Sequence alignment for CL0226

PF02157

MPRD_BOVIN/2-279MSPLHSSWRTGLLLLLLFSVAVRESWQTEEKTCDLVGEKGKESEKELALLKRLTPLFNKSFES-TVGQSPDMYSYVFRVC
MPRD_MOUSE/1-278MFPFSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKSFES-TVGQGSDTYSYIFRVC

PF09451

Q4WRS6_ASPFU/14-328-------------SALFTGLASASGSFDCRNIIAE.GIKYD--------LYGLHGVHTIYHVD-KAEDYIVNTTYVLDIC
ATG27_DEBHA/7-277-------------ISAALGLIGGVSGIDCGVKEL...KEYD--------FESIKGIHSVTTLK-DTPPTQTNVTWYIGIC
ATG27_CANGA/6-271-------------QVVALAMASSAVALNCKNHNVL..SNYN--------VANKD..ILLKNEL-DTPPSKTSEMWYLAPC
ATG27_YEAST/7-266-------------ICGFISIITVVQALSCEKHDVL..KKYQ--------VGKFS..SLTSTER-DTPPSTTIEKWWINVC
ATG27_KLULA/6-280-------------ATALVSLLPFSSAVECSKNEIL..NKYR--------VNEFS..IGGVSVQ-DTPPSETKESWWLNIC
ATG27_ASHGO/7-259-------------VLLTGALFNIAAGLKCADSKVL..SRYK--------VSQHA..AKGKFTE-STPPSETTDFWWINLC
Q55NF4_CRYNB/4-269-------------TLTFLAFLPLVAAFDCSITAFS..ISYD--------ISPLAGLRTASKDS-STPPTTSEVKVSMNLC
Q4P961_USTMA/31-324-------------TDTIAASKQTLSPFDCSNVAVSSKQSFD--------LSKIAYPIRVSSKE-STPPSETKTFIDIDLC
ATG27_YARLI/3-271-------------SAIIGYMAVAVAAASCQFTVDS..KNYD--------LSAISGPKSVEYTI-ETPPSKRKMEFVLDPC
Q5BF19_EMENI/12-291-------------VSLLPCLSFAVS.FDCSSIHVD.NYNYN--------LKALGGVHEIYHAE-QVGDLIVNTTYVLNLC
Q2UQK8_ASPOR/14-321-------------SALLPSLSAASG.FDCAHINVD.GYKYD--------LSELGGVHSLYNVE-KTEEHVVNTTYVLNIC
Q8WZV1_NEUCS/29-377-------------TAAAAAAAAPAEIMRCKEIVVD.GHKYD--------FGELGGPHTVVTNE-YDPPAYYNYTYTLDIC
Q54CZ8_DICDI/7-251-------------ILLVLAIATMAFGQGSPSQCTHNGINYG--------ALSNGSYSALSAVS-GTNPQG.KYRYYWNIC
ATG27_CANAL/3-247-------------LASLLTFATAALAFDCSDKEL...ERYN--------FESIKGVHSYTTLK-NTPPSQTNVTWNVGIC

PF00878

MPRI_HUMAN/1031-1178-----------------GTADAFIVRFVCNDDVY---------------SG...PLKFLHQDI-DSGQGIRNTYFEFETA
MPRI_HUMAN/423-573-----------------GFQRMSVINFECNKTAG---------------NDGKGTPVFTGEV.-.....DCTYFFTWDTE
MPRI_BOVIN/1040-1187-----------------GRADAFIIRFVCNDDVY---------------PG...TPKFLHQDI-DSSLGIRDTFFEFETA
Q63002_RAT/566-706-----------------DKKITTNITFVCKPGDL---------------ES...APVLRAAGP-....DGCSYEFEWHTA
Q90681_CHICK/1011-1157-----------------GKSDTFTVTFICN.DSY---------------PG...ELKFVREEI-NSMLNIHDTFFEFHTA
Q90681_CHICK/1299-1439-----------------IYERSTAILFYCDKTT.---------------.S...EPVFLKETP-.....DCTYMFEWHTQ
MPRI_MOUSE/1315-1455-----------------VYQRSTTIYFYCDRTT.---------------.Q...KPVFLKETS-.....DCSYMFEWRTQ
MPRI_MOUSE/418-567-----------------GFQRMSVINFECNKTAG---------------KDGRGEPVFTGEV.-.....DCTYFFTWDTK
Q90681_CHICK/412-563-----------------GFQRMTVINFECNETAG---------------NDGRGTPVFTGEV.-.....DCTYFFTWYTK
MPRI_BOVIN/432-582-----------------GFQRMSVINFECNQTAG---------------NNGRGAPVFTGEV.-.....DCTYFFTWDTK
MPRI_BOVIN/1331-1471-----------------VYQRSTTIFFYCDRST.---------------.Q...APVFLQETS-.....DCSYLFEWRTQ
MPRI_MOUSE/1024-1171-----------------DRGTAFIIRFICNDDIY---------------PG...APKFLHQDI-DSTRGIRNTYFEFETA

PF13015

B6K4H4_SCHJY/349-504-------------LEHQLNEVKYQYDDLQSEQARLFEDMNEPHGWDDIYRVLKGMETK---AK-SG-------DYEYRIR
C5M4M3_CANTT/386-532-------------LTMKIDELEDDIKNIEQKITAIKANLNSDFGPDDILRAYESRAIT---KK-LG-------GYNYVIN
C4R3S3_PICPG/341-510-------------IQKSIDSHNKEIVKIDSDL....ENSESRYGLEDIFRAYDGRCFV---EK-IG-------DYDYEYC
GLU2B_SCHPO/346-506-------------AQRDLDAAEENEKSLEKEHTKLMHELEYHHGW.DLYRAIKGMETK---RE-IG-------GYTYKVV
A5DJ02_PICGU/305-448-------------LEMEDDE...DITAIKQDISIYEEQLNRNYGPDDILRAIEGTWVS---ES-LN-------GYTYKVG

PF07915

Q74ZM0_ASHGO/505-608-----------------------------------------------------DFCIS...SK.FD.......EYTYHIC
Q4WG82_ASPFU/413-482-----------------------------------------------------GVCIS...KD.SG.......EYTYEHC
OS9_ASPFU/161-256-----------------------------------------------------GKCMY...YI.SG.......WWSYSFC
Q09396_CAEEL/122-193-----------------------------------------------------DKCVK...LRGNH.......WWSYILC
Q55BK1_DICDI/419-467-----------------------------------------------------SKCFD...LA.TK.......EYTYSVC
OS9_HUMAN/108-181-----------------------------------------------------APCLL...KT.KD.......WWTYEFC
FSTA_DANRE/33-91-----------------------------------------------------GNCWL......QQ.......GKN.GRC
A3GGW8_PICST/109-220-----------------------------------------------------EVCTF...HS.GS.......YWIYGYC
Q29NJ4_DROPS/101-190-----------------------------------------------------QTCSY...RI.EA.......YWSYEIC
OS9_DEBHA/130-240-----------------------------------------------------KDCVF..AYG.SNG.....GYWTLGYC
A5DHY4_PICGU/126-247-----------------------------------------------------KECVYVYNFN.SG.......YWTYAFC
Q29LB3_DROPS/439-496-----------------------------------------------------GECYN...FE.DR.......EYVYTLC
Q0V1F7_PHANO/438-509-----------------------------------------------------DTCIE...KD.SG.......EYTYEHC
Q29NJ4_DROPS/360-434-----------------------------------------------------ANCLT...GG.NG.......WWRYEFC
Q8LDD0_ARATH/527-579-----------------------------------------------------GRCFE...SK.QG.......KYTYKVC
A2GK42_TRIVA/71-135-----------------------------------------------------GQCFE...FTHTG.......YWFFKFC
Q16M80_AEDAE/441-496-----------------------------------------------------GECIN...YE.DR.......EYIYKLC
Q0D1V6_ASPTN/160-264-----------------------------------------------------GKCMY...YV.SG.......WWSYSFC
A2R1B3_ASPNC/442-511-----------------------------------------------------GVCIS...KD.SG.......EYTYEHC
Q6FHE1_HUMAN/30-88-----------------------------------------------------GNCWL......RQ.......AKN.GRC
ERLEC_HUMAN/111-199-----------------------------------------------------SSCSY...RI.ES.......YWTYEVC
Q6CK66_KLULA/502-608-----------------------------------------------------DFCVD...SE.LN.......SYIYRLC
Q5KAG5_CRYNJ/146-266-----------------------------------------------------GKCLY...SK.QG.......WFTYAYC
Q9VKC7_DROME/99-188-----------------------------------------------------LTCTY...RI.EA.......YWSYEIC
A7F2Y5_SCLS1/147-250-----------------------------------------------------NNCLY...FV.SG.......WWSYSFC
OS9_CANAL/114-193-----------------------------------------------------TSCVF..SFNLHA......NYWTIGYC
Q3U518_MOUSE/406-464-----------------------------------------------------SQCYE...LT.TN.......EYVYRLC
A4I229_LEIIN/228-294-----------------------------------------------------REEFT...ID.FQ.......EYTYAVI
Q4P0B9_USTMA/948-1012-----------------------------------------------------NKCFS...KD.MG.......EYTYEYC
Q5CSG1_CRYPI/286-401-----------------------------------------------------NRCQN...FTDSR.......FWNYELC
O65221_ARATH/57-104-----------------------------------------------------EKCLF...RQ.EG.......WWSYEFC
Q5DCH4_SCHJA/372-448-----------------------------------------------------KTCLS...IN.SG.......WWTYEIC
Q55ZR6_CRYNB/439-501-----------------------------------------------------GTCVD...KV.VG.......DYTYELC
Q86NV3_DROME/212-268-----------------------------------------------------GTCW.......QT.......HLGSGKC
A4S717_OSTLU/44-97-----------------------------------------------------GLCFD...QK.IE.......KYVYKAC
Q2GN19_CHAGB/165-263-----------------------------------------------------GQCMY...FV.AG.......WWSYSFC
Q38E25_TRYB2/57-160-----------------------------------------------------SGCIS...WK.TG.......YWTYEVC
OS9_YARLI/111-190-----------------------------------------------------GDCLF...YE.QG.......FFSYRFC
Q2UHS2_ASPOR/160-262-----------------------------------------------------GKCMY...YV.SG.......WWSYSFC
A2VDJ4_HUMAN/56-116-----------------------------------------------------GKCFS...LV.ES.......TYKYEFC
Q4RQ71_TETNG/370-475-----------------------------------------------------SYCLH...GG.VG.......WWKYEFC
A0BVD2_PARTE/98-171-----------------------------------------------------DQCVQ...HY.TK.......EFVYEYC
A7TM15_VANPO/111-181-----------------------------------------------------DICVV...YP.NG.......FWNYEYC
Q5DCH4_SCHJA/94-177-----------------------------------------------------HPCVV...RS.EA.......YWSYELC
Q08C06_DANRE/70-143-----------------------------------------------------AACLI...KT.KD.......WWTYEFC
Q6FV48_CANGA/491-608-----------------------------------------------------SGCVS...SK.VN.......EYSYEIC
A6SHA1_BOTFB/476-547-----------------------------------------------------GSCVS...KD.SG.......EYDYELC
A5E6Q1_LODEL/91-197-----------------------------------------------------GDCVF..AFNIQG......AYWTVGFC
Q170H4_AEDAE/351-420-----------------------------------------------------SYCLT...GG.SG.......WWKFELC
A0CKZ0_PARTE/98-170-----------------------------------------------------DLCVH...HT.TK.......EFLYEYC
Q4CS72_TRYCC/374-438-----------------------------------------------------NECFS...LN.TS.......THTYEIC
Q6PW72_9TELE/24-82-----------------------------------------------------GNCWY......EQ.......GKN.GRC
A7S009_NEMVE/245-317-----------------------------------------------------DYCLQ...GG.TG.......WWKYELC
A7S009_NEMVE/46-100-----------------------------------------------------AKCSY...RL.EA.......YWTYELC
Q6NVN2_XENTR/340-419-----------------------------------------------------SYCFH...GG.VG.......WWKYEFC
Q383K9_TRYB2/102-183-----------------------------------------------------NMCYT...ME.ES.......WWTYRLC
Q2UTA8_ASPOR/443-512-----------------------------------------------------GVCIQ...KD.AG.......EYTYEHC
Q6GLZ2_XENLA/401-459-----------------------------------------------------GECYE...LS.TS.......EYVYSLC
A4S612_OSTLU/68-155-----------------------------------------------------GRCFY...YG.NG......DWWTYELC
OS9_EMENI/151-245-----------------------------------------------------GKCLY...YI.SG.......WWSYSFC
Q5RJX3_XENLA/101-191-----------------------------------------------------SSCSY...RI.ES.......YWTYEVC
FSTL3_RAT/34-90-----------------------------------------------------GVCWL......QQ.......GKE.ATC
Q9VKC7_DROME/354-428-----------------------------------------------------KNCLT...GG.NG.......WWKYEFC
OS9_YEAST/115-193-----------------------------------------------------ERCIF...YQ.AG.......FWIYEYC
A2R8V3_ASPNC/155-251-----------------------------------------------------GKCMY...YI.SG.......WWSYSFC
Q57VU0_TRYB2/375-439-----------------------------------------------------DECFT...LD.VK.......VYTYKFC
GLU2B_YEAST/537-646-----------------------------------------------------SYCLD...DI.LD.......NYVYTIC
A2YFJ9_ORYSI/121-201-----------------------------------------------------DQCFY...RH.EG.......WWSYEFC
ERLEC_PONAB/342-421-----------------------------------------------------SYCFH...GG.VG.......WWKYEFC
OS9_GIBZE/149-241-----------------------------------------------------DSCLY...FM.SG.......WWSYSFC
A6XPJ8_AJECN/133-209-----------------------------------------------------GRCMY...YV.AG.......WWSYSFC
A4HEV5_LEIBR/388-454-----------------------------------------------------GMEFK...LD.NN.......EHTYKII
Q7QG77_ANOGA/348-417-----------------------------------------------------AYCLP...GG.SG.......WWKFELC
Q7S6V9_NEUCR/438-509-----------------------------------------------------GQCVS...AD.VG.......EYEYELC
A7SJQ2_NEMVE/423-480-----------------------------------------------------GNCFE...FR.DR.......EYLYKLC
A7TL63_VANPO/122-195-----------------------------------------------------SSCIN...YP.NG.......FWTYQFC
Q86H64_DICDI/159-253-----------------------------------------------------QKCIK...SANPG......LWWSYEFC
Q9NF22_CAEEL/350-427-----------------------------------------------------EDCIV...GG.TG.......WWKYEFC
Q20CF4_PETMA/30-88-----------------------------------------------------GNCWL......QQ.......SKN.GRC
OS9_CANGA/106-177-----------------------------------------------------NQCLV...SQ.NG.......FWTYRYC
Q7QG77_ANOGA/95-183-----------------------------------------------------TTCSY...RI.ES.......YWSYEVC
Q7PPE5_ANOGA/445-501-----------------------------------------------------GECFN...FE.DR.......EYVYKLC
OS9_NEUCR/167-265-----------------------------------------------------NQCLH...FV.SG.......WWSYQYC
Q16PW6_AEDAE/29-86-----------------------------------------------------GTCWL......RR.......IESTGKC
A1C3Z3_ASPCL/157-257-----------------------------------------------------GKCMY...YI.SG.......WWSYSFC
Q6C4G9_YARLI/307-374-----------------------------------------------------GECVS...SH.IG.......EYDYEVC
Q6NVN2_XENTR/108-198-----------------------------------------------------SSCSY...RI.ES.......YWTYEVC
Q170H4_AEDAE/98-185-----------------------------------------------------HSCSY...RI.ES.......YWTYEVC
Q9VJD1_DROME/434-491-----------------------------------------------------GQCYN...FE.DR.......EYVYTLC
Q803G0_DANRE/100-193-----------------------------------------------------SSCSY...RI.ES.......YWTYEVC
A8X7A1_CAEBR/101-181-----------------------------------------------------KLCSY...LI.DV.......YWTYQVC
A7SE51_NEMVE/70-130-----------------------------------------------------GKCFS...LT.EY.......GYKYEFC
A6REP5_AJECN/405-474-----------------------------------------------------GSCIS...KD.SG.......EYTYELC
Q00XK8_OSTTA/90-173-----------------------------------------------------GRCFY...YS.NG......DWWTYELC
Q5DA66_SCHJA/303-366-----------------------------------------------------DGCLD...LD.DR.......EYTYSLC
Q4RHD7_TETNG/423-488-----------------------------------------------------TVCVS...LA.NNLVDPFFYRYVYKLC
A8X7A1_CAEBR/339-416-----------------------------------------------------EDCII...AG.TG.......WWKYEFC
A7SG72_NEMVE/77-152-----------------------------------------------------NKCLY...HN.NG.......WWTYEVC
Q5B183_EMENI/1069-1138-----------------------------------------------------GVCIQ...KD.AG.......EYTYEHC
A1CD98_ASPCL/492-561-----------------------------------------------------GVCIS...KD.SG.......EYTYEHC
Q4RQ71_TETNG/131-225-----------------------------------------------------GFSAL...QI.ES.......YWTYEVC
Q0UVU1_PHANO/148-261-----------------------------------------------------GSCIY...YL.SG.......WWSYSFC
GLU2B_SCHPO/385-431-----------------------------------------------------GMETK...RE.IG.......GYTYKVV
Q4DFG0_TRYCC/99-181-----------------------------------------------------KVCIN...LL.EG.......WWTYRLC

PF02157

MPRD_BOVIN/2-279--------------REAG---NH-SSGAGLVQINKSNG--KETVVGRFNETQIFNGSNW-------------------IM
MPRD_MOUSE/1-278--------------REAS---NH-SSGAGLVQINKSND--KETVVGRINETHIFNGSNW-------------------IM

PF09451

Q4WRS6_ASPFU/14-328...KALGKASIRGDLKCG---TS.KNICGFQYKYTPDGSEEISHAFPIAGLDPLGHGSKDAEVTR.....LKGDGQEGLL
ATG27_DEBHA/7-277.......DTISEKIDHCP---KN.SDLCGITSINLEKNSNKDAVVSEIVGFNTNLQKQYKPFTKD......GDNNEDGIT
ATG27_CANGA/6-271.....EDGSRRQRPSECS---SD.DLMCAIRHVKVDG....SDHLTQKLDVHKSAKYEVEEVES............GGFD
ATG27_YEAST/7-266......EEHNVEPPEECK---KN.DMLCGLTDVILPGK...DAITTQIIDFDKNIGFNVEETES.............ALT
ATG27_KLULA/6-280....DEHDSKSSIPDQCN---VK.DIFCGVTSVALPGK...ESIVTKVMDFTSSVALEVKETAE.............ALS
ATG27_ASHGO/7-259......EEHSEPVPDKCK---DD.AMFCHRQQVKLDDG...KEYVTQVFDVPRNQEVDVEELRD.............GFQ
Q55NF4_CRYNB/4-269GGEGLGKEDGVADEDQCP---EN.TRVC.LKLINHKPSSSDPDRVTAVVSFWTVDTPDSDITATP.....LGKKGEQGLE
Q4P961_USTMA/31-324..KPLEADANRDEKDQCP---RG.TRIC.ITIEAIKDD...KAIVTQAIPVAYSDEAEGKKIEAKVEWGEELEGGEKSIE
ATG27_YARLI/3-271..ASLKQDKKKPADEQCP---DN.TIVCGLGYILLPKE..KDFVLSEVMPFGNGPAPQYQPLKT.......GPEGTEGLS
Q5BF19_EMENI/12-291...NTLKGASIRGNLKCG---TS.KNICGFNYTYGADGATENDFAFPIVGLEPMGQGAKDAEITRL...KKEDTEKEGLR
Q2UQK8_ASPOR/14-321...NILKGASIKGHLKCG---TS.KNICGFQYKYPVDGSEETSRAFPIVGLEHLGHGSKDPEITRL...KKLDPDEEGLL
Q8WZV1_NEUCS/29-377..APLKRKGDVKKEEQCG---GD.ARVCRLKHHYSPSDKKSTFETATTLA....GGSSFHYEATKLD..SSSDHKDGGVK
Q54CZ8_DICDI/7-251...........GVATQCK---NDAAAACQMQ..........VGGTSPPTPVGLITMGSWQTVSN...........LPSLQ
ATG27_CANAL/3-247........QPISAIKDCP---AN.SDICGVTSILRKDE...KPVVSEVVSFKSDLQKAYESSDN.............GIK

PF00878

MPRI_HUMAN/1031-1178--------------LACV...PS-PVDCQVT----------DLAG.NEYDLTGLSTVRK..-------------------
MPRI_HUMAN/423-573--------------YACV.KEKE-DLLCGAT----------DGK..KRYDLSALVRHAEPE-------------------
MPRI_BOVIN/1040-1187--------------LACV...PS-PVDCQVT----------DPAG.NEYDLSGLSKARK..-------------------
Q63002_RAT/566-706--------------AACVLSQTE-GENCTVL----------DAQAGFSFDLSLLTKKNG..-------------------
Q90681_CHICK/1011-1157--------------LACA...PA-PVDCQIT----------DAAG.NEYDLSDLSKEGK..-------------------
Q90681_CHICK/1299-1439--------------YACP..PVK-STECSYR----------DDEG.NFYDFSSLTRHRE..-------------------
MPRI_MOUSE/1315-1455--------------YACP..PFN-VTECSVQ----------DAAG.NSIDLSSLSRYSD..-------------------
MPRI_MOUSE/418-567--------------YACI.KEKE-DLLCGAI----------NGK..KRYDLSVLARHSESE-------------------
Q90681_CHICK/412-563--------------YACV.KERE-DLLCRVA----------DKK..KHYDLSPLIRSSESA-------------------
MPRI_BOVIN/432-582--------------YACV.HEKE-ALLCGVS----------DGK..QRFDLSALARHSELE-------------------
MPRI_BOVIN/1331-1471--------------YACP..PYD-LTECSFK----------NEAG.ETYDLSSLSRYSD..-------------------
MPRI_MOUSE/1024-1171--------------LACT...PS-LVDCQVT----------DPAG.NEYDLSALSMVRK..-------------------

PF13015

B6K4H4_SCHJY/349-504FY-----ETVFQ.----------------------------------....DDISLGEFVEQE...........GNILKY
C5M4M3_CANTT/386-532LL-----GSIVQ.----------------------------------....GDVLIGNFKKYE...........DGKIYF
C4R3S3_PICPG/341-510FT-----GSLTQI----------------------------------SSNGQRVSIGTRDKIEVLEDEQSVGGYSYRVYY
GLU2B_SCHPO/346-506FY-----ENVFQ.----------------------------------....DSILLGNFASQE...........GNVLKY
A5DJ02_PICGU/305-448LL-----ASIYQ.----------------------------------....EDIHIGSYKAAE...........GTKLIY

PF07915

Q74ZM0_ASHGO/505-608FNP..DTGRILQV.....---..-......................QDRDRSVVLVGHFKDFKLVSQ.............
Q4WG82_ASPFU/413-482FL.....GETKQI.....---..-......................PKKGGATIRMGKF.....................
OS9_ASPFU/161-256YK.....KQIKQFHALPS---GP-..............GVPNYPPIEDSTTHSFVLGRFPNSG.................
Q09396_CAEEL/122-193RG.....QTIEQVHG...---..-....................EPGQEGYVKNILGLF.....................
Q55BK1_DICDI/419-467PY.....EKASQG.....---..-............................HTSLGKF.....................
OS9_HUMAN/108-181YG.....RHIQQYHM...---..-....................EDSEIKGEVLYLGYY.....................
FSTA_DANRE/33-91.......QVLYMPGM...---..-.....................SREECCRSGRLGTS.....................
A3GGW8_PICST/109-220FG.....DKIIQFHPDME---HF-...............RLTGKHKPTEPDYVYTLGRFKGGPRNEIVKIE.......NE
Q29NJ4_DROPS/101-190HG.....HHVRQYHEE..---..-...................REGKSVKFQEYYLGKWSEEKT................
OS9_DEBHA/130-240YG.....DKVVQFHENLQ---HF-...............VATGKHKPEYPDYIYVLGRFKGSSKKPTNL...........
A5DHY4_PICGU/126-247FG.....DKIIQFHENLQ---RF-...............FKTGQHEPEFPDYVYVLGRFKNEDNSKWRSNSRANEKIKNQ
Q29LB3_DROPS/439-496PF.....DRASQK.....---..-......................PRNGGAETTLGRW.....................
Q0V1F7_PHANO/438-509FL.....SRTTQK.....---..-......................SKKGGGHTGMGNF.....................
Q29NJ4_DROPS/360-434YG.....KHVRQFHK...---..-......................DKNSEIELFLGYF.....................
Q8LDD0_ARATH/527-579AY.....KEATQE.....---..-........................EGYSKTRLGEW.....................
A2GK42_TRIVA/71-135PF.....KILNQFRY...---..-...................EPLKQIPIDNFILGQE.....................
Q16M80_AEDAE/441-496LF.....DKAIQQ.....---..-......................PKNGGAETRLGTW.....................
Q0D1V6_ASPTN/160-264YK.....KQVKQFHALPS---GS-..............GIPNYPPMEDPTTLSFILGKFPNADHDDE.............
A2R1B3_ASPNC/442-511FL.....DQTKQI.....---..-......................PKKGGGSTRMGKY.....................
Q6FHE1_HUMAN/30-88.......QVLYKTEL...---..-.....................SKEECCSTGRLSTS.....................
ERLEC_HUMAN/111-199HG.....KHIRQYHEE..---..-..................KETGQKINIHEYYLGNMLAKN.................
Q6CK66_KLULA/502-608YSND.KGGDIVQI.....---..-.....................ENKPDGNKVVIGRYRGFTIDTN.............
Q5KAG5_CRYNJ/146-266HD.....SYIRQFRAAAN---PH-T............HPTQGYVPQEDPKYEGYTLGRPYPVSKFKGSRVKAKG.GKPGS
Q9VKC7_DROME/99-188HG.....HHVRQYHEE..---..-...................REGKNVKFQEYYLGKWTDEKM................
A7F2Y5_SCLS1/147-250YN.....NEITQFHQLPP---QP-..............GKAPYPPQPDPSAQEFILGKAKKSSKSMS.............
OS9_CANAL/114-193HG.....INVIQFHENLD---D.-...............FISGIHKPHSPNHVYTLGNF.....................
Q3U518_MOUSE/406-464PF.....KLVSQK.....---..-......................PKHGGSPTSLGTW.....................
A4I229_LEIIN/228-294MF.....DKVYQR.....---..-.....................NIGMTTGGSLLGSW.....................
Q4P0B9_USTMA/948-1012FF.....GRATQI.....---..-......................PNNGGAQISLGTF.....................
Q5CSG1_CRYPI/286-401NL.....YVVSQFKK...---..-....................DSSTQELRLFNLGIHPNTAQILNITDDLEEYLSKNL
O65221_ARATH/57-104HQ.....KYVRQLHV...---..-..........................EDENKVGFY.....................
Q5DCH4_SCHJA/372-448FN.....DFVRQYHL...---..-....................DANAKKLQEILLGTWNL...................
Q55ZR6_CRYNB/439-501FF.....GKATQK.....---..-......................SNKDKSSNNLGSF.....................
Q86NV3_DROME/212-268.......GQVFSTDI...---..-.....................SRSECCGSSQSFSY.....................
A4S717_OSTLU/44-97PF.....GEAKQD.....---..-............................NTQLGRN.....................
Q2GN19_CHAGB/165-263YG.....KAVVQYHALPG---T.-...............KATDPPLRDEKDPEYVLGRAQETVVD...............
Q38E25_TRYB2/57-160PG.....RWIRQFHK...---..-.....................DGNVIVDENFLGVQHRWHLADEIGSKRL....RYR
OS9_YARLI/111-190YG.....SGVVQYRRHGD---NY-..............FPRIYPPPQADDSPTFVLGSF.....................
Q2UHS2_ASPOR/160-262YK.....KQIKQFHALPS---GS-..............GIPSYPPMEDPATHSFILGRFPRASDDE..............
A2VDJ4_HUMAN/56-116PF.....HNVTQHEQ...---..-.....................TFRWNAYSGILGIW.....................
Q4RQ71_TETNG/370-475YG.....KYVHQYHEVTS---VS-TTTADVTVARRATPEGDCPLQEKEQGKNIVVIGSWNA...................
A0BVD2_PARTE/98-171FK.....KYIRQFDDLN.---..-.................TMLNMRKQYKEDFSLGIS.....................
A7TM15_VANPO/111-181PG.....KEFIQFHG...---..-....................QSKKDNKWVFTLGIS.....................
Q5DCH4_SCHJA/94-177HN.....QYIKQFHEE..---..-..................RKSGKSSPVQEYYLGHYYP...................
Q08C06_DANRE/70-143YG.....QHIRQYHL...---..-....................EDSEIKGDVLFLGYY.....................
Q6FV48_CANGA/491-608IERDLNGELTGMLTQ...---..-....................RSLNDPMRVVRIGSFTGFNTLNEHESQ........A
A6SHA1_BOTFB/476-547WM.....EKTSQK.....---..-......................SKKGGGNTGMGNF.....................
A5E6Q1_LODEL/91-197FG.....DKVIQFHEDIK---D.-...............FKSGNHRPQLPNHIYVLGKFPNTAPYKKV............
Q170H4_AEDAE/351-420YE.....KHVRQYHE...---..-..........................DTSIFLGYFNK...................
A0CKZ0_PARTE/98-170FR.....KHVRQYDDLD.---..-.................TIQNMQKILKEDFSLGYS.....................
Q4CS72_TRYCC/374-438PL.....KDAHQY.....---..-......................DKGTTHGQCIGRW.....................
Q6PW72_9TELE/24-82.......QMLYLSEM...---..-.....................SREDCCRSERLGMA.....................
A7S009_NEMVE/245-317YG.....KRVIQFHV...---..-....................DQDHGGRTDILLGTWDK...................
A7S009_NEMVE/46-100HG.....KHVRQFHD...---..-........................................................
Q6NVN2_XENTR/340-419YG.....KYVHQYHE...---..-.....................DKDTGKTTVVVGTWKA...................
Q383K9_TRYB2/102-183WG.....SGVEQFHRSAV---AG-..............DSKSNAPKQMKEDPHFVLGVA.....................
Q2UTA8_ASPOR/443-512FL.....DQTKQI.....---..-......................PKKGGSTARMGNF.....................
Q6GLZ2_XENLA/401-459PF.....NRVTQK.....---..-......................PKHGGSETNLGSW.....................
A4S612_OSTLU/68-155YK.....TRVEQFHR...---..-.....................EGTTRVNSYSLGKFDEAAT................
OS9_EMENI/151-245YM.....NQIKQFHALPS---GG-..............GVPNYPPMEDHTTHSFILGRFPQEEGQD..............
Q5RJX3_XENLA/101-191HG.....KYIRQYHEE..---..-..................KEAGQKLNIQEYYLGKTVKKSP................
FSTL3_RAT/34-90.......SLVLKTQV...---..-.....................SREECCASGNINTA.....................
Q9VKC7_DROME/354-428YG.....RHVRQFH....---..-.....................KDKTSEVELFLGYFSE...................
OS9_YEAST/115-193PG.....IEFVQFHGRVN---T.-................KTGEIVNRDESLVYRLGKP.....................
A2R8V3_ASPNC/155-251YK.....NQIKQFHALPS---GS-..............GIPNYPPMEDHTTHSFILGKFPQGDGDED.............
Q57VU0_TRYB2/375-439PF.....KDAHQY.....---..-......................SKGTEIGNSIGKW.....................
GLU2B_YEAST/537-646FQRPMTEGVIYQA.....---..-.....................EDKVDGKKVLIGRFKTSGFNVDL............
A2YFJ9_ORYSI/121-201SY.....GKIRQVHV...---..-.....................EGEKVIQEYVLGEYDA...................
ERLEC_PONAB/342-421YG.....KHVHQYHE...---..-.....................DKDSGKTSVVVGTWNQ...................
OS9_GIBZE/149-241NN.....REIVQFHALPS---I.-...............PNGQPPKRDPHTMEFTLGRVPAV..................
A6XPJ8_AJECN/133-209YM.....DQIRQFHALAP---GN-..............GVPAYPPVEDPAAQSYVLGRF.....................
A4HEV5_LEIBR/388-454MF.....DRIEQC.....---..-.....................DLEKVSYSILLGKW.....................
Q7QG77_ANOGA/348-417FG.....KHVRQYHK...---..-..........................DTSIYLGYFDV...................
Q7S6V9_NEUCR/438-509WF.....DRTTQK.....---..-......................SKKGHGNTNMGNF.....................
A7SJQ2_NEMVE/423-480PF.....DRATQE.....---..-......................PKDGGASTSIGNW.....................
A7TL63_VANPO/122-195SG.....NSINQIHFG..---..-...................DIIKNDEKLNFTLGNT.....................
Q86H64_DICDI/159-253YH.....DKVRQVHV...---..-.....................EKNEVQSEFILGTFIDSPQNGA.............
Q9NF22_CAEEL/350-427YG.....KHVIQFHE...---..-.....................DANGQRSDILLGVFDE...................
Q20CF4_PETMA/30-88.......RELLKMNV...---..-.....................SQQECCRSGRLGSA.....................
OS9_CANGA/106-177GS.....GDFTQYHG...---..-...................VAPDPNDKLTYTLGRS.....................
Q7QG77_ANOGA/95-183HG.....NYIKQYHEE..---..-...................RHEKTSKLQEYFLGRWDKQKT................
Q7PPE5_ANOGA/445-501PF.....DKAIQQ.....---..-......................PRNGGAETRLGTW.....................
OS9_NEUCR/167-265YG.....KSIVQYHAVPN---P.-................KGGPPLRDKNSQEYILGTSLPPSSHS..............
Q16PW6_AEDAE/29-86.......NKLFTRNV...---..-.....................SRENCCNAGTGLGY.....................
A1C3Z3_ASPCL/157-257YK.....KQIKQFHARPF---GP-..............GVPNYPPLEDPATHSFVLGRFPSSSGNGGGA...........
Q6C4G9_YARLI/307-374FG.....QQCHQR.....---..-........................GNNINVSLGHF.....................
Q6NVN2_XENTR/108-198HG.....KYIRQYHEE..---..-..................KETGQKLSIQEYYLGKMMKKST................
Q170H4_AEDAE/98-185HG.....KYIKQYHEE..---..-...................RHEKTSKLQEYYLGKWDKEKT................
Q9VJD1_DROME/434-491PF.....DRASQK.....---..-......................SRSGGPETTLGRW.....................
Q803G0_DANRE/100-193HG.....KHVRQYHED..---..-..................KETGQKMNIQEYYLGNMNKKDGAE..............
A8X7A1_CAEBR/101-181HG.....RYAIQFHED..---..-..................KMLNGQISRTEYYLGNFD....................
A7SE51_NEMVE/70-130PF.....HNVTQREQ...---..-.....................SSRWNAFHGILGVF.....................
A6REP5_AJECN/405-474WM.....EKTKQI.....---..-......................PKKGGSTTTMGTF.....................
Q00XK8_OSTTA/90-173YK.....DRASQFHR...---..-.....................EGTTRVSSFSLGRFDRA..................
Q5DA66_SCHJA/303-366PF.....KSVHQK.....---..-...................LLGSSKSDPGTSIGIW.....................
Q4RHD7_TETNG/423-488PF.....NRVSQK.....---..-......................PKYGGSETSLGTW.....................
A8X7A1_CAEBR/339-416YG.....KHVIQYHE...---..-.....................DANGQRSEILLGSFDA...................
A7SG72_NEMVE/77-152FG.....KTISQYHE...---..-....................EGNSLKGDRISLGLY.....................
Q5B183_EMENI/1069-1138FL.....DQTKQI.....---..-......................PKKGGSSSRMGRF.....................
A1CD98_ASPCL/492-561FW.....DQTKQI.....---..-......................PKKGGASVRMGQF.....................
Q4RQ71_TETNG/131-225HG.....KHVRQYHEE..---..-..................KETGQKVSVQEYFLGNVAQ...................
Q0UVU1_PHANO/148-261YK.....KEVKQFHQLPP---SR-..............GVSLYPPVEDTSVHSFVLGRYQKEKETKKDARKT......LG
GLU2B_SCHPO/385-431FY.....ENVFQD.....---..-............................SILLGNF.....................
Q4DFG0_TRYCC/99-181WN.....DAIVQVHLPTV---IL-S.............DGVLLTTEPQGPQTQFLLGTS.....................

PF02157

MPRD_BOVIN/2-279LIYKGGDEYD--NHCGREQRRAVVMISC----NRHTLADNFNPVSEER--------------------------------
MPRD_MOUSE/1-278LIYKGGDEYD--NHCGKEQRRAVVMISC----NRHTLAANFNPVSEER--------------------------------

PF09451

Q4WRS6_ASPFU/14-328VKLAGGE..YIDKDKKKKDARAVIEFQC....DPDRSGLEGLSSVEEEEEEEETRRRLVVREDEGDKN..KEKDKEKTDP
ATG27_DEBHA/7-277IVYKG.......ANWGDNLVDAELRFVCASSSDKDKDLDKFQL.....................................
ATG27_CANGA/6-271IRFLG.......VKWGSNTIDATLSYSC....DTNLKTDELVT.....................................
ATG27_YEAST/7-266LTLKG.......ATWGANSFDAKLEFQC....NDNMKQDELTS.....................................
ATG27_KLULA/6-280IRLSG.......AAWGSHILNADIYLQC....QEKGSGSLTES.....................................
ATG27_ASHGO/7-259VSFTG........KWGERERKVKVRYTC....ADDKAEDEVSAE....................................
Q55NF4_CRYNB/4-269ISVKG.......QEYAGVPQHLQLTLLC....DTSSDSPNPTL.....................................
Q4P961_USTMA/31-324LQFPG.......ATYAEREQKAELELVC....DAKADADEQPSV....................................
ATG27_YARLI/3-271TSYGN........PWGSEKLDIDVNYIC....SDKEEGPKLEN.....................................
Q5BF19_EMENI/12-291VKLSGGGEYPEPGSKKKKKAGAVIEFEC....DPGRSGLEGLVKEDTKRLLRAREEGLDEGEGDGEGD...GNGEDKEPF
Q2UQK8_ASPOR/14-321VKLSGGN..YVDDEGKQKDAGAVLEFQC....DPERSGLEGLKTTDESDGEKKEAERRRAEGGD..........DKEQPP
Q8WZV1_NEUCS/29-377LTFSG.......YKHQGRQQKVVINFVC....NKTLTGTEGEVESSEDIQYEKPKLLLATRDDNDKKKEEEGDDGYPETQ
Q54CZ8_DICDI/7-251YTTSS.......KCSSGNMRTMVVSLQC....SQNANSIQATL.....................................
ATG27_CANAL/3-247VIYKG.......ANWGDVLVNAELNFQC....DKDSQNNEFTL.....................................

PF00878

MPRI_HUMAN/1031-1178------------.PWTAV--------------DTSVD.GRKRT-------------------------------------
MPRI_HUMAN/423-573------------QNWEAV--------------DGSQTETEKKH-------------------------------------
MPRI_BOVIN/1040-1187------------.PWTAV--------------DTFDE.GKKRT-------------------------------------
Q63002_RAT/566-706------------.AYKVE--------------TDKYD......-------------------------------------
Q90681_CHICK/1011-1157------------.PWVAI--------------DTSKD.AKKRT-------------------------------------
Q90681_CHICK/1299-1439------------.NWEAT--------------DISTS...TKI-------------------------------------
MPRI_MOUSE/1315-1455------------.NWEAV--------------TRTGA...TEH-------------------------------------
MPRI_MOUSE/418-567------------QNWEAV--------------DGSQAESEK.Y-------------------------------------
Q90681_CHICK/412-563------------QNWEAV--------------DSNLSEEWRKR-------------------------------------
MPRI_BOVIN/432-582------------QNWEAV--------------DGSQREAEKKH-------------------------------------
MPRI_BOVIN/1331-1471------------.NWEAV--------------TGTGS...TEH-------------------------------------
MPRI_MOUSE/1024-1171------------.PWTAV--------------DTSAY.GKRRH-------------------------------------

PF13015

B6K4H4_SCHJY/349-504ANGQKCWNGPPRSAQVKVECG-----------------------------------------------------------
C5M4M3_CANTT/386-532DRGAKCWNGPHRSAIVEFECG-----------------------------------------------------------
C4R3S3_PICPG/341-510EKGAKCWNGPVRKAIAVVQCG-----------------------------------------------------------
GLU2B_SCHPO/346-506ENGQSCWNGPHRSAIVTVECG-----------------------------------------------------------
A5DJ02_PICGU/305-448KDGSKCWNGPRRSAIVELVCG-----------------------------------------------------------

PF07915

Q74ZM0_ASHGO/505-608...RARDAYINQLQTRATDVD.......----------------------------------------------------
Q4WG82_ASPFU/413-482..............GRIGSVI.......----------------------------------------------------
OS9_ASPFU/161-256......DDEDLEGDAEHKKTT.......----------------------------------------------------
Q09396_CAEEL/122-193.................DGSL.......----------------------------------------------------
Q55BK1_DICDI/419-467............ESFGDNGKM.......----------------------------------------------------
OS9_HUMAN/108-181..............QSAFDWD.......----------------------------------------------------
FSTA_DANRE/33-91..............WTEEDVP.......----------------------------------------------------
A3GGW8_PICST/109-220AQKHNNQLDPGDFSIHDDLST.......----------------------------------------------------
Q29NJ4_DROPS/101-190.....ELLSRAWESEQKDGGK.......----------------------------------------------------
OS9_DEBHA/130-240DNQSPWASNNLDLSEFTIHES.......----------------------------------------------------
A5DHY4_PICGU/126-247SLWKGNNLDVSEFTIIDSDVS.......----------------------------------------------------
Q29LB3_DROPS/439-496............................----------------------------------------------------
Q0V1F7_PHANO/438-509............VSITSVTVD.......----------------------------------------------------
Q29NJ4_DROPS/360-434................SEESH.......----------------------------------------------------
Q8LDD0_ARATH/527-579............DKFENS..........----------------------------------------------------
A2GK42_TRIVA/71-135............................----------------------------------------------------
Q16M80_AEDAE/441-496............EKWASS..........----------------------------------------------------
Q0D1V6_ASPTN/160-264..DDAEPERRKSSSTSSSSSS.......----------------------------------------------------
A2R1B3_ASPNC/442-511............TGIGSVSVD.......----------------------------------------------------
Q6FHE1_HUMAN/30-88............................----------------------------------------------------
ERLEC_HUMAN/111-199......LLFEKEREAEEKEKS.......----------------------------------------------------
Q6CK66_KLULA/502-608...SKYDVYLQSLKYRYPNTE.......----------------------------------------------------
Q5KAG5_CRYNJ/146-266PAKAEDRSTAVETTANAPHTQ.......----------------------------------------------------
Q9VKC7_DROME/99-188.....EILTKAWQADIKAGVK.......----------------------------------------------------
A7F2Y5_SCLS1/147-250...KEDEWGNQIEAHTTTKKG.......----------------------------------------------------
OS9_CANAL/114-193...................SK.......----------------------------------------------------
Q3U518_MOUSE/406-464............GSWAGPDHD.......----------------------------------------------------
A4I229_LEIIN/228-294............KSFAENTYS.......----------------------------------------------------
Q4P0B9_USTMA/948-1012............TNFNPKHDK.......----------------------------------------------------
Q5CSG1_CRYPI/286-401ISNIVNTIKPGRVSLLENITT.......----------------------------------------------------
O65221_ARATH/57-104............................----------------------------------------------------
Q5DCH4_SCHJA/372-448.........DEHLKWLAENAK.......----------------------------------------------------
Q55ZR6_CRYNB/439-501............NQWNTAAEQ.......----------------------------------------------------
Q86NV3_DROME/212-268............................----------------------------------------------------
A4S717_OSTLU/44-97............SEGVRIDAD.......----------------------------------------------------
Q2GN19_CHAGB/165-263....TKAVADQSQPDSPTKNV.......----------------------------------------------------
Q38E25_TRYB2/57-160DGIHTIPERLNASGAPINNTE.......----------------------------------------------------
OS9_YARLI/111-190...................EK.......----------------------------------------------------
Q2UHS2_ASPOR/160-262...EDGEAERKKTAETTTTAT.......----------------------------------------------------
A2VDJ4_HUMAN/56-116............................----------------------------------------------------
Q4RQ71_TETNG/370-475.........NEHFEWAQKNVA.......----------------------------------------------------
A0BVD2_PARTE/98-171...................KS.......----------------------------------------------------
A7TM15_VANPO/111-181.................ASDI.......----------------------------------------------------
Q5DCH4_SCHJA/94-177.........SSKTERDRSTKD.......----------------------------------------------------
Q08C06_DANRE/70-143..............DTEFDWT.......----------------------------------------------------
Q6FV48_CANGA/491-608KHQSHLSAKYPDLDVRHLRNE.......----------------------------------------------------
A6SHA1_BOTFB/476-547............VRFDKIEVD.......----------------------------------------------------
A5E6Q1_LODEL/91-197.RPKNQLGITKAVEVDPDDFT.......----------------------------------------------------
Q170H4_AEDAE/351-420.........EKHLEWLEKNPS.......----------------------------------------------------
A0CKZ0_PARTE/98-170....................N.......----------------------------------------------------
Q4CS72_TRYCC/374-438............GRFGDNTYS.......----------------------------------------------------
Q6PW72_9TELE/24-82............................----------------------------------------------------
A7S009_NEMVE/245-317.........QKHVEWVAKRSS.......----------------------------------------------------
A7S009_NEMVE/46-100..................ERS.......----------------------------------------------------
Q6NVN2_XENTR/340-419.........DEHQEWAKKNLA.......----------------------------------------------------
Q383K9_TRYB2/102-183.................PPAD.......----------------------------------------------------
Q2UTA8_ASPOR/443-512............VRIGSVTID.......----------------------------------------------------
Q6GLZ2_XENLA/401-459............GSWAGPEDN.......----------------------------------------------------
A4S612_OSTLU/68-155.....MELGSERAATMGDGAE.......----------------------------------------------------
OS9_EMENI/151-245...EGKGAKSGK........S.......----------------------------------------------------
Q5RJX3_XENLA/101-191.....SEAGENQEDKERTEGH.......----------------------------------------------------
FSTL3_RAT/34-90............................----------------------------------------------------
Q9VKC7_DROME/354-428.........EAHRAWSNANPD.......----------------------------------------------------
OS9_YEAST/115-193.................KANV.......----------------------------------------------------
A2R8V3_ASPNC/155-251..EVEGAADQKK........P.......----------------------------------------------------
Q57VU0_TRYB2/375-439............VRFGESTYS.......----------------------------------------------------
GLU2B_YEAST/537-646..NMEKYAEHLKATYDEKSDL.......----------------------------------------------------
A2YFJ9_ORYSI/121-201........DATDAYYENQTSD.......----------------------------------------------------
ERLEC_PONAB/342-421.........EEHIEWAKKNTA.......----------------------------------------------------
OS9_GIBZE/149-241.......PASAAHQAKMNGQE.......----------------------------------------------------
A6XPJ8_AJECN/133-209............................----------------------------------------------------
A4HEV5_LEIBR/388-454............NSFAESTYS.......----------------------------------------------------
Q7QG77_ANOGA/348-417.........EKHREWLEKTPS.......----------------------------------------------------
Q7S6V9_NEUCR/438-509............ERITTEIAD.......----------------------------------------------------
A7SJQ2_NEMVE/423-480............GEWNGSPY........----------------------------------------------------
A7TL63_VANPO/122-195................NEEFE.......----------------------------------------------------
Q86H64_DICDI/159-253..IKGIDQTILEKYMKKEITE.......----------------------------------------------------
Q9NF22_CAEEL/350-427.........VVHKEWVKLDRH.......----------------------------------------------------
Q20CF4_PETMA/30-88............................----------------------------------------------------
OS9_CANGA/106-177.................SKQI.......----------------------------------------------------
Q7QG77_ANOGA/95-183......EALKARYAQADADKE.......----------------------------------------------------
Q7PPE5_ANOGA/445-501............DRWNGPG.........----------------------------------------------------
OS9_NEUCR/167-265....QKGKQIEVPNNEQKQLS.......----------------------------------------------------
Q16PW6_AEDAE/29-86............................----------------------------------------------------
A1C3Z3_ASPCL/157-257.EDVEGVAEHKK.......AS.......----------------------------------------------------
Q6C4G9_YARLI/307-374............NSIEELPRS.......----------------------------------------------------
Q6NVN2_XENTR/108-198.....TEAGENQEEKESTESP.......----------------------------------------------------
Q170H4_AEDAE/98-185......VTLKAFYENSDAEG........----------------------------------------------------
Q9VJD1_DROME/434-491............DKWSGEPK........----------------------------------------------------
Q803G0_DANRE/100-193....SETEKSSDSEAESPNTN.......----------------------------------------------------
A8X7A1_CAEBR/101-181...........ASLTASTNEN.......----------------------------------------------------
A7SE51_NEMVE/70-130............................----------------------------------------------------
A6REP5_AJECN/405-474............SAFTTITAD.......----------------------------------------------------
Q00XK8_OSTTA/90-173.......ATERLESERNATGD.......----------------------------------------------------
Q5DA66_SCHJA/303-366............SRWLESDEN.......----------------------------------------------------
Q4RHD7_TETNG/423-488............GKWAGPADN.......----------------------------------------------------
A8X7A1_CAEBR/339-416.........VIHKEWVKLDSK.......----------------------------------------------------
A7SG72_NEMVE/77-152............SSQTDWSKE.......----------------------------------------------------
Q5B183_EMENI/1069-1138............ERIGSVSVD.......----------------------------------------------------
A1CD98_ASPCL/492-561............VRIGSVTVD.......----------------------------------------------------
Q4RQ71_TETNG/131-225.........RSQSAETGSKVSWIPSFAY----------------------------------------------------
Q0UVU1_PHANO/148-261SEQGSKETFDDEGNVKDESES.......----------------------------------------------------
GLU2B_SCHPO/385-431............ASQEGNV.........----------------------------------------------------
Q4DFG0_TRYCC/99-181.................PSKD.......----------------------------------------------------

PF02157

MPRD_BOVIN/2-279-----------------GKVQDCFYLFEMDSSLAC--------------------------------SPEISHLSVGS--
MPRD_MOUSE/1-278-----------------GKVQDCFYLFEMDSSLAC--------------------------------SPEVSHLSVGS--

PF09451

Q4WRS6_ASPFU/14-328NDGSDPSRSLQFESFGPADDDAYVLKLKWRTRYAC................................DNYVRDRKGDG..
ATG27_DEBHA/7-277.................HQWDDKRLKVSVKTKAACIT............DKKDKKKPDN......KKDNKKGNDKDDN..
ATG27_CANGA/6-271.................TIWNSEYVLIEMSGPSGCKRDG.......NSDSGDNGNGNGN......GNDPDNNNNTGKDK.
ATG27_YEAST/7-266.................HTWADKSIQLTLKGPSGCLK............SKDDDKKNGD......GDNGKDGDSEGKKPA
ATG27_KLULA/6-280.................SWTDDQNVKLVFSGPFGCLKKGNDNKDGNGDDDNNDKDGDDS......DKKPHDGDKNGSKPK
ATG27_ASHGO/7-259...............GAFGAHTTPVEVALRGPSGCIQAT.......EKS...............................
Q55NF4_CRYNB/4-269.................VSYTAGLLSLEWATPDAC.....................PRS......GDSSSPSGSSGGG..
Q4P961_USTMA/31-324...............RSYDRAQGKLKLRWATKFACSSA..........ATKPGSGSPSK......GGSDSDGDKGSDSDG
ATG27_YARLI/3-271................VGLGLNNYYEINWKTPAACIND..........GSKPKQPVKEP......GKTPNDGDDASNG..
Q5BF19_EMENI/12-291YDGSDPDRSLQYKSFGKADDET..........................................................
Q2UQK8_ASPOR/14-321DEEKDRSHSLQFKSFGKADDDSYVLKLNWRTKYAC................................DHYLEEKKGDS..
Q8WZV1_NEUCS/29-377LLKNETATALLWNGYKRVGDDVDQLELTWNTKFACLDASGGDKDKPKDGDDKDKPKDGDKDKPKDGDNKDGGGNKGGNGE
Q54CZ8_DICDI/7-251.................VNENKCIYSTVMSGKDLC..................SGGSGS......GDNNNSGSNGGDQP.
ATG27_CANAL/3-247.................DQWDGTNLKLSMKTKAACIT............SKEDKKK.................EKHDN..

PF00878

MPRI_HUMAN/1031-1178-----------------FYLSVCN...PLPYIPGC-----------------------------------QGSAVGSCLV
MPRI_HUMAN/423-573-----------------FFINICHRVLQEGKARGC-----------------------------------P.EDAAVCAV
MPRI_BOVIN/1040-1187-----------------FYLSVCT...PLPYIPGC-----------------------------------HGTAVGCCLV
Q63002_RAT/566-706-----------------FYINVCG....PVSVNLC-----------------------------------Q.SNSGACQV
Q90681_CHICK/1011-1157-----------------FFLNVCK...PLPFVPGC-----------------------------------PGGAIGSCVK
Q90681_CHICK/1299-1439-----------------YYINVCKPLVPYGAAHSC-----------------------------------P.PDAAASLV
MPRI_MOUSE/1315-1455-----------------YLINVCKSLSPHAGTEPC-----------------------------------P.PEAAVCLL
MPRI_MOUSE/418-567-----------------FFINVCHRVLQEGKARNC-----------------------------------P.EDAAVCAV
Q90681_CHICK/412-563-----------------YYINVCHKVLKRGGASGC-----------------------------------P.DAAAICSV
MPRI_BOVIN/432-582-----------------FFINICHRVLQTGQARGC-----------------------------------P.EDAAVCAV
MPRI_BOVIN/1331-1471-----------------YLINVCKSLSPQAGSDPC-----------------------------------P.PEAAVCLL
MPRI_MOUSE/1024-1171-----------------FYLSVCN...PLPYIPGC-----------------------------------HGIALGSCMV

PF13015

B6K4H4_SCHJY/349-504--------------------------------------------------------------------------------
C5M4M3_CANTT/386-532--------------------------------------------------------------------------------
C4R3S3_PICPG/341-510--------------------------------------------------------------------------------
GLU2B_SCHPO/346-506--------------------------------------------------------------------------------
A5DJ02_PICGU/305-448--------------------------------------------------------------------------------

PF07915

Q74ZM0_ASHGO/505-608--------------------------------------------------------------------------------
Q4WG82_ASPFU/413-482--------------------------------------------------------------------------------
OS9_ASPFU/161-256--------------------------------------------------------------------------------
Q09396_CAEEL/122-193--------------------------------------------------------------------------------
Q55BK1_DICDI/419-467--------------------------------------------------------------------------------
OS9_HUMAN/108-181--------------------------------------------------------------------------------
FSTA_DANRE/33-91--------------------------------------------------------------------------------
A3GGW8_PICST/109-220--------------------------------------------------------------------------------
Q29NJ4_DROPS/101-190--------------------------------------------------------------------------------
OS9_DEBHA/130-240--------------------------------------------------------------------------------
A5DHY4_PICGU/126-247--------------------------------------------------------------------------------
Q29LB3_DROPS/439-496--------------------------------------------------------------------------------
Q0V1F7_PHANO/438-509--------------------------------------------------------------------------------
Q29NJ4_DROPS/360-434--------------------------------------------------------------------------------
Q8LDD0_ARATH/527-579--------------------------------------------------------------------------------
A2GK42_TRIVA/71-135--------------------------------------------------------------------------------
Q16M80_AEDAE/441-496--------------------------------------------------------------------------------
Q0D1V6_ASPTN/160-264--------------------------------------------------------------------------------
A2R1B3_ASPNC/442-511--------------------------------------------------------------------------------
Q6FHE1_HUMAN/30-88--------------------------------------------------------------------------------
ERLEC_HUMAN/111-199--------------------------------------------------------------------------------
Q6CK66_KLULA/502-608--------------------------------------------------------------------------------
Q5KAG5_CRYNJ/146-266--------------------------------------------------------------------------------
Q9VKC7_DROME/99-188--------------------------------------------------------------------------------
A7F2Y5_SCLS1/147-250--------------------------------------------------------------------------------
OS9_CANAL/114-193--------------------------------------------------------------------------------
Q3U518_MOUSE/406-464--------------------------------------------------------------------------------
A4I229_LEIIN/228-294--------------------------------------------------------------------------------
Q4P0B9_USTMA/948-1012--------------------------------------------------------------------------------
Q5CSG1_CRYPI/286-401--------------------------------------------------------------------------------
O65221_ARATH/57-104--------------------------------------------------------------------------------
Q5DCH4_SCHJA/372-448--------------------------------------------------------------------------------
Q55ZR6_CRYNB/439-501--------------------------------------------------------------------------------
Q86NV3_DROME/212-268--------------------------------------------------------------------------------
A4S717_OSTLU/44-97--------------------------------------------------------------------------------
Q2GN19_CHAGB/165-263--------------------------------------------------------------------------------
Q38E25_TRYB2/57-160--------------------------------------------------------------------------------
OS9_YARLI/111-190--------------------------------------------------------------------------------
Q2UHS2_ASPOR/160-262--------------------------------------------------------------------------------
A2VDJ4_HUMAN/56-116--------------------------------------------------------------------------------
Q4RQ71_TETNG/370-475--------------------------------------------------------------------------------
A0BVD2_PARTE/98-171--------------------------------------------------------------------------------
A7TM15_VANPO/111-181--------------------------------------------------------------------------------
Q5DCH4_SCHJA/94-177--------------------------------------------------------------------------------
Q08C06_DANRE/70-143--------------------------------------------------------------------------------
Q6FV48_CANGA/491-608--------------------------------------------------------------------------------
A6SHA1_BOTFB/476-547--------------------------------------------------------------------------------
A5E6Q1_LODEL/91-197--------------------------------------------------------------------------------
Q170H4_AEDAE/351-420--------------------------------------------------------------------------------
A0CKZ0_PARTE/98-170--------------------------------------------------------------------------------
Q4CS72_TRYCC/374-438--------------------------------------------------------------------------------
Q6PW72_9TELE/24-82--------------------------------------------------------------------------------
A7S009_NEMVE/245-317--------------------------------------------------------------------------------
A7S009_NEMVE/46-100--------------------------------------------------------------------------------
Q6NVN2_XENTR/340-419--------------------------------------------------------------------------------
Q383K9_TRYB2/102-183--------------------------------------------------------------------------------
Q2UTA8_ASPOR/443-512--------------------------------------------------------------------------------
Q6GLZ2_XENLA/401-459--------------------------------------------------------------------------------
A4S612_OSTLU/68-155--------------------------------------------------------------------------------
OS9_EMENI/151-245--------------------------------------------------------------------------------
Q5RJX3_XENLA/101-191--------------------------------------------------------------------------------
FSTL3_RAT/34-90--------------------------------------------------------------------------------
Q9VKC7_DROME/354-428--------------------------------------------------------------------------------
OS9_YEAST/115-193--------------------------------------------------------------------------------
A2R8V3_ASPNC/155-251--------------------------------------------------------------------------------
Q57VU0_TRYB2/375-439--------------------------------------------------------------------------------
GLU2B_YEAST/537-646--------------------------------------------------------------------------------
A2YFJ9_ORYSI/121-201--------------------------------------------------------------------------------
ERLEC_PONAB/342-421--------------------------------------------------------------------------------
OS9_GIBZE/149-241--------------------------------------------------------------------------------
A6XPJ8_AJECN/133-209--------------------------------------------------------------------------------
A4HEV5_LEIBR/388-454--------------------------------------------------------------------------------
Q7QG77_ANOGA/348-417--------------------------------------------------------------------------------
Q7S6V9_NEUCR/438-509--------------------------------------------------------------------------------
A7SJQ2_NEMVE/423-480--------------------------------------------------------------------------------
A7TL63_VANPO/122-195--------------------------------------------------------------------------------
Q86H64_DICDI/159-253--------------------------------------------------------------------------------
Q9NF22_CAEEL/350-427--------------------------------------------------------------------------------
Q20CF4_PETMA/30-88--------------------------------------------------------------------------------
OS9_CANGA/106-177--------------------------------------------------------------------------------
Q7QG77_ANOGA/95-183--------------------------------------------------------------------------------
Q7PPE5_ANOGA/445-501--------------------------------------------------------------------------------
OS9_NEUCR/167-265--------------------------------------------------------------------------------
Q16PW6_AEDAE/29-86--------------------------------------------------------------------------------
A1C3Z3_ASPCL/157-257--------------------------------------------------------------------------------
Q6C4G9_YARLI/307-374--------------------------------------------------------------------------------
Q6NVN2_XENTR/108-198--------------------------------------------------------------------------------
Q170H4_AEDAE/98-185--------------------------------------------------------------------------------
Q9VJD1_DROME/434-491--------------------------------------------------------------------------------
Q803G0_DANRE/100-193--------------------------------------------------------------------------------
A8X7A1_CAEBR/101-181--------------------------------------------------------------------------------
A7SE51_NEMVE/70-130--------------------------------------------------------------------------------
A6REP5_AJECN/405-474--------------------------------------------------------------------------------
Q00XK8_OSTTA/90-173--------------------------------------------------------------------------------
Q5DA66_SCHJA/303-366--------------------------------------------------------------------------------
Q4RHD7_TETNG/423-488--------------------------------------------------------------------------------
A8X7A1_CAEBR/339-416--------------------------------------------------------------------------------
A7SG72_NEMVE/77-152--------------------------------------------------------------------------------
Q5B183_EMENI/1069-1138--------------------------------------------------------------------------------
A1CD98_ASPCL/492-561--------------------------------------------------------------------------------
Q4RQ71_TETNG/131-225--------------------------------------------------------------------------------
Q0UVU1_PHANO/148-261--------------------------------------------------------------------------------
GLU2B_SCHPO/385-431--------------------------------------------------------------------------------
Q4DFG0_TRYCC/99-181--------------------------------------------------------------------------------

PF02157

MPRD_BOVIN/2-279------------ILLVTLASLVAVYIIGGFLYQRLVVGAKGM-----EQFPHL-AFWQDLGNLVAD-GC--DFVCRSKPR
MPRD_MOUSE/1-278------------ILLVIFASLVAVYIIGGFLYQRLVVGAKGM-----EQFPHL-AFWQDLGNLVAD-GC--DFVCRSKPR

PF09451

Q4WRS6_ASPFU/14-328...SSHWGFFTWLIIILFLCV.AAYLIFGSWLNYNRYGARGW.....DLLPHG.DTLRDIPYIFQD-WL--RR.......
ATG27_DEBHA/7-277...GESWGWFTWIFIFLVLFL.SIYIVGGAWFQYSKGNAIDFQSALREVLENFVSLLKGLPSFVRE-II--EK.......
ATG27_CANGA/6-271..KSKKTSWFTWLFVYAILFT.VIYLMVVSYLNTKGGSFQDFR...NEFVERGTEFITSLPTFVKE-VV--TK.......
ATG27_YEAST/7-266.KKAGGTSWFTWLFLYALLFT.LIYLMVVSFLNTRGGSFQDFR...AEFIQRSTQFLTSLPEFCKE-VV--SR.......
ATG27_KLULA/6-280.GGAGLGSWLVWLFMYATIFA.LIYLVVTSYMNTRNGSFNDFR...EEFVDRSTTFATNLPQFAKE-VA--GK.......
ATG27_ASHGO/7-259...SGIGGWITWLVIYAVLLT.LIYLLAKSYMSVGHGSMQDFR...EEFVERSTNLVSSLPEFAKE-VM--GKGRCGGPP
Q55NF4_CRYNB/4-269...GGFFSFVKTLFWLIIIGL.ILYFAIGIFYNHQQYSARGW.....DLIPHR.DFWREVPTLGQD-LI--SH.......
Q4P961_USTMA/31-324ASASGGWGFFHWLFFLLFVGF.VAYMGVGMYNNYNNYGASGW.....DLVPHK.DFWRESPYIARD-AA--TH.......
ATG27_YARLI/3-271...NPSWGWFTWLFIIIVLGV.AVYIIGNAWINYDRYGNAGV.....DLLPHA.DSLRDVPYLIRD-LI--AK.......
Q5BF19_EMENI/12-291................FFLCA.AAYLIFGSWLNYNRYGARGW.....DLLPHG.DTLRDIPYLFQD-WL--RR.......
Q2UQK8_ASPOR/14-321...SSHWGFFTWLIIILFLCI.AAYLIFGSWLNYNRYGARGW.....DLLPHG.DTIRDIPYIFQD-WL--RR.......
Q8WZV1_NEUCS/29-377EDINKSWGFFTWLVVLLFLGI.AAYLIFGSWLNYNRYGARGW.....DLLPHG.DTIRDIPYLLKD-WT--RR.......
Q54CZ8_DICDI/7-251.KKGGIGG..GWIFIIILLSVTVVYIVGGIIFNAKVKHQHGS.....DMFPNK.EMWVNFGGLIKD-GV--FF.......
ATG27_CANAL/3-247...GESWGWFTWIFIFLVLFL.SIYIIGGAWFQYNKGNAIDFQSALKEVVENFIELLKGLPSFGKE-II--EK.......

PF00878

MPRI_HUMAN/1031-1178SE.GNSWN-------------------LGVVQMSPQAAANGS---------------LSIMYVNGD-KC--G--------
MPRI_HUMAN/423-573DK.NGSKN-------------------LGKFISSPMKE.KGN---------------IQLSYSDGD-DC--G--------
MPRI_BOVIN/1040-1187TE.DSKLN-------------------LGVVQISPQVGANGS---------------LSLVYVNGD-KC--K--------
Q63002_RAT/566-706AKSGKSWN-------------------LGLSNTKLTYY.DGM---------------IQLSYRNGT-LY--N--------
Q90681_CHICK/1011-1157YA.DKSKN-------------------LGVIQINPQAATDGS---------------LSIIYLNGD-MC--K--------
Q90681_CHICK/1299-1439EG.IKCVS-------------------LGEVAEGPRWE.NGI---------------STLKYINGE-LC--P--------
MPRI_MOUSE/1315-1455NG.SKPVN-------------------LGKVRDGPQWT.DGV---------------TVLQYVDGD-LC--P--------
MPRI_MOUSE/418-567DK.NGSKN-------------------LGKFVSSPTKE.KGH---------------IQLSYTDGD-DC--G--------
Q90681_CHICK/412-563DKKNNSKN-------------------LGTFVSPPKKV.GEN---------------IQLTYSNGG-SC--G--------
MPRI_BOVIN/432-582DK.NGSKN-------------------LGRFISSPTRE.KGN---------------IQLSYSDGD-EC--G--------
MPRI_BOVIN/1331-1471GG.PKPVN-------------------LGRVRDSPQWS.QGL---------------TLLKYVDGD-LC--P--------
MPRI_MOUSE/1024-1171SE.DNSFN-------------------LGVVQISPQATGNGS---------------LSILYVNGD-RC--G--------

PF13015

B6K4H4_SCHJY/349-504-----------------------------KSNEIISVLEAQKCE-------------YLIQMLSPA-AC...STTLYRKS
C5M4M3_CANTT/386-532-----------------------------DALDLISVSEPEKCQ-------------YNFLVKGEA-WC.........KP
C4R3S3_PICPG/341-510-----------------------------DVEQLVSVSEPEKCE-------------YHLVVRSPV-GCFSEDNVYLVKE
GLU2B_SCHPO/346-506-----------------------------VENEIVSVLEAQKCE-------------YLIKMKSPA-AC...SPDQLKQS
A5DJ02_PICGU/305-448-----------------------------PQNRLLSVAEPEKCA-------------YTFEVMTPV-VC.........DS

PF07915

Q74ZM0_ASHGO/505-608-------------------------....LIGHLSNYSPGAGHDLLLGNL.PDIHNGLLLSYGNGH.KC-----------
Q4WG82_ASPFU/413-482-------------------------....IDNVNETGVIVPEER.............VSLEYTNGQ.TC-----------
OS9_ASPFU/161-256-------------------------.....TDVAELQTKGGSRY.............LVQRLGGGT.KC-----------
Q09396_CAEEL/122-193-------------------------....KMPSYQESTDDRLLF.............VEETYTSGT.FC-----------
Q55BK1_DICDI/419-467-------------------------..................................MLFENGQ.QC-----------
OS9_HUMAN/108-181-------------------------....DETAKASKQHRLKRY.............HSQTYGNGS.KC-----------
FSTA_DANRE/33-91-------------------------..............NSTLF.............RWMIFNGGAPNC-----------
A3GGW8_PICST/109-220-------------------------....PFSNSLEPKKKSPLV.............ISHVISDGE.IC-----------
Q29NJ4_DROPS/101-190-------------------------....HKYKTIKIDNTRYPY.............FEMEFSDGT.MC-----------
OS9_DEBHA/130-240-------------------------....SIISDATAKNEQSRF.............LQHTLYDGE.IC-----------
A5DHY4_PICGU/126-247-------------------------....PFTNGHLSESRSQRY.............IQHTLKMGG.IC-----------
Q29LB3_DROPS/439-496-------------------------.........EQWIGEGYKY.............SKQKYGNGA.AC-----------
Q0V1F7_PHANO/438-509-------------------------....EELPADGKGLGSGER.............IALKYENGQ.HC-----------
Q29NJ4_DROPS/360-434-------------------------....RQWAIANPDKGARRTGF........SSSIWHHYVKGT.HC-----------
Q8LDD0_ARATH/527-579-------------------------..................Y.............QFMSYTNGE.KC-----------
A2GK42_TRIVA/71-135-------------------------........DDSKPKSIYNG.............ISYDWNNGD.KC-----------
Q16M80_AEDAE/441-496-------------------------.................DY.............TVMRYGNGA.TC-----------
Q0D1V6_ASPTN/160-264-------------------------....TTDVAELQTKGGSRY.............LVQHLRGGT.RC-----------
A2R1B3_ASPNC/442-511-------------------------......VLNEAGEIVPEDR.............VTLQYANGQ.GC-----------
Q6FHE1_HUMAN/30-88-------------------------.....WTEEDVNDN..TLF.............KWMIFNGGAPNC-----------
ERLEC_HUMAN/111-199-------------------------....NEIPTKNIEGQMTPY.............YPVGMGNGT.PC-----------
Q6CK66_KLULA/502-608-------------------------....VGNHLSSDTVEIGKEEILLGNLPDLNNGLILEYRGGT.KC-----------
Q5KAG5_CRYNJ/146-266-------------------------....SSPSVSFGLGASSRY.............LVQRWSDGT.RC-----------
Q9VKC7_DROME/99-188-------------------------....PKYKSLKIDNTRYPY.............FEMEYSDGT.MC-----------
A7F2Y5_SCLS1/147-250-------------------------....DSPKTELQVKGDTRY.............LVQKMEGGT.IC-----------
OS9_CANAL/114-193-------------------------....QTSPLEFEFDTKERT.............ISQRLL.GE.VC-----------
Q3U518_MOUSE/406-464-------------------------.................KF.............SAMKYEQGT.GC-----------
A4I229_LEIIN/228-294-------------------------....VWAKDAH......DL.............SQMIYDNGL.RC-----------
Q4P0B9_USTMA/948-1012-------------------------....SADEDA.......YW.............LQQIYARGQ.KC-----------
Q5CSG1_CRYPI/286-401-------------------------....KIEPRNINELISGKYVHS.......KYVITVMLLNGT.YC-----------
O65221_ARATH/57-104-------------------------.................WY.............HSHVYTNGT.TC-----------
Q5DCH4_SCHJA/372-448-------------------------....DQKSSTGPDRQ.................ISLYYGHGD.YC-----------
Q55ZR6_CRYNB/439-501-------------------------....GSFG.........YY.............SQQLYKNGA.KC-----------
Q86NV3_DROME/212-268-------------------------........TDRELSSVEYF.............FATAIGGGV.EC-----------
A4S717_OSTLU/44-97-------------------------....G............KT.............MTLKFADGD.AC-----------
Q2GN19_CHAGB/165-263-------------------------....PPPNAQLQVKGDQRY.............LSQRLEDGT.IC-----------
Q38E25_TRYB2/57-160-------------------------....ATYTCSKDVSVSNVQ.............VDVLYSHGT.MC-----------
OS9_YARLI/111-190-------------------------....DDTTNTVTSAGGIPF.............LAHRLRSGT.HC-----------
Q2UHS2_ASPOR/160-262-------------------------....TTDVAELQTNGGSRY.............LVQRLEGGT.KC-----------
A2VDJ4_HUMAN/56-116-------------------------.........HEWEIANNTF.............TGMWMRDGD.AC-----------
Q4RQ71_TETNG/370-475-------------------------....RSYQHRDDGVQKVKL.............VSHFYGHGD.VC-----------
A0BVD2_PARTE/98-171-------------------------....YLRATDETNGIHQPD.............HALYTLDTH.YH-----------
A7TM15_VANPO/111-181-------------------------....KDREFQLLYNEYGYY.............ISEILDGGE.IC-----------
Q5DCH4_SCHJA/94-177-------------------------....NQPKSVTLGEHSYPY.............YEVNYVDGT.LC-----------
Q08C06_DANRE/70-143-------------------------....NETAKASKQHKLKRY.............HSQSYVNGS.KC-----------
Q6FV48_CANGA/491-608-------------------------....RLKMVNGSIEDEFEYLYGDEL.DNMDLPIVLGFTRGE.KC-----------
A6SHA1_BOTFB/476-547-------------------------....EEVDAEGKGLGKGIR.............TTLVYENGQ.HC-----------
A5E6Q1_LODEL/91-197-------------------------....VVDGEFSYFEDNQRF.............IKHTLY.GD.IC-----------
Q170H4_AEDAE/351-420-------------------------....IRNKRKNENQ..................LSNFYSGGD.VC-----------
A0CKZ0_PARTE/98-170-------------------------....QFISKNYSYAGFEPP.............NSSYYLDTN.YH-----------
Q4CS72_TRYCC/374-438-------------------------....LWSSTS.......DY.............THMIFENGD.RC-----------
Q6PW72_9TELE/24-82-------------------------.....WTEEDVPSN..TLF.............RWLLMHGGAPNC-----------
A7S009_NEMVE/245-317-------------------------....KSIKLGY.....................TVHLYTGGD.MC-----------
A7S009_NEMVE/46-100-------------------------....QKIPTRKVEGRDMRY.............YEVVMGNGT.PC-----------
Q6NVN2_XENTR/340-419-------------------------....RAYMTTPDGVQTVKT.............VSHFYGGGD.VC-----------
Q383K9_TRYB2/102-183-------------------------....VLDLRYGVNTKGLRY.............IYTIYSDGL.TC-----------
Q2UTA8_ASPOR/443-512-------------------------......QLNESGEIVPEER.............ISLEYAKGQ.TC-----------
Q6GLZ2_XENLA/401-459-------------------------.................KF.............SSMKYEHGT.SC-----------
A4S612_OSTLU/68-155-------------------------....AGVDSGKLALENQRY.............HAHAFTDGT.KC-----------
OS9_EMENI/151-245-------------------------....STELAELQTKGGSRY.............LVQRLESGD.QC-----------
Q5RJX3_XENLA/101-191-------------------------....KDIHTKNIEGQMTPY.............YPVEMTNGT.PC-----------
FSTL3_RAT/34-90-------------------------.....WSNFTHPGNKISLL.............GFL....GLVHC-----------
Q9VKC7_DROME/354-428-------------------------....KGARRSGFTTS.................IWHHYGKGT.HC-----------
OS9_YEAST/115-193-------------------------....EEREFELLYDDVGYY.............ISEIIGSGD.IC-----------
A2R8V3_ASPNC/155-251-------------------------....VTDVAELQTKGGSRY.............LVQRLDGGT.KC-----------
Q57VU0_TRYB2/375-439-------------------------....LWSTTD.......DH.............THMLYEGGD.WC-----------
GLU2B_YEAST/537-646-------------------------....ISNLAAIQDDDGNMQHYVFGNLNELNNGLVLEYENGD.QC-----------
A2YFJ9_ORYSI/121-201-------------------------....SADEDDNLIDTSKRY.............HVHLYTNGT.VC-----------
ERLEC_PONAB/342-421-------------------------....RAYHLQDDGTQTVRM.............VSHFYGNGD.IC-----------
OS9_GIBZE/149-241-------------------------....APPPAELQVKGDQRY.............LVQRLEGGT.IC-----------
A6XPJ8_AJECN/133-209-------------------------.....RGEKQGNKNGKGSR.............NSQSSSGGD.RK-----------
A4HEV5_LEIBR/388-454-------------------------....TWTKDTR......DF.............SRMIYDDGL.EC-----------
Q7QG77_ANOGA/348-417-------------------------....ARNKRKLENQ..................ISHFYTGGD.VC-----------
Q7S6V9_NEUCR/438-509-------------------------....EEDRVDGKGLGKGPR.............MVLRFENGQ.GC-----------
A7SJQ2_NEMVE/423-480-------------------------.................KY.............SRMKYSDGQ.NC-----------
A7TL63_VANPO/122-195-------------------------....KRDHKLLYDTVDGYY.............ISESISNGD.IC-----------
Q86H64_DICDI/159-253-------------------------....LPQSTTTTPSNFLPY.............FSEKYEDGT.VC-----------
Q9NF22_CAEEL/350-427-------------------------....ARGAIQGNNQIDQ...............ISQIYAKGD.IC-----------
Q20CF4_PETMA/30-88-------------------------.....YTGEQVSTA..TLF.............RWMAFSGGAPNC-----------
OS9_CANGA/106-177-------------------------....ENREFQLLYDDYGYY.............ISEIIESGD.IC-----------
Q7QG77_ANOGA/95-183-------------------------....QQMKYKKIEGFNLPY.............LELEMDSGT.IC-----------
Q7PPE5_ANOGA/445-501-------------------------.................DY.............SAMIYSNGA.PC-----------
OS9_NEUCR/167-265-------------------------....PPPNTELQAKDNQRY.............LVQRLDGGT.IC-----------
Q16PW6_AEDAE/29-86-------------------------........SDRDITDVQLF.............FVNAFNDGM.DC-----------
A1C3Z3_ASPCL/157-257-------------------------....TTDIAELQTKGGSRY.............LVQRLGGGT.RC-----------
Q6C4G9_YARLI/307-374-------------------------....ADWDEVLEGPR..YS.............YVMRYVSGA.RC-----------
Q6NVN2_XENTR/108-198-------------------------....KEIYTKNIEGQMTPY.............YPVEMINGT.PC-----------
Q170H4_AEDAE/98-185-------------------------....AKMQYKKIDGLNLPY.............LELEMDSGT.VC-----------
Q9VJD1_DROME/434-491-------------------------.................QY.............SQQKYTNGA.AC-----------
Q803G0_DANRE/100-193-------------------------....TEIPTKNIEGQLTPY.............YPVEMGHGT.EC-----------
A8X7A1_CAEBR/101-181-------------------------....IKPQTRRIENEDYPY.............YSVSYNHGT.TC-----------
A7SE51_NEMVE/70-130-------------------------.........QGWTIENNTF.............ISMLMSEGD.FC-----------
A6REP5_AJECN/405-474-------------------------......EQDSNGKVVPQKK.............IALEYTNGQ.TC-----------
Q00XK8_OSTTA/90-173-------------------------....VEDVDDALLSEDRRY.............HAHVFTGGA.KC-----------
Q5DA66_SCHJA/303-366-------------------------....EK...........SY.............KVMLYENGL.HC-----------
Q4RHD7_TETNG/423-488-------------------------.................VY.............SVMKYEHGT.GC-----------
A8X7A1_CAEBR/339-416-------------------------....NRGAIKGTQQIMQ...............LNHIYSKGD.IC-----------
A7SG72_NEMVE/77-152-------------------------....KVEKSKSKTTVVQRY.............HSQYYVNGT.VC-----------
Q5B183_EMENI/1069-1138-------------------------......EVNEAGEIIQVQK.............TSLEYKNGQ.GC-----------
A1CD98_ASPCL/492-561-------------------------......ELNEAGEMVPEER.............VSLVYANGQ.TC-----------
Q4RQ71_TETNG/131-225-------------------------ICVFITVPTKNIEGQLTPY.............YSVELGNGT.PC-----------
Q0UVU1_PHANO/148-261-------------------------....ALDLPRLESKGSSRY.............MVQRLNGGT.EC-----------
GLU2B_SCHPO/385-431-------------------------..................................LKYENGQ.SC-----------
Q4DFG0_TRYCC/99-181-------------------------....DLNFRYGVDALGNRY.............IFTKYPNGE.VC-----------

PF02157

MPRD_BOVIN/2-279NVPAAYRGVGDDQLGEESEERDDHLLPM
MPRD_MOUSE/1-278NVPAAYRGVGDDQLGEESEERDDHLLPM

PF09451

Q4WRS6_ASPFU/14-328.VINTLQG.........SGSRG------
ATG27_DEBHA/7-277.....FTG.........NSNRG------
ATG27_CANGA/6-271.TLGTRDS.........SASRG------
ATG27_YEAST/7-266.ILGRSTA...........QRG------
ATG27_KLULA/6-280.IVNSGSS..........SQRG------
ATG27_ASHGO/7-259PSGGRIQGQ......FYRGTKG------
Q55NF4_CRYNB/4-269.VVANVRGS.......GSGGRG------
Q4P961_USTMA/31-324.VWQAVSGNRGGGGFSGAGGRG------
ATG27_YARLI/3-271.VVGTFTG..........SSRT------
Q5BF19_EMENI/12-291.VVNTFQG.........AGSRG------
Q2UQK8_ASPOR/14-321.VVNTLQG.........SGSRG------
Q8WZV1_NEUCS/29-377.VLNTVQS.........SGSRG------
Q54CZ8_DICDI/7-251.IKSKVTG.........TGGQG------
ATG27_CANAL/3-247.....FTG.........RSNRG------

PF00878

MPRI_HUMAN/1031-1178----------------------------
MPRI_HUMAN/423-573----------------------------
MPRI_BOVIN/1040-1187----------------------------
Q63002_RAT/566-706----------------------------
Q90681_CHICK/1011-1157----------------------------
Q90681_CHICK/1299-1439----------------------------
MPRI_MOUSE/1315-1455----------------------------
MPRI_MOUSE/418-567----------------------------
Q90681_CHICK/412-563----------------------------
MPRI_BOVIN/432-582----------------------------
MPRI_BOVIN/1331-1471----------------------------
MPRI_MOUSE/1024-1171----------------------------

PF13015

B6K4H4_SCHJY/349-504LITEANEHPTPETI........AENDEL
C5M4M3_CANTT/386-532LSEE..EILSSFKI.........DYALL
C4R3S3_PICPG/341-510IAEG..ESHAPFKVI.......PFKDEL
GLU2B_SCHPO/346-506LLNT..QNSANENAVNGMEDKESSVDEL
A5DJ02_PICGU/305-448LTHE..DLLANFHI.........DYDSL

PF07915

Q74ZM0_ASHGO/505-608----------------------------
Q4WG82_ASPFU/413-482----------------------------
OS9_ASPFU/161-256----------------------------
Q09396_CAEEL/122-193----------------------------
Q55BK1_DICDI/419-467----------------------------
OS9_HUMAN/108-181----------------------------
FSTA_DANRE/33-91----------------------------
A3GGW8_PICST/109-220----------------------------
Q29NJ4_DROPS/101-190----------------------------
OS9_DEBHA/130-240----------------------------
A5DHY4_PICGU/126-247----------------------------
Q29LB3_DROPS/439-496----------------------------
Q0V1F7_PHANO/438-509----------------------------
Q29NJ4_DROPS/360-434----------------------------
Q8LDD0_ARATH/527-579----------------------------
A2GK42_TRIVA/71-135----------------------------
Q16M80_AEDAE/441-496----------------------------
Q0D1V6_ASPTN/160-264----------------------------
A2R1B3_ASPNC/442-511----------------------------
Q6FHE1_HUMAN/30-88----------------------------
ERLEC_HUMAN/111-199----------------------------
Q6CK66_KLULA/502-608----------------------------
Q5KAG5_CRYNJ/146-266----------------------------
Q9VKC7_DROME/99-188----------------------------
A7F2Y5_SCLS1/147-250----------------------------
OS9_CANAL/114-193----------------------------
Q3U518_MOUSE/406-464----------------------------
A4I229_LEIIN/228-294----------------------------
Q4P0B9_USTMA/948-1012----------------------------
Q5CSG1_CRYPI/286-401----------------------------
O65221_ARATH/57-104----------------------------
Q5DCH4_SCHJA/372-448----------------------------
Q55ZR6_CRYNB/439-501----------------------------
Q86NV3_DROME/212-268----------------------------
A4S717_OSTLU/44-97----------------------------
Q2GN19_CHAGB/165-263----------------------------
Q38E25_TRYB2/57-160----------------------------
OS9_YARLI/111-190----------------------------
Q2UHS2_ASPOR/160-262----------------------------
A2VDJ4_HUMAN/56-116----------------------------
Q4RQ71_TETNG/370-475----------------------------
A0BVD2_PARTE/98-171----------------------------
A7TM15_VANPO/111-181----------------------------
Q5DCH4_SCHJA/94-177----------------------------
Q08C06_DANRE/70-143----------------------------
Q6FV48_CANGA/491-608----------------------------
A6SHA1_BOTFB/476-547----------------------------
A5E6Q1_LODEL/91-197----------------------------
Q170H4_AEDAE/351-420----------------------------
A0CKZ0_PARTE/98-170----------------------------
Q4CS72_TRYCC/374-438----------------------------
Q6PW72_9TELE/24-82----------------------------
A7S009_NEMVE/245-317----------------------------
A7S009_NEMVE/46-100----------------------------
Q6NVN2_XENTR/340-419----------------------------
Q383K9_TRYB2/102-183----------------------------
Q2UTA8_ASPOR/443-512----------------------------
Q6GLZ2_XENLA/401-459----------------------------
A4S612_OSTLU/68-155----------------------------
OS9_EMENI/151-245----------------------------
Q5RJX3_XENLA/101-191----------------------------
FSTL3_RAT/34-90----------------------------
Q9VKC7_DROME/354-428----------------------------
OS9_YEAST/115-193----------------------------
A2R8V3_ASPNC/155-251----------------------------
Q57VU0_TRYB2/375-439----------------------------
GLU2B_YEAST/537-646----------------------------
A2YFJ9_ORYSI/121-201----------------------------
ERLEC_PONAB/342-421----------------------------
OS9_GIBZE/149-241----------------------------
A6XPJ8_AJECN/133-209----------------------------
A4HEV5_LEIBR/388-454----------------------------
Q7QG77_ANOGA/348-417----------------------------
Q7S6V9_NEUCR/438-509----------------------------
A7SJQ2_NEMVE/423-480----------------------------
A7TL63_VANPO/122-195----------------------------
Q86H64_DICDI/159-253----------------------------
Q9NF22_CAEEL/350-427----------------------------
Q20CF4_PETMA/30-88----------------------------
OS9_CANGA/106-177----------------------------
Q7QG77_ANOGA/95-183----------------------------
Q7PPE5_ANOGA/445-501----------------------------
OS9_NEUCR/167-265----------------------------
Q16PW6_AEDAE/29-86----------------------------
A1C3Z3_ASPCL/157-257----------------------------
Q6C4G9_YARLI/307-374----------------------------
Q6NVN2_XENTR/108-198----------------------------
Q170H4_AEDAE/98-185----------------------------
Q9VJD1_DROME/434-491----------------------------
Q803G0_DANRE/100-193----------------------------
A8X7A1_CAEBR/101-181----------------------------
A7SE51_NEMVE/70-130----------------------------
A6REP5_AJECN/405-474----------------------------
Q00XK8_OSTTA/90-173----------------------------
Q5DA66_SCHJA/303-366----------------------------
Q4RHD7_TETNG/423-488----------------------------
A8X7A1_CAEBR/339-416----------------------------
A7SG72_NEMVE/77-152----------------------------
Q5B183_EMENI/1069-1138----------------------------
A1CD98_ASPCL/492-561----------------------------
Q4RQ71_TETNG/131-225----------------------------
Q0UVU1_PHANO/148-261----------------------------
GLU2B_SCHPO/385-431----------------------------
Q4DFG0_TRYCC/99-181----------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window