Sequence alignment for CL0228

PF01553

Q23598_CAEEL/54-198-----------------KLICHN...KETFVKIL.............------------------------ENPNQP-LI
GPAT1_MOUSE/205-355-----------------QIHKGQ...LEMVKAAT.............------------------------.ETNLP-LL
Q21812_CAEEL/224-347-----------------VIRFHD...KENRAN...............------------------------....KG-GI
O54097_STRCO/67-199-----------------RVDLEG...LENVPA...............------------------------...EGG-AL
PLSC_HAEIN/52-180-----------------KVEHRI...PQDQKQ...............------------------------...ISR-AI
Q9VRC1_DROME/201-323-----------------IRRFHN...TEYRPT...............------------------------.....K-GI
Y2427_MYCLE/138-270-----------------RVEVSG...IENLPS...............------------------------...TGG-AL
O06830_MYCTU/42-173-----------------RSQVHG...LDSFPP...............------------------------....GG-AL
O53962_MYCTU/46-174-----------------KPKVYG...IENVPT...............------------------------....ER-AL
TAZ_HUMAN/41-215-----------------HLTVHNREVLYELIEKR.............------------------------.GPATP-LI
Q23087_CAEEL/81-242-----------------NIRIKG....DFINH...............------------------------...EEP-AL
P73054_SYNY3/40-177-----------------PIAIHG...QEHLPR...............------------------------...SGP-II
PLSC_BACSU/18-142-----------------GVKVYN...KENLPA...............------------------------...DSG-FV
O16526_CAEEL/65-226-----------------NFRVTG....DLIER...............------------------------...DEP-AI
PLC2_CAEEL/77-205-----------------HTTVYG...YEKTQV...............------------------------...EGP-AV
PLSC_MYCPN/72-202-----------------KVVIVN...PENVP................------------------------...KKA-VL
O07807_MYCTU/22-151-----------------KITVTG...VDNLPT...............------------------------...SGG-AV
O67119_AQUAE/640-768-----------------RIDVRG...LENLP................------------------------...KPP-FI
P74498_SYNY3/43-168-----------------QAQVYG...QELVPT...............------------------------...RGP-AL
O07809_MYCTU/23-150-----------------KITFEG...LENIPE...............------------------------...RGG-AL
PLSC_YEAST/62-191-----------------DVKVVG...EENLA................------------------------...KKP-YI
PLSC_ECOLI/52-180-----------------KVECRK...PTDAES...............------------------------...YGN-AI
PLCB_HUMAN/77-205-----------------RFEVRD...PRRLQE...............------------------------...ARP-CV
PLC1_CAEEL/73-201-----------------RFELRN...SEILHD...............------------------------...KKP-YI
PLSC_BORBU/67-194-----------------KIIVTG...SENIPK...............------------------------...KSN-VI
O84813_CHLTR/101-259-----------------ERLDQI...QEYIQA...............------------------------...GHN-VV
Q9W1B5_DROME/236-359-----------------FIKFHN...KQYKPT...............------------------------....VS-GF
PLSB_ECOLI/281-425-----------------GINVHN...AERVRQLA.............------------------------.HDGHE-LV
O53516_MYCTU/20-152-----------------RPKVEG...LEYIPS...............------------------------...SGP-AI
YD018_YEAST/84-276-----------------SLNVTF....ETSRPLKNSSN.....AKPC------------------------FRFKDR-AI
PLSB_ARATH/208-367-----------------SIFSEL...EDKIRQ...............------------------------...GHN-IV
O07808_MYCTU/23-150-----------------RITYVG...EENVPD...............------------------------...QGG-AV
CST26_YEAST/74-282-----------------AVRITT....ENSSVPKGTFFLDLKKKRIL------------------------SHLKSN-SV
PLCA_HUMAN/83-211-----------------RVEVRG...AHHFPP...............------------------------...SQP-YV
AAS_ECOLI/15-138-----------------RVRVTG...DTQALK...............------------------------...GER-VL
Q9N5S8_CAEEL/317-440-----------------VVYFHD...EHYKAQ...............------------------------....AQ-GI
GNPAT_HUMAN/138-283-----------------CVNEEG...IQKLQRA..............------------------------.IQEHP-VV
O67841_AQUAE/28-151-----------------RIEVIG...KENIP................------------------------...EGA-CI
PLSB_CAEEL/142-292-----------------LVCKEE...MEVLYEAE.............------------------------.QTGIP-MV
PLSB_HAEIN/281-425-----------------GINVQN...SNRVRKLA.............------------------------.LEGHE-IV
H7C777_BURPS/53-173-----------------...VHN....DAARL...............------------------------...DAR-AL
I6XFY8_MYCTU/82-222-----------------.ITVSG....SPVRN...............------------------------...LRG-VL
I6YDI9_MYCTU/312-438-----------------HLNVIG...KENLTA...............------------------------...QRP-AV
L5KBJ1_PTEAL/229-351-----------------.ITYHD...RKNRPR...............------------------------....NG-GI
Q3J501_RHOS4/70-203-----------------.VEVSG...LENLPR...............------------------------...NGP-AL
Q8GWG0_ARATH/153-274-----------------..KYHG...PRPSIR...............------------------------....PK-QV

PF03279

O84013_CHLTR/7-316RTGGKILVDHLVYG....LGLGVLTILRLLPRSSLRLFSKGLGTALF..YFISDVRKTALTNLALAFP.EKSFAERY-QI
Q9ZCL1_RICPR/1-290MKKFLKKLRYLIEY...FIVIIFLKVIGIFGIDKASDICSFIARKVG...ILFAVNKIAKRNIKAVFG.DMYDVEK.-.I
MSBB_ECOLI/11-305IPEFDKSFRHPRYWGA.WLGVAAMAGIALTPPKFRDPILARLGRFAG..RLGKSSRRRALINLSLCFP.ERSEAERE-AI
MSBB_HAEIN/17-309EAHFSWSYLKPQYWGI.WLGIFFLLLLAFVPFRLRDKLTGKLGIWIG..HKAKKQRTRAQTNLQYCFP.HWTEQQRE-QV
HTRB_ECOLI/4-297LPKFSTALLHPRYWLT.WLGIGVLWLVVQLPYPVIYRLGCGLGKLA..LRFMKRRAKIVHRNLELCFP.EMSEQERR-KM
HTRB_HAEIN/6-300LPQFQPHFLAPKYWLF.WLGVAIWRSILCLPYPILRHIGHGFGWLFSHLKVGERRAAIARRNLELCFP.DMPENERE-VI
O25057_HELPY/18-320.KGFKTELRILSIFIVESLVNILGFILAKMPHSWFLRCIKAVAWLMK..TFDKCRYFDAKANLDFVFGDSKSEEEKK-RI
DDG_ECOLI/5-296.CKFSREFLHPRYWLT.WFGLGVLWLWVQLPYPVLCFLGTRIGAMAR..PFLKRRESIARKNLELCFP.QHSAEERE-KM
ACYLT_MYCTU/11-302..PKDPRSSVTRTATD.WAYAAGWMAVRALPEFAVRNAFDTGARYFA...RH.GGPEQLRKNLARVLG.VPPAAVPD-PL
Q7AQJ0_MYCLE/10-306.MIRAPHRLMTGRAID.WAYAAGWRAVRAMPESAARFAFNTGARYAA...RN.GGPDQLRKNLARIIG.VQAADVPD-AL

PF04028

A8ZZ01_DESOH/64-132-----------------FF.ATR---------------------------------------------------KPI.TI
B0SP25_LEPBP/75-143-----------------KS.KKK---------------------------------------------------ADM.VA
B4SDV4_PELPB/57-125-----------------RL.FPE---------------------------------------------------KKI.TA
F2IZZ7_POLGS/64-140-----------------TK.PDG---------------------------------------------------WTT.RV
E1WZF2_BACMS/56-124-----------------LS.HLD---------------------------------------------------QKF.SM
R5H3I3_9SPIR/57-124-----------------...QDK---------------------------------------------------ARV.NI
Q6MRQ4_BDEBA/60-126-----------------...VKR---------------------------------------------------YRI.AT
H9ULS0_SPIAZ/58-128-----------------YW.YRH---------------------------------------------------RRG.SA
Q9ABC6_CAUCR/70-146-----------------QG.PDK---------------------------------------------------PEI.RV
A1BDV7_CHLPD/57-125-----------------KL.FTQ---------------------------------------------------SII.HA
E8RUM0_ASTEC/66-142-----------------PL.DRA---------------------------------------------------QKI.AI
D9QTV2_ACEAZ/58-126-----------------YH.FRR---------------------------------------------------RGY.YG
Q983L9_RHILO/65-141-----------------YY.PKR---------------------------------------------------KPL.VA
E0TGQ7_PARBH/67-143-----------------QR.QQG---------------------------------------------------RPL.AV
I5B662_9DELT/65-133-----------------FF.SNR---------------------------------------------------KPI.AI
J9ZBF5_LEPFM/54-123-----------------YF.GKW---------------------------------------------------GKI.RI
Q8F6G4_LEPIN/73-141-----------------YL.NRN---------------------------------------------------ERM.AV
V6EZ87_9PROT/67-135-----------------SW.RRG---------------------------------------------------LPI.SM
D3UG86_HELM1/67-136-----------------.....K---------------------------------------------------PKV.FV
D3PAM4_DEFDS/54-122-----------------NL.HKN---------------------------------------------------EKI.VT
B8DJK1_DESVM/57-126-----------------HV.RGD---------------------------------------------------LEI.VT
F0SQI7_PLABD/66-133-----------------FS.GKP---------------------------------------------------QNV.AG
F0S084_DESTD/50-120-----------------FA.NYA---------------------------------------------------DKV.SI
E8UZ77_TERSS/67-135-----------------YR.FRN---------------------------------------------------MGI.AI
N0B9S3_9RHIZ/83-157-----------------LR.PEN---------------------------------------------------VKV.AA
G8NV89_GRAMM/64-132-----------------HR.FRN---------------------------------------------------KGI.AI
E0UPC6_SULAO/66-130-----------------.....T---------------------------------------------------PHV.KL
A7IFD8_XANP2/64-140-----------------AM.KPH---------------------------------------------------HKA.KV
E3DMT5_HALPG/62-130-----------------YF.LRG---------------------------------------------------LGI.YA
E4RJY2_HALHG/62-130-----------------YF.LRD---------------------------------------------------LGI.YA
O25048_HELPY/11-75-----------------.....K---------------------------------------------------PSV.YV
Q11L84_CHESB/71-147-----------------IK.PRR---------------------------------------------------QPL.VA
Q0BPV8_GRABC/79-147-----------------RK.ANP---------------------------------------------------EPC.HV
Q0AS10_MARMM/66-142-----------------WA.RQK---------------------------------------------------DRM.VA
O67824_AQUAE/58-130-----------------LY.GMD---------------------------------------------------RGI.VV
Q30PR2_SULDN/66-130-----------------.....T---------------------------------------------------PHA.KV
W0DGX2_9AQUI/56-129-----------------FF.GLD---------------------------------------------------RGI.VA
A6QCC9_SULNB/61-129-----------------KI.HKT---------------------------------------------------RPA.SA
J9Z1G0_9PROT/65-132-----------------SW.KFK---------------------------------------------------PKL.RP
R6PBE5_9CLOT/58-124-----------------...EDR---------------------------------------------------GNL.NV
I7H665_9HELI/71-139-----------------QQ.GRD---------------------------------------------------KGF.YI
R6IYI6_9PROT/74-142-----------------FW.NKK---------------------------------------------------RPL.NA
F8E554_FLESM/55-122-----------------.F.YKN---------------------------------------------------TGT.VT
B8FFT7_DESAA/67-135-----------------YL.FKG---------------------------------------------------WNA.AI
Q3B2C3_PELLD/65-133-----------------RL.WPD---------------------------------------------------RDA.SA
A0RQN4_CAMFF/65-129-----------------.....T---------------------------------------------------KNV.KV
I0AGE8_IGNAJ/62-130-----------------YV.HRN---------------------------------------------------ENF.AA
R7MFY6_9CLOT/57-124-----------------...SNR---------------------------------------------------EKL.HV
B1LYS3_METRJ/71-150-----------------LR.RPG---------------------------------------------------DRV.AT
W0RK11_9BACT/71-137-----------------...HRD---------------------------------------------------LGA.AV
E4TYI7_SULKY/66-130-----------------.....N---------------------------------------------------PKA.NV
D6Z3S1_DESAT/74-140-----------------...DPK---------------------------------------------------ARW.VL
L0KCN8_HALHC/57-123-----------------...LRN---------------------------------------------------KGH.IA
Q6NDP3_RHOPA/63-131-----------------LQ.TKS---------------------------------------------------KPL.VA
I7DWR6_PHAIB/80-148-----------------FD.TSL---------------------------------------------------GRI.CA
B4U6Q4_HYDS0/48-121-----------------MY.GID---------------------------------------------------KNI.YS
Y090_RICPR/70-138-----------------MF.TGH---------------------------------------------------RNV.YA
C6BUF4_DESAD/64-130-----------------....EK---------------------------------------------------LPL.VT
R7L764_9BACT/67-134-----------------LY.RPH---------------------------------------------------YPM.SG
D5BSX8_PUNMI/65-133-----------------LW.PRR---------------------------------------------------HPM.YV
D2QZ30_PIRSD/60-127-----------------VF.FAD---------------------------------------------------CGI.HT
Q3SPI1_NITWN/67-142-----------------IR.RAH---------------------------------------------------HRG.KV
C6XQU3_HIRBI/73-149-----------------WK.KAE---------------------------------------------------NPI.SM
B4S5E5_PROA2/69-137-----------------RL.FPQ---------------------------------------------------KKI.TA
Q8RE56_FUSNN/59-126-----------------FR.NVE---------------------------------------------------KKL..A
A7ZE08_CAMC1/68-136-----------------SS.QNR---------------------------------------------------KQG.KV
B3QSJ8_CHLT3/66-133-----------------.C.FPR---------------------------------------------------HPA.FA
B3DYR7_METI4/50-118-----------------KY.FPK---------------------------------------------------RKL.IA
Q7MR26_WOLSU/59-123-----------------.....K---------------------------------------------------PRI.SV
W0J2E6_9BACT/116-183-----------------.F.RPT---------------------------------------------------RPL.HA
Q21CB2_RHOPB/63-131-----------------LC.MED---------------------------------------------------KAL.KA
Q8KBV7_CHLTE/63-131-----------------RL.YPK---------------------------------------------------REI.SA
A9H0X4_GLUDA/73-146-----------------PQ.NPA---------------------------------------------------LRL.HV
D9S4X2_FIBSS/31-98-----------------AA.FKD---------------------------------------------------KNV.HI
R5XZA3_9PROT/77-145-----------------FW.RNP---------------------------------------------------RQM.KA
A7HQR6_PARL1/69-149-----------------FW.HNW---------------------------------------------------REV.RV
V4IQX8_9DELT/64-132-----------------YY.LRR---------------------------------------------------YSA.AV
B4REI6_PHEZH/69-143-----------------...WWR---------------------------------------------------KRT.RC
E8X0D5_ACISM/63-131-----------------YY.FRG---------------------------------------------------QKI.AI
E3HZ07_RHOVT/78-152-----------------IK.PKT---------------------------------------------------MPV.SN
Q6MBL2_PARUW/79-142-----------------IY....---------------------------------------------------....AA
Q0C4B2_HYPNA/87-161-----------------...EKR---------------------------------------------------GRG.AM
F3Z2J0_DESAF/59-128-----------------AT.RKG---------------------------------------------------LTV.GA
M4V8B2_9DELT/59-127-----------------FL.VRR---------------------------------------------------YRL.ST
G0JN00_9GAMM/54-122-----------------WR.VGG---------------------------------------------------RKI.KI
Q0PB56_CAMJE/61-126-----------------....KN---------------------------------------------------KKA.YV
D5V753_ARCNC/62-126-----------------.....K---------------------------------------------------GKV.SA
E8RHR4_DESPD/61-129-----------------IY.LRR---------------------------------------------------YPS.AI
A7I0Q2_CAMHC/62-130-----------------QC.WKQ---------------------------------------------------RPA.KV
Q3AU77_CHLCH/57-125-----------------KL.FPH---------------------------------------------------KNV.AA
B2KBY8_ELUMP/72-140-----------------YP.YRG---------------------------------------------------QRI.CV
E6W1J7_DESIS/59-127-----------------WL.YGR---------------------------------------------------GNI.YA
E8R441_ISOPI/72-140-----------------YY.WAW---------------------------------------------------PSM.TI
A6Q530_NITSB/66-130-----------------.....N---------------------------------------------------HPI.AV
Q1IHY6_KORVE/73-141-----------------WV.FRG---------------------------------------------------RDL.AV
D5SXZ6_PLAL2/66-134-----------------FT.ARR---------------------------------------------------SDLCCG
B8CZC4_HALOH/67-135-----------------YF.FRK---------------------------------------------------RDC.VT
D1AZK0_SULD5/63-131-----------------YY.SKR---------------------------------------------------VSI.DT
R5RAX8_9PROT/76-144-----------------FW.NRK---------------------------------------------------KPL.NA
B1ZNQ8_OPITP/76-143-----------------.Y.RPH---------------------------------------------------RPL.YA
G2LIZ0_CHLTF/58-126-----------------LF.FQR---------------------------------------------------RGI.VV
I4CDF4_DESTA/77-146-----------------YY.CRR---------------------------------------------------YPG.VV
C7JH60_ACEP3/75-148-----------------PQ.NPH---------------------------------------------------IRL.RV
C8X102_DESRD/59-128-----------------TL.HRG---------------------------------------------------EGV.VA
E8T5G8_THEA1/50-120-----------------LR.EFS---------------------------------------------------SKV.AI
F2NIN6_DESAR/44-112-----------------FR.DRP---------------------------------------------------RKI.VL
M1NHV0_DESSD/63-131-----------------YY.MRK---------------------------------------------------DSG.VA
G8PRP9_PSEUV/64-140-----------------AR.PKD---------------------------------------------------WDV.RV
E1QK73_DESB2/69-137-----------------...FGG---------------------------------------------------YHP.AV
L0DF38_SINAD/64-131-----------------YF.WAW---------------------------------------------------PEM.QI
Q1MQ03_LAWIP/64-132-----------------YF.RGK---------------------------------------------------LKI.IT
R6HP46_9PROT/74-142-----------------FW.NRS---------------------------------------------------HPL.NA
D3DFJ2_HYDTT/56-129-----------------LF.GMD---------------------------------------------------RGI.YT
W0JIH7_DESAE/48-117-----------------FV.YLG---------------------------------------------------NNL.SV
K7YPV9_9PROT/65-133-----------------SW.PRG---------------------------------------------------KPL.AM
F9ZPD4_ACICS/63-131-----------------RE.VGG---------------------------------------------------RRV.KI
A0LIS3_SYNFM/43-111-----------------YH.YRD---------------------------------------------------LNV.VT
D8PHJ4_9BACT/77-145-----------------LA.IPG---------------------------------------------------LEA.HV
C1F7K9_ACIC5/65-133-----------------WY.FRK---------------------------------------------------FRC.SI
I0IL07_LEPFC/80-149-----------------WK.GLR---------------------------------------------------GRS.RI
A8ERF0_ARCB4/62-126-----------------.....N---------------------------------------------------GIV.KA
Q5LVH2_RUEPO/68-136-----------------FP.LDK---------------------------------------------------GRI.CS
F2LXE1_HIPMA/50-118-----------------AY.DKT---------------------------------------------------REI.KI
D5C4J1_NITHN/50-118-----------------WY.WRN---------------------------------------------------RGI.IV
D6ZZS2_STAND/64-139-----------------LV.RPY---------------------------------------------------HRA.RV
B6JIY0_OLICO/67-142-----------------LK.RKK---------------------------------------------------YAA.KV
A4Z0S3_BRASO/67-143-----------------IRNKPS---------------------------------------------------YRA.KV
F8KRG5_HELBC/66-130-----------------.....K---------------------------------------------------PNL.YV
C7LQU5_DESBD/60-129-----------------PA.HAG---------------------------------------------------ERM.AC
I3TPI2_TISMK/68-136-----------------VW.RTG---------------------------------------------------MPM.NM
F8JIN3_HYPSM/61-135-----------------LR.PEN---------------------------------------------------VKI.AA
I3ZEX2_TERRK/83-151-----------------WR.YRG---------------------------------------------------LGI.RI
J9Z9Q6_LEPFM/85-154-----------------WS.GRW---------------------------------------------------GGA.HA
I4B448_TURPD/68-135-----------------...DKG---------------------------------------------------VHL.TV
D5EMA6_CORAD/74-142-----------------KY.IRG---------------------------------------------------RKL.AV
A8ZZ32_DESOH/66-137-----------------YF.RKL---------------------------------------------------KNA.GI
Q2YIH6_BRUA2/79-155-----------------LR.PKG---------------------------------------------------LEL.VA
Q2YMG0_BRUA2/58-131-----------------AR.PPE---------------------------------------------------KKF.VA
D5MG22_9BACT/72-140-----------------FV.YPG---------------------------------------------------KSG.AL
C5AWR7_METEA/66-144-----------------MS.RPQ---------------------------------------------------DRV.AT
Q2VZT0_MAGSA/67-135-----------------SW.RQS---------------------------------------------------VPI.HM
B3EMB6_CHLPB/59-127-----------------KI.FPD---------------------------------------------------KNI.HA
C1A8S4_GEMAT/86-154-----------------LY.GHK---------------------------------------------------IHT.GV
B0SQM7_LEPBP/59-127-----------------YL.HRN---------------------------------------------------KNV.AV
S0EW12_CHTCT/80-145-----------------....RN---------------------------------------------------RGY.WA
Q7VGP5_HELHP/69-137-----------------SK.ERD---------------------------------------------------KGF.YI
I6Z7D3_MELRP/64-132-----------------YL.HKD---------------------------------------------------LNS.AA

PF03982

DGAT2_MOUSE/92-388MYTFCTDCWLIAVLYFTWLAFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQL.VKTHN.L-------------LTTRNY
Q23067_CAEEL/63-359HVLFNTRWWFLVPLYAVWFYYDFDTPKKASRRWNWARRHVAWKYFASYFPLRL.IKTAD.L-------------PADRNY
Q9XUW0_CAEEL/50-345FVLFFTGQWIILGLYAVWYLYDRESPRRGGYRDNWFRNLSLHKWFAEYFPVKL.HKTAE.L-------------DPNQNY
Q9N4S3_CAEEL/44-340FFLLFTFQWHILALYACWYFYDMDSPRRGGYSSDWVRKWRVNDWFAQYFPINL.HKTAE.L-------------STDKNY
O01881_CAEEL/55-349YMLY.TVLWPLIFLYGLWMIYDWNSPKKGAYMSNWFQRQRIHSWYANYFPVKL.HTTSD.M-------------PEEHNY
DGAT2_ARATH/39-312SLIFLPPSLSLMVLGLLSLFIFIPIDHRSKYGRKLAR..YICKHACNYFPVSLYVEDYEAF-------------QPNRAY

PF01553

Q23598_CAEEL/54-198TVSNHRSN...IDDPLMW.CILK---FRE.FWRYK--------------DRNRYTLAAHNICFTKQFHTTMFS....LGR
GPAT1_MOUSE/205-355FLPVHRSH...IDYLLLT.FILF---CHN..I...--------------.KAPYIASGNN.LNI.PVFSTLIH....KLG
Q21812_CAEEL/224-347CVANHTSP...IDVMVLS.C...---.....D...--------------.NCYAMIGQKQAGFLGFLQTTLSR....SEH
O54097_STRCO/67-199LVANHSGTL.PLDALMLQ.VALH---DHHSTH...--------------.RRLRLLAADLAFDL.PVVRDLAR....KAG
PLSC_HAEIN/52-180YIGNHQNN...YDMVTIS.YMV.---.....Q...--------------.PRTVSVGKKSLIWI.PFFGILYW....VTG
Q9VRC1_DROME/201-323CVCNHTSP...LDVLVLM.C...---.....D...--------------.ANYSLTGQVHTGILGVLQRALSR....VSH
Y2427_MYCLE/138-270VVANHAGVL.PFDGLMLS.LAVH---DEHPAQ...--------------.RDLRLLVADMVFDL.PVVGEAVR....KAG
O06830_MYCTU/42-173VVANHSGGMFPMDVPVFS.VDFY---DKFGYD...--------------.RPVYTLSHDILFM..GLTGDLFR....RTG
O53962_MYCTU/46-174LVGNHNTLG.LVDAPLLA.AELW---ERG......--------------.RIVRSLGDHAHFKI.PGWRDALT....RTG
TAZ_HUMAN/41-215TVSNHQSC...MDDPHLW.GILK---LRHIWNL..--------------KLMRWTPAAADICFTKELHSHFFS....LGK
Q23087_CAEEL/81-242IIMNHRTR...LDWLFFW.NALY---KMD..PW.L--------------CTTEKISLKGMLKYV.PGAGWAMQ....AAS
P73054_SYNY3/40-177LAPTHRSR...WDAILLS.LAAG---RGVTGR...--------------.DLRFMVAVTEVQ...GLQGWFIR....HLG
PLSC_BACSU/18-142IACTHSGW...VDVITLGVGIL.---.....P...--------------.YQIHYMAKKELFQN.KWIGSFLK....KIH
O16526_CAEEL/65-226LIMNHRTR...LDWLFSW.NALY---KMD..PW.L--------------LTTEKISLKAPLKKI.PGAGWAMS....SGS
PLC2_CAEEL/77-205VICNHQSS...LDILSMA.SIW.---.....P...--------------.KNCVVMMKRILAYV.PFFNLGAY....FSN
PLSC_MYCPN/72-202VVANHKSN...LDPLILI.KAFG---KTEGVP...--------------..PLTFIAKIELQD..TWLFKIMK....LID
O07807_MYCTU/22-151VAINHTSY...LDFTFAG.LPAY---QQGLG....--------------.RKVRFMAKQEVFDH.KITGPIMR....SLR
O67119_AQUAE/640-768IAPNHQSY...LDAFAIA.AVLP---KEI.A....--------------.HETYFLGDETYFRN.PITSTFGK....LAH
P74498_SYNY3/43-168VVSNHASY...FDPPFLS.CAM.---.....A...--------------.RPVAFMAKEELFNV.PLLGPAIR....LYG
O07809_MYCTU/23-150IALNHTSY...VDWVPAS.IAAH---HRR......--------------.RRLRFMIKAEMQDV.RAVNYVIK....HAQ
PLSC_YEAST/62-191MIANHQST...LDIFMLG.RIF.---.....P...--------------.PGCTVTAKKSLKYV.PFLGWFMA....LSG
PLSC_ECOLI/52-180YIANHQNN...YDMVTAS.NIV.---.....Q...--------------.PPTVTVGKKSLLWI.PFFGQLYW....LTG
PLCB_HUMAN/77-205IVSNHQSI...LDMMGLM.EVL.---.....P...--------------.ERCVQIAKRELLFL.GPVGLIMY....LGG
PLC1_CAEEL/73-201IIANHQSA...LDVLGMS.FAW.---.....P...--------------.VDCVVMLKSSLKYL.PGFNLCAY....LCD
PLSC_BORBU/67-194IMGNHIAA...MDPLIFI.YTF.---.....A...--------------.CPFVILAKHSLLRI.PFVNIVLI....VMG
O84813_CHLTR/101-259LLANHQTE...SDPQLMY.CLLG---ASY..PQ.L--------------MESMIFVAGDRITSD.PLARPFSMG..CDLL
Q9W1B5_DROME/236-359CVANHTSP...LDVAILS.T...---.....D...--------------.CTYSLIGQRHGGFLGVLQRALAR....ASP
PLSB_ECOLI/281-425YVPCHRSH...MDYLLLS.YVLY---HQG.L....--------------.VPPHIAAGIN.LNF.WPAGPIFR....RLG
O53516_MYCTU/20-152LASNHLAV...ADSFYLP.LVV.---.....R...--------------.RRIWFLAKSEYFTGTGLKGWINRWFYSVSG
YD018_YEAST/84-276IIANHQMY...ADWIYLW.WLSF---VSNLG....--------------.GNVYIILKKALQYI.PLLGFGMR....NFK
PLSB_ARATH/208-367LISNHQSE...ADPAVIS.LLLE---AQS..PF.I--------------GENIKCVAGDRVITD.PLCKPFSMG..RNLI
O07808_MYCTU/23-150VAINHTSY...VDWLPAA.LAMH---RRR......--------------.RRMRFMIKAEMQRV.RLVNFLIR....HTR
CST26_YEAST/74-282AICNHQIY...TDWIFLW.WLAY---TSNLG....--------------.ANVFIILKKSLASI.PILGFGMR....NYN
PLCA_HUMAN/83-211VVSNHQSS...LDLLGMM.EVL.---.....P...--------------.GRCVPIAKRELLWA.GSAGLACW....LAG
AAS_ECOLI/15-138ITPNHVSF...IDGILLG.LFL.---.....P...--------------.VRPVFAVYTSISQQ.WYMRWLKS....FID
Q9N5S8_CAEEL/317-440CVANHTSP...IDALILS.I...---.....D...--------------.NVYALIGQKHEGLLGIVQRALSR....ASS
GNPAT_HUMAN/138-283LLPSHRSY...IDFLMLS.FLLY---NYD.L....--------------.PVPVIAAGMDFLGM.KMVGELLR....MSG
O67841_AQUAE/28-151VASNHRSH...LDPPVLN.AVF.---.....P...--------------.EPLVFLAKEELFK..PPFGGILK....HMR
PLSB_CAEEL/142-292YLPLHRSH...LDYLLIT.WCNW---HFG.L....--------------.KLPHIASGDN.LNL.SGLGWLLR....ATG
PLSB_HAEIN/281-425YVPCHRSH...IDYLLLS.YVLY---HQG.L....--------------.VPPHIAAGIN.LNF.WPIGRMFR....SWG
H7C777_BURPS/53-173VVGNHVSW...LDIYVIN.A...---.....W...--------------.RPTPFVSKAEVRAW.PVVGWLAE....RLG
I6XFY8_MYCTU/82-222VVSGHVSW...LDVFCIG.SVL.---.........--------------..PGSFVARADMFTG.RTIGIVAR....ILK
I6YDI9_MYCTU/312-438FIFNHRNQ...VDPVIAG.ALV.---.....R...--------------.DNWVGVGKKELASD.PIMGTLGK....LLD
L5KBJ1_PTEAL/229-351CVANHTSP...IDVIILA.S...---.....D...--------------.GYYAMVGQVHGGLMGVIQRAMVK....ACP
Q3J501_RHOS4/70-203VVCNHPTG..IADGVILH.HILA---PLR......--------------.PDLFFYANRDILRVLPQMEDLIC....PVE
Q8GWG0_ARATH/153-274YVANHTSM...IDFIVLE.QMT.---.........--------------..AFAVIMQKHPGWVGLLQSTILE....SVG

PF03279

O84013_CHLTR/7-316ARQSVQQMIITFVELATV-DKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQE-GAILFCGHQANWELP
Q9ZCL1_RICPR/1-290IDQTWDNFGRFIGEFIYV-DKMD...ESELESRIE..............IIGKENIK..KLEDQ-PFLLFSGHFANWDIS
MSBB_ECOLI/11-305VDEMFATAPQAMAMMAEL-AIRG...PEKIQPRVD..............WQGLEIIEEMRRNNE-KVIFLVPHGWAVDIP
MSBB_HAEIN/17-309IDKMFAVVAQVMFGIGEI-AIRS...KKHLQKRSE..............FIGLEHIEQAKAEGK-NIILMVPHGWAIDAS
HTRB_ECOLI/4-297VVKNFESVGMGLMETGMA-WFWP...DRRIARWTE..............VIGMEHIRDVQAQKR-GILLVGIHFLTLELG
HTRB_HAEIN/6-300LQENLRSVGMAIIETGMA-WFWS...DSRIKKWSK..............VEGLHYLK..ENQKD-GIVLVGVHFLTLELG
O25057_HELPY/18-320IKKGYENFAFIILETIRV-IFIP...KDEYDARFT..............LINEENVWKSLNKEG-QAITLCMHFGYWEAV
DDG_ECOLI/5-296IAENFRSLGMALVETGMA-WFWP...DSRVRKWFD..............VEGLDNLKRAQMQNR-GVMVVGVHFMSLELG
ACYLT_MYCTU/11-302MCASLESYGRYWREVFRL-PTIN...HRKLARQLDR............VIGGLDHLDAALAAGL-GAVLALPHSGNWDMA
Q7AQJ0_MYCLE/10-306IRTSLASYARYWREAFRL-PTMN...PHTVAKQVEA............YGIDLHRVGEALDAGR-GVVLALPHSGNWDMA

PF04028

A8ZZ01_DESOH/64-132MISQSKDG---------------------------------------------------------EMAARVVA----IL.
B0SP25_LEPBP/75-143LVSQSKDG---------------------------------------------------------EIIHQTFA----RS.
B4SDV4_PELPB/57-125VVSMSEDG---------------------------------------------------------KTLADTLE----RL.
F2IZZ7_POLGS/64-140MISRSADG---------------------------------------------------------EINAVAAK----KL.
E1WZF2_BACMS/56-124IISSSKDG---------------------------------------------------------EYVANICE----NF.
R5H3I3_9SPIR/57-124LISTSFDG---------------------------------------------------------EIVTYAAQ----GM.
Q6MRQ4_BDEBA/60-126IASQSKDG---------------------------------------------------------ELMATVLK----WL.
H9ULS0_SPIAZ/58-128LVEDSWKG---------------------------------------------------------DVLAGIMN----HF.
Q9ABC6_CAUCR/70-146LVSQSRDG---------------------------------------------------------EFIARVIA----RL.
A1BDV7_CHLPD/57-125VVSLSEDG---------------------------------------------------------QLLSGTLS----NI.
E8RUM0_ASTEC/66-142LVSLSKSG---------------------------------------------------------DFSVRTNT----LF.
D9QTV2_ACEAZ/58-126LASRSRDG---------------------------------------------------------EYISRVLK----KL.
Q983L9_RHILO/65-141MVSRSADA---------------------------------------------------------ELNALMLE----KF.
E0TGQ7_PARBH/67-143LVSEHRDG---------------------------------------------------------EMIAQVMT----HF.
I5B662_9DELT/65-133MISQSRDG---------------------------------------------------------EMAARTVT----IL.
J9ZBF5_LEPFM/54-123IVSRSRDG---------------------------------------------------------ALISSLLW----WF.
Q8F6G4_LEPIN/73-141LISESKDG---------------------------------------------------------DFINQVVH----RF.
V6EZ87_9PROT/67-135LTSEHRDG---------------------------------------------------------QLIARTAA----PF.
D3UG86_HELM1/67-136ISSRHFDG---------------------------------------------------------ELMVRLYS----YF.
D3PAM4_DEFDS/54-122IVSESKDG---------------------------------------------------------DIADYFLK----KF.
B8DJK1_DESVM/57-126VVSQSRDG---------------------------------------------------------EYLAQVLQ----RL.
F0SQI7_PLABD/66-133LVSRHQDG---------------------------------------------------------SYLADSMK----LI.
F0S084_DESTD/50-120LISRHRDG---------------------------------------------------------ELAARFIE----KL.
E8UZ77_TERSS/67-135LISQSFDG---------------------------------------------------------ELIARTVE----RL.
N0B9S3_9RHIZ/83-157MVAKHGDA---------------------------------------------------------ELIGEAMR----AL.
G8NV89_GRAMM/64-132LISRSFDG---------------------------------------------------------ELIARIVE----RL.
E0UPC6_SULAO/66-130IISDHFDG---------------------------------------------------------TLIAKTLS----YF.
A7IFD8_XANP2/64-140LISRHADA---------------------------------------------------------EINAIAAE----KL.
E3DMT5_HALPG/62-130LASLSRDG---------------------------------------------------------SYIAKVLE----NL.
E4RJY2_HALHG/62-130LTSLSRDG---------------------------------------------------------SYMTGVLE----SL.
O25048_HELPY/11-75IASQHFDG---------------------------------------------------------SIAAGLFE----SF.
Q11L84_CHESB/71-147LFSRSADA---------------------------------------------------------ELNALVAE----KM.
Q0BPV8_GRABC/79-147IISRHRDG---------------------------------------------------------RLVATLMR----LL.
Q0AS10_MARMM/66-142LASRSREG---------------------------------------------------------EIGSRLAR----WY.
O67824_AQUAE/58-130LVSRFRDG---------------------------------------------------------EIAARLLK----EL.
Q30PR2_SULDN/66-130LISSHFDG---------------------------------------------------------MLISKTIK----YF.
W0DGX2_9AQUI/56-129LVSRFRDG---------------------------------------------------------DIADGLLK----RF.
A6QCC9_SULNB/61-129IISSHFDG---------------------------------------------------------SLIAGTLK----LF.
J9Z1G0_9PROT/65-132IATSHRDG---------------------------------------------------------QLSTLVQK----KF.
R6PBE5_9CLOT/58-124MISKSLDG---------------------------------------------------------DIIAAATE----HM.
I7H665_9HELI/71-139IASHHFDA---------------------------------------------------------QLMVSLCE----YF.
R6IYI6_9PROT/74-142LVSLHQDG---------------------------------------------------------RLIAGFLE----KC.
F8E554_FLESM/55-122IVSKSKDG---------------------------------------------------------DIADFFLK----RL.
B8FFT7_DESAA/67-135MVSASEDG---------------------------------------------------------EYIAQVLG----RQ.
Q3B2C3_PELLD/65-133VVSLSEDG---------------------------------------------------------SILSLALK----RF.
A0RQN4_CAMFF/65-129MISDHKDG---------------------------------------------------------EMVNGVSY----HF.
I0AGE8_IGNAJ/62-130LTSLSKDG---------------------------------------------------------DLLARQLK----SW.
R7MFY6_9CLOT/57-124LISNSLDG---------------------------------------------------------QIISGVCE----RL.
B1LYS3_METRJ/71-150IISRNQDG---------------------------------------------------------NINTIALE----RF.
W0RK11_9BACT/71-137LISEHRDG---------------------------------------------------------EIIARVVE----AF.
E4TYI7_SULKY/66-130LISDHFDG---------------------------------------------------------QIIARIMR----YF.
D6Z3S1_DESAT/74-140MVSASDDA---------------------------------------------------------ELLSGALR----LM.
L0KCN8_HALHC/57-123LASQSDDG---------------------------------------------------------EYISQVLN----KL.
Q6NDP3_RHOPA/63-131LISGHRDG---------------------------------------------------------KIISRVGA----AF.
I7DWR6_PHAIB/80-148LTSAARAG---------------------------------------------------------RLAGQILV----RL.
B4U6Q4_HYDS0/48-121MASQNKDG---------------------------------------------------------DIAAILLE----GL.
Y090_RICPR/70-138LISPHLDG---------------------------------------------------------KILNALVG----KF.
C6BUF4_DESAD/64-130MASDSKDG---------------------------------------------------------QIITEVLE----RI.
R7L764_9BACT/67-134LVSASRDG---------------------------------------------------------AYLCALFY----LM.
D5BSX8_PUNMI/65-133LQSPHADG---------------------------------------------------------QLMSYTVN----RM.
D2QZ30_PIRSD/60-127LISKSTDG---------------------------------------------------------DYVTRMVD----HL.
Q3SPI1_NITWN/67-142LISRHRDG---------------------------------------------------------EFNALAAE----RL.
C6XQU3_HIRBI/73-149IISQSRDG---------------------------------------------------------AFITQAAI----HL.
B4S5E5_PROA2/69-137VVSLSRDG---------------------------------------------------------EILAGTLS----KL.
Q8RE56_FUSNN/59-126MSSPTKDG---------------------------------------------------------ELISVPLE----KM.
A7ZE08_CAMC1/68-136IISDHKDG---------------------------------------------------------ELITRIIK----FF.
B3QSJ8_CHLT3/66-133IVSLSKDG---------------------------------------------------------EILSNALQ----AL.
B3DYR7_METI4/50-118LVSRSNDG---------------------------------------------------------KFLSRVLG----QF.
Q7MR26_WOLSU/59-123MISDHFDG---------------------------------------------------------EIIARMIG----FF.
W0J2E6_9BACT/116-183LTSASKDG---------------------------------------------------------ALMGAFLE----ML.
Q21CB2_RHOPB/63-131LISGHRDG---------------------------------------------------------RIISKIGA----IF.
Q8KBV7_CHLTE/63-131VVSLSGDG---------------------------------------------------------QILSDTLD----RL.
A9H0X4_GLUDA/73-146LISRNRDG---------------------------------------------------------RLVTDIVA----PW.
D9S4X2_FIBSS/31-98LVSESNDG---------------------------------------------------------EFFAQAAK----QL.
R5XZA3_9PROT/77-145LVSPHNDG---------------------------------------------------------RIIARLLR----GF.
A7HQR6_PARL1/69-149LVSKHGDG---------------------------------------------------------EIVANIMR----IL.
V4IQX8_9DELT/64-132LVSASEDG---------------------------------------------------------DYIAELAH----HL.
B4REI6_PHEZH/69-143LVSPSADG---------------------------------------------------------EFIAQALS----MS.
E8X0D5_ACISM/63-131LISRSFDG---------------------------------------------------------EIIARTVE----RL.
E3HZ07_RHOVT/78-152MVAKHADG---------------------------------------------------------EMIGRTLL----HF.
Q6MBL2_PARUW/79-142FISNSRDG---------------------------------------------------------ELIGRIVR----SYK
Q0C4B2_HYPNA/87-161MISLSADG---------------------------------------------------------EPVARAIK----HL.
F3Z2J0_DESAF/59-128MVSQSRDG---------------------------------------------------------ELLAGIIE----SL.
M4V8B2_9DELT/59-127MISTSKDG---------------------------------------------------------EMMNTIYK----LF.
G0JN00_9GAMM/54-122LVSEHRDG---------------------------------------------------------ELIAATMA----HW.
Q0PB56_CAMJE/61-126MISHHKDG---------------------------------------------------------EQIAKIIK----LF.
D5V753_ARCNC/62-126MISDHKDG---------------------------------------------------------EAITKTVE----YL.
E8RHR4_DESPD/61-129MVSASKDG---------------------------------------------------------EYIARLAQ----LM.
A7I0Q2_CAMHC/62-130MISDHKDG---------------------------------------------------------EIITRVIS----HF.
Q3AU77_CHLCH/57-125VVSQSGDG---------------------------------------------------------TILADALG----TL.
B2KBY8_ELUMP/72-140LISLSKDG---------------------------------------------------------EYIARVLP----KF.
E6W1J7_DESIS/59-127LLSQHKDA---------------------------------------------------------EIFGRILR----YF.
E8R441_ISOPI/72-140LISDHRDG---------------------------------------------------------ELITRVVR----GL.
A6Q530_NITSB/66-130MISEHFDG---------------------------------------------------------ELIAKTIR----HF.
Q1IHY6_KORVE/73-141MTSRSADG---------------------------------------------------------EYIARVIE----KF.
D5SXZ6_PLAL2/66-134LVSRHDGA---------------------------------------------------------SFLSTAIE----ML.
B8CZC4_HALOH/67-135LASLSNDG---------------------------------------------------------EYITRVLE----KY.
D1AZK0_SULD5/63-131IVSHHFDG---------------------------------------------------------ELVAKLMQ----IF.
R5RAX8_9PROT/76-144LVSLHRDG---------------------------------------------------------RMIAGLLE----KF.
B1ZNQ8_OPITP/76-143LISASKDG---------------------------------------------------------ALLTAFFA----MVG
G2LIZ0_CHLTF/58-126MTSQSRDG---------------------------------------------------------DIIAEVIR----RF.
I4CDF4_DESTA/77-146MVSQSWDG---------------------------------------------------------EIIDRSIR----RM.
C7JH60_ACEP3/75-148LISRNRDG---------------------------------------------------------RMIADVVA----PW.
C8X102_DESRD/59-128VVSQSRDG---------------------------------------------------------EILAKVLQ----AF.
E8T5G8_THEA1/50-120LISRHRDG---------------------------------------------------------QLIAEVVE----RL.
F2NIN6_DESAR/44-112LASPSYDG---------------------------------------------------------ELVGRIAE----RF.
M1NHV0_DESSD/63-131MVSASKDG---------------------------------------------------------EYISRVAN----KL.
G8PRP9_PSEUV/64-140MISRSADG---------------------------------------------------------EMQAICAS----KL.
E1QK73_DESB2/69-137MISRSNDG---------------------------------------------------------ELLARFLR----VM.
L0DF38_SINAD/64-131LISDHRDG---------------------------------------------------------ELITQVVK----RL.
Q1MQ03_LAWIP/64-132VVSKSKDG---------------------------------------------------------DILANVIQ----RI.
R6HP46_9PROT/74-142LVSLHHDG---------------------------------------------------------RMIAGLLE----KF.
D3DFJ2_HYDTT/56-129LVSRFRDG---------------------------------------------------------DIAAYILK----KL.
W0JIH7_DESAE/48-117LISTHKDG---------------------------------------------------------RLASDVIK----YF.
K7YPV9_9PROT/65-133LHSSHSDG---------------------------------------------------------RMISEAMS----DF.
F9ZPD4_ACICS/63-131LISDHRDG---------------------------------------------------------ELIARAMA----HW.
A0LIS3_SYNFM/43-111MASRSRDG---------------------------------------------------------ELAARVAE----RL.
D8PHJ4_9BACT/77-145LISQHRDG---------------------------------------------------------ELIRRIVA----RF.
C1F7K9_ACIC5/65-133LISRSFDG---------------------------------------------------------ELIARTLG----HL.
I0IL07_LEPFC/80-149IVSRSKDG---------------------------------------------------------DLIAGLLR----IF.
A8ERF0_ARCB4/62-126MISHNKDG---------------------------------------------------------EIITKLVS----NF.
Q5LVH2_RUEPO/68-136ITSAARAG---------------------------------------------------------SMVGRVQQ----LF.
F2LXE1_HIPMA/50-118LQSTHKDG---------------------------------------------------------VLASMVIN----KF.
D5C4J1_NITHN/50-118MASMNLDG---------------------------------------------------------EAMTHCIQ----RH.
D6ZZS2_STAND/64-139MISRSADA---------------------------------------------------------DVNAIAAE----AL.
B6JIY0_OLICO/67-142LISRHRDG---------------------------------------------------------EINAIAAE----RL.
A4Z0S3_BRASO/67-143LISKHRDG---------------------------------------------------------EFNAIAAE----RL.
F8KRG5_HELBC/66-130VASQHFDG---------------------------------------------------------TLAARLYE----CF.
C7LQU5_DESBD/60-129VVSQSKDG---------------------------------------------------------EILAAALK----SF.
I3TPI2_TISMK/68-136LISQHRDG---------------------------------------------------------RLIADTIA----HF.
F8JIN3_HYPSM/61-135MVARHGDA---------------------------------------------------------EIISETLQ----AI.
I3ZEX2_TERRK/83-151LISASFDG---------------------------------------------------------ELIARLVE----RL.
J9Z9Q6_LEPFM/85-154IVSRSRDG---------------------------------------------------------ERIAAILR----FF.
I4B448_TURPD/68-135LISQSNDG---------------------------------------------------------EAIANVVE----RW.
D5EMA6_CORAD/74-142LISASGDG---------------------------------------------------------AWLSELLK----QV.
A8ZZ32_DESOH/66-137MISSSKGG---------------------------------------------------------DIAAGIAR----RF.
Q2YIH6_BRUA2/79-155MFSRSADA---------------------------------------------------------ELNARVAE----KL.
Q2YMG0_BRUA2/58-131AVSKSRDG---------------------------------------------------------ELVAQMLG----KL.
D5MG22_9BACT/72-140LISQHRDG---------------------------------------------------------EYFSRIAT----IL.
C5AWR7_METEA/66-144IISRSPDG---------------------------------------------------------NINTMALT----RM.
Q2VZT0_MAGSA/67-135LISQHRDG---------------------------------------------------------QLIARTVS----HF.
B3EMB6_CHLPB/59-127VVSQSKDG---------------------------------------------------------ELLSHVLA----KL.
C1A8S4_GEMAT/86-154LISEHRDG---------------------------------------------------------EIISQIVA----MF.
B0SQM7_LEPBP/59-127LISESKDG---------------------------------------------------------DYINEVVH----RF.
S0EW12_CHTCT/80-145LISLSRDG---------------------------------------------------------ELQNRIFR----RF.
Q7VGP5_HELHP/69-137VQSHHFDA---------------------------------------------------------ELMVRVIA----LF.
I6Z7D3_MELRP/64-132LVSKSKDG---------------------------------------------------------EVLYHILS----KW.

PF03982

DGAT2_MOUSE/92-388IFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLA..GNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGS.GNA
Q23067_CAEEL/63-359IIGSHPHGMFSVGGFTAMSTNATGFEDKFPGIKSHIMTLN..GQFYFPFRREFGIMLGGIEVSKESLEYTLTKCGK.GRA
Q9XUW0_CAEEL/50-345LFGYHPHGILGVGAWSCFGFDACNVKQVFKGIRFNICTLP..GNFTAMFRREILLSIGMIESSKESIEHVLNSEEK.GRA
Q9N4S3_CAEEL/44-340LVGIHPHGIISMAAWSNFATNGTGIYEKFPGIRWNLCTLA..LQFRMAIRRELLLLTGLIDCSRESIEYVLDKCGQKGRA
O01881_CAEEL/55-349LIGYHPHGIISMAAFINFATNGTGILDTLPRIRFHLCTLV..GQFWTPWRREWGLLHGMIDCSRESIKHVLEHEKK.GKA
DGAT2_ARATH/39-312VFGYEPHSVLPIGV.VALC.DLTGFMPI.....PNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYS....

PF01553

Q23598_CAEEL/54-198CVPCVR...--...........................GE-------------GVYQKG--------MDFCVD...MLND
GPAT1_MOUSE/205-355GFFIRRRLD--E....................TPDGRKDI-------------LYRALL--------HGHVVE...LLRQ
Q21812_CAEEL/224-347HIWFER...--..........................GEA-------------GDRAKV--------MDRMRE..HVNDE
O54097_STRCO/67-199HVRACP...--.............................-------------......--------.ENALR...LLGS
PLSC_HAEIN/52-180NIFLDR...--..........................ENR-------------TKAHNT--------MSQLAR...RINE
Q9VRC1_DROME/201-323HMWFDR...--..........................KEL-------------ADREAL--------GLVLRL..HCSMK
Y2427_MYCLE/138-270HTVACT...--.............................-------------......--------.SDAHR...LLAA
O06830_MYCTU/42-173YIRATR...--.............................-------------......--------.ENAAK...ALRS
O53962_MYCTU/46-174VVEGTR...--.............................-------------......--------.EITSE...LMRR
TAZ_HUMAN/41-215CVPVCRGAE--FFQAENEGKGVLDTGRHMPGAGKRREKGD-------------GVYQKG--------MDFILE...KLNH
Q23087_CAEEL/81-242YIFLDR...--...........................SF-------------DTDKTK--------LDNILNYYAETEY
P73054_SYNY3/40-177GFPVDV...--............................K-------------RPEISS--------VSYSVQ...LLQA
PLSC_BACSU/18-142AFPVDR...--..........................ENP-------------G..PSS--------IKTPIK...LLKE
O16526_CAEEL/65-226YIFLDR...--...........................NF-------------ENDKPV--------LERIVKYYSGSEK
PLC2_CAEEL/77-205TIFIDR...--..........................YNR-------------ERAMAS--------VDYCAS...EMKN
PLSC_MYCPN/72-202CVFIDR...--..........................KNL-------------RQMAAS--------LEQQQQ...IIRQ
O07807_MYCTU/22-151HIPVDR...--.............................-------------QDGSAS--------YDAAVR...MLKA
O67119_AQUAE/640-768VITVNV...--............................N-------------KGLKES--------LQKTAY...ALMS
P74498_SYNY3/43-168AYPVKR...--..........................GSG-------------D..RGA--------LRAALT...ALGD
O07809_MYCTU/23-150LIPVDR...--.............................-------------SVGADA--------YAVAVQ...RLRA
PLSC_YEAST/62-191TYFLDR...--..........................SKR-------------QEAIDT--------LNKGLE...NVKK
PLSC_ECOLI/52-180NLLIDR...--..........................NNR-------------TKAHGT--------IAEVVN...HFKK
PLCB_HUMAN/77-205VFFINR...--..........................QRS-------------STAMTV--------MADLGE...RMVR
PLC1_CAEEL/73-201SVYINR...--..........................FSK-------------EKALKT--------VDTTLH...EIVT
PLSC_BORBU/67-194VIFVNR...--..........................RSI-------------RSAAAA--------EVKAIK...VMRE
O84813_CHLTR/101-259CIYSKRHIN--H.....................PPELKEE-------------KLMHNQ--------KSMRTLK.MLLSE
Q9W1B5_DROME/236-359HIWFER...--..........................GEA-------------KDRHLV--------AERLKQ..HVSDP
PLSB_ECOLI/281-425AFFIRRT..--........................FKGNK-------------LYSTVF--------REYLGE...LFSR
O53516_MYCTU/20-152QVPIDR...--..........................TNA-------------DSAQGA--------LQTAVV...LLGQ
YD018_YEAST/84-276FIFLSRNWQ--KDEKA.............LTNSLVSMDLN-------------ARCKGP--------LTNYKSCYSKTNE
PLSB_ARATH/208-367CVYSKKHMN--D.....................DPELVDM-------------KRKANT--------RSLK.EMATMLRS
O07808_MYCTU/23-150TIPVDR...--.............................-------------GAGGSA--------YAVAVQ...RLRE
CST26_YEAST/74-282FIFMSRKWA--QDKIT.............LSNSLAGLDSN-------------ARGAGS--------LAGKSPE.RITEE
PLCA_HUMAN/83-211VIFIDR...--..........................KRT-------------GDAISV--------MSEVAQ...TLLT
AAS_ECOLI/15-138FVPLDP...--..........................TQP-------------M....A--------IKHLVR...LVEQ
Q9N5S8_CAEEL/317-440HIWFER...--..........................SEA-------------KDRLVV--------AQKLKE..HCTNP
GNPAT_HUMAN/138-283AFFMRRT..--........................FGGNK-------------LYWAVF--------SEYVKT...MLRN
O67841_AQUAE/28-151AIPLRR...--..........................GSE-------------D..IST--------LEECVS...LLKL
PLSB_CAEEL/142-292AFFIRRRVD--P....................DDERGKDQ-------------LYRAIL--------HSYIEQ...VLSK
PLSB_HAEIN/281-425AFFIRRT..--........................FKGNR-------------LYSAIF--------REYLSE...LFHR
H7C777_BURPS/53-173TVFIQR...--..........................EKR-------------SEAKRI--------MHELSE...RLGN
I6XFY8_MYCTU/82-222IIPIER...--..........................ASL-------------RRLPGV--------VDTIAR...RLRA
I6YDI9_MYCTU/312-438GVFIDR...--..........................DDP-------------VAAVET--------LHTVEE...RARN
L5KBJ1_PTEAL/229-351HVWFER...--..........................SEV-------------KDRHLV--------AKRLTE..HVQDK
Q3J501_RHOS4/70-203WRQEKR...--...........................SL-------------QKTRET--------MDYTRR...AIEA
Q8GWG0_ARATH/153-274CIWFNR...--..........................SEA-------------KDREIV--------AKKLRD..HVQGA

PF03279

O84013_CHLTR/7-316FLYITKRYP..GLAFAKPVK.NRRLNQKIISLRESFQGKI-------------VPPQNA........INQALR---ALHR
Q9ZCL1_RICPR/1-290LKVLKKYYP..KVAVIYRKANNPYVNKLVNESRAGDKLRL-------------IPKGSE.......GIRSLVR---AIKE
MSBB_ECOLI/11-305AMLMASQGQ..KMAAMFHNQGNPVFDYVWNTVRRRFGGRL-------------HARNDG........IKPFIQ---SVRQ
MSBB_HAEIN/17-309GIILHTQGM..PMTSMYNPHRNPLVDWLWTITRQRFGGKM-------------HARQNG........IKPFLS---HVRK
HTRB_ECOLI/4-297ARQFGMQEP..GIGVYRPND.NPLIDWLQTWGRLRSNKSM-------------LDRKD.........LKGMIK---ALKK
HTRB_HAEIN/6-300ARIIGLHHP..GIGVYRPND.NPLLDWLQTQGRLRSNKDM-------------LDRKD.........LRGMIK---ALRH
O25057_HELPY/18-320GTTLAQYYENYGRGCLGRLTKFAPINHMIMSRREAFGVRF-------------VNKIGA........MKELIK---MYNQ
DDG_ECOLI/5-296GRVMGLCQP..MMATYRPHN.NQLMEWVQTRGRMRSNKAM-------------IGRNN.........LRGIVG---ALKK
ACYLT_MYCTU/11-302GMWLVQRHG..TFTTVAERLKPESLYQRFIDYRESLGFEV-------------LPLSGGER....PPFEVLSE---RLRN
Q7AQJ0_MYCLE/10-306GVWLVQCHG..TFTTVAERLKPESLYRRFINYRENLGFEV-------------LPMSANKDTGFQALFELLCE---RLRS

PF04028

A8ZZ01_DESOH/64-132GWLPVR-------------------------------GSS.T...........RGGREA--------LAEIKR---LS.G
B0SP25_LEPBP/75-143GLRSVR-------------------------------GSS.T...........RGGTGA--------FRNILK---EM.K
B4SDV4_PELPB/57-125GFSLIR-------------------------------GSS.S...........KGGAAV--------KQAMQK---AL.Q
F2IZZ7_POLGS/64-140GIELIR-------------------------------ASG.S...QKAHQIAKRGGMRG--------FIEALR---AL.K
E1WZF2_BACMS/56-124GHIPVR-------------------------------GSS.S...........KGGVKA--------LINSIK---LL.K
R5H3I3_9SPIR/57-124GFNTVR-------------------------------GSS.G..........KKGAVES--------SMQMLE---KL.N
Q6MRQ4_BDEBA/60-126GAKTSR-------------------------------GSS.T...........RGGVQA--------LKGLLR---LV.K
H9ULS0_SPIAZ/58-128GFKDFR-------------------------------INS.N.........NSRAYGRG--------VLGFIR---YL.K
Q9ABC6_CAUCR/70-146GLPSIR-------------------------------GSS.L...KKTDTAKNKGGEQA--------FRDMVK---WV.K
A1BDV7_CHLPD/57-125GFSLIR-------------------------------GSS.S...........KGADEV--------KSAILK---AL.Q
E8RUM0_ASTEC/66-142GYHIIR-------------------------------GSA.A...KKSDPTKQKGGAQA--------FRDMLR---WI.R
D9QTV2_ACEAZ/58-126GWNVVR-------------------------------GST.S...........RGSVRA--------LLKLVK---LL.R
Q983L9_RHILO/65-141GIEAVR-------------------------------GSG.G...RDNARHLDKGGAKA--------LIALKK---SL.T
E0TGQ7_PARBH/67-143SIDTRR-------------------------------GSG.A...DPRKPEKNKGGASA--------LKALTR---IL.K
I5B662_9DELT/65-133GWRAVR-------------------------------GSS.S...........HGGDQA--------LETMKI---LA.R
J9ZBF5_LEPFM/54-123GILSVR-------------------------------GSS.S...........NGGIQA--------LRELLK---IA.K
Q8F6G4_LEPIN/73-141GNYSIR-------------------------------GSS.S...........KGGSKA--------LKALIV---HL.K
V6EZ87_9PROT/67-135GIGTIT-------------------------------GSS.T...........RGGAGG--------LRALLK---AL.K
D3UG86_HELM1/67-136GFKTIR-------------------------------GST.N......YNGIDRGGIKV--------LMESFR---YL.R
D3PAM4_DEFDS/54-122GFQTVR-------------------------------GSS.S...........RGGVKA--------VIGAKR---LM.G
B8DJK1_DESVM/57-126GLRTAR-------------------------------GSS.S...........RGGVKA--------LIGAAR---QMRK
F0SQI7_PLABD/66-133GIEPIR-------------------------------GSS.K...........RGGTQA--------LKQCLD---AA..
F0S084_DESTD/50-120GFSTVR-------------------------------GST.G.........KGKGGDRA--------FREMVN---IL.E
E8UZ77_TERSS/67-135GFVAIR-------------------------------GSS.S...........RGGAVA--------LLQMER---AV.K
N0B9S3_9RHIZ/83-157GVQLIR-------------------------------GAG.A.....GSRRRDRGGASA--------LRASLS---AL.A
G8NV89_GRAMM/64-132GFVAVR-------------------------------GSS.T...........RGGPQA--------LRGMQQ---AY.T
E0UPC6_SULAO/66-130GFGTIR-------------------------------GSS.R...........RNAARA--------LLQAIK---AL.K
A7IFD8_XANP2/64-140GVGTIR-------------------------------GSG.A...TSRNDFHRKGAVSA--------TYEMLD---TL.E
E3DMT5_HALPG/62-130GWELIR-------------------------------GSS.S...........RGGSRS--------LLQLYR---KL.K
E4RJY2_HALHG/62-130GWKTIR-------------------------------GSS.S...........RGASRS--------LLSLYR---KL.K
O25048_HELPY/11-75GFKNIR-------------------------------GSS.K...........KGGVKV--------LIEGLK---RL.K
Q11L84_CHESB/71-147DIQVVR-------------------------------GSG.G...RQQKNSAQKGGAAA--------LIQLKR---AI.D
Q0BPV8_GRABC/79-147GAKTLN-------------------------------GSS.S...........RGGATV--------LRDTLR---IL.E
Q0AS10_MARMM/66-142KVGVVR-------------------------------GSS.R...NPDKPGAAKGGEAA--------YRAMVN---HL.N
O67824_AQUAE/58-130GFEVVR-------------------------------GST.E......EGKAKKGGRSA--------TLKLIE---YL.K
Q30PR2_SULDN/66-130GLGTIA-------------------------------GST.N...........RNAARV--------LIQAIS---AI.K
W0DGX2_9AQUI/56-129GFETVR-------------------------------GST.E......EGREEKGGRSA--------LLKLME---LL.R
A6QCC9_SULNB/61-129HIRPLR-------------------------------GST.K...........KGARQV--------LLQAFK---SI.K
J9Z1G0_9PROT/65-132GLDPLL-------------------------------RKK.D............NPTFL--------IKNISK---AV.Q
R6PBE5_9CLOT/58-124GIKVVR-------------------------------GSH.K...........RSGAAA--------SLALIE---KL.E
I7H665_9HELI/71-139KLKPLR-------------------------------GST.T...........RGGLKV--------LIDSLK---LL.R
R6IYI6_9PROT/74-142GLGTIG-------------------------------GSS.N...........GNAVGS--------ARDLLE---SL.R
F8E554_FLESM/55-122DYKTVR-------------------------------GSS.S...........RGGNEA--------LMNAAA---LM.E
B8FFT7_DESAA/67-135GHDCVR-------------------------------GSS.T...........RHGVKA--------LQGIVK---KM.Q
Q3B2C3_PELLD/65-133GFRLIR-------------------------------GSS.S...........KGGSEV--------RAAMQG---AL.Q
A0RQN4_CAMFF/65-129GIGTIR-------------------------------GST.T...........KGALKA--------LLAAFR---TI.K
I0AGE8_IGNAJ/62-130NYKVVR-------------------------------GSS.S...........KGGDVA--------LGIMVD---LA.K
R7MFY6_9CLOT/57-124GFNVCR-------------------------------GSS.N..........RKGAVSG--------TLMLLS---KL.K
B1LYS3_METRJ/71-150GVRVMR-------------------------------ASG.ARGRGRATDQRAKGGAEG--------LRAMLR---AL.K
W0RK11_9BACT/71-137GYRTVR-------------------------------GST.S...........RGAGRA--------LLELVR---VL.R
E4TYI7_SULKY/66-130KLGTIH-------------------------------GST.T...........RGGAKV--------LIQGLK---SL.S
D6Z3S1_DESAT/74-140NAELVR-------------------------------GSR.N...........RGGVAA--------LKSMIS---QV.K
L0KCN8_HALHC/57-123GWGVVR-------------------------------GST.S...........RGGARS--------LLKLVK---EI.R
Q6NDP3_RHOPA/63-131GIQTAV-------------------------------GSS.S...........KGGMRA--------AREMMR---LG.K
I7DWR6_PHAIB/80-148GFETIP-------------------------------MSS.H...........KRHVAL--------SREVLR---RT.K
B4U6Q4_HYDS0/48-121GFGVVR-------------------------------GSS.N......KDNKDKGGAKA--------LIQIKK---IL.E
Y090_RICPR/70-138GCQVIV-------------------------------GST.N...........KNSIVA--------LRNIIG---KL.S
C6BUF4_DESAD/64-130GYEVAR-------------------------------GSS.T...........RGGLKA--------MLGVAR---IMRK
R7L764_9BACT/67-134GIGTVR-------------------------------GSS.K...........RRGAGA--------ILDLIE---RL.K
D5BSX8_PUNMI/65-133GIRTVW-------------------------------GSS.N...........RNAISG--------LRGLKR---VL.D
D2QZ30_PIRSD/60-127GFQAIR-------------------------------GST.G...........RGGLRA--------VREIIR---TI..
Q3SPI1_NITWN/67-142GIETIR-------------------------------GSG.D...HGS.AFNRKGGVGA--------FKEMVR---AL.E
C6XQU3_HIRBI/73-149NLNPIR-------------------------------GSA.A...NKKKKNKDKGGTEA--------LRLATK---AL.K
B4S5E5_PROA2/69-137GFQLIR-------------------------------GSS.S...........RGSQAV--------KKQMLD---TI.T
Q8RE56_FUSNN/59-126GYILVR-------------------------------GSS.D...........KNQISS--------TISLLK---YL.K
A7ZE08_CAMC1/68-136GIGTIR-------------------------------GSS.S...........KGGARA--------LIEALR---EI.K
B3QSJ8_CHLT3/66-133HFKLVR-------------------------------GSS.S...........KGKELV--------KTQSKD---VL.E
B3DYR7_METI4/50-118NLIPAE-------------------------------GSS.S...........KKGASA--------FKAAIQ---AAKK
Q7MR26_WOLSU/59-123GFKTLR-------------------------------GSS.S...........KGAKRV--------LLGAIR---EL.E
W0J2E6_9BACT/116-183GIRVIR-------------------------------GSS.S...........NYGHKA--------ATALIA---AL.R
Q21CB2_RHOPB/63-131GIQTVT-------------------------------GSS.S...........KGGMRA--------VRELMR---FG.R
Q8KBV7_CHLTE/63-131GFHLIR-------------------------------GSS.S...........RGKEVV--------RRGIGV---AL.S
A9H0X4_GLUDA/73-146KIKAIA-------------------------------GST.D......RKGKSKGGARA--------LRRMLD---QV.R
D9S4X2_FIBSS/31-98HYEVTR-------------------------------GSD.T............HGATN--------VRHLLK---SL.K
R5XZA3_9PROT/77-145NILSID-------------------------------GSS.Y...........RKALPA--------ALSIVH---EL.E
A7HQR6_PARL1/69-149GVGTIR-------------------------------GAGVPKGEERAHKQKGKGGAGA--------LRAMVR---AL.G
V4IQX8_9DELT/64-132DFETVR-------------------------------GSR.N...........RGGLSA--------LRGLIR---VM.R
B4REI6_PHEZH/69-143GFPAIR-------------------------------VSS.A...KKGDSAKARQAVAA--------IREATT---WV.A
E8X0D5_ACISM/63-131GFIAIR-------------------------------GSS.T...........RGGSTA--------LRQMVE---HF.K
E3HZ07_RHOVT/78-152DMGLIR-------------------------------GAG.A.....GESGKDRGGAGA--------LRAALK---AL.K
Q6MBL2_PARUW/79-142TGRVIR-------------------------------VPH.............HSRHEA--------LREMIR---HVNF
Q0C4B2_HYPNA/87-161DLDVVR-------------------------------GST.G...NKKKAGKDKGGMRA--------IAEAST---RL.R
F3Z2J0_DESAF/59-128GIPTIR-------------------------------GSS.S...........RGGVKA--------LVSAIR---LIER
M4V8B2_9DELT/59-127GGKTSR-------------------------------GSS.T...........RGGVSA--------LKGLIE---LT.K
G0JN00_9GAMM/54-122GYGAVR-------------------------------GST.R...........SGAVKG--------ARGMLR---AA.H
Q0PB56_CAMJE/61-126GLDTVR-------------------------------GST.S...........RGASSA--------LRAAFK---VL.E
D5V753_ARCNC/62-126GIYSIR-------------------------------GSS.T...........RGGTKA--------LIGAIK---EL.K
E8RHR4_DESPD/61-129GHVAVR-------------------------------GSS.N...........RGGVKA--------LREMID---HL.R
A7I0Q2_CAMHC/62-130GIGAIR-------------------------------GSS.S...........KNAARA--------LISAFR---EL.D
Q3AU77_CHLCH/57-125GFTLIR-------------------------------GSS.S...........TDGDMV--------KQRMYE---HV.Q
B2KBY8_ELUMP/72-140KMKAVR-------------------------------GST.S...........KGGANA--------LRNLID---LS.Q
E6W1J7_DESIS/59-127GHDAVR-------------------------------GSS.T...........RGAIAA--------LRQVIG---KL.R
E8R441_ISOPI/72-140GFNVVR-------------------------------GST.T...........RGGVRA--------LLELKE---LS.N
A6Q530_NITSB/66-130GLESIR-------------------------------GST.K...........KGGARV--------MISAMK---KM.K
Q1IHY6_KORVE/73-141GFPAVR-------------------------------GSS.S...........RGGAQA--------LRQLRA---MI.E
D5SXZ6_PLAL2/66-134GGKAIR-------------------------------GSS.R...........KGATSA--------LKQMLT---QT..
B8CZC4_HALOH/67-135GYRVVR-------------------------------GSS.S...........RGGGRA--------LLRLLR---EA.K
D1AZK0_SULD5/63-131GGGTIR-------------------------------GSS.S...........KGGVSA--------LRQALK---AL.Q
R5RAX8_9PROT/76-144GLGTIG-------------------------------GSS.N...........ENASGA--------AVKLMH---SL.K
B1ZNQ8_OPITP/76-143GMRAVR-------------------------------GST.S...........NFGREA--------ATALVQ---AQ.R
G2LIZ0_CHLTF/58-126GFGAAR-------------------------------GSA.T...........RGSVTA--------LKAMVK---AI.R
I4CDF4_DESTA/77-146GYDTVR-------------------------------GSS.S...........RGGKEA--------LAEMID---QIKD
C7JH60_ACEP3/75-148RIWSIA-------------------------------GSS.D......SKGKNKGGAAA--------LRRMRA---SL.R
C8X102_DESRD/59-128GYGLAR-------------------------------GST.S...........RGGLRA--------LVGACR---EIQK
E8T5G8_THEA1/50-120GFKTVR-------------------------------GST.G.........PGKGGERA--------FLQMLE---LL.D
F2NIN6_DESAR/44-112GAMILS-------------------------------GSR.N...........KGGLAA--------LKKMAG---LI.R
M1NHV0_DESSD/63-131GYSTVR-------------------------------GSR.K...........KGGLQA--------IKSLVR---HM.R
G8PRP9_PSEUV/64-140GLGLIR-------------------------------AAG.A...QRAKQIKKRGGMRG--------FIEALR---AL.K
E1QK73_DESB2/69-137GGVPVR-------------------------------GSS.S...........GGGMAG--------LRAMAR---FL.E
L0DF38_SINAD/64-131GFGVVR-------------------------------GST.T...........RGGARA--------LREMTS---RV.D
Q1MQ03_LAWIP/64-132GLETAR-------------------------------GSS.S...........RGGSEA--------LRNVIK---RM.K
R6HP46_9PROT/74-142GMGTIG-------------------------------GSS.T...........ENGKNA--------ALELMR---SL.Q
D3DFJ2_HYDTT/56-129GYHVIR-------------------------------GST.E......EGRAEKGGRSG--------VIKLIK---AI.K
W0JIH7_DESAE/48-117KMGTIG-------------------------------GSV.N...........RNPKKA--------FLEMLK---LIKN
K7YPV9_9PROT/65-133ITLPIE-------------------------------GST.R...........RKPMNA--------LRGMLR---AL.K
F9ZPD4_ACICS/63-131GFGAVR-------------------------------GST.R...........RGAVRG--------AKGMLR---AA.R
A0LIS3_SYNFM/43-111GMRCFR-------------------------------GSP.G...........KGGGAA--------LKGLID---AL.Q
D8PHJ4_9BACT/77-145GLDAVR-------------------------------GSS.T...........RGGAEA--------FRQLIR---LG.R
C1F7K9_ACIC5/65-133GYQSVR-------------------------------GSS.S...........RGGAAG--------LLALGS---VL.T
I0IL07_LEPFC/80-149GILCVR-------------------------------GSS.T...........RGGKEA--------LSDILI---AGSD
A8ERF0_ARCB4/62-126KIGAVR-------------------------------GST.S...........KGAAKV--------MISAIK---EL.K
Q5LVH2_RUEPO/68-136GMDTIA-------------------------------MSS.H...........KRHVAL--------SREVLG---KM.K
F2LXE1_HIPMA/50-118GLKTVW-------------------------------GSS.N...........REPLKA--------FRSMVK---EI.K
D5C4J1_NITHN/50-118GYSAVR-------------------------------GSS.S...........RGGLKA--------LSAMVK---EI.Q
D6ZZS2_STAND/64-139GIGAVR-------------------------------GSG.A...QGR.DFRTKGGFNA--------TVEMIR---HL.S
B6JIY0_OLICO/67-142NVGTVR-------------------------------GSG.D...HGS.EFHRKGGVAA--------FKTMLR---EL.D
A4Z0S3_BRASO/67-143GIGTIR-------------------------------GSG.D...HGG.SFHRKGGVGA--------FREMVQ---AL.E
F8KRG5_HELBC/66-130GFNAIR-------------------------------GSS.K...........KGGVRV--------LIEGIR---HL.K
C7LQU5_DESBD/60-129GFMSVR-------------------------------GSS.S...........RGGMRA--------LIAAKR---VMDE
I3TPI2_TISMK/68-136GLGSVA-------------------------------GSS.S...........KGGAAA--------VRQIVK---AI.R
F8JIN3_HYPSM/61-135DVQLIR-------------------------------GAG.A.....GYRKKDRGGASA--------LRSSLQ---AL.L
I3ZEX2_TERRK/83-151GFVPIR-------------------------------GSS.S...........RGGAAG--------LLAATR---AR.A
J9Z9Q6_LEPFM/85-154GIGTIR-------------------------------GSS.T...........RGGTSV--------LRQVLA---VTKS
I4B448_TURPD/68-135GGDVAR-------------------------------GSS.S...........RGGKEA--------LTMLSH---ALGR
D5EMA6_CORAD/74-142GMEPVR-------------------------------GSR.Y...........NRGAQA--------LRELIQ---AS.E
A8ZZ32_DESOH/66-137GYDVVR-------------------------------GSS.S...........QGGRTA--------LLNMVS---YM.K
Q2YIH6_BRUA2/79-155GLLTVR-------------------------------GSG.G...RGTRANPEKGGARA--------LLTLKN---AL.R
Q2YMG0_BRUA2/58-131GIRAIR-------------------------------GSG.A....GQRKGNRQGGAAA--------LRQMLY---AL.R
D5MG22_9BACT/72-140GFEVIR-------------------------------GSA.T...........RGGMRA--------IKQMIR---AI.K
C5AWR7_METEA/66-144GVRVMR-------------------------------ASG.A.RGRAVKDARAKGGAEG--------LRAMVK---AL.K
Q2VZT0_MAGSA/67-135GIETVQ-------------------------------GST.T...........RGGSAA--------LRAMLK---FL.K
B3EMB6_CHLPB/59-127GFSLIR-------------------------------GSS.S...........KGSSEV--------KKSMIA---RL.E
C1A8S4_GEMAT/86-154GAFGIR-------------------------------GSS.S...........RGGTRA--------LLEAAR---IA.R
B0SQM7_LEPBP/59-127GNTSVR-------------------------------GSS.S...........KGGSKA--------LKSVIQ---HL.K
S0EW12_CHTCT/80-145GFQTVR-------------------------------GST.G...........RGGVRG--------ALEMAR---KV.Q
Q7VGP5_HELHP/69-137GLKTLR-------------------------------GSS.S...........KGGLRV--------LMEALK---LL.K
I6Z7D3_MELRP/64-132GYKVVR-------------------------------GSS.H...........VGGKEA--------LEEMIS---LL.K

PF03982

DGAT2_MOUSE/92-388IIIVVG-------------------------------GAAES-----------LSSMPGKNAVTLKNRKGFVK--LALRH
Q23067_CAEEL/63-359CAIVIG-------------------------------GASEA-----------LEAHPNKNTLTLINRRGFCK--YALKF
Q9XUW0_CAEEL/50-345VVIVVG-------------------------------GAAEA-----------LEAHPGKHTLTLANRKGFVR--EAVKT
Q9N4S3_CAEEL/44-340VVLVIG-------------------------------GAEEA-----------LDAHPGYHTLTLASRKGFVR--EALIT
O01881_CAEEL/55-349VVLVVG-------------------------------GAEEA-----------LDAHPGCHILTLKKRKGFVK--IALQT
DGAT2_ARATH/39-312CVLVPG-------------------------------GVQET-----------FHMQHDAENVFLSRRRGFVR--IAMEQ

PF01553

Q23598_CAEEL/54-198N................K--W.VHIFP-EG....KVCTLE...................SEP....LRFKWGIGRLVMDA
GPAT1_MOUSE/205-355Q................Q--F.LEIFL-EG.....TRSRS...................GKT....SCARAGLLSVVVDT
Q21812_CAEEL/224-347N................K--LPIIIFP-EG.....TCINN...................TSV....MMFKKGSFEI....
O54097_STRCO/67-199G................E--L.VGVMP-EGYKGLGKPFEE...................RYRL..QRFGRGGFAAVALRS
PLSC_HAEIN/52-180D................N--LSIWMFP-EG.....TRNRG...................RGL....LPFKTGAFHAAISA
Q9VRC1_DROME/201-323D................R--PPVLLFP-EG.....TCINN...................TAV....MQFKKGSFAV....
Y2427_MYCLE/138-270G................E--L.TAVFP-EGYKGLGKRFQD...................RYRL..QRFGRGGFVKAALST
O06830_MYCTU/42-173G................G--V.VVVFP-GGDYDAYRPTFA...................ENVI..DFNGRKGYVSTAVEA
O53962_MYCTU/46-174G................E--L.VMVFP-GGAREVNKRKNE...................RYKL..VWKNRLGFARLAIQH
TAZ_HUMAN/41-215G................D--W.VHIFP-EG.....KVNMS...................SEF....LRFKWGIGRLIAEC
Q23087_CAEEL/81-242.................K--YQLLLFP-EG.....TDKCPKATERSRI..HSEKKGLVHYQYV..LHPRVTGFVHIVQAM
P73054_SYNY3/40-177G................E--M.LVIFP-EG.....GIFRD....................QHT..VHPLKRGIGRIAMEV
PLSC_BACSU/18-142G................E--I.VGIFP-SG.....TRTSE.........................DVPLKRGAVTIAQMG
O16526_CAEEL/65-226.................K--YQILLFA-EG.....TDKGERATRLSDA..FADKNGLPRYEYV..LHPRTTGFKFLMELM
PLC2_CAEEL/77-205R................N--LKLWVFP-EG.....TRNRE...................GGF....IPFKKGAFNIAVRA
PLSC_MYCPN/72-202G................T--A.LCVFP-EG.....TRVLS...................RQI....GEFKSGALKVAYNA
O07807_MYCTU/22-151G................E--L.VGVYP-EA.....TISRS...................FEI....KEFKTGAARMAIEA
O67119_AQUAE/640-768G................K--V.VVIFP-EG.....ARTRT...................EEL....MEFKKGVAILAREL
P74498_SYNY3/43-168G................W--L.VGVFL-EG.....TRTKD...................GRI....HQPKLGAAMIAAKA
O07809_MYCTU/23-150G................E--L.VGLHP-EA.....TISRS...................LEL....REFKTGAARMALEA
PLSC_YEAST/62-191N................K--RALWVFP-EG.....TRSYT...................SELT..MLPFKKGAFHLAQQG
PLSC_ECOLI/52-180R................R--ISIWMFP-EG.....TRSRG...................RGL....LPFKTGAFHAAIAA
PLCB_HUMAN/77-205E................N--LKVWIYP-EG.....TRNDN...................GDL....LPFKKGAFYLAVQA
PLC1_CAEEL/73-201K................K--RKVWIYP-EG.....TRNAE...................PEL....LPFKKGAFILAKQA
PLSC_BORBU/67-194G................R--S.IGIFP-EG.....TRNRG...................GDT....RVFKKGSIKMALKT
O84813_CHLTR/101-259G................G--KFFYVAP-SG.....GRDRKN................LQGELY..PAEFHPDSVEMFRLL
Q9W1B5_DROME/236-359N................N--PPILIFP-EG.....TCINN...................TSV....MQFKKGSFEV....
PLSB_ECOLI/281-425G................Y--S.VEYFV-EG.....GRSRT...................GRL....LDPKTGTLSMTIQA
O53516_MYCTU/20-152G................K--L.LGMYP-EG.....TRSPD...................GRL....YKGKTGLARLALHT
YD018_YEAST/84-276SI..............AA--YNLIMFP-EG.....TNLSLKTREKSEAFCQRAHLDHVQLRHL..LLPHSKGLKFAVEKL
PLSB_ARATH/208-367G................G--QLIWIAP-SG.....GRDRPNP...............STGEWF..PAPFDASSVDNMRRL
O07808_MYCTU/23-150G................E--L.VGVYP-EA.....TISRS...................FEL....KGFKTGAARMAAEA
CST26_YEAST/74-282GESIWNPEVIDPKQIHWP--YNLILFP-EG.....TNLSADTRQKSAK..YAAKIGKKPFKNV..LLPHSTGLRYSLQKL
PLCA_HUMAN/83-211Q................D--VRVWVFP-EG.....TRNHN...................GSM....LPFKRGAFHLAVQA
AAS_ECOLI/15-138G................R--P.VVIFP-EG.....RITTT...................GSL....MKIYDGAGFVAAKS
Q9N5S8_CAEEL/317-440D................K--LPILIFP-EG.....TCINN...................TSV....MMFKKGSFEI....
GNPAT_HUMAN/138-283G................Y--APVEFFL-EG.....TRSRS...................AKT....LTPKFGLLNIVMEP
O67841_AQUAE/28-151G................C--K.IGIFP-EG.....TRANP...................GEF....KRAKPGVGFLAINS
PLSB_CAEEL/142-292D................M--P.IEFFL-EG.....TRSRF...................GKA....LTPKNGLISNVVEA
PLSB_HAEIN/281-425G................Y--S.VEYFI-EG.....GRSRT...................GRL....LAPKTGMMSMTLQA
H7C777_BURPS/53-173G................E--L.MCVFP-EG.....TTSDG...................LGL....LPFHSNLFQAVVSA
I6XFY8_MYCTU/82-222G................Q--T.VVAFP-EG.....TTWCGRPGDDAGRPAARAGAGCSHRGC....GAFYPAMFQAAIDA
I6YDI9_MYCTU/312-438G................L--S.IVIAP-EG.....TRLDT...................TEV....GSFKKGPFRIAMAA
L5KBJ1_PTEAL/229-351S................K--LPILIFP-EG.....TCINN...................TSV....MMFKKGSFEI....
Q3J501_RHOS4/70-203G................R--L.GVIFP-SG.....RLAKR...................TGLKLMERPWMASAAMIARKF
Q8GWG0_ARATH/153-274D................S--NPLLIFP-EG.....TCVNN...................NYT....VMFKKGAFEL....

PF03279

O84013_CHLTR/7-316G----------------E--.VVGIVG-DQ-----VLLSS---------------.EYSYPLFGSQAFTTTSPALLAYKT
Q9ZCL1_RICPR/1-290G----------------E--.SIVMLV-DQ-----KMNDG---------------..IEVPFLGRPSMTASSIAKIALQY
MSBB_ECOLI/11-305G----------------Y--.WGYYLP-DQ-----DHGPE---------------HSEFVDFFATYKATLPAIGRLMKVC
MSBB_HAEIN/17-309G----------------E--.MGYYLP-DE-----DFGAE---------------QSVFVDFFGTYKATLPGLNKMAKLS
HTRB_ECOLI/4-297G----------------E--.VVWYAP-DH-----DYGPR---------------SSVFVPLFAVEQAATTTGTWMLARM
HTRB_HAEIN/6-300E----------------E--.TIWYAP-DH-----DYGRK---------------NAVFVPFFAVPDTCTTTGSYYLLKS
O25057_HELPY/18-320G----------------N--GLVGILV-DQ-----NVVPK---------------DGVVVKFFDRDATHTTIASILSRRY
DDG_ECOLI/5-296G----------------E--.AVWFAP-DQ-----DYGRK---------------GSSFAPFFAVENVATTNGTYVLSRL
ACYLT_MYCTU/11-302N----------------R--.VVCLMA-ER-----DLTRT---------------.GVEVDFFGEPTRMPVGPAKLAVET
Q7AQJ0_MYCLE/10-306N----------------R--.VVCLMA-ER-----DLTRT---------------.GVEVDFFGEPTRMPAGPAKLAIKT

PF04028

A8ZZ01_DESOH/64-132S----------------G..YKIGHIV.DG-----PQGPF----------------------------------------
B0SP25_LEPBP/75-143Q----------------G..AVPIFTV.DG-----PKGPR----------------------------------------
B4SDV4_PELPB/57-125N----------------G..NIVALTP.DG-----PRGPA----------------------------------------
F2IZZ7_POLGS/64-140D----------------G..EIVALTA.DV-----PKGPA----------------------------------------
E1WZF2_BACMS/56-124E----------------G..IPSAVAI.DG-----PRGPL----------------------------------------
R5H3I3_9SPIR/57-124K----------------G..EDVAIMV.DG-----PGGPY----------------------------------------
Q6MRQ4_BDEBA/60-126D----------------G..GNCSFAV.DG-----PKGPL----------------------------------------
H9ULS0_SPIAZ/58-128D----------------G..HDGTIAM.DG-----PNGPA----------------------------------------
Q9ABC6_CAUCR/70-146D----------------G..GAMAITP.DG-----PRGPV----------------------------------------
A1BDV7_CHLPD/57-125S----------------G..DIVAITP.DG-----PRGPV----------------------------------------
E8RUM0_ASTEC/66-142A----------------G..NAVALTP.DG-----PRGPA----------------------------------------
D9QTV2_ACEAZ/58-126Q----------------G..EDVAITP.DG-----PRGPR----------------------------------------
Q983L9_RHILO/65-141A----------------G..KNVAMIA.DI-----PHGTP----------------------------------------
E0TGQ7_PARBH/67-143E----------------G..KNAGITP.DG-----PRGPR----------------------------------------
I5B662_9DELT/65-133Q----------------G..YKIGHIV.DG-----PQGPF----------------------------------------
J9ZBF5_LEPFM/54-123D----------------GC.TSLVFTP.DG-----PKGPI----------------------------------------
Q8F6G4_LEPIN/73-141K----------------N..FPAAITP.DG-----PRGPA----------------------------------------
V6EZ87_9PROT/67-135A----------------G..AYVGITP.DG-----PKGPR----------------------------------------
D3UG86_HELM1/67-136E----------------G..WDTGITP.DG-----PRGPY----------------------------------------
D3PAM4_DEFDS/54-122E----------------E..YDAAITV.DG-----PKGPI----------------------------------------
B8DJK1_DESVM/57-126E----------------G..LCGCVTV.DG-----PRGPR----------------------------------------
F0SQI7_PLABD/66-133G----------------K..YHIAITP.DG-----PRGPR----------------------------------------
F0S084_DESTD/50-120S----------------G..KSVAITP.DG-----PRGPK----------------------------------------
E8UZ77_TERSS/67-135S----------------G..LLAAFTA.DG-----PRGPV----------------------------------------
N0B9S3_9RHIZ/83-157D----------------G..HSLVMTA.DI-----PPGPA----------------------------------------
G8NV89_GRAMM/64-132D----------------G..RICAFTA.DG-----PKGPA----------------------------------------
E0UPC6_SULAO/66-130E----------------G..CDLGITP.DG-----PKGPR----------------------------------------
A7IFD8_XANP2/64-140Q----------------G..INVAMTA.DV-----PKIAR----------------------------------------
E3DMT5_HALPG/62-130H----------------G..FSAAITP.DG-----PTGPR----------------------------------------
E4RJY2_HALHG/62-130E----------------G..ENTALTI.DG-----PTGPI----------------------------------------
O25048_HELPY/11-75E----------------G..CDVAITP.DG-----PKGPR----------------------------------------
Q11L84_CHESB/71-147A----------------G..SNAAMIA.DI-----PHGTP----------------------------------------
Q0BPV8_GRABC/79-147Q----------------G..GRIIITP.DG-----PRGPR----------------------------------------
Q0AS10_MARMM/66-142A----------------G..GCGAVTP.DG-----PRGPR----------------------------------------
O67824_AQUAE/58-130E----------------G..KNVAITV.DG-----PKVP.----------------------------------------
Q30PR2_SULDN/66-130D----------------G..YDIGITP.DG-----PKGPR----------------------------------------
W0DGX2_9AQUI/56-129E----------------G..KNVAITV.DG-----PKGPP----------------------------------------
A6QCC9_SULNB/61-129A----------------G..EEVLITP.DG-----PRGPR----------------------------------------
J9Z1G0_9PROT/65-132N----------------G..DCIYITP.DA-----PHGPP----------------------------------------
R6PBE5_9CLOT/58-124Q----------------G..ECAAITI.DG-----PRGPF----------------------------------------
I7H665_9HELI/71-139N----------------G..YDIGIAP.DG-----PKGPY----------------------------------------
R6IYI6_9PROT/74-142N----------------D..TAICIIP.DG-----PKGPS----------------------------------------
F8E554_FLESM/55-122N----------------G..LNAAVTV.DG-----PKGPK----------------------------------------
B8FFT7_DESAA/67-135N----------------G..QPAGIVP.DG-----PQGPR----------------------------------------
Q3B2C3_PELLD/65-133R----------------G..NLVVLTP.DG-----PRGPL----------------------------------------
A0RQN4_CAMFF/65-129E----------------G..ADVAITP.DG-----PKGPR----------------------------------------
I0AGE8_IGNAJ/62-130S----------------K..YSVAITP.DG-----PKGPV----------------------------------------
R7MFY6_9CLOT/57-124E----------------G..ENIAIMV.DG-----PRGPL----------------------------------------
B1LYS3_METRJ/71-150A----------------G..ESVAFSA.DV-----PKVSR----------------------------------------
W0RK11_9BACT/71-137G----------------G..IDVAITP.DG-----PRGPR----------------------------------------
E4TYI7_SULKY/66-130E----------------G..YDIGITP.DG-----PKGPR----------------------------------------
D6Z3S1_DESAT/74-140Q----------------G..ANAGIIA.DG-----SQGPA----------------------------------------
L0KCN8_HALHC/57-123R----------------G..KNVAITP.DG-----PTGPR----------------------------------------
Q6NDP3_RHOPA/63-131S----------------G..HSLFVTP.DG-----PRGPR----------------------------------------
I7DWR6_PHAIB/80-148E----------------G..CSIGIAA.DG-----PRGPA----------------------------------------
B4U6Q4_HYDS0/48-121Q----------------G..YNIAITV.DG-----PTGPP----------------------------------------
Y090_RICPR/70-138Q----------------G..ANIIVTP.DG-----PKGPV----------------------------------------
C6BUF4_DESAD/64-130K----------------G..KIGAITM.DG-----PKGPR----------------------------------------
R7L764_9BACT/67-134S----------------S...DIFITP.DG-----PRGPK----------------------------------------
D5BSX8_PUNMI/65-133R----------------G..QIATITP.DG-----PRGPA----------------------------------------
D2QZ30_PIRSD/60-127G----------------H..ANLAITP.DG-----PRGPR----------------------------------------
Q3SPI1_NITWN/67-142E----------------G..YNVALTA.DV-----PKRSR----------------------------------------
C6XQU3_HIRBI/73-149K----------------G..GVVCMTP.DG-----PRGPR----------------------------------------
B4S5E5_PROA2/69-137N----------------H..GIVAITP.DG-----PRGPK----------------------------------------
Q8RE56_FUSNN/59-126K----------------G..YSIG.TPLDG-----PKGPK----------------------------------------
A7ZE08_CAMC1/68-136Q----------------G..HDVIITP.DG-----PRGPR----------------------------------------
B3QSJ8_CHLT3/66-133K----------------G..FLLSVTP.DG-----PRGPR----------------------------------------
B3DYR7_METI4/50-118E----------------G..YDIAVTP.DG-----PRGP.----------------------------------------
Q7MR26_WOLSU/59-123G----------------G..GDIAITP.DG-----PRGPY----------------------------------------
W0J2E6_9BACT/116-183R----------------G..SDIGLTP.DG-----PRGPR----------------------------------------
Q21CB2_RHOPB/63-131D----------------G..HCLFVTP.DG-----PRGPR----------------------------------------
Q8KBV7_CHLTE/63-131N----------------G..GVAAVTP.DG-----PRGPH----------------------------------------
A9H0X4_GLUDA/73-146N----------------D..SLIVITP.DG-----PRGPR----------------------------------------
D9S4X2_FIBSS/31-98D----------------N..RFVGMAL.DG-----PHGPA----------------------------------------
R5XZA3_9PROT/77-145Q----------------G..TVVALIP.DG-----PRGPR----------------------------------------
A7HQR6_PARL1/69-149E----------------N..ISVALTA.DL-----PPGPA----------------------------------------
V4IQX8_9DELT/64-132S----------------G..KHAGIVA.DG-----SQGPP----------------------------------------
B4REI6_PHEZH/69-143G----------------G..GALVVTP.DG-----PRGPN----------------------------------------
E8X0D5_ACISM/63-131N----------------G..HQCAITA.DG-----PKGPP----------------------------------------
E3HZ07_RHOVT/78-152G----------------G..TTVAMTT.DI-----PPGPA----------------------------------------
Q6MBL2_PARUW/79-142K----------------K..SIAIITP.DG-----PRGPR----------------------------------------
Q0C4B2_HYPNA/87-161K----------------G..DYICMTP.DG-----PRGPR----------------------------------------
F3Z2J0_DESAF/59-128Q----------------G..HDIVITV.DG-----PRGPR----------------------------------------
M4V8B2_9DELT/59-127N----------------G..SSCGVAV.DG-----PKGPI----------------------------------------
G0JN00_9GAMM/54-122A----------------G..YDLAISP.DG-----PRGPR----------------------------------------
Q0PB56_CAMJE/61-126Q----------------N..DDIVITP.DG-----PRGPY----------------------------------------
D5V753_ARCNC/62-126G----------------G..DDIAITP.DG-----PKGPR----------------------------------------
E8RHR4_DESPD/61-129H----------------G..KNSAIVA.DG-----SQGPA----------------------------------------
A7I0Q2_CAMHC/62-130N----------------G..VNIVITP.DG-----PRGPF----------------------------------------
Q3AU77_CHLCH/57-125Q----------------G..QMVAITP.DG-----PRGPN----------------------------------------
B2KBY8_ELUMP/72-140A----------------G..YHPMITP.DG-----PRGPI----------------------------------------
E6W1J7_DESIS/59-127Q----------------G..HDVAITP.DG-----PKGPP----------------------------------------
E8R441_ISOPI/72-140R----------------G..GNLCFTP.DG-----PRGPR----------------------------------------
A6Q530_NITSB/66-130A----------------G..YDIAITP.DG-----PRGPR----------------------------------------
Q1IHY6_KORVE/73-141N----------------K..RNAVFTI.DG-----PRGPR----------------------------------------
D5SXZ6_PLAL2/66-134D----------------G..YHILITP.DG-----PMGPR----------------------------------------
B8CZC4_HALOH/67-135K----------------G..ATVLLTP.DG-----PRGPI----------------------------------------
D1AZK0_SULD5/63-131N----------------G..RDIGITP.DG-----PRGPR----------------------------------------
R5RAX8_9PROT/76-144D----------------D..TAICIIP.DG-----PRGPR----------------------------------------
B1ZNQ8_OPITP/76-143E----------------G..HDIGITP.DG-----PRGP.----------------------------------------
G2LIZ0_CHLTF/58-126Q----------------G..ADAAFTI.DG-----PKGPR----------------------------------------
I4CDF4_DESTA/77-146R----------------N..YCSGLAV.DA-----PRGPS----------------------------------------
C7JH60_ACEP3/75-148N----------------A..TLVAITP.DG-----PRGPR----------------------------------------
C8X102_DESRD/59-128K----------------G..RDAVLTV.DG-----PRGPR----------------------------------------
E8T5G8_THEA1/50-120K----------------G..YVVAITP.DG-----PRGPR----------------------------------------
F2NIN6_DESAR/44-112R----------------G..QSGGIIA.DG-----SRGPC----------------------------------------
M1NHV0_DESSD/63-131A----------------G..QNAAIVA.DG-----SQGPA----------------------------------------
G8PRP9_PSEUV/64-140E----------------G..GNVAMTA.DV-----PKGPS----------------------------------------
E1QK73_DESB2/69-137G----------------GPRRYAATVA.DG-----PRGPR----------------------------------------
L0DF38_SINAD/64-131R----------------G...HLCVTP.DG-----PKGPR----------------------------------------
Q1MQ03_LAWIP/64-132D----------------G..FCACITV.DG-----PKGPR----------------------------------------
R6HP46_9PROT/74-142K----------------G..EAIAIIP.DG-----PKGPS----------------------------------------
D3DFJ2_HYDTT/56-129D----------------G..NNVAITV.DG-----PKGPA----------------------------------------
W0JIH7_DESAE/48-117Q----------------A..CDIGITP.DG-----PRGPR----------------------------------------
K7YPV9_9PROT/65-133K----------------G..YPVAITP.DG-----PRGPR----------------------------------------
F9ZPD4_ACICS/63-131E----------------G..YDLAITP.DG-----PRGPR----------------------------------------
A0LIS3_SYNFM/43-111S----------------S..YGGGFIA.DG-----SQGPP----------------------------------------
D8PHJ4_9BACT/77-145S----------------G..GNLVLTP.DG-----PKGPR----------------------------------------
C1F7K9_ACIC5/65-133K----------------G..QPVVFTA.DG-----PRGPI----------------------------------------
I0IL07_LEPFC/80-149P----------------G..MTLVVTP.DG-----PKGPA----------------------------------------
A8ERF0_ARCB4/62-126D----------------G..NDIAITP.DG-----PRGPR----------------------------------------
Q5LVH2_RUEPO/68-136D----------------G..ISIGIAA.DG-----PRGPE----------------------------------------
F2LXE1_HIPMA/50-118S----------------G..YSIGITP.DG-----PKGPP----------------------------------------
D5C4J1_NITHN/50-118Q----------------G..RDAAFTI.DG-----PRGPR----------------------------------------
D6ZZS2_STAND/64-139E----------------G..TNVAMTA.DV-----PKISR----------------------------------------
B6JIY0_OLICO/67-142N----------------N..TNMALTA.DV-----PKVAR----------------------------------------
A4Z0S3_BRASO/67-143D----------------N..YNVASTA.DV-----PKRAR----------------------------------------
F8KRG5_HELBC/66-130A----------------G..ADVGLTP.DG-----PKGPY----------------------------------------
C7LQU5_DESBD/60-129Q----------------G..VGVIFTV.DG-----PRGPR----------------------------------------
I3TPI2_TISMK/68-136A----------------G..EYAGVTP.DG-----PRGPR----------------------------------------
F8JIN3_HYPSM/61-135D----------------G..SSVVMTA.DV-----PPGPA----------------------------------------
I3ZEX2_TERRK/83-151A----------------D..HKVAITA.DG-----PRGPV----------------------------------------
J9Z9Q6_LEPFM/85-154Q----------------E..SSFFVTP.DG-----PTGPP----------------------------------------
I4B448_TURPD/68-135R----------------K..SSVVMTP.DG-----PRGPM----------------------------------------
D5EMA6_CORAD/74-142A----------------G..FDIGVTP.DG-----SRGPI----------------------------------------
A8ZZ32_DESOH/66-137T----------------SPVQMICGTPVDG-----PRGPG----------------------------------------
Q2YIH6_BRUA2/79-155K----------------G..QSTSMIA.DI-----AHGKA----------------------------------------
Q2YMG0_BRUA2/58-131N----------------G..ESIVMAA.ET-----NKK..----------------------------------------
D5MG22_9BACT/72-140G----------------G..LDLVVTP.DG-----PKGPR----------------------------------------
C5AWR7_METEA/66-144G----------------G..ETVAFSA.DV-----PKVSR----------------------------------------
Q2VZT0_MAGSA/67-135S----------------G..ECVGITP.DG-----PKGPR----------------------------------------
B3EMB6_CHLPB/59-127K----------------N..GIIAITP.DG-----PRGPS----------------------------------------
C1A8S4_GEMAT/86-154Q----------------G..TDIAFTP.DG-----PRGPR----------------------------------------
B0SQM7_LEPBP/59-127K----------------G..LPAAFTP.DG-----PRGPA----------------------------------------
S0EW12_CHTCT/80-145K----------------G..EVLAFTP.DG-----PRGPT----------------------------------------
Q7VGP5_HELHP/69-137G----------------G..CDIGMSP.DG-----PKGPY----------------------------------------
I6Z7D3_MELRP/64-132E----------------K..HTLVITP.DG-----PRGPR----------------------------------------

PF03982

DGAT2_MOUSE/92-388G----------------ADLVPTYSFG-ENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSK
Q23067_CAEEL/63-359G----------------ADLVPMYNFG-ENDLYEQYENPKGSRLREVQEKIKDMFGLCPPLLRGRSLFNQYLIGLLPFRK
Q9XUW0_CAEEL/50-345G----------------AHLVPVYAFG-ENDIYKQIDNPEGSKLRKIQEWGKKKMGISLPLIYGRGYFQ.MALGLLPMSR
Q9N4S3_CAEEL/44-340G----------------AYLVPVYSFG-ENDVFEQMENPVGSRLRNFQEWCKSIFGISYPIFHGRGFFQ.LTFGYLPFRK
O01881_CAEEL/55-349G----------------AQLVPCYSFG-ENDIFNQAENPKGSTIRQFQTIMKRVLGFSPPAFYGRGVFN.YTFGLLPFRK
DGAT2_ARATH/39-312G----------------SPLVPVFCFG-QARVYKWWKPDCDLYL.....KLSRAIRFTPICFWG..VFGSP....LPCRQ

PF01553

Q23598_CAEEL/54-198K.....TD--PVILPVWCK-------------------------------------------------------------
GPAT1_MOUSE/205-355LSSNTIPD--ILVIPVGIS-------------------------------------------------------------
Q21812_CAEEL/224-347.......G--STIYPIAVK-------------------------------------------------------------
O54097_STRCO/67-199.......R--RPMVPCSIV-------------------------------------------------------------
PLSC_HAEIN/52-180.......G--VPIIPVVCS-------------------------------------------------------------
Q9VRC1_DROME/201-323.......S--DVVHPVAIR-------------------------------------------------------------
Y2427_MYCLE/138-270.......K--ATIVPCSIV-------------------------------------------------------------
O06830_MYCTU/42-173.......G--VPIVPAVSI-------------------------------------------------------------
O53962_MYCTU/46-174.......G--YPIVPFASV-------------------------------------------------------------
TAZ_HUMAN/41-215H.....LN--PIILPLWHV-------------------------------------------------------------
Q23087_CAEEL/81-242RRANNIKY--IYDVSIGFG-------------------------------------------------------------
P73054_SYNY3/40-177CKQNPNTD--IKVIPVTIA-------------------------------------------------------------
PLSC_BACSU/18-142.......K--APLVPAAYQ-------------------------------------------------------------
O16526_CAEEL/65-226KKENYIKY--VYDLTIAYS-------------------------------------------------------------
PLC2_CAEEL/77-205.......Q--IPIIPVVFS-------------------------------------------------------------
PLSC_MYCPN/72-202.......F--VPIVPLTIV-------------------------------------------------------------
O07807_MYCTU/22-151.......G--VPIVPHIVW-------------------------------------------------------------
O67119_AQUAE/640-768.......G--VPIVPVAIE-------------------------------------------------------------
P74498_SYNY3/43-168.......Q--VPIIPVSLG-------------------------------------------------------------
O07809_MYCTU/23-150.......Q--VPIIPMIVW-------------------------------------------------------------
PLSC_YEAST/62-191.......K--IPIVPVVVS-------------------------------------------------------------
PLSC_ECOLI/52-180.......G--VPIIPVCVS-------------------------------------------------------------
PLCB_HUMAN/77-205.......Q--VPIVPVVYS-------------------------------------------------------------
PLC1_CAEEL/73-201.......K--IPIVPCVFS-------------------------------------------------------------
PLSC_BORBU/67-194.......G--TSILPVTLY-------------------------------------------------------------
O84813_CHLTR/101-259AKS.SGKT--THFFPLAMK-------------------------------------------------------------
Q9W1B5_DROME/236-359.......G--GVIYPVAIK-------------------------------------------------------------
PLSB_ECOLI/281-425MLRGGTRP--ITLIPIYIG-------------------------------------------------------------
O53516_MYCTU/20-152.......G--VPVIPVAMI-------------------------------------------------------------
YD018_YEAST/84-276AP..SLDA--IYDVTIGYS-------------------------------------------------------------
PLSB_ARATH/208-367VEH.SGAP--GHIYPMSLL-------------------------------------------------------------
O07808_MYCTU/23-150.......D--VPIVPVVVW-------------------------------------------------------------
CST26_YEAST/74-282KP..SIES--LYDITIGYS-------------------------------------------------------------
PLCA_HUMAN/83-211.......Q--VPIVPIVMS-------------------------------------------------------------
AAS_ECOLI/15-138.......G--ATVIPVRIE-------------------------------------------------------------
Q9N5S8_CAEEL/317-440.......G--TTIYPIAMK-------------------------------------------------------------
GNPAT_HUMAN/138-283FFKREVFD--TYLVPISIS-------------------------------------------------------------
O67841_AQUAE/28-151.......G--FPVLPVYID-------------------------------------------------------------
PLSB_CAEEL/142-292VQHGFIKD--CYLVPVSYT-------------------------------------------------------------
PLSB_HAEIN/281-425LQHSQTRP--ISIVPVYVG-------------------------------------------------------------
H7C777_BURPS/53-173.......D--CSVQPICL.-------------------------------------------------------------
I6XFY8_MYCTU/82-222.......G--RPVQPLR..-------------------------------------------------------------
I6YDI9_MYCTU/312-438.......K--IPIVPIVI.-------------------------------------------------------------
L5KBJ1_PTEAL/229-351.......G--ATVYPVAIK-------------------------------------------------------------
Q3J501_RHOS4/70-203.......D--LPVAPVNI.-------------------------------------------------------------
Q8GWG0_ARATH/153-274.......D--CTVCPIAIK-------------------------------------------------------------

PF03279

O84013_CHLTR/7-316-------K..KTVIAVAIYRKPNGNYLVVPSKAFHANTELSIRE....STEQLMDRLMRFLEKGITCKPEQWLWLHKRWK
Q9ZCL1_RICPR/1-290-------K..YPIIPCQIIRTKGS....YFKVIVHPQLKFEQTGDNKVDCYNIMFNINQILGEWVKQNPAQWFWFHNRWK
MSBB_ECOLI/11-305-------R..ARVVPLFPIYDGKT...HRLTIQVRPPMDDLLEA....DDHTIARRMNEEVEIFVGPRPEQYTWILKLLK
MSBB_HAEIN/17-309-------K..AVVIPMFPRYNAET...GKYEMEIHPAMNLSDD......PEQSARAMNEEIESFVTPAPEQYVWILQLLR
HTRB_ECOLI/4-297-------S.GACLVPFVPRRKPDG...KGYQLIMLPPECSPPLD....DAETTAAWMNKVVEKCIMMAPEQYMWLHRRFK
HTRB_HAEIN/6-300-------SQNSKVIPFAPLRNKDG...SGYTVSISAPVDFTDLQ....DETAIAARMNQIVEKEIMKDITIYMWLHRRFK
O25057_HELPY/18-320-------N..IDIQPVFIDFNDDY...SHYTATYYPSIRSQITDNAQNDILECTQAQASLCEEVIRNHPESYFWFHRRFK
DDG_ECOLI/5-296-------S.GAAMLTVTMVRKADY...SGYRLFITPEMEGYPT.....DENQAAAYMNKIIEKEIMRAPEQYLWIHRRFK
ACYLT_MYCTU/11-302-------G..AALLPTHCWFEGRG.....WGFQVYPALDCTSG.....DVAAITQALADRFAQNIAAHPADWHMLQPQWL
Q7AQJ0_MYCLE/10-306-------G..AALLPVHCWFQGSG.....WGFSVHPALDCTSG.....DVGDVTQALADQFAQDIAANPTDWHMLQPQWL

PF04028

A8ZZ01_DESOH/64-132--------------------------------------------------------------------------------
B0SP25_LEPBP/75-143--------------------------------------------------------------------------------
B4SDV4_PELPB/57-125--------------------------------------------------------------------------------
F2IZZ7_POLGS/64-140--------------------------------------------------------------------------------
E1WZF2_BACMS/56-124--------------------------------------------------------------------------------
R5H3I3_9SPIR/57-124--------------------------------------------------------------------------------
Q6MRQ4_BDEBA/60-126--------------------------------------------------------------------------------
H9ULS0_SPIAZ/58-128--------------------------------------------------------------------------------
Q9ABC6_CAUCR/70-146--------------------------------------------------------------------------------
A1BDV7_CHLPD/57-125--------------------------------------------------------------------------------
E8RUM0_ASTEC/66-142--------------------------------------------------------------------------------
D9QTV2_ACEAZ/58-126--------------------------------------------------------------------------------
Q983L9_RHILO/65-141--------------------------------------------------------------------------------
E0TGQ7_PARBH/67-143--------------------------------------------------------------------------------
I5B662_9DELT/65-133--------------------------------------------------------------------------------
J9ZBF5_LEPFM/54-123--------------------------------------------------------------------------------
Q8F6G4_LEPIN/73-141--------------------------------------------------------------------------------
V6EZ87_9PROT/67-135--------------------------------------------------------------------------------
D3UG86_HELM1/67-136--------------------------------------------------------------------------------
D3PAM4_DEFDS/54-122--------------------------------------------------------------------------------
B8DJK1_DESVM/57-126--------------------------------------------------------------------------------
F0SQI7_PLABD/66-133--------------------------------------------------------------------------------
F0S084_DESTD/50-120--------------------------------------------------------------------------------
E8UZ77_TERSS/67-135--------------------------------------------------------------------------------
N0B9S3_9RHIZ/83-157--------------------------------------------------------------------------------
G8NV89_GRAMM/64-132--------------------------------------------------------------------------------
E0UPC6_SULAO/66-130--------------------------------------------------------------------------------
A7IFD8_XANP2/64-140--------------------------------------------------------------------------------
E3DMT5_HALPG/62-130--------------------------------------------------------------------------------
E4RJY2_HALHG/62-130--------------------------------------------------------------------------------
O25048_HELPY/11-75--------------------------------------------------------------------------------
Q11L84_CHESB/71-147--------------------------------------------------------------------------------
Q0BPV8_GRABC/79-147--------------------------------------------------------------------------------
Q0AS10_MARMM/66-142--------------------------------------------------------------------------------
O67824_AQUAE/58-130--------------------------------------------------------------------------------
Q30PR2_SULDN/66-130--------------------------------------------------------------------------------
W0DGX2_9AQUI/56-129--------------------------------------------------------------------------------
A6QCC9_SULNB/61-129--------------------------------------------------------------------------------
J9Z1G0_9PROT/65-132--------------------------------------------------------------------------------
R6PBE5_9CLOT/58-124--------------------------------------------------------------------------------
I7H665_9HELI/71-139--------------------------------------------------------------------------------
R6IYI6_9PROT/74-142--------------------------------------------------------------------------------
F8E554_FLESM/55-122--------------------------------------------------------------------------------
B8FFT7_DESAA/67-135--------------------------------------------------------------------------------
Q3B2C3_PELLD/65-133--------------------------------------------------------------------------------
A0RQN4_CAMFF/65-129--------------------------------------------------------------------------------
I0AGE8_IGNAJ/62-130--------------------------------------------------------------------------------
R7MFY6_9CLOT/57-124--------------------------------------------------------------------------------
B1LYS3_METRJ/71-150--------------------------------------------------------------------------------
W0RK11_9BACT/71-137--------------------------------------------------------------------------------
E4TYI7_SULKY/66-130--------------------------------------------------------------------------------
D6Z3S1_DESAT/74-140--------------------------------------------------------------------------------
L0KCN8_HALHC/57-123--------------------------------------------------------------------------------
Q6NDP3_RHOPA/63-131--------------------------------------------------------------------------------
I7DWR6_PHAIB/80-148--------------------------------------------------------------------------------
B4U6Q4_HYDS0/48-121--------------------------------------------------------------------------------
Y090_RICPR/70-138--------------------------------------------------------------------------------
C6BUF4_DESAD/64-130--------------------------------------------------------------------------------
R7L764_9BACT/67-134--------------------------------------------------------------------------------
D5BSX8_PUNMI/65-133--------------------------------------------------------------------------------
D2QZ30_PIRSD/60-127--------------------------------------------------------------------------------
Q3SPI1_NITWN/67-142--------------------------------------------------------------------------------
C6XQU3_HIRBI/73-149--------------------------------------------------------------------------------
B4S5E5_PROA2/69-137--------------------------------------------------------------------------------
Q8RE56_FUSNN/59-126--------------------------------------------------------------------------------
A7ZE08_CAMC1/68-136--------------------------------------------------------------------------------
B3QSJ8_CHLT3/66-133--------------------------------------------------------------------------------
B3DYR7_METI4/50-118--------------------------------------------------------------------------------
Q7MR26_WOLSU/59-123--------------------------------------------------------------------------------
W0J2E6_9BACT/116-183--------------------------------------------------------------------------------
Q21CB2_RHOPB/63-131--------------------------------------------------------------------------------
Q8KBV7_CHLTE/63-131--------------------------------------------------------------------------------
A9H0X4_GLUDA/73-146--------------------------------------------------------------------------------
D9S4X2_FIBSS/31-98--------------------------------------------------------------------------------
R5XZA3_9PROT/77-145--------------------------------------------------------------------------------
A7HQR6_PARL1/69-149--------------------------------------------------------------------------------
V4IQX8_9DELT/64-132--------------------------------------------------------------------------------
B4REI6_PHEZH/69-143--------------------------------------------------------------------------------
E8X0D5_ACISM/63-131--------------------------------------------------------------------------------
E3HZ07_RHOVT/78-152--------------------------------------------------------------------------------
Q6MBL2_PARUW/79-142--------------------------------------------------------------------------------
Q0C4B2_HYPNA/87-161--------------------------------------------------------------------------------
F3Z2J0_DESAF/59-128--------------------------------------------------------------------------------
M4V8B2_9DELT/59-127--------------------------------------------------------------------------------
G0JN00_9GAMM/54-122--------------------------------------------------------------------------------
Q0PB56_CAMJE/61-126--------------------------------------------------------------------------------
D5V753_ARCNC/62-126--------------------------------------------------------------------------------
E8RHR4_DESPD/61-129--------------------------------------------------------------------------------
A7I0Q2_CAMHC/62-130--------------------------------------------------------------------------------
Q3AU77_CHLCH/57-125--------------------------------------------------------------------------------
B2KBY8_ELUMP/72-140--------------------------------------------------------------------------------
E6W1J7_DESIS/59-127--------------------------------------------------------------------------------
E8R441_ISOPI/72-140--------------------------------------------------------------------------------
A6Q530_NITSB/66-130--------------------------------------------------------------------------------
Q1IHY6_KORVE/73-141--------------------------------------------------------------------------------
D5SXZ6_PLAL2/66-134--------------------------------------------------------------------------------
B8CZC4_HALOH/67-135--------------------------------------------------------------------------------
D1AZK0_SULD5/63-131--------------------------------------------------------------------------------
R5RAX8_9PROT/76-144--------------------------------------------------------------------------------
B1ZNQ8_OPITP/76-143--------------------------------------------------------------------------------
G2LIZ0_CHLTF/58-126--------------------------------------------------------------------------------
I4CDF4_DESTA/77-146--------------------------------------------------------------------------------
C7JH60_ACEP3/75-148--------------------------------------------------------------------------------
C8X102_DESRD/59-128--------------------------------------------------------------------------------
E8T5G8_THEA1/50-120--------------------------------------------------------------------------------
F2NIN6_DESAR/44-112--------------------------------------------------------------------------------
M1NHV0_DESSD/63-131--------------------------------------------------------------------------------
G8PRP9_PSEUV/64-140--------------------------------------------------------------------------------
E1QK73_DESB2/69-137--------------------------------------------------------------------------------
L0DF38_SINAD/64-131--------------------------------------------------------------------------------
Q1MQ03_LAWIP/64-132--------------------------------------------------------------------------------
R6HP46_9PROT/74-142--------------------------------------------------------------------------------
D3DFJ2_HYDTT/56-129--------------------------------------------------------------------------------
W0JIH7_DESAE/48-117--------------------------------------------------------------------------------
K7YPV9_9PROT/65-133--------------------------------------------------------------------------------
F9ZPD4_ACICS/63-131--------------------------------------------------------------------------------
A0LIS3_SYNFM/43-111--------------------------------------------------------------------------------
D8PHJ4_9BACT/77-145--------------------------------------------------------------------------------
C1F7K9_ACIC5/65-133--------------------------------------------------------------------------------
I0IL07_LEPFC/80-149--------------------------------------------------------------------------------
A8ERF0_ARCB4/62-126--------------------------------------------------------------------------------
Q5LVH2_RUEPO/68-136--------------------------------------------------------------------------------
F2LXE1_HIPMA/50-118--------------------------------------------------------------------------------
D5C4J1_NITHN/50-118--------------------------------------------------------------------------------
D6ZZS2_STAND/64-139--------------------------------------------------------------------------------
B6JIY0_OLICO/67-142--------------------------------------------------------------------------------
A4Z0S3_BRASO/67-143--------------------------------------------------------------------------------
F8KRG5_HELBC/66-130--------------------------------------------------------------------------------
C7LQU5_DESBD/60-129--------------------------------------------------------------------------------
I3TPI2_TISMK/68-136--------------------------------------------------------------------------------
F8JIN3_HYPSM/61-135--------------------------------------------------------------------------------
I3ZEX2_TERRK/83-151--------------------------------------------------------------------------------
J9Z9Q6_LEPFM/85-154--------------------------------------------------------------------------------
I4B448_TURPD/68-135--------------------------------------------------------------------------------
D5EMA6_CORAD/74-142--------------------------------------------------------------------------------
A8ZZ32_DESOH/66-137--------------------------------------------------------------------------------
Q2YIH6_BRUA2/79-155--------------------------------------------------------------------------------
Q2YMG0_BRUA2/58-131--------------------------------------------------------------------------------
D5MG22_9BACT/72-140--------------------------------------------------------------------------------
C5AWR7_METEA/66-144--------------------------------------------------------------------------------
Q2VZT0_MAGSA/67-135--------------------------------------------------------------------------------
B3EMB6_CHLPB/59-127--------------------------------------------------------------------------------
C1A8S4_GEMAT/86-154--------------------------------------------------------------------------------
B0SQM7_LEPBP/59-127--------------------------------------------------------------------------------
S0EW12_CHTCT/80-145--------------------------------------------------------------------------------
Q7VGP5_HELHP/69-137--------------------------------------------------------------------------------
I6Z7D3_MELRP/64-132--------------------------------------------------------------------------------

PF03982

DGAT2_MOUSE/92-388PITTVVGEPITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFGLPETEVLEVN------------------------
Q23067_CAEEL/63-359PVTTVMGRPIRVTQTDEPTVEQIDELHAKYCDALYNLFEEYKHLHSIPPDTHLIFQ------------------------
Q9XUW0_CAEEL/50-345AVNVVVGAPIQVEKELDPSKEVIDEIHGVYMEKLAELFEEHKAKFGVSKDTRLVFQ------------------------
Q9N4S3_CAEEL/44-340PIDTVVGAPIPVEKVENPTKEQIDELHTIYCQKLTELFDEHKEKYGVEKDVPLVLR------------------------
O01881_CAEEL/55-349PINTVLGAPISVTKTVNPTQEQIDTLHQTYMDRLHELFEEHKTKYDVSPTTQLVIN------------------------
DGAT2_ARATH/39-312PMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRVG....YDLELK------------------------

PF01553

Q23598_CAEEL/54-198-
GPAT1_MOUSE/205-355-
Q21812_CAEEL/224-347-
O54097_STRCO/67-199-
PLSC_HAEIN/52-180-
Q9VRC1_DROME/201-323-
Y2427_MYCLE/138-270-
O06830_MYCTU/42-173-
O53962_MYCTU/46-174-
TAZ_HUMAN/41-215-
Q23087_CAEEL/81-242-
P73054_SYNY3/40-177-
PLSC_BACSU/18-142-
O16526_CAEEL/65-226-
PLC2_CAEEL/77-205-
PLSC_MYCPN/72-202-
O07807_MYCTU/22-151-
O67119_AQUAE/640-768-
P74498_SYNY3/43-168-
O07809_MYCTU/23-150-
PLSC_YEAST/62-191-
PLSC_ECOLI/52-180-
PLCB_HUMAN/77-205-
PLC1_CAEEL/73-201-
PLSC_BORBU/67-194-
O84813_CHLTR/101-259-
Q9W1B5_DROME/236-359-
PLSB_ECOLI/281-425-
O53516_MYCTU/20-152-
YD018_YEAST/84-276-
PLSB_ARATH/208-367-
O07808_MYCTU/23-150-
CST26_YEAST/74-282-
PLCA_HUMAN/83-211-
AAS_ECOLI/15-138-
Q9N5S8_CAEEL/317-440-
GNPAT_HUMAN/138-283-
O67841_AQUAE/28-151-
PLSB_CAEEL/142-292-
PLSB_HAEIN/281-425-
H7C777_BURPS/53-173-
I6XFY8_MYCTU/82-222-
I6YDI9_MYCTU/312-438-
L5KBJ1_PTEAL/229-351-
Q3J501_RHOS4/70-203-
Q8GWG0_ARATH/153-274-

PF03279

O84013_CHLTR/7-316R
Q9ZCL1_RICPR/1-290K
MSBB_ECOLI/11-305T
MSBB_HAEIN/17-309T
HTRB_ECOLI/4-297T
HTRB_HAEIN/6-300T
O25057_HELPY/18-320S
DDG_ECOLI/5-296T
ACYLT_MYCTU/11-302.
Q7AQJ0_MYCLE/10-306.

PF04028

A8ZZ01_DESOH/64-132-
B0SP25_LEPBP/75-143-
B4SDV4_PELPB/57-125-
F2IZZ7_POLGS/64-140-
E1WZF2_BACMS/56-124-
R5H3I3_9SPIR/57-124-
Q6MRQ4_BDEBA/60-126-
H9ULS0_SPIAZ/58-128-
Q9ABC6_CAUCR/70-146-
A1BDV7_CHLPD/57-125-
E8RUM0_ASTEC/66-142-
D9QTV2_ACEAZ/58-126-
Q983L9_RHILO/65-141-
E0TGQ7_PARBH/67-143-
I5B662_9DELT/65-133-
J9ZBF5_LEPFM/54-123-
Q8F6G4_LEPIN/73-141-
V6EZ87_9PROT/67-135-
D3UG86_HELM1/67-136-
D3PAM4_DEFDS/54-122-
B8DJK1_DESVM/57-126-
F0SQI7_PLABD/66-133-
F0S084_DESTD/50-120-
E8UZ77_TERSS/67-135-
N0B9S3_9RHIZ/83-157-
G8NV89_GRAMM/64-132-
E0UPC6_SULAO/66-130-
A7IFD8_XANP2/64-140-
E3DMT5_HALPG/62-130-
E4RJY2_HALHG/62-130-
O25048_HELPY/11-75-
Q11L84_CHESB/71-147-
Q0BPV8_GRABC/79-147-
Q0AS10_MARMM/66-142-
O67824_AQUAE/58-130-
Q30PR2_SULDN/66-130-
W0DGX2_9AQUI/56-129-
A6QCC9_SULNB/61-129-
J9Z1G0_9PROT/65-132-
R6PBE5_9CLOT/58-124-
I7H665_9HELI/71-139-
R6IYI6_9PROT/74-142-
F8E554_FLESM/55-122-
B8FFT7_DESAA/67-135-
Q3B2C3_PELLD/65-133-
A0RQN4_CAMFF/65-129-
I0AGE8_IGNAJ/62-130-
R7MFY6_9CLOT/57-124-
B1LYS3_METRJ/71-150-
W0RK11_9BACT/71-137-
E4TYI7_SULKY/66-130-
D6Z3S1_DESAT/74-140-
L0KCN8_HALHC/57-123-
Q6NDP3_RHOPA/63-131-
I7DWR6_PHAIB/80-148-
B4U6Q4_HYDS0/48-121-
Y090_RICPR/70-138-
C6BUF4_DESAD/64-130-
R7L764_9BACT/67-134-
D5BSX8_PUNMI/65-133-
D2QZ30_PIRSD/60-127-
Q3SPI1_NITWN/67-142-
C6XQU3_HIRBI/73-149-
B4S5E5_PROA2/69-137-
Q8RE56_FUSNN/59-126-
A7ZE08_CAMC1/68-136-
B3QSJ8_CHLT3/66-133-
B3DYR7_METI4/50-118-
Q7MR26_WOLSU/59-123-
W0J2E6_9BACT/116-183-
Q21CB2_RHOPB/63-131-
Q8KBV7_CHLTE/63-131-
A9H0X4_GLUDA/73-146-
D9S4X2_FIBSS/31-98-
R5XZA3_9PROT/77-145-
A7HQR6_PARL1/69-149-
V4IQX8_9DELT/64-132-
B4REI6_PHEZH/69-143-
E8X0D5_ACISM/63-131-
E3HZ07_RHOVT/78-152-
Q6MBL2_PARUW/79-142-
Q0C4B2_HYPNA/87-161-
F3Z2J0_DESAF/59-128-
M4V8B2_9DELT/59-127-
G0JN00_9GAMM/54-122-
Q0PB56_CAMJE/61-126-
D5V753_ARCNC/62-126-
E8RHR4_DESPD/61-129-
A7I0Q2_CAMHC/62-130-
Q3AU77_CHLCH/57-125-
B2KBY8_ELUMP/72-140-
E6W1J7_DESIS/59-127-
E8R441_ISOPI/72-140-
A6Q530_NITSB/66-130-
Q1IHY6_KORVE/73-141-
D5SXZ6_PLAL2/66-134-
B8CZC4_HALOH/67-135-
D1AZK0_SULD5/63-131-
R5RAX8_9PROT/76-144-
B1ZNQ8_OPITP/76-143-
G2LIZ0_CHLTF/58-126-
I4CDF4_DESTA/77-146-
C7JH60_ACEP3/75-148-
C8X102_DESRD/59-128-
E8T5G8_THEA1/50-120-
F2NIN6_DESAR/44-112-
M1NHV0_DESSD/63-131-
G8PRP9_PSEUV/64-140-
E1QK73_DESB2/69-137-
L0DF38_SINAD/64-131-
Q1MQ03_LAWIP/64-132-
R6HP46_9PROT/74-142-
D3DFJ2_HYDTT/56-129-
W0JIH7_DESAE/48-117-
K7YPV9_9PROT/65-133-
F9ZPD4_ACICS/63-131-
A0LIS3_SYNFM/43-111-
D8PHJ4_9BACT/77-145-
C1F7K9_ACIC5/65-133-
I0IL07_LEPFC/80-149-
A8ERF0_ARCB4/62-126-
Q5LVH2_RUEPO/68-136-
F2LXE1_HIPMA/50-118-
D5C4J1_NITHN/50-118-
D6ZZS2_STAND/64-139-
B6JIY0_OLICO/67-142-
A4Z0S3_BRASO/67-143-
F8KRG5_HELBC/66-130-
C7LQU5_DESBD/60-129-
I3TPI2_TISMK/68-136-
F8JIN3_HYPSM/61-135-
I3ZEX2_TERRK/83-151-
J9Z9Q6_LEPFM/85-154-
I4B448_TURPD/68-135-
D5EMA6_CORAD/74-142-
A8ZZ32_DESOH/66-137-
Q2YIH6_BRUA2/79-155-
Q2YMG0_BRUA2/58-131-
D5MG22_9BACT/72-140-
C5AWR7_METEA/66-144-
Q2VZT0_MAGSA/67-135-
B3EMB6_CHLPB/59-127-
C1A8S4_GEMAT/86-154-
B0SQM7_LEPBP/59-127-
S0EW12_CHTCT/80-145-
Q7VGP5_HELHP/69-137-
I6Z7D3_MELRP/64-132-

PF03982

DGAT2_MOUSE/92-388-
Q23067_CAEEL/63-359-
Q9XUW0_CAEEL/50-345-
Q9N4S3_CAEEL/44-340-
O01881_CAEEL/55-349-
DGAT2_ARATH/39-312-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window