Sequence alignment for CL0228

PF01553

Q23598_CAEEL/54-198-----------------KLICHN...KETFVKIL...........------------------------..ENPNQPLIT
GPAT1_MOUSE/205-355-----------------QIHKGQ...LEMVKAAT...........------------------------...ETNLPLLF
Q9FF57_ARATH/134-257-----------------VVKYHG...PRPSIR.............------------------------......PKQVY
Q21812_CAEEL/224-347-----------------VIRFHD...KENRAN.............------------------------......KGGIC
O54097_STRCO/67-199-----------------RVDLEG...LENVPA.............------------------------.....EGGALL
PLSC_MYCGE/72-202-----------------KVVTVN...DKIIP..............------------------------.....KKPVLV
Q50898_MYXXA/28-156-----------------GLWVRG....ALPPG.............------------------------.....GPGRLV
PLSC_HAEIN/52-180-----------------KVEHRI...PQDQKQ.............------------------------.....ISRAIY
Q9VRC1_DROME/201-323-----------------IRRFHN...TEYRPT.............------------------------.......KGIC
PLSC_NEIGO/60-182-----------------EVGRPA...PEH................------------------------.....PNGVLV
Q9Z6V0_CHLPN/101-259-----------------HRLKEI...EEYIAR.............------------------------.....GDNVVL
Y2427_MYCLE/138-270-----------------RVEVSG...IENLPS.............------------------------.....TGGALV
O06830_MYCTU/42-173-----------------RSQVHG...LDSFPP.............------------------------......GGALV
O53962_MYCTU/46-174-----------------KPKVYG...IENVPT.............------------------------......ERALL
O32330_CLOBU/35-163-----------------NITVRG...LENIDN.............------------------------....VKKPRIF
O35259_MOUSE/106-229-----------------IITYHN...RKNRPR.............------------------------......NGGIC
O53208_MYCTU/312-439-----------------HLNVIG...KENLTA.............------------------------.....QRPAVF
PLSC_LIMAL/90-216-----------------PIEIQG...SEHT...............------------------------.....KKRAIY
TAZ_HUMAN/41-215-----------------HLTVHNREVLYELIEKR...........------------------------...GPATPLIT
O53046_9LACO/76-210-----------------KIQVTGLDKLQHLAK.............------------------------......GGAIV
Q23087_CAEEL/81-242-----------------NIRIKG....DFINH.............------------------------.....EEPALI
P73054_SYNY3/40-177-----------------PIAIHG...QEHLPR.............------------------------.....SGPIIL
PLSC_COCNU/111-237-----------------PITIEG...SEFS...............------------------------.....NTRAIY
PLSC_BACSU/18-142-----------------GVKVYN...KENLPA.............------------------------.....DSGFVI
O16526_CAEEL/65-226-----------------NFRVTG....DLIER.............------------------------.....DEPAIL
Q53145_RHOSH/69-204-----------------DVEVSG...LENLPR.............------------------------.....NGPALV
PLC2_CAEEL/77-205-----------------HTTVYG...YEKTQV.............------------------------.....EGPAVV
PLSC_MYCPN/72-202-----------------KVVIVN...PENVP..............------------------------.....KKAVLV
O07807_MYCTU/22-151-----------------KITVTG...VDNLPT.............------------------------.....SGGAVV
O67119_AQUAE/640-768-----------------RIDVRG...LENLP..............------------------------.....KPPFII
P74498_SYNY3/43-168-----------------QAQVYG...QELVPT.............------------------------.....RGPALV
O07809_MYCTU/23-150-----------------KITFEG...LENIPE.............------------------------.....RGGALI
PLSC_YEAST/62-191-----------------DVKVVG...EENLA..............------------------------.....KKPYIM
PLSB_PEA/206-365-----------------PLFIQM...EEQLKQ.............------------------------.....GHNIIL
PLSC_ECOLI/52-180-----------------KVECRK...PTDAES.............------------------------.....YGNAIY
PLSB_SPIOL/220-379-----------------AIFQEM...EEKLKQ.............------------------------.....GDNIIL
PLCB_HUMAN/77-205-----------------RFEVRD...PRRLQE.............------------------------.....ARPCVI
PLC1_CAEEL/73-201-----------------RFELRN...SEILHD.............------------------------.....KKPYII
PLSB_CARTI/208-368-----------------SVFGVM...EEQLKQ.............------------------------.....GDKVVL
O69114_BURPE/48-174-----------------GMRLVV...HNDAAR.............------------------------....LDARALV
PLSC_BORBU/67-194-----------------KIIVTG...SENIPK.............------------------------.....KSNVII
O84813_CHLTR/101-259-----------------ERLDQI...QEYIQA.............------------------------.....GHNVVL
Q9W1B5_DROME/236-359-----------------FIKFHN...KQYKPT.............------------------------......VSGFC
PLSB_ECOLI/281-425-----------------GINVHN...AERVRQLA...........------------------------...HDGHELVY
O53516_MYCTU/20-152-----------------RPKVEG...LEYIPS.............------------------------.....SGPAIL
YD018_YEAST/84-276-----------------SLNVTF....ETSRPLKNSSN.....AK------------------------PCFRFKDRAII
PLSB_ARATH/208-367-----------------SIFSEL...EDKIRQ.............------------------------.....GHNIVL
O07808_MYCTU/23-150-----------------RITYVG...EENVPD.............------------------------.....QGGAVV
O53273_MYCTU/79-224-----------------GVRITV...SGSPVR.............------------------------....NLRGVLV
CST26_YEAST/74-282-----------------AVRITT....ENSSVPKGTFFLDLKKKR------------------------ILSHLKSNSVA
PLCA_HUMAN/83-211-----------------RVEVRG...AHHFPP.............------------------------.....SQPYVV
AAS_ECOLI/15-138-----------------RVRVTG...DTQALK.............------------------------.....GERVLI
Q9N5S8_CAEEL/317-440-----------------VVYFHD...EHYKAQ.............------------------------......AQGIC
GNPAT_HUMAN/138-283-----------------CVNEEG...IQKLQRA............------------------------...IQEHPVVL
O67841_AQUAE/28-151-----------------RIEVIG...KENIP..............------------------------.....EGACIV
PLSB_CAEEL/142-292-----------------LVCKEE...MEVLYEAE...........------------------------...QTGIPMVY
PLSB_HAEIN/281-425-----------------GINVQN...SNRVRKLA...........------------------------...LEGHEIVY

PF03279

O07148_MYCLE/9-307KMIRAPHRLMTGRAID.WAYAAGWRAVRAMPESAARFAFNTGARYAA...RN.GGPDQLRKNLARIIG.VQAADVPDALI
O84013_CHLTR/7-316RTGGKILVDHLVYG....LGLGVLTILRLLPRSSLRLFSKGLGTALF..YFISDVRKTALTNLALAFP.EKSFAERYQIA
Q9ZCL1_RICPR/1-290MKKFLKKLRYLIEY...FIVIIFLKVIGIFGIDKASDICSFIARKVG...ILFAVNKIAKRNIKAVFG.DMYDVEK..II
Q9Z983_CHLPN/6-314HQIKRTILEAPLYY....LVSGIIALCRHTPRSFLTGLGKGFGFLAF..YIISDYRKTALTNLALAFP.EKTFDERYKIA
MSBB_ECOLI/11-305IPEFDKSFRHPRYWGA.WLGVAAMAGIALTPPKFRDPILARLGRFAG..RLGKSSRRRALINLSLCFP.ERSEAEREAIV
ACYLT_MYCTU/9-303KLPKDPRSSVTRTATD.WAYAAGWMAVRALPEFAVRNAFDTGARYFA...RH.GGPEQLRKNLARVLG.VPPAAVPDPLM
Q9RA26_VIBMA/9-305DLSFKKTFLLPKFWPV.WFGVFAIYLLAFMPVKPRDKFARFIAKKLFSLKMMAKRKKVAKINLSMCFP.EMDDTEQDRII
MSBB_HAEIN/17-309EAHFSWSYLKPQYWGI.WLGIFFLLLLAFVPFRLRDKLTGKLGIWIG..HKAKKQRTRAQTNLQYCFP.HWTEQQREQVI
HTRB_ECOLI/4-297LPKFSTALLHPRYWLT.WLGIGVLWLVVQLPYPVIYRLGCGLGKLA..LRFMKRRAKIVHRNLELCFP.EMSEQERRKMV
HTRB_HAEIN/6-300LPQFQPHFLAPKYWLF.WLGVAIWRSILCLPYPILRHIGHGFGWLFSHLKVGERRAAIARRNLELCFP.DMPENEREVIL
Q9ZMF5_HELPJ/17-320DKGFKTELRILSVFIVEFLVNILGFMLAKMPHFWFLRCVKALAWLMK..TFDRRRYFDAKANLDFVFGDSKSEEEKKRII
DDG_SHIFL/4-296QCKFSREFLHPRYWLT.WFGLGVLWLWVQLPYPVLCFLGTRIGAMAR..PFLKRRESIARKNLELCFP.QHSAEEREKMI
Q9ZGU3_ECO57/41-334IPRFNLTLCFPRYWMT.WTGIGIICVFAMVPPALRDPLLGKLGMLVG..RLGKSARQRALINLSLCFP.EYSDKEKENIV

PF03982

DGAT2_MOUSE/92-388MYTFCTDCWLIAVLYFTWLAFDW--NTPKKGGRRSQWVRNWAVWRYFRDYFPIQL.VKTHN.LLTTRNYIFGYHPHGIMG
Q23067_CAEEL/63-359HVLFNTRWWFLVPLYAVWFYYDF--DTPKKASRRWNWARRHVAWKYFASYFPLRL.IKTAD.LPADRNYIIGSHPHGMFS
Q9XUW0_CAEEL/50-345FVLFFTGQWIILGLYAVWYLYDR--ESPRRGGYRDNWFRNLSLHKWFAEYFPVKL.HKTAE.LDPNQNYLFGYHPHGILG
Q9N4S3_CAEEL/44-340FFLLFTFQWHILALYACWYFYDM--DSPRRGGYSSDWVRKWRVNDWFAQYFPINL.HKTAE.LSTDKNYLVGIHPHGIIS
O01881_CAEEL/55-349YMLY.TVLWPLIFLYGLWMIYDW--NSPKKGAYMSNWFQRQRIHSWYANYFPVKL.HTTSD.MPEEHNYLIGYHPHGIIS
DGAT2_ARATH/39-312SLIFLPPSLSLMVLGLLSLFIFI--PIDHRSKYGRKLAR..YICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLP

PF04028

D1N6P7_9BACT/65-137-----------------VAIPGY..AR.....-------------------------------------.....KRTMAV
A5VP00_BRUO2/58-140-----------------MFLAAFARPP.....-------------------------------------....EKKFVAA
B4S5E5_PROA2/66-138-----------------LIQRLF..PQ.....-------------------------------------.....KKITAV
B8CZC4_HALOH/63-136-----------------WVPAYF.FRK.....-------------------------------------.....RDCVTL
Q1Q2B7_9BACT/51-125-----------------LLCLAYIGRN.....-------------------------------------.....ANIQVL
O67824_AQUAE/54-132-----------------LGLALY.GMD.....-------------------------------------.....RGIVVL
Q07UI0_RHOP5/59-132-----------------SLPMLR.VVD.....-------------------------------------.....KPLVAL
A7I0Q2_CAMHC/55-131-----------------MMSLIY..KQCW...-------------------------------------...KQRPAKVM
Q17YC6_HELAH/56-131-----------------MIGFAY..LRL....-------------------------------------...KKPCIYVI
A8GUS8_RICB8/66-139-----------------LSPAMF..KG.....-------------------------------------....MPDVYAL
Q4HSN1_CAMUP/50-127-----------------LMPFAF..RRFR...-------------------------------------..KKGKRAFVM
A7HQR6_PARL1/65-150-----------------LTPCFW.HNW.....-------------------------------------.....REVRVL
Q0BPV8_GRABC/70-148-----------------LMPKVW..LRFRK..-------------------------------------..ANPEPCHVI
Q3SPI1_NITWN/63-143-----------------MTPFIR.RAH.....-------------------------------------.....HRGKVL
Q13EQ9_RHOPS/59-132-----------------MLPMLR.NGS.....-------------------------------------.....KPLVAL
Q0G3U5_9RHIZ/91-172-----------------LAPIFR.PVE.....-------------------------------------.....LPYVAL
A4SG45_PROVI/55-128-----------------LLARSL.AKG.....-------------------------------------.....RTIAAI
Q72BG4_DESVH/52-127-----------------LFPLMHVRRE.....-------------------------------------.....LEIVTV
Q68XV8_RICTY/66-139-----------------LSPVMF..TG.....-------------------------------------....HRNIYAL
A8ZZ32_DESOH/61-138-----------------IFFFYYFRKL.....-------------------------------------.....KNAGIM
A3ZQ00_9PLAN/59-131-----------------SFPLYL.RPY.....-------------------------------------.....CNIAML
A4EPH0_9RHOB/51-125-----------------MAPYLFDTSL.....-------------------------------------.....GRICAL
B7KT05_METC4/62-145-----------------MISFMS.RPQ.....-------------------------------------.....DRVATI
Q3AU77_CHLCH/54-126-----------------LAKKLF..PH.....-------------------------------------.....KNVAAV
Q8KBV7_CHLTE/60-132-----------------LARRLY..PK.....-------------------------------------.....REISAV
A0NV66_9RHOB/60-141-----------------MVPFAK.PAH.....-------------------------------------.....WPAKVM
Q1IHY6_KORVE/68-142-----------------VFPAIWVFRG.....-------------------------------------.....RDLAVM
Q1NQI4_9DELT/69-141-----------------QQRAIA..PT.....-------------------------------------.....ARWALM
Q04QU1_LEPBJ/92-164-----------------YSPYLN..RN.....-------------------------------------.....LGVVVL
A3EPV4_9BACT/80-155-----------------FMPFMWSGRW.....-------------------------------------.....GGAHAI
Q0YU03_9CHLB/56-128-----------------LARELF..PG.....-------------------------------------.....EPTAAV
B4U6Q4_HYDS0/44-122-----------------LAVAMY.GID.....-------------------------------------.....KNIYSM
A3YRB1_CAMJU/34-111-----------------LMPFAF..RHYR...-------------------------------------..QKNKKAYVM
A6Q530_NITSB/55-131-----------------MMPFLY..KKIR...-------------------------------------...QNHPIAVM
Q0C4B2_HYPNA/73-162-----------------LMPAGW..TRAVRH.-------------------------------------WPEKRGRGAMM
A5VTV7_BRUO2/75-156-----------------MGPFLR.PKG.....-------------------------------------.....LELVAM
A7ZE08_CAMC1/58-137-----------------FMSFAY..RRWWS..-------------------------------------.SQNRKQGKVI
A7IFD8_XANP2/60-141-----------------LTPFAM.KPH.....-------------------------------------.....HKAKVL
Q6MRQ4_BDEBA/54-127-----------------LALLSI.VKR.....-------------------------------------.....YRIATI
A6QCC9_SULNB/54-130-----------------MSPQAY..RKIH...-------------------------------------...KTRPASAI
Q2C9V5_9RHOB/36-112-----------------LAFAAWLSGRL....-------------------------------------....IPEVIAL
Q0AS10_MARMM/61-143-----------------MALHGWARQK.....-------------------------------------.....DRMVAL
A3V370_9RHOB/43-117-----------------MAALHWPVAD.....-------------------------------------.....GPLTSL
Q30PR2_SULDN/55-131-----------------MLPYLY..SKYR...-------------------------------------...KTPHAKVL
Q8RE56_FUSNN/54-127-----------------ITPIFF.RNV.....-------------------------------------.....EKKLAM
A5FW91_ACICJ/79-154-----------------AMHALR..RPA....-------------------------------------...DAPTAYML
C0AB63_9BACT/89-161-----------------LGRRYR..PD.....-------------------------------------.....WPLHAL
Q1MQ03_LAWIP/59-133-----------------LFPLIYFRGK.....-------------------------------------.....LKIITV
E0TGQ7_PARBH/62-144-----------------MMPIIQRQQG.....-------------------------------------.....RPLAVL
A3UFX9_9RHOB/75-156-----------------MTIAAWPKNV.....-------------------------------------.....QPPAIL
A0LIS3_SYNFM/40-112-----------------TVVYHY..RD.....-------------------------------------.....LNVVTM
Q2LXB8_SYNAS/104-179-----------------AAIRHFKTYS.....-------------------------------------....IYSPSLM
A4U4M9_9PROT/68-141-----------------MMMKSW.RRG.....-------------------------------------.....LPISML
A6C345_9PLAN/58-131-----------------VIPPLFCNVE.....-------------------------------------.....HNSVAL
Q11L84_MESSB/67-148-----------------LAPAIK.PRR.....-------------------------------------.....QPLVAL
Q1K139_DESAC/59-131-----------------LMAQGY..QG.....-------------------------------------.....PGSQIL
Q6MBL2_PARUW/66-143-----------------LAPFILYHLTP....-------------------------------------....QFIYAAF
Q3B2C3_PELLD/62-134-----------------FVRRLW..PD.....-------------------------------------.....RDASAV
Q5LVH2_SILPO/63-137-----------------QSPYFFPLDK.....-------------------------------------.....GRICSI
Q0EXM5_9PROT/1-74-----------------MMGVGL..KG.....-------------------------------------.....CKGYTL
Q5FPH5_GLUOX/51-135-----------------LSSALWFWARTL...-------------------------------------..EPRLELRVL
Q7MR26_WOLSU/48-124-----------------LQPFLY..RQIR...-------------------------------------...AKPRISVM
Q7UNH8_RHOBA/40-115-----------------LAALSL..SA.....-------------------------------------.....PRVGAM
A0RQN4_CAMFF/54-130-----------------MLPFVF..KKWW...-------------------------------------...DTKNVKVM
A7GZE2_CAMC5/59-137-----------------FMSYAY..KKWWQ..-------------------------------------..PIKKPAKVI
Q0EZ13_9PROT/53-128-----------------MIPRISRNRA.....-------------------------------------.....WHGYML
A1BDV7_CHLPD/54-126-----------------LARKLF..TQ.....-------------------------------------.....SIIHAV
B3EMB6_CHLPB/56-128-----------------LAKKIF..PD.....-------------------------------------.....KNIHAV
Q6AJI7_DESPS/60-135-----------------SILFILSQLR.....-------------------------------------....NDSATVM
Q983L9_RHILO/61-142-----------------LTPAYY.PKR.....-------------------------------------.....KPLVAM
A3EVN0_9BACT/75-150-----------------LMPFVYFGKW.....-------------------------------------.....GKIRII
A8ZZ01_DESOH/61-133-----------------GIAFFA..TR.....-------------------------------------.....KPITIM
B4SDV4_PELPB/54-126-----------------LAQRLF..PE.....-------------------------------------.....KKITAV
Q2VZT0_MAGSA/63-136-----------------MMPKSW.RQS.....-------------------------------------.....VPIHML
A4Z0S3_BRASO/63-144-----------------LTPFIRNKPS.....-------------------------------------.....YRAKVL
B9KF52_CAMLR/50-127-----------------LMPFAY..RKMG...-------------------------------------..IKGKKAYVM
A3ZQR1_9PLAN/53-130-----------------VAAAMG..GE.....-------------------------------------.....AGTAAM
A1UU05_BARBK/79-160-----------------MGPFLR.PSD.....-------------------------------------.....EVIMGM
Q7VGP5_HELHP/56-138-----------------MLPFLY..KRFQKVV-------------------------------------SKERDKGFYIV

PF01553

Q23598_CAEEL/54-198VSNHRSN...IDDPLMW.CILK---FRE.FWRYK--------------DRNRYTLAAHNICFTKQFHTTMFS....LGRC
GPAT1_MOUSE/205-355LPVHRSH...IDYLLLT.FILF---CHN..I...--------------.KAPYIASGNN.LNI.PVFSTLIH....KLGG
Q9FF57_ARATH/134-257VANHTSM...IDFIVLE.Q...---.....M...--------------.TAFAVIMQKHPGWVGLLQSTILE....SVGC
Q21812_CAEEL/224-347VANHTSP...IDVMVLS.C...---.....D...--------------.NCYAMIGQKQAGFLGFLQTTLSR....SEHH
O54097_STRCO/67-199VANHSGTL.PLDALMLQ.VALH---DHHSTH...--------------.RRLRLLAADLAFDL.PVVRDLAR....KAGH
PLSC_MYCGE/72-202VANHKSN...LDPLVLI.KAFG---RLKNSP...--------------..PLTFVAKIELKD..TVLFKLMK....LIDC
Q50898_MYXXA/28-156YLNHSNW...WDGFVLN.QLCQ---TAG.W....--------------.DGYCLMDEENLRRY.....RFLT....RIGA
PLSC_HAEIN/52-180IGNHQNN...YDMVTIS.YMV.---.....Q...--------------.PRTVSVGKKSLIWI.PFFGILYW....VTGN
Q9VRC1_DROME/201-323VCNHTSP...LDVLVLM.C...---.....D...--------------.ANYSLTGQVHTGILGVLQRALSR....VSHH
PLSC_NEIGO/60-182AANHVSW...LDIFAMS.AVY.---.........--------------..PSSFIAKQEIKSW.PVLGKMGQ....NAGT
Q9Z6V0_CHLPN/101-259LANHQTE...CDPQLMY.YALG---KTH..PE.L--------------MENMIFVAGDRVTSD.PLARPFSMG..CDLLC
Y2427_MYCLE/138-270VANHAGVL.PFDGLMLS.LAVH---DEHPAQ...--------------.RDLRLLVADMVFDL.PVVGEAVR....KAGH
O06830_MYCTU/42-173VANHSGGMFPMDVPVFS.VDFY---DKFGYD...--------------.RPVYTLSHDILFM..GLTGDLFR....RTGY
O53962_MYCTU/46-174VGNHNTLG.LVDAPLLA.AELW---ERG......--------------.RIVRSLGDHAHFKI.PGWRDALT....RTGV
O32330_CLOBU/35-163VCNHLSN...SDGLVLN.KILK---EK.......--------------.SDPYFIAGIKLSND.PITNIGTK....IVKN
O35259_MOUSE/106-229VANHTSR...IDVIIFA.S...---.....D...--------------.GYYAMVGQVHGGLMGVIQRAMVK....ACPH
O53208_MYCTU/312-439IFNHRNQ...VDPVIAG.ALV.---.....R...--------------.DNWVGVGKKELASD.PIMGTLGK....LLDG
PLSC_LIMAL/90-216ISNHASP...IDAFFVM.WLA.---.....P...--------------.IGTVGVAKKEVIWY.PLLGQLYT....LAHH
TAZ_HUMAN/41-215VSNHQSC...MDDPHLW.GILK---LRHIWNL..--------------KLMRWTPAAADICFTKELHSHFFS....LGKC
O53046_9LACO/76-210TANHFNQ...VDALAVN.RLAQ---KTH......--------------.HRMEIVIEDTNLKLPGFFSFIMN....NMGS
Q23087_CAEEL/81-242IMNHRTR...LDWLFFW.NALY---KMD..PW.L--------------CTTEKISLKGMLKYV.PGAGWAMQ....AASY
P73054_SYNY3/40-177APTHRSR...WDAILLS.LAAG---RGVTGR...--------------.DLRFMVAVTEVQ...GLQGWFIR....HLGG
PLSC_COCNU/111-237ICNHASL...VDIFLIM.WLI.---.....P...--------------.KGTVTIAKKEIIWY.PLFGQLYV....LANH
PLSC_BACSU/18-142ACTHSGW...VDVITLGVGIL.---.....P...--------------.YQIHYMAKKELFQN.KWIGSFLK....KIHA
O16526_CAEEL/65-226IMNHRTR...LDWLFSW.NALY---KMD..PW.L--------------LTTEKISLKAPLKKI.PGAGWAMS....SGSY
Q53145_RHOSH/69-204VCNHPTG..IADGVILH.HILA---PLR......--------------.PDLFFYANRDILRVLPQMEDLIC....PVEW
PLC2_CAEEL/77-205ICNHQSS...LDILSMA.SIW.---.....P...--------------.KNCVVMMKRILAYV.PFFNLGAY....FSNT
PLSC_MYCPN/72-202VANHKSN...LDPLILI.KAFG---KTEGVP...--------------..PLTFIAKIELQD..TWLFKIMK....LIDC
O07807_MYCTU/22-151AINHTSY...LDFTFAG.LPAY---QQGLG....--------------.RKVRFMAKQEVFDH.KITGPIMR....SLRH
O67119_AQUAE/640-768APNHQSY...LDAFAIA.AVLP---KEI.A....--------------.HETYFLGDETYFRN.PITSTFGK....LAHV
P74498_SYNY3/43-168VSNHASY...FDPPFLS.CAM.---.....A...--------------.RPVAFMAKEELFNV.PLLGPAIR....LYGA
O07809_MYCTU/23-150ALNHTSY...VDWVPAS.IAAH---HRR......--------------.RRLRFMIKAEMQDV.RAVNYVIK....HAQL
PLSC_YEAST/62-191IANHQST...LDIFMLG.RIF.---.....P...--------------.PGCTVTAKKSLKYV.PFLGWFMA....LSGT
PLSB_PEA/206-365MSNHQSE...ADPAIIA.LLLE---MRL..PH.I--------------AENLIYVAGDRVITV.PLCKPFSIG..RNLIC
PLSC_ECOLI/52-180IANHQNN...YDMVTAS.NIV.---.....Q...--------------.PPTVTVGKKSLLWI.PFFGQLYW....LTGN
PLSB_SPIOL/220-379MSNHQSE...ADPAVIA.LLLE---KTN..SL.I--------------AENLIYIAGDRVITD.PLCKPFSMG..RNLLC
PLCB_HUMAN/77-205VSNHQSI...LDMMGLM.EVL.---.....P...--------------.ERCVQIAKRELLFL.GPVGLIMY....LGGV
PLC1_CAEEL/73-201IANHQSA...LDVLGMS.FAW.---.....P...--------------.VDCVVMLKSSLKYL.PGFNLCAY....LCDS
PLSB_CARTI/208-368ISNHQTE...ADPAVIA.LMLE---TTN..PH.I--------------SENIIYVAGDRVITD.PLCKPFSMG..RNLLC
O69114_BURPE/48-174VGNHVSW...LDIYVIN.AWR.---.........--------------..PTPFVSKAEVRAW.PVVGWLAE....RLGT
PLSC_BORBU/67-194MGNHIAA...MDPLIFI.YTF.---.....A...--------------.CPFVILAKHSLLRI.PFVNIVLI....VMGV
O84813_CHLTR/101-259LANHQTE...SDPQLMY.CLLG---ASY..PQ.L--------------MESMIFVAGDRITSD.PLARPFSMG..CDLLC
Q9W1B5_DROME/236-359VANHTSP...LDVAILS.T...---.....D...--------------.CTYSLIGQRHGGFLGVLQRALAR....ASPH
PLSB_ECOLI/281-425VPCHRSH...MDYLLLS.YVLY---HQG.L....--------------.VPPHIAAGIN.LNF.WPAGPIFR....RLGA
O53516_MYCTU/20-152ASNHLAV...ADSFYLP.LVV.---.....R...--------------.RRIWFLAKSEYFTGTGLKGWINRWFYSVSGQ
YD018_YEAST/84-276IANHQMY...ADWIYLW.WLSF---VSNLG....--------------.GNVYIILKKALQYI.PLLGFGMR....NFKF
PLSB_ARATH/208-367ISNHQSE...ADPAVIS.LLLE---AQS..PF.I--------------GENIKCVAGDRVITD.PLCKPFSMG..RNLIC
O07808_MYCTU/23-150AINHTSY...VDWLPAA.LAMH---RRR......--------------.RRMRFMIKAEMQRV.RLVNFLIR....HTRT
O53273_MYCTU/79-224VSGHVSW...LDVFCIG.SVL.---.........--------------..PGSFVARADMFTG.RTIGIVAR....ILKI
CST26_YEAST/74-282ICNHQIY...TDWIFLW.WLAY---TSNLG....--------------.ANVFIILKKSLASI.PILGFGMR....NYNF
PLCA_HUMAN/83-211VSNHQSS...LDLLGMM.EVL.---.....P...--------------.GRCVPIAKRELLWA.GSAGLACW....LAGV
AAS_ECOLI/15-138TPNHVSF...IDGILLG.LFL.---.....P...--------------.VRPVFAVYTSISQQ.WYMRWLKS....FIDF
Q9N5S8_CAEEL/317-440VANHTSP...IDALILS.I...---.....D...--------------.NVYALIGQKHEGLLGIVQRALSR....ASSH
GNPAT_HUMAN/138-283LPSHRSY...IDFLMLS.FLLY---NYD.L....--------------.PVPVIAAGMDFLGM.KMVGELLR....MSGA
O67841_AQUAE/28-151ASNHRSH...LDPPVLN.AVF.---.....P...--------------.EPLVFLAKEELFK..PPFGGILK....HMRA
PLSB_CAEEL/142-292LPLHRSH...LDYLLIT.WCNW---HFG.L....--------------.KLPHIASGDN.LNL.SGLGWLLR....ATGA
PLSB_HAEIN/281-425VPCHRSH...IDYLLLS.YVLY---HQG.L....--------------.VPPHIAAGIN.LNF.WPIGRMFR....SWGA

PF03279

O07148_MYCLE/9-307RTSLASYARYWREAFRL-PTMN...PHTVAKQVEA............YGIDLHRVGEALDAGR-GVVLALPHSGNWDMAG
O84013_CHLTR/7-316RQSVQQMIITFVELATV-DKFAKHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQE-GAILFCGHQANWELPF
Q9ZCL1_RICPR/1-290DQTWDNFGRFIGEFIYV-DKMD...ESELESRIE..............IIGKENIK..KLEDQ-PFLLFSGHFANWDISL
Q9Z983_CHLPN/6-314RQSLQHLIITLLELLAI-EQLVGNIDKLITIVTSSRNPKGFSSEEVISNEDLEETFKNLQEKQ-GLILFCGHQANWELPF
MSBB_ECOLI/11-305DEMFATAPQAMAMMAEL-AIRG...PEKIQPRVD..............WQGLEIIEEMRRNNE-KVIFLVPHGWAVDIPA
ACYLT_MYCTU/9-303CASLESYGRYWREVFRL-PTIN...HRKLARQLDR............VIGGLDHLDAALAAGL-GAVLALPHSGNWDMAG
Q9RA26_VIBMA/9-305MVNLVTFCQTILSYAEP-SARS...RAYNRDRMI..............VHGGENLFPLLEQGK-ACILLVPHSFAIDFAG
MSBB_HAEIN/17-309DKMFAVVAQVMFGIGEI-AIRS...KKHLQKRSE..............FIGLEHIEQAKAEGK-NIILMVPHGWAIDASG
HTRB_ECOLI/4-297VKNFESVGMGLMETGMA-WFWP...DRRIARWTE..............VIGMEHIRDVQAQKR-GILLVGIHFLTLELGA
HTRB_HAEIN/6-300QENLRSVGMAIIETGMA-WFWS...DSRIKKWSK..............VEGLHYLK..ENQKD-GIVLVGVHFLTLELGA
Q9ZMF5_HELPJ/17-320KKGYENFAFIILETIRV-IFIP...KDEYDARFT..............LINEENVWKSLNKEG-QAITLCMHFGYWEAVG
DDG_SHIFL/4-296AENFRSLGMALVETGMA-WFWP...DSRVRKWFD..............VEGLDNLKRAQMQNR-GVMVVGVHFMSLELGG
Q9ZGU3_ECO57/41-334DAMFATASMAVVLMAEL-ALSG...PDKISHRIR..............WNGLEIVEKMAQNNE-KVIFLVPHAWGVDIPA

PF03982

DGAT2_MOUSE/92-388LGAFCNFSTEATEVSKKFPGIR---------------------------PYLATLA..GNFRM-PVLREYLM----SGGI
Q23067_CAEEL/63-359VGGFTAMSTNATGFEDKFPGIK---------------------------SHIMTLN..GQFYF-PFRREFGI----MLGG
Q9XUW0_CAEEL/50-345VGAWSCFGFDACNVKQVFKGIR---------------------------FNICTLP..GNFTA-MFRREILL----SIGM
Q9N4S3_CAEEL/44-340MAAWSNFATNGTGIYEKFPGIR---------------------------WNLCTLA..LQFRM-AIRRELLL----LTGL
O01881_CAEEL/55-349MAAFINFATNGTGILDTLPRIR---------------------------FHLCTLV..GQFWT-PWRREWGL----LHGM
DGAT2_ARATH/39-312IGV.VALC.DLTGFMPI.....---------------------------PNIKVLASSAIFYT-PFLRHIWT----WLGL

PF04028

D1N6P7_9BACT/65-137VSASRDG---------------------------------------------------------QYIADFIS----VLGL
A5VP00_BRUO2/58-140VSKSRDG---------------------------------------------------------ELVAQMLG----KLGI
B4S5E5_PROA2/66-138VSLSRDG---------------------------------------------------------EILAGTLS----KLGF
B8CZC4_HALOH/63-136ASLSNDG---------------------------------------------------------EYITRVLE----KYGY
Q1Q2B7_9BACT/51-125VSQHSDG---------------------------------------------------------EYIAGVIK----RLGF
O67824_AQUAE/54-132VSRFRDG---------------------------------------------------------EIAARLLK----ELGF
Q07UI0_RHOP5/59-132ISGHRDG---------------------------------------------------------RIISKIGG----IFGI
A7I0Q2_CAMHC/55-131ISDHKDG---------------------------------------------------------EIITRVIS----HFGI
Q17YC6_HELAH/56-131TSQHFDG---------------------------------------------------------SIAAGLFE----SFGF
A8GUS8_RICB8/66-139ISPHLDG---------------------------------------------------------KILNDLVD----KFGC
Q4HSN1_CAMUP/50-127ISHHNDG---------------------------------------------------------ELIARLIH----LYGL
A7HQR6_PARL1/65-150VSKHGDG---------------------------------------------------------EIVANIMR----ILGV
Q0BPV8_GRABC/70-148ISRHRDG---------------------------------------------------------RLVATLMR----LLGA
Q3SPI1_NITWN/63-143ISRHRDG---------------------------------------------------------EFNALAAE----RLGI
Q13EQ9_RHOPS/59-132ISGHRDG---------------------------------------------------------QIISKAGT----VFGI
Q0G3U5_9RHIZ/91-172LSRNADA---------------------------------------------------------EINAQVVS----RFGI
A4SG45_PROVI/55-128ASLSEDG---------------------------------------------------------SILSDALT----TLGF
Q72BG4_DESVH/52-127VSQSRDG---------------------------------------------------------EYLARVLQ----GLGL
Q68XV8_RICTY/66-139ISPHLDG---------------------------------------------------------KILNAIVG----KFGC
A8ZZ32_DESOH/61-138ISSSKGG---------------------------------------------------------DIAAGIAR----RFGY
A3ZQ00_9PLAN/59-131LSKHRDA---------------------------------------------------------EWLAHTAT----MMGF
A4EPH0_9RHOB/51-125TSAARAG---------------------------------------------------------RLAGQILV----RLGF
B7KT05_METC4/62-145ISRSPDG---------------------------------------------------------NINTMALT----RMGV
Q3AU77_CHLCH/54-126VSQSGDG---------------------------------------------------------TILADALG----TLGF
Q8KBV7_CHLTE/60-132VSLSGDG---------------------------------------------------------QILSDTLD----RLGF
A0NV66_9RHOB/60-141ISRSADG---------------------------------------------------------EVNAIAAR----KLGL
Q1IHY6_KORVE/68-142TSRSADG---------------------------------------------------------EYIARVIE----KFGF
Q1NQI4_9DELT/69-141VSASDDA---------------------------------------------------------EILSGALT----MMNA
Q04QU1_LEPBJ/92-164ISESKDG---------------------------------------------------------DFINQVVH----RFGN
A3EPV4_9BACT/80-155VSRSRDG---------------------------------------------------------ERIAAILR----FFGI
Q0YU03_9CHLB/56-128VSQSKDG---------------------------------------------------------RILSDALQ----QLGY
B4U6Q4_HYDS0/44-122ASQNKDG---------------------------------------------------------DIAAILLE----GLGF
A3YRB1_CAMJU/34-111ISHHKDG---------------------------------------------------------EQIAKIIK----LFGL
A6Q530_NITSB/55-131ISEHFDG---------------------------------------------------------ELIAKTIR----HFGL
Q0C4B2_HYPNA/73-162ISLSADG---------------------------------------------------------EPVARAIK----HLDL
A5VTV7_BRUO2/75-156FSRSADA---------------------------------------------------------ELNARVAE----KLGL
A7ZE08_CAMC1/58-137ISDHKDG---------------------------------------------------------ELITRIIK----FFGI
A7IFD8_XANP2/60-141ISRHADA---------------------------------------------------------EINAIAAE----KLGV
Q6MRQ4_BDEBA/54-127ASQSKDG---------------------------------------------------------ELMATVLK----WLGA
A6QCC9_SULNB/54-130ISSHFDG---------------------------------------------------------SLIAGTLK----LFHI
Q2C9V5_9RHOB/36-112RDPSPAG---------------------------------------------------------RVGAAVQE----SFGM
Q0AS10_MARMM/61-143ASRSREG---------------------------------------------------------EIGSRLAR----WYKV
A3V370_9RHOB/43-117YDSSPIG---------------------------------------------------------RVSGALQR----RVGL
Q30PR2_SULDN/55-131ISSHFDG---------------------------------------------------------MLISKTIK----YFGL
Q8RE56_FUSNN/54-127SSPTKDG---------------------------------------------------------ELISVPLE----KMGY
A5FW91_ACICJ/79-154ASRHRDG---------------------------------------------------------QLVVNALR----RFGL
C0AB63_9BACT/89-161ISASKDG---------------------------------------------------------AWAVAFFE----LLGL
Q1MQ03_LAWIP/59-133VSKSKDG---------------------------------------------------------DILANVIQ----RIGL
E0TGQ7_PARBH/62-144VSEHRDG---------------------------------------------------------EMIAQVMT----HFSI
A3UFX9_9RHOB/75-156ISRSREG---------------------------------------------------------DVVTKVAA----HHKV
A0LIS3_SYNFM/40-112ASRSRDG---------------------------------------------------------ELAARVAE----RLGM
Q2LXB8_SYNAS/104-179ISQSKDG---------------------------------------------------------DIIAGIAK----RSGW
A4U4M9_9PROT/68-141TSEHRDG---------------------------------------------------------QLIARTAA----PFGI
A6C345_9PLAN/58-131ISQHRDA---------------------------------------------------------DTIEAMLK----AARM
Q11L84_MESSB/67-148FSRSADA---------------------------------------------------------ELNALVAE----KMDI
Q1K139_DESAC/59-131ISASKDG---------------------------------------------------------ELIARTMH----HLGQ
Q6MBL2_PARUW/66-143ISNSRDG---------------------------------------------------------ELIGRIVR----SYKT
Q3B2C3_PELLD/62-134VSLSEDG---------------------------------------------------------SILSLALK----RFGF
Q5LVH2_SILPO/63-137TSAARAG---------------------------------------------------------SMVGRVQQ----LFGM
Q0EXM5_9PROT/1-74ISAHRDG---------------------------------------------------------GFIADALH----LQGF
Q5FPH5_GLUOX/51-135ISRNPDG---------------------------------------------------------MLIADVVR----PWGI
Q7MR26_WOLSU/48-124ISDHFDG---------------------------------------------------------EIIARMIG----FFGF
Q7UNH8_RHOBA/40-115VSRSRDG---------------------------------------------------------DLLMPLLR----GNGC
A0RQN4_CAMFF/54-130ISDHKDG---------------------------------------------------------EMVNGVSY----HFGI
A7GZE2_CAMC5/59-137ISDHKDG---------------------------------------------------------ELITRVMK----LFDI
Q0EZ13_9PROT/53-128ISEHRDG---------------------------------------------------------GYIADTMH----LLGI
A1BDV7_CHLPD/54-126VSLSEDG---------------------------------------------------------QLLSGTLS----NIGF
B3EMB6_CHLPB/56-128VSQSKDG---------------------------------------------------------ELLSHVLA----KLGF
Q6AJI7_DESPS/60-135VSASSDG---------------------------------------------------------DYIASLAE----LLGY
Q983L9_RHILO/61-142VSRSADA---------------------------------------------------------ELNALMLE----KFGI
A3EVN0_9BACT/75-150VSRSRDG---------------------------------------------------------ALISSLLW----WFGI
A8ZZ01_DESOH/61-133ISQSKDG---------------------------------------------------------EMAARVVA----ILGW
B4SDV4_PELPB/54-126VSMSEDG---------------------------------------------------------KTLADTLE----RLGF
Q2VZT0_MAGSA/63-136ISQHRDG---------------------------------------------------------QLIARTVS----HFGI
A4Z0S3_BRASO/63-144ISKHRDG---------------------------------------------------------EFNAIAAE----RLGI
B9KF52_CAMLR/50-127ISHHKDG---------------------------------------------------------EIIARNIA----FFGL
A3ZQR1_9PLAN/53-130VSQSLDG---------------------------------------------------------ELIVPTLR----MMGV
A1UU05_BARBK/79-160FSRSADA---------------------------------------------------------EINAQLAK----KLGL
Q7VGP5_HELHP/56-138QSHHFDA---------------------------------------------------------ELMVRVIA----LFGL

PF01553

Q23598_CAEEL/54-198VPCVR...--.......-....................GE--GVYQKG--------MDFCVD...MLNDN..........
GPAT1_MOUSE/205-355FFIRRRLD--E......-..............TPDGRKDI--LYRALL--------HGHVVE...LLRQQ..........
Q9FF57_ARATH/134-257IWFNR...--.......-...................SEA--KDREIV--------AKKLRD..HVQGAD..........
Q21812_CAEEL/224-347IWFER...--.......-...................GEA--GDRAKV--------MDRMRE..HVNDEN..........
O54097_STRCO/67-199VRACP...--.......-......................--......--------.ENALR...LLGSG..........
PLSC_MYCGE/72-202VFIDR...--.......-...................KNI--RQIANA--------LETQQQ...LIRQG..........
Q50898_MYXXA/28-156FSIRR...--.......-...................KDA--TSPVAP--------LRYAKE...LLRKP..........
PLSC_HAEIN/52-180IFLDR...--.......-...................ENR--TKAHNT--------MSQLAR...RINED..........
Q9VRC1_DROME/201-323MWFDR...--.......-...................KEL--ADREAL--------GLVLRL..HCSMKD..........
PLSC_NEIGO/60-182VFINR...--.......-...................NSR--RDIEPI--------NRAVCE...TLQRG..........
Q9Z6V0_CHLPN/101-259IYSKRHIA--T......-...............PPELREE--KLLHNQ--------KSMQILK.TLLNEG..........
Y2427_MYCLE/138-270TVACT...--.......-......................--......--------.SDAHR...LLAAG..........
O06830_MYCTU/42-173IRATR...--.......-......................--......--------.ENAAK...ALRSG..........
O53962_MYCTU/46-174VEGTR...--.......-......................--......--------.EITSE...LMRRG..........
O32330_CLOBU/35-163IAIKP...--.......-...................NSA--D..KEA--------ITKVVK...ALKSG..........
O35259_MOUSE/106-229VWFER...--.......-...................SEV--KDRHLV--------AKRLTE..HVQDKS..........
O53208_MYCTU/312-439VFIDR...--.......-...................DDP--VAAVET--------LHTVEE...RARNG..........
PLSC_LIMAL/90-216IRIDR...--.......-...................SNP--AAAIQS--------MKEAVR...VITEK..........
TAZ_HUMAN/41-215VPVCRGAE--FFQAENE-GKGVLDTGRHMPGAGKRREKGD--GVYQKG--------MDFILE...KLNHG..........
O53046_9LACO/76-210IPLFQ...--.......-...................SPN--YIGREF--------IHHLSH...AFNKG..........
Q23087_CAEEL/81-242IFLDR...--.......-....................SF--DTDKTK--------LDNILNYYAETEY...........
P73054_SYNY3/40-177FPVDV...--.......-.....................K--RPEISS--------VSYSVQ...LLQAG..........
PLSC_COCNU/111-237QRIDR...--.......-...................SNP--SAAIES--------IKEVAR...AVVKK..........
PLSC_BACSU/18-142FPVDR...--.......-...................ENP--G..PSS--------IKTPIK...LLKEG..........
O16526_CAEEL/65-226IFLDR...--.......-....................NF--ENDKPV--------LERIVKYYSGSEK...........
Q53145_RHOSH/69-204RQEKR...--.......-....................SL--QKTRET--------MDYTRR...AIEAG..........
PLC2_CAEEL/77-205IFIDR...--.......-...................YNR--ERAMAS--------VDYCAS...EMKNR..........
PLSC_MYCPN/72-202VFIDR...--.......-...................KNL--RQMAAS--------LEQQQQ...IIRQG..........
O07807_MYCTU/22-151IPVDR...--.......-......................--QDGSAS--------YDAAVR...MLKAG..........
O67119_AQUAE/640-768ITVNV...--.......-.....................N--KGLKES--------LQKTAY...ALMSG..........
P74498_SYNY3/43-168YPVKR...--.......-...................GSG--D..RGA--------LRAALT...ALGDG..........
O07809_MYCTU/23-150IPVDR...--.......-......................--SVGADA--------YAVAVQ...RLRAG..........
PLSC_YEAST/62-191YFLDR...--.......-...................SKR--QEAIDT--------LNKGLE...NVKKN..........
PLSB_PEA/206-365VYSKKHML--D......-...............NPELVDM--KRKANT--------RSRK.EMAMLLRSG..........
PLSC_ECOLI/52-180LLIDR...--.......-...................NNR--TKAHGT--------IAEVVN...HFKKR..........
PLSB_SPIOL/220-379VYSKKHMY--D......-...............DPELVDV--KKRANT--------RSLK.ELVLLLRGG..........
PLCB_HUMAN/77-205FFINR...--.......-...................QRS--STAMTV--------MADLGE...RMVRE..........
PLC1_CAEEL/73-201VYINR...--.......-...................FSK--EKALKT--------VDTTLH...EIVTK..........
PLSB_CARTI/208-368VYSKKHMN--D......-...............VPELAEM--KKRSNT--------RSLKGRMALLLRGG..........
O69114_BURPE/48-174VFIQR...--.......-...................EKR--SEAKRI--------MHELSE...RLGNG..........
PLSC_BORBU/67-194IFVNR...--.......-...................RSI--RSAAAA--------EVKAIK...VMREG..........
O84813_CHLTR/101-259IYSKRHIN--H......-...............PPELKEE--KLMHNQ--------KSMRTLK.MLLSEG..........
Q9W1B5_DROME/236-359IWFER...--.......-...................GEA--KDRHLV--------AERLKQ..HVSDPN..........
PLSB_ECOLI/281-425FFIRRT..--.......-.................FKGNK--LYSTVF--------REYLGE...LFSRG..........
O53516_MYCTU/20-152VPIDR...--.......-...................TNA--DSAQGA--------LQTAVV...LLGQG..........
YD018_YEAST/84-276IFLSRNWQ--KDEKA..-...........LTNSLVSMDLN--ARCKGP--------LTNYKSCYSKTNESI.........
PLSB_ARATH/208-367VYSKKHMN--D......-...............DPELVDM--KRKANT--------RSLK.EMATMLRSG..........
O07808_MYCTU/23-150IPVDR...--.......-......................--GAGGSA--------YAVAVQ...RLREG..........
O53273_MYCTU/79-224IPIER...--.......-...................ASL--RRLPGV--------VDTIAR...RLRAG..........
CST26_YEAST/74-282IFMSRKWA--QDKIT..-...........LSNSLAGLDSN--ARGAGS--------LAGKSPE.RITEEGESIWNPEVID
PLCA_HUMAN/83-211IFIDR...--.......-...................KRT--GDAISV--------MSEVAQ...TLLTQ..........
AAS_ECOLI/15-138VPLDP...--.......-...................TQP--M....A--------IKHLVR...LVEQG..........
Q9N5S8_CAEEL/317-440IWFER...--.......-...................SEA--KDRLVV--------AQKLKE..HCTNPD..........
GNPAT_HUMAN/138-283FFMRRT..--.......-.................FGGNK--LYWAVF--------SEYVKT...MLRNG..........
O67841_AQUAE/28-151IPLRR...--.......-...................GSE--D..IST--------LEECVS...LLKLG..........
PLSB_CAEEL/142-292FFIRRRVD--P......-..............DDERGKDQ--LYRAIL--------HSYIEQ...VLSKD..........
PLSB_HAEIN/281-425FFIRRT..--.......-.................FKGNR--LYSAIF--------REYLSE...LFHRG..........

PF03279

O07148_MYCLE/9-307VWLVQCHG..TFTTVAE-RLKPESLYRRFINYRENLGFEV--LPMSANKDTGFQALFELLCE---RLRSN----------
O84013_CHLTR/7-316LYITKRYP..GLAFAKP-VK.NRRLNQKIISLRESFQGKI--VPPQNA........INQALR---ALHRG----------
Q9ZCL1_RICPR/1-290KVLKKYYP..KVAVIYR-KANNPYVNKLVNESRAGDKLRL--IPKGSE......G.IRSLVR---AIKEG----------
Q9Z983_CHLPN/6-314LYITKNYP..GIAFAKA-IK.NQRLSKKIFALREVFKGKI--VPPKNG........IQQGIE---ALNQG----------
MSBB_ECOLI/11-305MLMASQGQ..KMAAMFH-NQGNPVFDYVWNTVRRRFGGRL--HARNDG........IKPFIQ---SVRQG----------
ACYLT_MYCTU/9-303MWLVQRHG..TFTTVAE-RLKPESLYQRFIDYRESLGFEV--LPLSG....GERPPFEVLSE---RLRNN----------
Q9RA26_VIBMA/9-305LHIASYGA..PFCTMFN-NSENELFDWLMTRQRAMFGGTV--YHRKAG........LGALVK---SLKSG----------
MSBB_HAEIN/17-309IILHTQGM..PMTSMYN-PHRNPLVDWLWTITRQRFGGKM--HARQNG........IKPFLS---HVRKG----------
HTRB_ECOLI/4-297RQFGMQEP..GIGVYRP-ND.NPLIDWLQTWGRLRSNKSM--LDRKD.........LKGMIK---ALKKG----------
HTRB_HAEIN/6-300RIIGLHHP..GIGVYRP-ND.NPLLDWLQTQGRLRSNKDM--LDRKD.........LRGMIK---ALRHE----------
Q9ZMF5_HELPJ/17-320TTLAQYYENYGRGCLGR-LTKFAPINHMIMSRREAFGVRF--VNKIGA........MKELIK---MYNQG----------
DDG_SHIFL/4-296RVMGLCQP..MMATYRP-HN.NQLMEWVQTRGRMRSNKAM--IGRNN.........LRGIVG---ALKKG----------
Q9ZGU3_ECO57/41-334MLMAASGR..KMAAMFH-NQRNPVVDYVWNSVRRRFGGKL--HARNDG........IASFVR---SVRQG----------

PF03982

DGAT2_MOUSE/92-388CPVNRDTIDYLLSKNGS.GNAIIIVVGGAAESLSSMPGKN--AVTLKN--------RKGFVK--LALRHG----------
Q23067_CAEEL/63-359IEVSKESLEYTLTKCGK.GRACAIVIGGASEALEAHPNKN--TLTLIN--------RRGFCK--YALKFG----------
Q9XUW0_CAEEL/50-345IESSKESIEHVLNSEEK.GRAVVIVVGGAAEALEAHPGKH--TLTLAN--------RKGFVR--EAVKTG----------
Q9N4S3_CAEEL/44-340IDCSRESIEYVLDKCGQKGRAVVLVIGGAEEALDAHPGYH--TLTLAS--------RKGFVR--EALITG----------
O01881_CAEEL/55-349IDCSRESIKHVLEHEKK.GKAVVLVVGGAEEALDAHPGCH--ILTLKK--------RKGFVK--IALQTG----------
DGAT2_ARATH/39-312TAASRKNFTSLLDSGYS....CVLVPGGVQETFHMQHDAE--NVFLSR--------RRGFVR--IAMEQG----------

PF04028

D1N6P7_9BACT/65-137KSLRG----------------------S..........SS..RGGAKA--------QLAAVH---AIR.D----------
A5VP00_BRUO2/58-140RAIRG----------------------SGAG...QRKGNR..QGGAAA--------LRQMLY---ALR.N----------
B4S5E5_PROA2/66-138QLIRG----------------------S..........SS..RGSQAV--------KKQMLD---TIT.N----------
B8CZC4_HALOH/63-136RVVRG----------------------S..........SS..RGGGRA--------LLRLLR---EAK.K----------
Q1Q2B7_9BACT/51-125GVVRG----------------------S..........TT..RGGARA--------VKALMD---KTK.A----------
O67824_AQUAE/54-132EVVRG----------------------STE.....EGKAK..KGGRSA--------TLKLIE---YLK.E----------
Q07UI0_RHOP5/59-132LTVTG----------------------S..........SS..KGGMRA--------VRELMR---FAR.D----------
A7I0Q2_CAMHC/55-131GAIRG----------------------S..........SS..KNAARA--------LISAFR---ELD.N----------
Q17YC6_HELAH/56-131KNIRG----------------------S..........SK..KGGVKV--------LIEGLK---RLK.E----------
A8GUS8_RICB8/66-139KVIVG----------------------S..........SN..KNPLGA--------LRNIIE---KLS.Q----------
Q4HSN1_CAMUP/50-127NVIRG----------------------S..........TF..RGASTA--------LRSAFK---VLE.Q----------
A7HQR6_PARL1/65-150GTIRG----------------------AGVPKGEERAHKQKGKGGAGA--------LRAMVR---ALG.E----------
Q0BPV8_GRABC/70-148KTLNG----------------------S..........SS..RGGATV--------LRDTLR---ILE.Q----------
Q3SPI1_NITWN/63-143ETIRG----------------------SGDH...GSAFNR..KGGVGA--------FKEMVR---ALE.E----------
Q13EQ9_RHOPS/59-132QTAVG----------------------S..........SS..KGGMRA--------AREMLR---LAR.D----------
Q0G3U5_9RHIZ/91-172ETVRG----------------------SGGRE..GGTRSE..KGGARA--------VIALRK---ALK.S----------
A4SG45_PROVI/55-128KLIRG----------------------S..........SS..TGGAEV--------RSAMQT---ELE.K----------
Q72BG4_DESVH/52-127HTARG----------------------S..........SS..RGGVKA--------LLQAAR---MMQKQ----------
Q68XV8_RICTY/66-139QVIVG----------------------S..........TN..KNSIVA--------LRNIIG---KLS.Q----------
A8ZZ32_DESOH/61-138DVVRG----------------------S..........SS..QGGRTA--------LLNMVS---YMKTS----------
A3ZQ00_9PLAN/59-131DTVRG----------------------S..........SQ..RGGASA--------LLELLE---KSK..----------
A4EPH0_9RHOB/51-125ETIPM----------------------S..........SH..KRHVAL--------SREVLR---RTK.E----------
B7KT05_METC4/62-145RVMRA----------------------SGARGRAVKDARA..KGGAEG--------LRAMVK---ALK.G----------
Q3AU77_CHLCH/54-126TLIRG----------------------S..........SS..TDGDMV--------KQRMYE---HVQ.Q----------
Q8KBV7_CHLTE/60-132HLIRG----------------------S..........SS..RGKEVV--------RRGIGV---ALS.N----------
A0NV66_9RHOB/60-141GLIRA----------------------SGGKN..ARQIKK..RGGMRG--------FIEALR---ALK.E----------
Q1IHY6_KORVE/68-142PAVRG----------------------S..........SS..RGGAQA--------LRQLRA---MIE.N----------
Q1NQI4_9DELT/69-141ELVRG----------------------S..........RH..RGGVAA--------LKELIG---RVR.A----------
Q04QU1_LEPBJ/92-164CSVRG----------------------S..........SS..KGGSRA--------LKALVT---HLK.K----------
A3EPV4_9BACT/80-155GTIRG----------------------S..........ST..RGGTSV--------LRQVLA---MTKAQ----------
Q0YU03_9CHLB/56-128ALIRG----------------------S..........SS..RGSVEV--------IRAMQQ---TLE.K----------
B4U6Q4_HYDS0/44-122GVVRG----------------------SSN.....KDNKD..KGGAKA--------LIQIKK---ILE.Q----------
A3YRB1_CAMJU/34-111DTVRG----------------------S..........TS..RGASSA--------LRAAFK---VLE.Q----------
A6Q530_NITSB/55-131ESIRG----------------------S..........TK..KGGARV--------MISAMK---KMK.A----------
Q0C4B2_HYPNA/73-162DVVRG----------------------STGNK..KKAGKD..KGGMRA--------IAEAST---RLR.K----------
A5VTV7_BRUO2/75-156LTVRG----------------------SGGRG..TRANPE..KGGARA--------LLTLKN---ALR.K----------
A7ZE08_CAMC1/58-137GTIRG----------------------S..........SS..KGGARA--------LIEALR---EIK.Q----------
A7IFD8_XANP2/60-141GTIRG----------------------SGATS..RNDFHR..KGAVSA--------TYEMLD---TLE.Q----------
Q6MRQ4_BDEBA/54-127KTSRG----------------------S..........ST..RGGVQA--------LKGLLR---LVK.D----------
A6QCC9_SULNB/54-130RPLRG----------------------S..........TK..KGARQV--------LLQAFK---SIK.A----------
Q2C9V5_9RHOB/36-112RQVAM----------------------K..........GG..ASNVAT--------SRTVLR---ALR.G----------
Q0AS10_MARMM/61-143GVVRG----------------------SSRNP..DKPGAA..KGGEAA--------YRAMVN---HLN.A----------
A3V370_9RHOB/43-117RSIQM----------------------S..........RQ..TTNLAA--------SRIVLK---RVR.E----------
Q30PR2_SULDN/55-131GTIAG----------------------S..........TN..RNAARV--------LIQAIS---AIK.D----------
Q8RE56_FUSNN/54-127ILVRG----------------------S..........SD..KNQISS--------TISLLK---YLK.K----------
A5FW91_ACICJ/79-154EAISA----------------------S..........SS..RGGAAG--------LLELAR---LVR.A----------
C0AB63_9BACT/89-161NAVRG----------------------S..........SS..NFGREA--------IYALTD---VLR.R----------
Q1MQ03_LAWIP/59-133ETARG----------------------S..........SS..RGGSEA--------LRNVIK---RMK.D----------
E0TGQ7_PARBH/62-144DTRRG----------------------SGADP..RKPEKN..KGGASA--------LKALTR---ILK.E----------
A3UFX9_9RHOB/75-156EVIRG----------------------SSRN...KKKTKQ..KGGLSA--------FREMVR---WVE.G----------
A0LIS3_SYNFM/40-112RCFRG----------------------S..........PG..KGGGAA--------LKGLID---ALQ.S----------
Q2LXB8_SYNAS/104-179NPVRG----------------------S..........SS..RNGGRA--------LREMVE---QLKAT----------
A4U4M9_9PROT/68-141GTITG----------------------S..........ST..RGGAGG--------LRALLK---ALK.A----------
A6C345_9PLAN/58-131GAIRG----------------------S..........TT..RGGASA--------MKKLMT---SAE..----------
Q11L84_MESSB/67-148QVVRG----------------------SGGRQ..QKNSAQ..KGGAAA--------LIQLKR---AID.A----------
Q1K139_DESAC/59-131HAVRG----------------------S..........SS..RGGRSA--------FKQLLR---LAR.E----------
Q6MBL2_PARUW/66-143GRVIR----------------------V..........PH..HSRHEA--------LREMIR---HVNFK----------
Q3B2C3_PELLD/62-134RLIRG----------------------S..........SS..KGGSEV--------RAAMQG---ALQ.R----------
Q5LVH2_SILPO/63-137DTIAM----------------------S..........SH..KRHVAL--------SREVLG---KMK.D----------
Q0EXM5_9PROT/1-74RTIRG----------------------S..........ST..RGGSRA--------LMQMIF---KSRDE----------
Q5FPH5_GLUOX/51-135IGIHG----------------------SSS.....KKGKN..KGGAAV--------LRTALK---ELE.A----------
Q7MR26_WOLSU/48-124KTLRG----------------------S..........SS..KGAKRV--------LLGAIR---ELE.G----------
Q7UNH8_RHOBA/40-115VPIRG----------------------SS.......GVGE..KGGATA--------LTKMIR---HVK.D----------
A0RQN4_CAMFF/54-130GTIRG----------------------S..........TT..KGALKA--------LLAAFR---TIK.E----------
A7GZE2_CAMC5/59-137GAIRG----------------------S..........SS..KGGAKA--------LITALQ---DIK.S----------
Q0EZ13_9PROT/53-128DTVRG----------------------S..........TT..RGGARA--------MLKMLR---AVRDE----------
A1BDV7_CHLPD/54-126SLIRG----------------------S..........SS..KGADEV--------KSAILK---ALQ.S----------
B3EMB6_CHLPB/56-128SLIRG----------------------S..........SS..KGSSEV--------KKSMIA---RLE.K----------
Q6AJI7_DESPS/60-135KTARG----------------------S..........HN..SGGMRA--------LKHVLR---DVK.N----------
Q983L9_RHILO/61-142EAVRG----------------------SGGRD..NARHLD..KGGAKA--------LIALKK---SLT.A----------
A3EVN0_9BACT/75-150LSVRG----------------------S..........SS..NGGIQA--------LRELLK---IAKDG----------
A8ZZ01_DESOH/61-133LPVRG----------------------S..........ST..RGGREA--------LAEIKR---LSG.S----------
B4SDV4_PELPB/54-126SLIRG----------------------S..........SS..KGGAAV--------KQAMQK---ALQ.N----------
Q2VZT0_MAGSA/63-136ETVQG----------------------S..........TT..RGGSAA--------LRAMLK---FLK.S----------
A4Z0S3_BRASO/63-144GTIRG----------------------SGDH...GGSFHR..KGGVGA--------FREMVQ---ALE.D----------
B9KF52_CAMLR/50-127DTLRG----------------------S..........TS..KGALAL--------LKQSFK---ILD.Q----------
A3ZQR1_9PLAN/53-130TPIRG----------------------SNR.....TRGQT..KGGREA--------LVGLIE---HVD.G----------
A1UU05_BARBK/79-160EIVRG----------------------SGGRG..KTHYVN..KGGAKA--------LLTLKN---SLK.S----------
Q7VGP5_HELHP/56-138KTLRG----------------------S..........SS..KGGLRV--------LMEALK---LLK.G----------

PF01553

Q23598_CAEEL/54-198......KW.V--HIFPEG....KVCTLE...................SEP..LRFKWGIGR-----LVMDAK.....TDP
GPAT1_MOUSE/205-355......QF.L--EIFLEG.....TRSRS...................GKT..SCARAGLLS-----VVVDTLSSNTIPDI
Q9FF57_ARATH/134-257......SNPL--LIFPEG.....TCVNN...................NYT..VMFKKGAFE-----L...........DC
Q21812_CAEEL/224-347......KLPI--IIFPEG.....TCINN...................TSV..MMFKKGSFE-----I...........GS
O54097_STRCO/67-199......EL.V--GVMPEGYKGLGKPFEE...................RYRLQRFGRGGFAA-----VALRS.......RR
PLSC_MYCGE/72-202......TA.I--AVFAEG.....TRILS...................NDI..GEFKPGALK-----VAYNA.......FV
Q50898_MYXXA/28-156......RAVV--FVFPEG......EHRP...................FGVLPLRLERGVEL-----LARVS.......KV
PLSC_HAEIN/52-180......NLSI--WMFPEG.....TRNRG...................RGL..LPFKTGAFH-----AAISA.......GV
Q9VRC1_DROME/201-323......RPPV--LLFPEG.....TCINN...................TAV..MQFKKGSFA-----V...........SD
PLSC_NEIGO/60-182......QN.V--SFFPEA.....RTSSG...................LGL..LPFKAALFQ-----SAIDA.......GA
Q9Z6V0_CHLPN/101-259......GKFI--YVAPAG.....GRDRKN................AEGRLYPSEFSPESIE-----VFRLLAKA.SNQTT
Y2427_MYCLE/138-270......EL.T--AVFPEGYKGLGKRFQD...................RYRLQRFGRGGFVK-----AALST.......KA
O06830_MYCTU/42-173......GV.V--VVFPGGDYDAYRPTFA...................ENVIDFNGRKGYVS-----TAVEA.......GV
O53962_MYCTU/46-174......EL.V--MVFPGGAREVNKRKNE...................RYKLVWKNRLGFAR-----LAIQH.......GY
O32330_CLOBU/35-163......ED.I--LIFPEG.....TRSRI...................GAM..IEGKKGILL-----FARMA.......KA
O35259_MOUSE/106-229......KLPI--LIFPEG.....TCINN...................TSV..MMFKKGSFE-----I...........GA
O53208_MYCTU/312-439......LS.I--VIAPEG.....TRLDT...................TEV..GSFKKGPFR-----IAMAA.......KI
PLSC_LIMAL/90-216......NLSL--IMFPEG.....TRSGD...................GRL..LPFKKGFVH-----LALQS.......HL
TAZ_HUMAN/41-215......DW.V--HIFPEG.....KVNMS...................SEF..LRFKWGIGR-----LIAECH.....LNP
O53046_9LACO/76-210......HW.V--LIFPEQEMWWNYRKPR.........................KPQRGAYY-----FAAKC.......NV
Q23087_CAEEL/81-242......KYQL--LLFPEG.....TDKCPKATERSRI..HSEKKGLVHYQYVLHPRVTGFVH-----IVQAMRRANNIKYI
P73054_SYNY3/40-177......EM.L--VIFPEG.....GIFRD....................QHTVHPLKRGIGR-----IAMEVCKQNPNTDI
PLSC_COCNU/111-237......NLSL--IIFPEG.....TRSKT...................GRL..LPFKKGFIH-----IALQT.......RL
PLSC_BACSU/18-142......EI.V--GIFPSG.....TRTSE.......................DVPLKRGAVT-----IAQMG.......KA
O16526_CAEEL/65-226......KYQI--LLFAEG.....TDKGERATRLSDA..FADKNGLPRYEYVLHPRTTGFKF-----LMELMKKENYIKYV
Q53145_RHOSH/69-204......RL.G--VIFPSGR...LAKRTG...................LKLMERPWMASAAM-----IARKF.......DL
PLC2_CAEEL/77-205......NLKL--WVFPEG.....TRNRE...................GGF..IPFKKGAFN-----IAVRA.......QI
PLSC_MYCPN/72-202......TA.L--CVFPEG.....TRVLS...................RQI..GEFKSGALK-----VAYNA.......FV
O07807_MYCTU/22-151......EL.V--GVYPEA.....TISRS...................FEI..KEFKTGAAR-----MAIEA.......GV
O67119_AQUAE/640-768......KV.V--VIFPEG.....ARTRT...................EEL..MEFKKGVAI-----LAREL.......GV
P74498_SYNY3/43-168......WL.V--GVFLEG.....TRTKD...................GRI..HQPKLGAAM-----IAAKA.......QV
O07809_MYCTU/23-150......EL.V--GLHPEA.....TISRS...................LEL..REFKTGAAR-----MALEA.......QV
PLSC_YEAST/62-191......KRAL--WVFPEG.....TRSYT...................SELTMLPFKKGAFH-----LAQQG.......KI
PLSB_PEA/206-365......SQII--WIAPSG.....GRDRPVA...............NSGEWAPAPFDSSSVD-----NMRRLVDH.SGPPG
PLSC_ECOLI/52-180......RISI--WMFPEG.....TRSRG...................RGL..LPFKTGAFH-----AAIAA.......GV
PLSB_SPIOL/220-379......SKII--WIAPSG.....GRDRPDA...............VTGEWYPGTFDFAALD-----NMRRLVEH.AGRPG
PLCB_HUMAN/77-205......NLKV--WIYPEG.....TRNDN...................GDL..LPFKKGAFY-----LAVQA.......QV
PLC1_CAEEL/73-201......KRKV--WIYPEG.....TRNAE...................PEL..LPFKKGAFI-----LAKQA.......KI
PLSB_CARTI/208-368......SKII--WIAPSG.....GRDRPDP...............ITNQWFPAPFDATSLD-----NMRRLVDH.AGLVG
O69114_BURPE/48-174......EL.M--CVFPEG.....TTSDG...................LGL..LPFHSNLFQ-----AVVSA.......DC
PLSC_BORBU/67-194......RS.I--GIFPEG.....TRNRG...................GDT..RVFKKGSIK-----MALKT.......GT
O84813_CHLTR/101-259......GKFF--YVAPSG.....GRDRKN................LQGELYPAEFHPDSVE-----MFRLLAKS.SGKTT
Q9W1B5_DROME/236-359......NPPI--LIFPEG.....TCINN...................TSV..MQFKKGSFE-----V...........GG
PLSB_ECOLI/281-425......YS.V--EYFVEG.....GRSRT...................GRL..LDPKTGTLS-----MTIQAMLRGGTRPI
O53516_MYCTU/20-152......KL.L--GMYPEG.....TRSPD...................GRL..YKGKTGLAR-----LALHT.......GV
YD018_YEAST/84-276.....AAYNL--IMFPEG.....TNLSLKTREKSEAFCQRAHLDHVQLRHLLLPHSKGLKF-----AVEKLAP..SLDAI
PLSB_ARATH/208-367......GQLI--WIAPSG.....GRDRPNP...............STGEWFPAPFDASSVD-----NMRRLVEH.SGAPG
O07808_MYCTU/23-150......EL.V--GVYPEA.....TISRS...................FEL..KGFKTGAAR-----MAAEA.......DV
O53273_MYCTU/79-224......QT.V--VAFPEG.....TTWCGRPGDDAGRPAARAGAGCSHRGC..GAFYPAMFQ-----AAIDA.......GR
CST26_YEAST/74-282PKQIHWPYNL--ILFPEG.....TNLSADTRQKSAK..YAAKIGKKPFKNVLLPHSTGLRY-----SLQKLKP..SIESL
PLCA_HUMAN/83-211......DVRV--WVFPEG.....TRNHN...................GSM..LPFKRGAFH-----LAVQA.......QV
AAS_ECOLI/15-138......RP.V--VIFPEG.....RITTT...................GSL..MKIYDGAGF-----VAAKS.......GA
Q9N5S8_CAEEL/317-440......KLPI--LIFPEG.....TCINN...................TSV..MMFKKGSFE-----I...........GT
GNPAT_HUMAN/138-283......YAPV--EFFLEG.....TRSRS...................AKT..LTPKFGLLN-----IVMEPFFKREVFDT
O67841_AQUAE/28-151......CK.I--GIFPEG.....TRANP...................GEF..KRAKPGVGF-----LAINS.......GF
PLSB_CAEEL/142-292......MP.I--EFFLEG.....TRSRF...................GKA..LTPKNGLIS-----NVVEAVQHGFIKDC
PLSB_HAEIN/281-425......YS.V--EYFIEG.....GRSRT...................GRL..LAPKTGMMS-----MTLQALQHSQTRPI

PF03279

O07148_MYCLE/9-307------R.VV--CLMAER-----DLTRT------------------.GVEVDFFGEPTRMP-----AGPAKLAIKTG..A
O84013_CHLTR/7-316------E.VV--GIVGDQ-----VLLSS------------------.EYSYPLFGSQAFTT-----TSPALLAYKTK..K
Q9ZCL1_RICPR/1-290------E.SI--VMLVDQ-----KMNDG------------------..IEVPFLGRPSMTA-----SSIAKIALQYK..Y
Q9Z983_CHLPN/6-314------K.LV--GIVGDQ-----ALLMS------------------.SYTYPLFGSPAFTT-----TSPALLAYKTG..F
MSBB_ECOLI/11-305------Y.WG--YYLPDQ-----DHGPE------------------HSEFVDFFATYKATL-----PAIGRLMKVCR..A
ACYLT_MYCTU/9-303------R.VV--CLMAER-----DLTRT------------------.GVEVDFFGEPTRMP-----VGPAKLAVETG..A
Q9RA26_VIBMA/9-305------E.SC--YYLPDE-----DHGPK------------------RSVFAPLFATQKATL-----PVMGKLAEKTN..A
MSBB_HAEIN/17-309------E.MG--YYLPDE-----DFGAE------------------QSVFVDFFGTYKATL-----PGLNKMAKLSK..A
HTRB_ECOLI/4-297------E.VV--WYAPDH-----DYGPR------------------SSVFVPLFAVEQAAT-----TTGTWMLARMS.GA
HTRB_HAEIN/6-300------E.TI--WYAPDH-----DYGRK------------------NAVFVPFFAVPDTCT-----TTGSYYLLKSSQNS
Q9ZMF5_HELPJ/17-320------NGLV--GILVDQ-----NVVPK------------------DGVVVKFFNKDATHT-----TIASILSRRYN..I
DDG_SHIFL/4-296------E.AV--WFAPDQ-----DYGRK------------------GSSFAPFFAVENVAT-----TNGTYVLSRLS.GA
Q9ZGU3_ECO57/41-334------Y.WG--YYLPDQ-----DHGPE------------------FSEFADFFATYKATL-----PVIGRLSRISG..A

PF03982

DGAT2_MOUSE/92-388------ADLV--PTYSFGENEVYKQVIF--EEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGE
Q23067_CAEEL/63-359------ADLV--PMYNFGENDLYEQYEN--PKGSRLREVQEKIKDMFGLCPPLLRGRSLFNQYLIGLLPFRKPVTTVMGR
Q9XUW0_CAEEL/50-345------AHLV--PVYAFGENDIYKQIDN--PEGSKLRKIQEWGKKKMGISLPLIYGRGYFQ.MALGLLPMSRAVNVVVGA
Q9N4S3_CAEEL/44-340------AYLV--PVYSFGENDVFEQMEN--PVGSRLRNFQEWCKSIFGISYPIFHGRGFFQ.LTFGYLPFRKPIDTVVGA
O01881_CAEEL/55-349------AQLV--PCYSFGENDIFNQAEN--PKGSTIRQFQTIMKRVLGFSPPAFYGRGVFN.YTFGLLPFRKPINTVLGA
DGAT2_ARATH/39-312------SPLV--PVFCFGQARVYKWWKP--DCDLYL.....KLSRAIRFTPICFWG..VFGSP....LPCRQPMHVVVGK

PF04028

D1N6P7_9BACT/65-137------GYNV..SFTPDG-------------------------------------PRGPIY-------------------
A5VP00_BRUO2/58-140------GESI..VMAVET-------------------------------------NKKVFR-------------------
B4S5E5_PROA2/66-138------HGIV..AITPDG-------------------------------------PRGPKH-------------------
B8CZC4_HALOH/63-136------GATV..LLTPDG-------------------------------------PRGPIY-------------------
Q1Q2B7_9BACT/51-125------GYSI..AITPDG-------------------------------------PRGPRC-------------------
O67824_AQUAE/54-132------GKNV..AITVDG-------------------------------------PKVPLT-------------------
Q07UI0_RHOP5/59-132------GHCL..FVTPDG-------------------------------------PRGPRM-------------------
A7I0Q2_CAMHC/55-131------GVNI..VITPDG-------------------------------------PRGPFQ-------------------
Q17YC6_HELAH/56-131------GYDV..AITPDG-------------------------------------PKGPRH-------------------
A8GUS8_RICB8/66-139------GANV..IITPDG-------------------------------------PKGPVY-------------------
Q4HSN1_CAMUP/50-127------KDDI..IITPDG-------------------------------------PRGPRH-------------------
A7HQR6_PARL1/65-150------NISV..ALTADL-------------------------------------PPGPAR-------------------
Q0BPV8_GRABC/70-148------GGRI..IITPDG-------------------------------------PRGPRR-------------------
Q3SPI1_NITWN/63-143------GYNV..ALTADV-------------------------------------PKRSRI-------------------
Q13EQ9_RHOPS/59-132------GHSL..FVTPDG-------------------------------------PRGPRM-------------------
Q0G3U5_9RHIZ/91-172------GYGV..CMIADV-------------------------------------PKGVPR-------------------
A4SG45_PROVI/55-128------GTIV..CITPDG-------------------------------------PRGPFE-------------------
Q72BG4_DESVH/52-127------NLCG..CVTVDG-------------------------------------PRGPRH-------------------
Q68XV8_RICTY/66-139------GANI..IVTPDG-------------------------------------PKGPVY-------------------
A8ZZ32_DESOH/61-138------PVQMICGTPVDG-------------------------------------PRGPGR-------------------
A3ZQ00_9PLAN/59-131------NMHL..AITPDG-------------------------------------PRGPRR-------------------
A4EPH0_9RHOB/51-125------GCSI..GIAADG-------------------------------------PRGPAR-------------------
B7KT05_METC4/62-145------GETV..AFSADV-------------------------------------PKVSRV-------------------
Q3AU77_CHLCH/54-126------GQMV..AITPDG-------------------------------------PRGPNH-------------------
Q8KBV7_CHLTE/60-132------GGVA..AVTPDG-------------------------------------PRGPHH-------------------
A0NV66_9RHOB/60-141------GYSI..AMTADV-------------------------------------PKGPAR-------------------
Q1IHY6_KORVE/68-142------KRNA..VFTIDG-------------------------------------PRGPRY-------------------
Q1NQI4_9DELT/69-141------GANA..GIIADG-------------------------------------SQGPAR-------------------
Q04QU1_LEPBJ/92-164------NLPA..AITPDG-------------------------------------PRGPAL-------------------
A3EPV4_9BACT/80-155------ESSF..FVTPDG-------------------------------------PTGPPF-------------------
Q0YU03_9CHLB/56-128------GDIV..VITPDG-------------------------------------PRGPIN-------------------
B4U6Q4_HYDS0/44-122------GYNI..AITVDG-------------------------------------PTGPPK-------------------
A3YRB1_CAMJU/34-111------NDDI..VITPDG-------------------------------------PRGPYH-------------------
A6Q530_NITSB/55-131------GYDI..AITPDG-------------------------------------PRGPRH-------------------
Q0C4B2_HYPNA/73-162------GDYI..CMTPDG-------------------------------------PRGPRR-------------------
A5VTV7_BRUO2/75-156------GQST..SMIADI-------------------------------------DHGKAR-------------------
A7ZE08_CAMC1/58-137------GHDV..IITPDG-------------------------------------PRGPRH-------------------
A7IFD8_XANP2/60-141------GINV..AMTADV-------------------------------------PKIARR-------------------
Q6MRQ4_BDEBA/54-127------GGNC..SFAVDG-------------------------------------PKGPLH-------------------
A6QCC9_SULNB/54-130------GEEV..LITPDG-------------------------------------PRGPRH-------------------
Q2C9V5_9RHOB/36-112------GASI..GLALDG-------------------------------------PLGPAR-------------------
Q0AS10_MARMM/61-143------GGCG..AVTPDG-------------------------------------PRGPRM-------------------
A3V370_9RHOB/43-117------GISI..GMTADG-------------------------------------PLGPAY-------------------
Q30PR2_SULDN/55-131------GYDI..GITPDG-------------------------------------PKGPRH-------------------
Q8RE56_FUSNN/54-127------GYSI..GTPLDG-------------------------------------PKGPKE-------------------
A5FW91_ACICJ/79-154------GHPV..VITPDG-------------------------------------PRGPRR-------------------
C0AB63_9BACT/89-161------GDDI..GLTPDG-------------------------------------PRGPRY-------------------
Q1MQ03_LAWIP/59-133------GFCA..CITVDG-------------------------------------PKGPRH-------------------
E0TGQ7_PARBH/62-144------GKNA..GITPDG-------------------------------------PRGPRR-------------------
A3UFX9_9RHOB/75-156------GGCM..ALTPDG-------------------------------------PRGPRM-------------------
A0LIS3_SYNFM/40-112------SYGG..GFIADG-------------------------------------SQGPPR-------------------
Q2LXB8_SYNAS/104-179------GLA...AHIVDG-------------------------------------PTGPAG-------------------
A4U4M9_9PROT/68-141------GAYV..GITPDG-------------------------------------PKGPRM-------------------
A6C345_9PLAN/58-131------GKHV..VITPDG-------------------------------------PRGPHH-------------------
Q11L84_MESSB/67-148------GSNA..AMIADI-------------------------------------PHGTPR-------------------
Q1K139_DESAC/59-131------AKDL..VITPDG-------------------------------------PRGPRH-------------------
Q6MBL2_PARUW/66-143------KSIA..IITPDG-------------------------------------PRGPRY-------------------
Q3B2C3_PELLD/62-134------GNLV..VLTPDG-------------------------------------PRGPLH-------------------
Q5LVH2_SILPO/63-137------GISI..GIAADG-------------------------------------PRGPER-------------------
Q0EXM5_9PROT/1-74------KCDF..GLSPDG-------------------------------------PKGPRE-------------------
Q5FPH5_GLUOX/51-135------GSLV..AITPDG-------------------------------------PRGPAE-------------------
Q7MR26_WOLSU/48-124------GGDI..AITPDG-------------------------------------PRGPYH-------------------
Q7UNH8_RHOBA/40-115------GNPS..VIAVDG-------------------------------------PRGPRG-------------------
A0RQN4_CAMFF/54-130------GADV..AITPDG-------------------------------------PKGPRH-------------------
A7GZE2_CAMC5/59-137------GTDV..IITPDG-------------------------------------PRGPRH-------------------
Q0EZ13_9PROT/53-128------NRHL..AITPDG-------------------------------------PKGPRE-------------------
A1BDV7_CHLPD/54-126------GDIV..AITPDG-------------------------------------PRGPVH-------------------
B3EMB6_CHLPB/56-128------NGII..AITPDG-------------------------------------PRGPSQ-------------------
Q6AJI7_DESPS/60-135------GGSA..GIVADG-------------------------------------SQGPAL-------------------
Q983L9_RHILO/61-142------GKNV..AMIADI-------------------------------------PHGTPR-------------------
A3EVN0_9BACT/75-150------CTSL..VFTPDG-------------------------------------PKGPIY-------------------
A8ZZ01_DESOH/61-133------GYKI..GHIVDG-------------------------------------PQGPFG-------------------
B4SDV4_PELPB/54-126------GNIV..ALTPDG-------------------------------------PRGPAN-------------------
Q2VZT0_MAGSA/63-136------GECV..GITPDG-------------------------------------PKGPRM-------------------
A4Z0S3_BRASO/63-144------NYNV..ASTADV-------------------------------------PKRARI-------------------
B9KF52_CAMLR/50-127------GDDI..IITPDG-------------------------------------PRGPYH-------------------
A3ZQR1_9PLAN/53-130------GKPA..YLAVDG-------------------------------------PRGPRN-------------------
A1UU05_BARBK/79-160------GKTV..AMIADI-------------------------------------ANGKAR-------------------
Q7VGP5_HELHP/56-138------GCDI..GMSPDG-------------------------------------PKGPYH-------------------

PF01553

Q23598_CAEEL/54-198VILPVWCK--------------------------------------------------------------
GPAT1_MOUSE/205-355LVIPVGIS--------------------------------------------------------------
Q9FF57_ARATH/134-257TVCPIAIK--------------------------------------------------------------
Q21812_CAEEL/224-347TIYPIAVK--------------------------------------------------------------
O54097_STRCO/67-199PMVPCSIV--------------------------------------------------------------
PLSC_MYCGE/72-202PILPVSIV--------------------------------------------------------------
Q50898_MYXXA/28-156ECLPIAVR--------------------------------------------------------------
PLSC_HAEIN/52-180PIIPVVCS--------------------------------------------------------------
Q9VRC1_DROME/201-323VVHPVAIR--------------------------------------------------------------
PLSC_NEIGO/60-182KVLAVALR--------------------------------------------------------------
Q9Z6V0_CHLPN/101-259HFYPFALK--------------------------------------------------------------
Y2427_MYCLE/138-270TIVPCSIV--------------------------------------------------------------
O06830_MYCTU/42-173PIVPAVSI--------------------------------------------------------------
O53962_MYCTU/46-174PIVPFASV--------------------------------------------------------------
O32330_CLOBU/35-163EIIPIGMS--------------------------------------------------------------
O35259_MOUSE/106-229TVYPVAIK--------------------------------------------------------------
O53208_MYCTU/312-439PIVPIVIR--------------------------------------------------------------
PLSC_LIMAL/90-216PIVPMILT--------------------------------------------------------------
TAZ_HUMAN/41-215IILPLWHV--------------------------------------------------------------
O53046_9LACO/76-210PIISTFVE--------------------------------------------------------------
Q23087_CAEEL/81-242YDVSIGFG--------------------------------------------------------------
P73054_SYNY3/40-177KVIPVTIA--------------------------------------------------------------
PLSC_COCNU/111-237PIVPMVLT--------------------------------------------------------------
PLSC_BACSU/18-142PLVPAAYQ--------------------------------------------------------------
O16526_CAEEL/65-226YDLTIAYS--------------------------------------------------------------
Q53145_RHOSH/69-204PVAPVNIR--------------------------------------------------------------
PLC2_CAEEL/77-205PIIPVVFS--------------------------------------------------------------
PLSC_MYCPN/72-202PIVPLTIV--------------------------------------------------------------
O07807_MYCTU/22-151PIVPHIVW--------------------------------------------------------------
O67119_AQUAE/640-768PIVPVAIE--------------------------------------------------------------
P74498_SYNY3/43-168PIIPVSLG--------------------------------------------------------------
O07809_MYCTU/23-150PIIPMIVW--------------------------------------------------------------
PLSC_YEAST/62-191PIVPVVVS--------------------------------------------------------------
PLSB_PEA/206-365HIYPLAIL--------------------------------------------------------------
PLSC_ECOLI/52-180PIIPVCVS--------------------------------------------------------------
PLSB_SPIOL/220-379HIYPLALL--------------------------------------------------------------
PLCB_HUMAN/77-205PIVPVVYS--------------------------------------------------------------
PLC1_CAEEL/73-201PIVPCVFS--------------------------------------------------------------
PLSB_CARTI/208-368HIYPLAIL--------------------------------------------------------------
O69114_BURPE/48-174SVQPICLM--------------------------------------------------------------
PLSC_BORBU/67-194SILPVTLY--------------------------------------------------------------
O84813_CHLTR/101-259HFFPLAMK--------------------------------------------------------------
Q9W1B5_DROME/236-359VIYPVAIK--------------------------------------------------------------
PLSB_ECOLI/281-425TLIPIYIG--------------------------------------------------------------
O53516_MYCTU/20-152PVIPVAMI--------------------------------------------------------------
YD018_YEAST/84-276YDVTIGYS--------------------------------------------------------------
PLSB_ARATH/208-367HIYPMSLL--------------------------------------------------------------
O07808_MYCTU/23-150PIVPVVVW--------------------------------------------------------------
O53273_MYCTU/79-224PVQPLRLT--------------------------------------------------------------
CST26_YEAST/74-282YDITIGYS--------------------------------------------------------------
PLCA_HUMAN/83-211PIVPIVMS--------------------------------------------------------------
AAS_ECOLI/15-138TVIPVRIE--------------------------------------------------------------
Q9N5S8_CAEEL/317-440TIYPIAMK--------------------------------------------------------------
GNPAT_HUMAN/138-283YLVPISIS--------------------------------------------------------------
O67841_AQUAE/28-151PVLPVYID--------------------------------------------------------------
PLSB_CAEEL/142-292YLVPVSYT--------------------------------------------------------------
PLSB_HAEIN/281-425SIVPVYVG--------------------------------------------------------------

PF03279

O07148_MYCLE/9-307ALLPVHCWFQGSG.....WGFSVHPALDCTSG.....DVGDVTQALADQFAQDIAANPTDWHMLQPQWLA
O84013_CHLTR/7-316TVIAVAIYRKPNGNYLVVPSKAFHANTELSIRE....STEQLMDRLMRFLEKGITCKPEQWLWLHKRWKR
Q9ZCL1_RICPR/1-290PIIPCQIIRTKGS....YFKVIVHPQLKFEQTGDNKVDCYNIMFNINQILGEWVKQNPAQWFWFHNRWKK
Q9Z983_CHLPN/6-314PVIAVNVSRQAKG.FEVIPSAKLYANKSLPMKE....SVAILMDQMMGFLEKGIASQPEQWMWIHKRWKR
MSBB_ECOLI/11-305RVVPLFPIYDGKT...HRLTIQVRPPMDDLLEA....DDHTIARRMNEEVEIFVGPRPEQYTWILKLLKT
ACYLT_MYCTU/9-303ALLPTHCWFEGRG.....WGFQVYPALDCTSG.....DVAAITQALADRFAQNIAAHPADWHMLQPQWLA
Q9RA26_VIBMA/9-305LVVPVYAAYNESL...GKFETFIRPAMQNFPSE....SPEQDAVMMNKEIEALIECGVDQYMWTLRLLRT
MSBB_HAEIN/17-309VVIPMFPRYNAET...GKYEMEIHPAMNLSDD......PEQSARAMNEEIESFVTPAPEQYVWILQLLRT
HTRB_ECOLI/4-297CLVPFVPRRKPDG...KGYQLIMLPPECSPPLD....DAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKT
HTRB_HAEIN/6-300KVIPFAPLRNKDG...SGYTVSISAPVDFTDLQ....DETAIAARMNQIVEKEIMKDITIYMWLHRRFKT
Q9ZMF5_HELPJ/17-320DIQPVFIDFNDDY...SHYTATYYPSIRSQITDNAQNDILECTQAQASLCEEVIRNHPESYFWFHRRFKS
DDG_SHIFL/4-296AMLTVTMVRKADY...SGYRLFITPEMEGYPT.....DENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKT
Q9ZGU3_ECO57/41-334RIIPLFPVYDGKT...HHLTIHVSPPLAIRQKS....DAH.IARQINEVVENFVRPHPEQYTWILKLLKT

PF03982

DGAT2_MOUSE/92-388PITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFGLPETEVLEVN----------------------
Q23067_CAEEL/63-359PIRVTQTDEPTVEQIDELHAKYCDALYNLFEEYKHLHSIPPDTHLIFQ----------------------
Q9XUW0_CAEEL/50-345PIQVEKELDPSKEVIDEIHGVYMEKLAELFEEHKAKFGVSKDTRLVFQ----------------------
Q9N4S3_CAEEL/44-340PIPVEKVENPTKEQIDELHTIYCQKLTELFDEHKEKYGVEKDVPLVLR----------------------
O01881_CAEEL/55-349PISVTKTVNPTQEQIDTLHQTYMDRLHELFEEHKTKYDVSPTTQLVIN----------------------
DGAT2_ARATH/39-312PIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRVG....YDLELK----------------------

PF04028

D1N6P7_9BACT/65-137----------------------------------------------------------------------
A5VP00_BRUO2/58-140----------------------------------------------------------------------
B4S5E5_PROA2/66-138----------------------------------------------------------------------
B8CZC4_HALOH/63-136----------------------------------------------------------------------
Q1Q2B7_9BACT/51-125----------------------------------------------------------------------
O67824_AQUAE/54-132----------------------------------------------------------------------
Q07UI0_RHOP5/59-132----------------------------------------------------------------------
A7I0Q2_CAMHC/55-131----------------------------------------------------------------------
Q17YC6_HELAH/56-131----------------------------------------------------------------------
A8GUS8_RICB8/66-139----------------------------------------------------------------------
Q4HSN1_CAMUP/50-127----------------------------------------------------------------------
A7HQR6_PARL1/65-150----------------------------------------------------------------------
Q0BPV8_GRABC/70-148----------------------------------------------------------------------
Q3SPI1_NITWN/63-143----------------------------------------------------------------------
Q13EQ9_RHOPS/59-132----------------------------------------------------------------------
Q0G3U5_9RHIZ/91-172----------------------------------------------------------------------
A4SG45_PROVI/55-128----------------------------------------------------------------------
Q72BG4_DESVH/52-127----------------------------------------------------------------------
Q68XV8_RICTY/66-139----------------------------------------------------------------------
A8ZZ32_DESOH/61-138----------------------------------------------------------------------
A3ZQ00_9PLAN/59-131----------------------------------------------------------------------
A4EPH0_9RHOB/51-125----------------------------------------------------------------------
B7KT05_METC4/62-145----------------------------------------------------------------------
Q3AU77_CHLCH/54-126----------------------------------------------------------------------
Q8KBV7_CHLTE/60-132----------------------------------------------------------------------
A0NV66_9RHOB/60-141----------------------------------------------------------------------
Q1IHY6_KORVE/68-142----------------------------------------------------------------------
Q1NQI4_9DELT/69-141----------------------------------------------------------------------
Q04QU1_LEPBJ/92-164----------------------------------------------------------------------
A3EPV4_9BACT/80-155----------------------------------------------------------------------
Q0YU03_9CHLB/56-128----------------------------------------------------------------------
B4U6Q4_HYDS0/44-122----------------------------------------------------------------------
A3YRB1_CAMJU/34-111----------------------------------------------------------------------
A6Q530_NITSB/55-131----------------------------------------------------------------------
Q0C4B2_HYPNA/73-162----------------------------------------------------------------------
A5VTV7_BRUO2/75-156----------------------------------------------------------------------
A7ZE08_CAMC1/58-137----------------------------------------------------------------------
A7IFD8_XANP2/60-141----------------------------------------------------------------------
Q6MRQ4_BDEBA/54-127----------------------------------------------------------------------
A6QCC9_SULNB/54-130----------------------------------------------------------------------
Q2C9V5_9RHOB/36-112----------------------------------------------------------------------
Q0AS10_MARMM/61-143----------------------------------------------------------------------
A3V370_9RHOB/43-117----------------------------------------------------------------------
Q30PR2_SULDN/55-131----------------------------------------------------------------------
Q8RE56_FUSNN/54-127----------------------------------------------------------------------
A5FW91_ACICJ/79-154----------------------------------------------------------------------
C0AB63_9BACT/89-161----------------------------------------------------------------------
Q1MQ03_LAWIP/59-133----------------------------------------------------------------------
E0TGQ7_PARBH/62-144----------------------------------------------------------------------
A3UFX9_9RHOB/75-156----------------------------------------------------------------------
A0LIS3_SYNFM/40-112----------------------------------------------------------------------
Q2LXB8_SYNAS/104-179----------------------------------------------------------------------
A4U4M9_9PROT/68-141----------------------------------------------------------------------
A6C345_9PLAN/58-131----------------------------------------------------------------------
Q11L84_MESSB/67-148----------------------------------------------------------------------
Q1K139_DESAC/59-131----------------------------------------------------------------------
Q6MBL2_PARUW/66-143----------------------------------------------------------------------
Q3B2C3_PELLD/62-134----------------------------------------------------------------------
Q5LVH2_SILPO/63-137----------------------------------------------------------------------
Q0EXM5_9PROT/1-74----------------------------------------------------------------------
Q5FPH5_GLUOX/51-135----------------------------------------------------------------------
Q7MR26_WOLSU/48-124----------------------------------------------------------------------
Q7UNH8_RHOBA/40-115----------------------------------------------------------------------
A0RQN4_CAMFF/54-130----------------------------------------------------------------------
A7GZE2_CAMC5/59-137----------------------------------------------------------------------
Q0EZ13_9PROT/53-128----------------------------------------------------------------------
A1BDV7_CHLPD/54-126----------------------------------------------------------------------
B3EMB6_CHLPB/56-128----------------------------------------------------------------------
Q6AJI7_DESPS/60-135----------------------------------------------------------------------
Q983L9_RHILO/61-142----------------------------------------------------------------------
A3EVN0_9BACT/75-150----------------------------------------------------------------------
A8ZZ01_DESOH/61-133----------------------------------------------------------------------
B4SDV4_PELPB/54-126----------------------------------------------------------------------
Q2VZT0_MAGSA/63-136----------------------------------------------------------------------
A4Z0S3_BRASO/63-144----------------------------------------------------------------------
B9KF52_CAMLR/50-127----------------------------------------------------------------------
A3ZQR1_9PLAN/53-130----------------------------------------------------------------------
A1UU05_BARBK/79-160----------------------------------------------------------------------
Q7VGP5_HELHP/56-138----------------------------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window