT......................YTCSKDVSVSNVQ
Q4CS72_TRYCC/374-438---------------------------------.GRFGDNT............................YSLWSSTSD.Y
Q4DFG0_TRYCC/99-181---------------------------------.TSPSKDDLNFR.........................YGVDALGNRY
OS9_GIBZE/149-241---------------------------------QAKMNGQEAPPP........................AELQVKGDQRY
Q4RHD7_TETNG/423-488---------------------------------.GKWAGPA...................................DNVY
Q4RQ71_TETNG/131-225---------------------------------KVSWIPSFAYIC..................VFITVPTKNIEGQLTPY
Q4RQ71_TETNG/370-475---------------------------------HFEWAQKNVARS......................YQHRDDGVQKVKL
Q4WG82_ASPFU/413-482---------------------------------.GRIGSVIIDNV........................NETGVIVPEER
Q55BK1_DICDI/419-467---------------------------------........................................ESFGDNG
Q55ZR6_CRYNB/439-501---------------------------------...................................NTAAEQGSFGYY
Q57VU0_TRYB2/375-439---------------------------------.VRFGEST............................YSLWSTTDD.H
OS9_CANAL/114-193---------------------------------..............................SKQTSPLEFEFDTKERT
Q5B183_EMENI/1069-1138---------------------------------.ERIGSVSVDEV........................NEAGEIIQVQK
OS9_EMENI/151-245---------------------------------DEGKGAKSGKSS.....................TELAELQTKGGSRY
Q5CSG1_CRYPI/286-401---------------------------------LSKNLISNIVNTIKPGRVSLLENITTKIEPRNINELISGKYVHSKYV
Q5DA66_SCHJA/303-366---------------------------------.SRWLESDENEK.................................SY
Q5DCH4_SCHJA/94-177---------------------------------KTERDRSTKDNQ......................PKSVTLGEHSYPY
Q5DCH4_SCHJA/372-448---------------------------------HLKWLAENAKDQ..........................KSSTGPDRQ
Q5RJX3_XENLA/101-191---------------------------------PSEAGENQEDKE...............RTEGHKDIHTKNIEGQMTPY
OS9_DEBHA/130-240---------------------------------QSPWASNNLDLS.............EFTIHESSIISDATAKNEQSRF
OS9_YARLI/111-190---------------------------------......EKDDTT........................NTVTSAGGIPF
Q6C4G9_YARLI/307-374---------------------------------.NSIEELPRSAD........................WDEVLEGPRYS
Q6CK66_KLULA/502-608---------------------------------NSKYDVYLQSLKYRYPNTEVGNHLSSDTVEIGKEEILLGNLPDLNNG
Q6FHE1_HUMAN/30-88---------------------------------....................................TEEDVNDNTLF
Q6FV48_CANGA/491-608---------------------------------HQSHLSAKYPDLDVRHLRNERLKMVNGSIEDEFEYLYGDELDNMDLP
OS9_CANGA/106-177---------------------------------..RSSKQIENRE........................FQLLYDDYGYY
Q6GLZ2_XENLA/401-459---------------------------------.GSWAGPEDNK...................................F
Q6NVN2_XENTR/108-198---------------------------------TTEAGENQEEKE...............STESPKEIYTKNIEGQMTPY
Q6NVN2_XENTR/340-419---------------------------------HQEWAKKNLARA......................YMTTPDGVQTVKT
Q6PW72_ICTFU/24-82---------------------------------....................................TEEDVPSNTLF
Q74ZM0_ASHGO/505-608---------------------------------SQRARDAYINQLQTRATDVDLIGHLSNYSPGAGHDLLLGNLPDIHNG
Q7PPE5_ANOGA/445-501---------------------------------.DRWNGPGD.....................................Y
Q7QG77_ANOGA/95-183---------------------------------KARYAQADADKE....................QQMKYKKIEGFNLPY
Q7QG77_ANOGA/348-417---------------------------------HREWLEKTPSAR...........................NKRKLENQ
Q7S6V9_NEUCR/438-509---------------------------------.ERITTEIADEE......................DRVDGKGLGKGPR
Q86H64_DICDI/159-253---------------------------------DQTILEKYMKKE.................ITELPQSTTTTPSNFLPY
Q86NV3_DROME/212-268---------------------------------...................................YTDRELSSVEYF
OS9_NEUCR/167-265---------------------------------QIEVPNNEQKQL...................SPPPNTELQAKDNQRY
ERLEC_HUMAN/111-199---------------------------------EKEREAEEKEKS....................NEIPTKNIEGQMTPY
OS9_YEAST/115-193---------------------------------..KPKANVEERE........................FELLYDDVGYY
FSTL3_RAT/34-90---------------------------------.....................................SNFTHPGNKI
PSL4_ARATH/527-579---------------------------------........................................DKFENSY
Q9NF22_CAEEL/350-427---------------------------------HKEWVKLDRHAR........................GAIQGNNQIDQ
GLU2B_SCHPO/385-431---------------------------------..........................................ASQEG
Q9VJD1_DROME/434-491---------------------------------.....................................DKWSGEPKQY
Q9VKC7_DROME/99-188---------------------------------TKAWQADIKAGV...................KPKYKSLKIDNTRYPY
Q9VKC7_DROME/354-428---------------------------------HRAWSNANPDKG..........................ARRSGFTTS

PF02157

MPRD_BOVIN/2-279VCRSKPRNVP-AAYRGVGDDQ-LGEESEERDDHLLPM-------------------------

PF09451

Q54CZ8_DICDI/7-251IK.........SKVTG..TGG-QG--------------------------------------
ATG27_DEBHA/7-277...........EKFTG..NSN-RG--------------------------------------
ATG27_CANAL/3-247...........EKFTG..RSN-RG--------------------------------------
ATG27_ASHGO/7-246VV.........GG..G..PSS-RG--------------------------------------
ATG27_KLULA/6-280IV.........NS.GS..SSQ-RG--------------------------------------
ATG27_CANGA/6-271TL.........GTRDS..SAS-RG--------------------------------------
G2WGJ7_YEASK/7-266IL.........GR..S..TAQ-RG--------------------------------------
Q55NF4_CRYNB/4-269VV.........ANVRGSGSGG-RG--------------------------------------
Q4P961_USTMA/31-324VWQAVSGNRGGGGFSG..AGG-RG--------------------------------------
ATG27_YARLI/3-271VV.........GTFTG...SS-RT--------------------------------------
Q1K5D2_NEUCR/29-377VL.........NTVQS..SGS-RG--------------------------------------
Q5BF19_EMENI/12-291VV.........NTFQG..AGS-RG--------------------------------------
B0XN71_ASPFC/14-328VI.........NTLQG..SGS-RG--------------------------------------
B8MZF4_ASPFN/14-321VV.........NTLQG..SGS-RG--------------------------------------

PF00878

MPRI_HUMAN/1031-1178IM-----------YVN--GDK-CG--------------------------------------
MPRI_HUMAN/423-573LS-----------YSD--GDD-CG--------------------------------------
MPRI_BOVIN/1040-1187LV-----------YVN--GDK-CK--------------------------------------
MPRI_MOUSE/1315-1455LQ-----------YVD--GDL-CP--------------------------------------
MPRI_BOVIN/1331-1471LK-----------YVD--GDL-CP--------------------------------------
MPRI_MOUSE/1024-1171IL-----------YVN--GDR-CG--------------------------------------
F1NVD2_CHICK/503-654LT-----------YSN--GGS-CG--------------------------------------
G3V824_RAT/569-708LS-----------YRN--GTL-YN--------------------------------------

PF13015

B6K4H4_SCHJY/349-504EY---------LIQML--SPAAC...STTLYRKSLITEANEHPTPETI........AENDEL
C5M4M3_CANTT/386-532QY---------NFLVK--GEAWC.........KPLSEE..EILSSFKI.........DYALL
C4R3S3_PICPG/341-510EY---------HLVVR--SPVGCFSEDNVYLVKEIAEG..ESHAPFKVI.......PFKDEL
GLU2B_SCHPO/346-506EY---------LIKMK--SPAAC...SPDQLKQSLLNT..QNSANENAVNGMEDKESSVDEL
A5DJ02_PICGU/305-448AY---------TFEVM--TPVVC.........DSLTHE..DLLANFHI.........DYDSL

PF07915

A0A023ZAE6_YEASX/537-646LV---------LEYEN--GDQ.C---------------------------------------
A0BVD2_PARTE/98-171DH---------ALYTL--DTHYH---------------------------------------
A0CKZ0_PARTE/98-170NS---------SYYLD--TNY.H---------------------------------------
A1C3Z3_ASPCL/157-257LV---------QRLGG--GTR.C---------------------------------------
A1CD98_ASPCL/492-561VS---------LVYAN--GQT.C---------------------------------------
A2GK42_TRIVA/71-135IS---------YDWNN--GDK.C---------------------------------------
A2R1B3_ASPNC/442-511VT---------LQYAN--GQG.C---------------------------------------
A2R8V3_ASPNC/155-251LV---------QRLDG--GTK.C---------------------------------------
A2VDJ4_HUMAN/56-116TG---------MWMRD--GDA.C---------------------------------------
A2YFJ9_ORYSI/121-201HV---------HLYTN--GTV.C---------------------------------------
A3GGW8_PICST/109-220IS---------HVISD--GEI.C---------------------------------------
A4HEV5_LEIBR/388-454SR---------MIYDD--GLE.C---------------------------------------
A4I229_LEIIN/228-294SQ---------MIYDN--GLR.C---------------------------------------
A4S612_OSTLU/68-155HA---------HAFTD--GTK.C---------------------------------------
A4S717_OSTLU/44-97MT---------LKFAD--GDA.C---------------------------------------
A5DHY4_PICGU/126-247IQ---------HTLKM--GGI.C---------------------------------------
A5E6Q1_LODEL/91-197IK---------HTLY.--GDI.C---------------------------------------
A6REP5_AJECN/405-474IA---------LEYTN--GQT.C---------------------------------------
A6XPJ8_AJECN/133-209NS---------QSSSG--GDR.K---------------------------------------
A7F2Y5_SCLS1/147-250LV---------QKMEG--GTI.C---------------------------------------
A7S009_NEMVE/46-100YE---------VVMGN--GTP.C---------------------------------------
A7S009_NEMVE/245-317TV---------HLYTG--GDM.C---------------------------------------
A7SE51_NEMVE/70-130IS---------MLMSE--GDF.C---------------------------------------
A7SG72_NEMVE/77-152HS---------QYYVN--GTV.C---------------------------------------
A7SJQ2_NEMVE/423-480SR---------MKYSD--GQN.C---------------------------------------
A7TL63_VANPO/122-195IS---------ESISN--GDI.C---------------------------------------
A7TM15_VANPO/111-181IS---------EILDG--GEI.C---------------------------------------
A8X7A1_CAEBR/101-181YS---------VSYNH--GTT.C---------------------------------------
A8X7A1_CAEBR/339-416LN---------HIYSK--GDI.C---------------------------------------
A9UM90_XENTR/33-91RW---------MIFNG--GAPNC---------------------------------------
B0YA10_ASPFC/161-256LV---------QRLGG--GTK.C---------------------------------------
B1H2B8_XENTR/100-193YP---------VEMGH--GTE.C---------------------------------------
F5HAI8_CRYNB/146-266LV---------QRWSD--GTR.C---------------------------------------
G1RCI8_NOMLE/342-421VS---------HFYGN--GDI.C---------------------------------------
GLU2B_MOUSE/406-464SA---------MKYEQ--GTG.C---------------------------------------
O65221_ARATH/57-104HS---------HVYTN--GTT.C---------------------------------------
Q00XK8_OSTTA/90-173HA---------HVFTG--GAK.C---------------------------------------
Q08C06_DANRE/70-143HS---------QSYVN--GSK.C---------------------------------------
Q09396_CAEEL/122-193VE---------ETYTS--GTF.C---------------------------------------
Q0D1V6_ASPTN/160-264LV---------QHLRG--GTR.C---------------------------------------
Q0UVU1_PHANO/148-261MV---------QRLNG--GTE.C---------------------------------------
Q0V1F7_PHANO/438-509IA---------LKYEN--GQH.C---------------------------------------
OS9_HUMAN/108-181HS---------QTYGN--GSK.C---------------------------------------
Q16M80_AEDAE/441-496TV---------MRYGN--GAT.C---------------------------------------
Q16PW6_AEDAE/29-86FV---------NAFND--GMD.C---------------------------------------
Q170H4_AEDAE/98-185LE---------LEMDS--GTV.C---------------------------------------
Q170H4_AEDAE/351-420LS---------NFYSG--GDV.C---------------------------------------
Q20CF4_PETMA/30-88RW---------MAFSG--GAPNC---------------------------------------
Q29LB3_DROPS/439-496SK---------QKYGN--GAA.C---------------------------------------
Q29NJ4_DROPS/101-190FE---------MEFSD--GTM.C---------------------------------------
Q29NJ4_DROPS/360-434IW---------HHYVK--GTH.C---------------------------------------
Q2GN19_CHAGB/165-263LS---------QRLED--GTI.C---------------------------------------
Q2UHS2_ASPOR/160-262LV---------QRLEG--GTK.C---------------------------------------
Q2UTA8_ASPOR/443-512IS---------LEYAK--GQT.C---------------------------------------
Q383K9_TRYB2/102-183IY---------TIYSD--GLT.C---------------------------------------
Q38E25_TRYB2/57-160VD---------VLYSH--GTM.C---------------------------------------
Q4CS72_TRYCC/374-438TH---------MIFEN--GDR.C---------------------------------------
Q4DFG0_TRYCC/99-181IF---------TKYPN--GEV.C---------------------------------------
OS9_GIBZE/149-241LV---------QRLEG--GTI.C---------------------------------------
Q4RHD7_TETNG/423-488SV---------MKYEH--GTG.C---------------------------------------
Q4RQ71_TETNG/131-225YS---------VELGN--GTP.C---------------------------------------
Q4RQ71_TETNG/370-475VS---------HFYGH--GDV.C---------------------------------------
Q4WG82_ASPFU/413-482VS---------LEYTN--GQT.C---------------------------------------
Q55BK1_DICDI/419-467KM---------MLFEN--GQQ.C---------------------------------------
Q55ZR6_CRYNB/439-501SQ---------QLYKN--GAK.C---------------------------------------
Q57VU0_TRYB2/375-439TH---------MLYEG--GDW.C---------------------------------------
OS9_CANAL/114-193IS---------QRLL.--GEV.C---------------------------------------
Q5B183_EMENI/1069-1138TS---------LEYKN--GQG.C---------------------------------------
OS9_EMENI/151-245LV---------QRLES--GDQ.C---------------------------------------
Q5CSG1_CRYPI/286-401IT---------VMLLN--GTY.C---------------------------------------
Q5DA66_SCHJA/303-366KV---------MLYEN--GLH.C---------------------------------------
Q5DCH4_SCHJA/94-177YE---------VNYVD--GTL.C---------------------------------------
Q5DCH4_SCHJA/372-448IS---------LYYGH--GDY.C---------------------------------------
Q5RJX3_XENLA/101-191YP---------VEMTN--GTP.C---------------------------------------
OS9_DEBHA/130-240LQ---------HTLYD--GEI.C---------------------------------------
OS9_YARLI/111-190LA---------HRLRS--GTH.C---------------------------------------
Q6C4G9_YARLI/307-374YV---------MRYVS--GAR.C---------------------------------------
Q6CK66_KLULA/502-608LI---------LEYRG--GTK.C---------------------------------------
Q6FHE1_HUMAN/30-88KW---------MIFNG--GAPNC---------------------------------------
Q6FV48_CANGA/491-608IV---------LGFTR--GEK.C---------------------------------------
OS9_CANGA/106-177IS---------EIIES--GDI.C---------------------------------------
Q6GLZ2_XENLA/401-459SS---------MKYEH--GTS.C---------------------------------------
Q6NVN2_XENTR/108-198YP---------VEMIN--GTP.C---------------------------------------
Q6NVN2_XENTR/340-419VS---------HFYGG--GDV.C---------------------------------------
Q6PW72_ICTFU/24-82RW---------LLMHG--GAPNC---------------------------------------
Q74ZM0_ASHGO/505-608LL---------LSYGN--GHK.C---------------------------------------
Q7PPE5_ANOGA/445-501SA---------MIYSN--GAP.C---------------------------------------
Q7QG77_ANOGA/95-183LE---------LEMDS--GTI.C---------------------------------------
Q7QG77_ANOGA/348-417IS---------HFYTG--GDV.C---------------------------------------
Q7S6V9_NEUCR/438-509MV---------LRFEN--GQG.C---------------------------------------
Q86H64_DICDI/159-253FS---------EKYED--GTV.C---------------------------------------
Q86NV3_DROME/212-268FA---------TAIGG--GVE.C---------------------------------------
OS9_NEUCR/167-265LV---------QRLDG--GTI.C---------------------------------------
ERLEC_HUMAN/111-199YP---------VGMGN--GTP.C---------------------------------------
OS9_YEAST/115-193IS---------EIIGS--GDI.C---------------------------------------
FSTL3_RAT/34-90SL---------LGFLG--LVH.C---------------------------------------
PSL4_ARATH/527-579QF---------MSYTN--GEK.C---------------------------------------
Q9NF22_CAEEL/350-427IS---------QIYAK--GDI.C---------------------------------------
GLU2B_SCHPO/385-431NV---------LKYEN--GQS.C---------------------------------------
Q9VJD1_DROME/434-491SQ---------QKYTN--GAA.C---------------------------------------
Q9VKC7_DROME/99-188FE---------MEYSD--GTM.C---------------------------------------
Q9VKC7_DROME/354-428IW---------HHYGK--GTH.C---------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window