Sequence alignment for CL0229

PF13901

B7Q8K7_IXOSC/495-696-------------------------------------------------------------------------HVCTYDG
Q9W3C9_DROME/619-824-------------------------------------------------------------------------RYCTYLG
H2WP71_CAEJA/258-466-------------------------------------------------------------------------RLCDYSG
B4JLA4_DROGR/709-910-------------------------------------------------------------------------RYCNYLG
A0BWI8_PARTE/329-520-------------------------------------------------------------------------.YCHYSG
M4EY72_BRARP/290-495-------------------------------------------------------------------------RLCEYTG
I3KPJ5_ORENI/861-1062-------------------------------------------------------------------------RLCEFSG
G7Y978_CLOSI/540-742-------------------------------------------------------------------------RFCEFFG
U1LYD3_ASCSU/245-449-------------------------------------------------------------------------RLCDYNG
B4I7Z9_DROSE/499-700-------------------------------------------------------------------------QVCAFSG
D6WGG5_TRICA/215-416-------------------------------------------------------------------------RKCDYSG
H3AQ72_LATCH/257-456-------------------------------------------------------------------------RYCEYLG
W5MPN4_LEPOC/703-904-------------------------------------------------------------------------RYCEYLG
D2H8H1_AILME/525-726-------------------------------------------------------------------------KVCNYSG
B7Q1L9_IXOSC/224-426-------------------------------------------------------------------------RRCEYTG
H2YN40_CIOSA/169-371-------------------------------------------------------------------------RLCDYNG
W5CJD8_WHEAT/308-510-------------------------------------------------------------------------RFCAYTG
D3BFT0_POLPA/795-997-------------------------------------------------------------------------RFCYYTG
J9KYL6_ACYPI/640-840-------------------------------------------------------------------------RYCFYLG
B0G190_DICDI/1180-1384-------------------------------------------------------------------------KICYYTG
T1JKT5_STRMM/256-458-------------------------------------------------------------------------RMCDYSG
T1FZW2_HELRO/83-284-------------------------------------------------------------------------RQCDYDG
T1L198_TETUR/170-375-------------------------------------------------------------------------RVCEFDG
Q7Q6B8_ANOGA/327-529-------------------------------------------------------------------------RLCDYTG
E9FRK4_DAPPU/108-308-------------------------------------------------------------------------.LCDYSG
B4N298_DROWI/585-790-------------------------------------------------------------------------RYCTYLG
U6HJ48_ECHMU/451-682-------------------------------------------------------------------------RFCEYFG
B4MMN6_DROWI/248-450-------------------------------------------------------------------------RLCDYNG
G6DK84_DANPL/508-709-------------------------------------------------------------------------KVCGFTG
A9T181_PHYPA/259-461-------------------------------------------------------------------------RWCEYSG
H2YFY0_CIOSA/55-253-------------------------------------------------------------------------RLCWYTG
B7PZV1_IXOSC/400-601-------------------------------------------------------------------------RYCSYLG
W5LPV2_ASTMX/534-735-------------------------------------------------------------------------RLCEFSG
G3X7G7_BOVIN/852-1058-------------------------------------------------------------------------KLCAFSG
H9K3M3_APIME/716-918-------------------------------------------------------------------------RYCEYLG
A9UU05_MONBE/125-326-------------------------------------------------------------------------HLCDYSG
H3EAL3_PRIPA/754-955-------------------------------------------------------------------------.VCALDG
H0YYN7_TAEGU/823-1024-------------------------------------------------------------------------KLCSFSG
E9CH38_CAPO3/757-957-------------------------------------------------------------------------RTCDYSG
H3AA51_LATCH/845-1046-------------------------------------------------------------------------KLCAFSG
K1S180_CRAGI/366-568-------------------------------------------------------------------------RLCDYSG
T1L3P9_TETUR/344-549-------------------------------------------------------------------------.YCYYTG
G3R769_GORGO/295-497-------------------------------------------------------------------------RQCDYTG
G3WFP8_SARHA/565-764-------------------------------------------------------------------------RYCDYLG
E9BYG8_CAPO3/1395-1595-------------------------------------------------------------------------RFCEYIG
I7MFD5_TETTS/395-585-------------------------------------------------------------------------.FCHYTG
W1P5W0_AMBTC/840-1041-------------------------------------------------------------------------RLCEYTG
A8P142_BRUMA/315-527-------------------------------------------------------------------------RYCDYYG
F4PVD1_DICFS/686-883-------------------------------------------------------------------------RYCEYSG
F1A452_DICPU/942-1142-------------------------------------------------------------------------RLCDYSG
W4XSF2_STRPU/412-614-------------------------------------------------------------------------RLCDYSG
G1KN51_ANOCA/851-1052-------------------------------------------------------------------------KLCSFTG
J9JZL2_ACYPI/216-416-------------------------------------------------------------------------RLCDYDG
H9JZI4_APIME/250-452-------------------------------------------------------------------------RLCDYTG
R4FMB7_RHOPR/242-441-------------------------------------------------------------------------RKCDYNG
F7E023_ORNAN/420-619-------------------------------------------------------------------------RYCDYLG
A8XHJ6_CAEBR/387-603-------------------------------------------------------------------------KFCDYYG
H0ZH73_TAEGU/715-915-------------------------------------------------------------------------RYCEYLG
F6ZK14_CIOIN/612-810-------------------------------------------------------------------------RLCYFTG
D7FQ81_ECTSI/1257-1460-------------------------------------------------------------------------..CRYAD
E5S714_TRISP/197-388-------------------------------------------------------------------------RLCHYSG
A8XYD1_CAEBR/276-477-------------------------------------------------------------------------.TCAIDS
J9JLP1_ACYPI/451-650-------------------------------------------------------------------------..CNFTA
T1HXH3_RHOPR/730-924-------------------------------------------------------------------------RYCEYLA
M0UBC7_MUSAM/273-478-------------------------------------------------------------------------RFCEYSG
I1GFB5_AMPQE/599-798-------------------------------------------------------------------------RFCYYIG
E1ZXM9_CAMFO/755-957-------------------------------------------------------------------------RYCEYLG
Q16MZ5_AEDAE/483-680-------------------------------------------------------------------------RYCHYLG
K4BKD6_SOLLC/671-875-------------------------------------------------------------------------RFCEYSG
G6DR39_DANPL/218-415-------------------------------------------------------------------------RLCDYTG
H2M7Y1_ORYLA/868-1069-------------------------------------------------------------------------RLCEFSG
F2UDN1_SALR5/921-1126-------------------------------------------------------------------------KLCDYTG
F1RAA9_DANRE/73-272-------------------------------------------------------------------------RYCDYLG
B3S7P2_TRIAD/84-285-------------------------------------------------------------------------.VCNFDG
Q29GS8_DROPS/642-843-------------------------------------------------------------------------RYCSYLG
B0W0J9_CULQU/596-795-------------------------------------------------------------------------RYCHYLG
E0VZS4_PEDHC/212-414-------------------------------------------------------------------------RLCDYTG
D2UZU6_NAEGR/962-1169-------------------------------------------------------------------------RYCNYTN
F1Q4W5_DANRE/692-894-------------------------------------------------------------------------RYCEYLG
U3K0L4_FICAL/293-492-------------------------------------------------------------------------RYCDYLG
J9EU11_WUCBA/2-201-------------------------------------------------------------------------..CGFDE
A7SVS4_NEMVE/36-235-------------------------------------------------------------------------KVCSYDG
F5HJM0_ANOGA/399-591-------------------------------------------------------------------------RYCHYTG
H2VVR0_CAEJA/379-592-------------------------------------------------------------------------RFCDYFG
A0BU97_PARTE/109-299-------------------------------------------------------------------------.LCFFHG
M4ATE6_XIPMA/868-1069-------------------------------------------------------------------------RLCEFSG
E5SLH5_TRISP/488-680-------------------------------------------------------------------------KVCNFDG
W4XDG9_STRPU/79-271-------------------------------------------------------------------------RYCEYLG
D8QPZ9_SELML/294-498-------------------------------------------------------------------------RFCEYTG
W5JEW3_ANODA/349-551-------------------------------------------------------------------------RLCDYTG
F1NS53_CHICK/781-982-------------------------------------------------------------------------KLCAYSG
E1G3Q0_LOALO/235-437-------------------------------------------------------------------------RLCDYNG
W5MWV1_LEPOC/272-471-------------------------------------------------------------------------RYCEYLG
Q54BL5_DICDI/1135-1340-------------------------------------------------------------------------RFCDYSG
G3NH32_GASAC/866-1069-------------------------------------------------------------------------RLCEFSG
E0VRE2_PEDHC/406-607-------------------------------------------------------------------------RLCYFTG
T1IN68_STRMM/846-1047-------------------------------------------------------------------------RYCEYLG
U6HKA0_ECHMU/286-475-------------------------------------------------------------------------.VCHFTK
F2UD64_SALR5/665-865-------------------------------------------------------------------------RWCEYTG
U6IB77_HYMMI/442-665-------------------------------------------------------------------------RFCEYFG
B0WIJ1_CULQU/290-494-------------------------------------------------------------------------RLCDYSG
M3ZYS3_XIPMA/514-713-------------------------------------------------------------------------RHCEYLG
H3AW67_LATCH/702-903-------------------------------------------------------------------------RYCEYLG
X6NIC7_RETFI/99-294-------------------------------------------------------------------------HYCRYTG
C3XVM6_BRAFL/226-428-------------------------------------------------------------------------RQCDYTG
E9H211_DAPPU/35-239-------------------------------------------------------------------------RVCNFSG
M3W8L8_FELCA/301-503-------------------------------------------------------------------------KLCAFSG
H2S0U6_TAKRU/778-981-------------------------------------------------------------------------RLCHFSG
I3KKB8_ORENI/353-554-------------------------------------------------------------------------KVCYYSG
B9I3B8_POPTR/793-999-------------------------------------------------------------------------RLCEYTG
H2LST4_ORYLA/718-919-------------------------------------------------------------------------RYCEYLG
T1L0C9_TETUR/212-411-------------------------------------------------------------------------.LCDYDG
U1MIB3_ASCSU/827-1027-------------------------------------------------------------------------.VCALDA
H3FHB7_PRIPA/340-564-------------------------------------------------------------------------RFCDYYG
K7J291_NASVI/486-684-------------------------------------------------------------------------.VCCFSG
F6S0C5_XENTR/726-926-------------------------------------------------------------------------RYCEYLG
F6ZX35_XENTR/773-974-------------------------------------------------------------------------KHCAYSA
F4PGY6_DICFS/902-1102-------------------------------------------------------------------------..CFNKC
W5N6E1_LEPOC/842-1043-------------------------------------------------------------------------RLCEYSG
A3KNA4_DANRE/635-836-------------------------------------------------------------------------RLCEFSG
E0VEL0_PEDHC/612-811-------------------------------------------------------------------------RYCEYLG
E9CAV8_CAPO3/1008-1238-------------------------------------------------------------------------.HCGYCG
F4WPF9_ACREC/488-687-------------------------------------------------------------------------HVCAYSG
W5QGD3_SHEEP/744-931-------------------------------------------------------------------------.......
K7IQS8_NASVI/225-427-------------------------------------------------------------------------RLCDYTG
B7ZBN5_HUMAN/293-492-------------------------------------------------------------------------RYCEYLG

PF02591

D7CW01_TRURR/196-228--------------------------------------------------------------------------------
E8RBW9_DESPD/198-230--------------------------------------------------------------------------------
D5USN8_TSUPD/203-237--------------------------------------------------------------------------------
H8KX59_SOLCM/203-235--------------------------------------------------------------------------------
H2K064_STRHJ/154-188--------------------------------------------------------------------------------
A6GYY0_FLAPJ/207-239--------------------------------------------------------------------------------
A0R095_MYCS2/203-237--------------------------------------------------------------------------------
F4GK73_SPICD/198-230--------------------------------------------------------------------------------
D9QBM9_CORP2/199-233--------------------------------------------------------------------------------
D3SLT3_THEAH/194-225--------------------------------------------------------------------------------
C7M0A3_ACIFD/194-225--------------------------------------------------------------------------------
E1WZY1_BACMS/198-230--------------------------------------------------------------------------------
A1AU73_PELPD/198-230--------------------------------------------------------------------------------
H6L2M2_SAPGL/209-241--------------------------------------------------------------------------------
B2V9X7_SULSY/199-231--------------------------------------------------------------------------------
D6Z574_DESAT/198-230--------------------------------------------------------------------------------
F0SP42_PLABD/198-229--------------------------------------------------------------------------------
C7LXG6_DESBD/201-233--------------------------------------------------------------------------------
B5HBP1_STRPR/205-239--------------------------------------------------------------------------------
A4J7B5_DESRM/199-231--------------------------------------------------------------------------------
E3IZA7_FRASU/205-239--------------------------------------------------------------------------------
F2NIX1_DESAR/198-230--------------------------------------------------------------------------------
D7WEF2_9CORY/185-219--------------------------------------------------------------------------------
Q1MR74_LAWIP/201-233--------------------------------------------------------------------------------
C6VSB1_DYAFD/203-235--------------------------------------------------------------------------------
Q310X1_DESAG/201-233--------------------------------------------------------------------------------
B3QVG4_CHLT3/224-255--------------------------------------------------------------------------------
O67273_AQUAE/199-231--------------------------------------------------------------------------------
E4NAI7_KITSK/204-238--------------------------------------------------------------------------------
Q2LRB2_SYNAS/198-230--------------------------------------------------------------------------------
A7ZDY4_CAMC1/198-230--------------------------------------------------------------------------------
D1BFS0_SANKS/205-239--------------------------------------------------------------------------------
D3PKG4_MEIRD/209-241--------------------------------------------------------------------------------
F8E5M6_FLESM/198-230--------------------------------------------------------------------------------
E1R070_OLSUV/200-232--------------------------------------------------------------------------------
Q8FNL0_COREF/200-234--------------------------------------------------------------------------------
E4TJQ2_CALNY/198-230--------------------------------------------------------------------------------
C8W3J9_DESAS/199-229--------------------------------------------------------------------------------
F7UUL4_EEGSY/204-236--------------------------------------------------------------------------------
G8QW58_SPHPG/201-233--------------------------------------------------------------------------------
Q1IH82_KORVE/197-229--------------------------------------------------------------------------------
F2IHQ3_FLUTR/210-242--------------------------------------------------------------------------------
Q39YN1_GEOMG/198-230--------------------------------------------------------------------------------
Q3A145_PELCD/203-235--------------------------------------------------------------------------------
D6ZCR4_SEGRD/202-236--------------------------------------------------------------------------------
F0JJ48_DESDE/199-231--------------------------------------------------------------------------------
C7R4X6_JONDD/205-239--------------------------------------------------------------------------------
B8E091_DICTD/203-234--------------------------------------------------------------------------------
D0LJD1_HALO1/197-229--------------------------------------------------------------------------------
B8FBL1_DESAA/198-230--------------------------------------------------------------------------------
D2QM72_SPILD/203-235--------------------------------------------------------------------------------
A1TB60_MYCVP/203-237--------------------------------------------------------------------------------
I0AGC4_IGNAJ/198-230--------------------------------------------------------------------------------
H5XB79_9PSEU/203-237--------------------------------------------------------------------------------
Q82B29_STRAW/154-188--------------------------------------------------------------------------------
F4CPL6_PSEUX/204-238--------------------------------------------------------------------------------
D9SW71_CLOC7/134-166--------------------------------------------------------------------------------
F8KR50_HELBC/198-230--------------------------------------------------------------------------------
F2NRR6_TRES6/199-231--------------------------------------------------------------------------------
H6RR27_BLASD/204-238--------------------------------------------------------------------------------
I0IQZ1_LEPFC/205-237--------------------------------------------------------------------------------
E8WWT9_ACISM/197-231--------------------------------------------------------------------------------
B2HHN3_MYCMM/203-237--------------------------------------------------------------------------------
D3Q8L5_STANL/203-237--------------------------------------------------------------------------------
F4L5M1_HALH1/205-237--------------------------------------------------------------------------------
E2SAW4_9ACTO/217-251--------------------------------------------------------------------------------
F8A8B3_THEID/198-230--------------------------------------------------------------------------------
C7QEZ0_CATAD/213-247--------------------------------------------------------------------------------
C0QXL6_BRAHW/236-268--------------------------------------------------------------------------------
E6X1V8_NITSE/198-230--------------------------------------------------------------------------------
C4LHY9_CORK4/204-238--------------------------------------------------------------------------------
D1ABL3_THECD/205-239--------------------------------------------------------------------------------
A5N6R6_CLOK5/198-230--------------------------------------------------------------------------------
Q6AFH8_LEIXX/202-236--------------------------------------------------------------------------------
E3M712_CAERE/151-185--------------------------------------------------------------------------------
Q892T4_CLOTE/202-233--------------------------------------------------------------------------------
E4TZZ4_SULKY/198-230--------------------------------------------------------------------------------
F8C3W2_THEGP/198-230--------------------------------------------------------------------------------
D4H0K2_DENA2/198-230--------------------------------------------------------------------------------
D1BU89_XYLCX/205-239--------------------------------------------------------------------------------
A0LTB4_ACIC1/195-229--------------------------------------------------------------------------------
A1R7D0_ARTAT/204-238--------------------------------------------------------------------------------
C0QQ58_PERMH/198-230--------------------------------------------------------------------------------
F5XSN4_MICPN/218-252--------------------------------------------------------------------------------
B4U7G6_HYDS0/196-229--------------------------------------------------------------------------------
A9GWK4_SORC5/199-231--------------------------------------------------------------------------------
I0I5N9_CALAS/197-230--------------------------------------------------------------------------------
E6SCX3_INTC7/204-238--------------------------------------------------------------------------------
D9QVH7_ACEAZ/200-232--------------------------------------------------------------------------------
B0VEU1_CLOAI/198-230--------------------------------------------------------------------------------
E3PSL8_CLOSD/197-229--------------------------------------------------------------------------------
D5SMG3_PLAL2/198-229--------------------------------------------------------------------------------
B5YKU4_THEYD/198-230--------------------------------------------------------------------------------
F2N9J7_CORGP/199-231--------------------------------------------------------------------------------
A5D3S3_PELTS/200-232--------------------------------------------------------------------------------
B1ZR74_OPITP/55-87--------------------------------------------------------------------------------
D2PXM0_KRIFD/210-244--------------------------------------------------------------------------------
F4KM12_PORAD/213-245--------------------------------------------------------------------------------
Q4JWH7_CORJK/209-246--------------------------------------------------------------------------------
A4FA30_SACEN/202-236--------------------------------------------------------------------------------
D5V694_ARCNC/198-230--------------------------------------------------------------------------------
G8S6I4_ACTS5/202-236--------------------------------------------------------------------------------
F4H288_CELFA/205-239--------------------------------------------------------------------------------
C1A4A7_GEMAT/199-231--------------------------------------------------------------------------------
C8WAM4_ATOPD/199-231--------------------------------------------------------------------------------
F4LT01_TEPAE/203-235--------------------------------------------------------------------------------
F6FX24_ISOV2/205-239--------------------------------------------------------------------------------
D6E737_9ACTN/204-236--------------------------------------------------------------------------------
B2A1Z6_NATTJ/202-233--------------------------------------------------------------------------------
I0GKK5_CALEA/198-232--------------------------------------------------------------------------------
E8T3Z5_THEA1/196-230--------------------------------------------------------------------------------
F0RPE1_DEIPM/221-254--------------------------------------------------------------------------------
D7B0S9_NOCDD/205-239--------------------------------------------------------------------------------
I0IBX2_PHYMF/204-237--------------------------------------------------------------------------------
B9M160_GEODF/198-230--------------------------------------------------------------------------------
A6WDB0_KINRD/205-239--------------------------------------------------------------------------------
E1QGT3_DESB2/198-230--------------------------------------------------------------------------------
F0S1X1_DESTD/196-230--------------------------------------------------------------------------------
D2B5L8_STRRD/204-238--------------------------------------------------------------------------------
C7N548_SLAHD/204-236--------------------------------------------------------------------------------
G0HE53_CORVD/203-237--------------------------------------------------------------------------------
D7GEZ5_PROFC/205-239--------------------------------------------------------------------------------
E8R2V5_ISOPI/212-244--------------------------------------------------------------------------------
C8WYS1_DESRD/201-233--------------------------------------------------------------------------------
H1XNL8_9BACT/198-230--------------------------------------------------------------------------------
H6RB51_NOCCG/203-237--------------------------------------------------------------------------------
F5YHY4_TREPZ/200-232--------------------------------------------------------------------------------
E8N603_ANATU/201-233--------------------------------------------------------------------------------
B1H0J8_UNCTG/201-233--------------------------------------------------------------------------------
B1ZTK1_OPITP/198-236--------------------------------------------------------------------------------
Q47NI2_THEFY/205-239--------------------------------------------------------------------------------
D5EJ60_CORAD/200-232--------------------------------------------------------------------------------
Q02AV0_SOLUE/198-230--------------------------------------------------------------------------------
D6Y3S0_THEBD/204-238--------------------------------------------------------------------------------
Q9RXL9_DEIRA/202-235--------------------------------------------------------------------------------
F8DZM6_CORRG/160-194--------------------------------------------------------------------------------
C7MNB6_CRYCD/204-236--------------------------------------------------------------------------------
Q3AEW5_CARHZ/190-223--------------------------------------------------------------------------------
F6DN00_DESRL/200-232--------------------------------------------------------------------------------
E8NEW2_MICTS/211-245--------------------------------------------------------------------------------
D2R6Q9_PIRSD/198-229--------------------------------------------------------------------------------
A1SI89_NOCSJ/192-226--------------------------------------------------------------------------------
F3ZEA3_9ACTO/247-281--------------------------------------------------------------------------------
D5MKY7_9BACT/198-230--------------------------------------------------------------------------------
D5XA06_THEPJ/201-235--------------------------------------------------------------------------------
C1CYG9_DEIDV/201-234--------------------------------------------------------------------------------
Q6AQL1_DESPS/198-230--------------------------------------------------------------------------------
F6EEJ8_AMYSD/203-237--------------------------------------------------------------------------------
A9WV12_RENSM/203-237--------------------------------------------------------------------------------
B2GJM7_KOCRD/206-240--------------------------------------------------------------------------------
D8PBZ4_9BACT/198-230--------------------------------------------------------------------------------
B2UPD4_AKKM8/206-238--------------------------------------------------------------------------------
C8XD03_NAKMY/205-239--------------------------------------------------------------------------------
D8K3D7_DEHLB/196-227--------------------------------------------------------------------------------
A8ZUC1_DESOH/203-235--------------------------------------------------------------------------------
B3E3Z4_GEOLS/198-230--------------------------------------------------------------------------------
A0LHK0_SYNFM/198-230--------------------------------------------------------------------------------
C9ZFS7_STRSW/154-188--------------------------------------------------------------------------------
B3ERJ2_AMOA5/203-235--------------------------------------------------------------------------------
H9UJ68_SPIAZ/199-231--------------------------------------------------------------------------------
C6WMA7_ACTMD/203-237--------------------------------------------------------------------------------
D3DIT4_HYDTT/201-232--------------------------------------------------------------------------------
D3UJC4_HELM1/198-230--------------------------------------------------------------------------------
G8NXJ9_GRAMM/202-237--------------------------------------------------------------------------------
F2LX23_HIPMA/198-230--------------------------------------------------------------------------------
E4U6K4_OCEP5/208-240--------------------------------------------------------------------------------
C0QJZ7_DESAH/202-234--------------------------------------------------------------------------------
F3ZXL4_MAHA5/200-232--------------------------------------------------------------------------------
A4XA49_SALTO/203-237--------------------------------------------------------------------------------
A5I614_CLOBH/200-232--------------------------------------------------------------------------------
A8EW76_ARCB4/198-230--------------------------------------------------------------------------------
B0RBZ5_CLAMS/216-247--------------------------------------------------------------------------------
B1MNT6_MYCA9/203-237--------------------------------------------------------------------------------
B1VZB7_STRGG/205-239--------------------------------------------------------------------------------
B5EBN9_GEOBB/199-230--------------------------------------------------------------------------------
B9L658_NAUPA/198-230--------------------------------------------------------------------------------
C3PHN4_CORA7/199-233--------------------------------------------------------------------------------
C5ZXZ9_9HELI/198-230--------------------------------------------------------------------------------
E3FII3_STIAD/206-238--------------------------------------------------------------------------------
E9T6R3_COREQ/203-237--------------------------------------------------------------------------------
F9D1I3_PREDD/209-241--------------------------------------------------------------------------------
G0GDN6_SPITZ/200-232--------------------------------------------------------------------------------
G2LF52_CHLTF/198-230--------------------------------------------------------------------------------
H6MTK0_GORPV/203-237--------------------------------------------------------------------------------
I0FDE6_BORCA/197-230--------------------------------------------------------------------------------
I7GYL8_9HELI/198-230--------------------------------------------------------------------------------
J9ZCR4_LEPFM/169-201--------------------------------------------------------------------------------
M4ZSY7_9FLAO/214-243--------------------------------------------------------------------------------
O25612_HELPY/198-230--------------------------------------------------------------------------------
O83507_TREPA/200-232--------------------------------------------------------------------------------
Q2INW5_ANADE/216-248--------------------------------------------------------------------------------
Q3Z9J3_DEHM1/198-228--------------------------------------------------------------------------------
Q6AA08_PROAC/204-238--------------------------------------------------------------------------------
Q73N09_TREDE/199-231--------------------------------------------------------------------------------
Q7UQ03_RHOBA/205-236--------------------------------------------------------------------------------
Q83GK9_TROWT/198-232--------------------------------------------------------------------------------
Q8NNG7_CORGL/200-234--------------------------------------------------------------------------------
Q97JH9_CLOAB/202-233--------------------------------------------------------------------------------
Y1638_MYCLE/190-223--------------------------------------------------------------------------------
R5ZHZ8_9ACTN/201-232--------------------------------------------------------------------------------
R7JLD2_9BACT/212-244--------------------------------------------------------------------------------
U5RWI1_9CLOT/198-230--------------------------------------------------------------------------------
V9XG76_9NOCA/203-237--------------------------------------------------------------------------------
W0EZD5_9SPHI/207-239--------------------------------------------------------------------------------
W5XSH9_9CORY/203-237--------------------------------------------------------------------------------

PF13920

B6K124_SCHJY/78-128---------------------DGEF-------------------------------------------------------
YJ01_SCHPO/77-127---------------------DEQI-------------------------------------------------------
Q0CN45_ASPTN/467-517---------------------DGEI-------------------------------------------------------
A8Q0G3_MALGO/102-152---------------------ERDI-------------------------------------------------------
Q4P332_USTMA/106-156---------------------EAEL-------------------------------------------------------
C5DTT6_ZYGRC/62-112---------------------EKEF-------------------------------------------------------
A5E539_LODEL/84-134---------------------EGQQ-------------------------------------------------------
A3LV07_PICST/58-108---------------------ESNQ-------------------------------------------------------
Q6BL77_DEBHA/44-94---------------------EDEQ-------------------------------------------------------
C4QYV6_PICPG/48-98---------------------KRTT-------------------------------------------------------
Q6CMY9_KLULA/85-135---------------------SSNV-------------------------------------------------------
D0N6K8_PHYIT/120-171---------------------EPEY-------------------------------------------------------
C5LYS2_PERM5/156-207---------------------IDEE-------------------------------------------------------
B4LJJ4_DROVI/48-98---------------------DDNA-------------------------------------------------------
Q7QJY2_ANOGA/21-71---------------------TETL-------------------------------------------------------
Q54UX1_DICDI/728-773---------------------NGKT-------------------------------------------------------
A7S739_NEMVE/703-752---------------------ELFA-------------------------------------------------------
Q22W29_TETTS/178-228---------------------KDQT-------------------------------------------------------
Q4QHY1_LEIMA/418-463---------------------KQEN-------------------------------------------------------
D2VIL5_NAEGR/915-962---------------------ENNH-------------------------------------------------------
Q1RL83_CIOIN/726-771---------------------DSNS-------------------------------------------------------
RNF26_HUMAN/376-428---------------------ERKK-------------------------------------------------------
D2HCL2_AILME/270-315---------------------NSKD-------------------------------------------------------
C3XYZ2_BRAFL/80-125---------------------ARKD-------------------------------------------------------
B7PQN0_IXOSC/155-200---------------------PEPL-------------------------------------------------------
C3Y345_BRAFL/524-577---------------------EKRL-------------------------------------------------------
B8C513_THAPS/1796-1843---------------------DEHL-------------------------------------------------------
A7RWB7_NEMVE/452-503---------------------DKTL-------------------------------------------------------
B0WTA2_CULQU/338-387---------------------SIGL-------------------------------------------------------
Q5KMN2_CRYNJ/400-449---------------------ERGL-------------------------------------------------------
D0MRP4_PHYIT/742-789---------------------ELKL-------------------------------------------------------
B5DIZ4_DROPS/288-334---------------------DDQL-------------------------------------------------------
B0WPA5_CULQU/285-331---------------------DEQR-------------------------------------------------------
Q4D380_TRYCC/244-288---------------------EHER-------------------------------------------------------
Q75HV4_ORYSJ/33-82---------------------MGKE-------------------------------------------------------
MGRN1_HUMAN/274-323---------------------NSNE-------------------------------------------------------
B4JL40_DROGR/312-361---------------------HGSE-------------------------------------------------------
D3B0G5_POLPA/399-448---------------------DNRE-------------------------------------------------------
Q55DC5_DICDI/356-405---------------------ISDE-------------------------------------------------------
Q8I660_PLAF7/235-284---------------------SDRE-------------------------------------------------------
Q4D0Q6_TRYCC/310-360---------------------EIDL-------------------------------------------------------
Q4QHA0_LEIMA/308-357---------------------EEGL-------------------------------------------------------
Q57UZ4_TRYB2/281-331---------------------DDKL-------------------------------------------------------
D0MQ76_PHYIT/288-337---------------------EGAE-------------------------------------------------------
Q00TM5_OSTTA/321-373---------------------DDDL-------------------------------------------------------
Q4E000_TRYCC/296-345---------------------EDGL-------------------------------------------------------
Q5CL02_CRYHO/210-259---------------------DSEK-------------------------------------------------------
B6AAH4_CRYMR/246-295---------------------QDDL-------------------------------------------------------
A4H9Q8_LEIBR/102-149---------------------DAEQ-------------------------------------------------------
Q4CVI6_TRYCC/107-152---------------------EGEE-------------------------------------------------------
B7PKQ1_IXOSC/144-193---------------------RDKD-------------------------------------------------------
B3S6I8_TRIAD/181-230---------------------KEKE-------------------------------------------------------
A7S4Z9_NEMVE/255-304---------------------KESE-------------------------------------------------------
Q5CJY8_CRYHO/629-676---------------------DELD-------------------------------------------------------
C5KK04_PERM5/366-413---------------------DDKT-------------------------------------------------------
B7QP11_IXOSC/231-276---------------------VQNP-------------------------------------------------------
D2VUY6_NAEGR/325-374---------------------VELL-------------------------------------------------------
A0BTS1_PARTE/375-420---------------------GENL-------------------------------------------------------
A0DZP3_PARTE/363-408---------------------ENNF-------------------------------------------------------
A0DSA8_PARTE/389-434---------------------HENS-------------------------------------------------------
B4MWC3_DROWI/221-271---------------------NRPG-------------------------------------------------------
B3MJU2_DROAN/218-268---------------------NRGG-------------------------------------------------------
B4KIZ8_DROMO/234-285---------------------HRSN-------------------------------------------------------
B4LV95_DROVI/234-285---------------------SRTH-------------------------------------------------------
B4JAJ2_DROGR/234-285---------------------NRII-------------------------------------------------------
B4G746_DROPE/150-202---------------------SSGS-------------------------------------------------------
A8B237_GIAIC/880-926---------------------YEDF-------------------------------------------------------
Q4CMQ0_TRYCC/661-713---------------------TANV-------------------------------------------------------
A9SHG7_PHYPA/405-450---------------------EKVL-------------------------------------------------------
Q8LBF1_ARATH/416-461---------------------EKVL-------------------------------------------------------
Q0J1V3_ORYSJ/63-108---------------------EQIL-------------------------------------------------------
C5XC80_SORBI/53-98---------------------ERIL-------------------------------------------------------
Q4N6R0_THEPA/101-150---------------------RIKN-------------------------------------------------------
C5L3T8_PERM5/394-443---------------------ESGM-------------------------------------------------------
C5LA51_PERM5/115-168---------------------EIPC-------------------------------------------------------
C5LTS1_PERM5/447-500---------------------TIAP-------------------------------------------------------
C5LZC2_PERM5/112-165---------------------ALLP-------------------------------------------------------
B2YG41_MHVB/210-258---------------------VNRL-------------------------------------------------------
A9SEP3_PHYPA/195-240---------------------EQRT-------------------------------------------------------
B9HU58_POPTR/288-333---------------------EHVT-------------------------------------------------------
B9RB10_RICCO/250-295---------------------RQMV-------------------------------------------------------
B9I3B5_POPTR/306-351---------------------KQMT-------------------------------------------------------
B3H4E5_ARATH/232-277---------------------QRMR-------------------------------------------------------
Q4TU35_ARATH/289-334---------------------TGMR-------------------------------------------------------
C5XTA8_SORBI/271-318---------------------RKRA-------------------------------------------------------
C5XTB1_SORBI/370-415---------------------TRAA-------------------------------------------------------
C5YFF0_SORBI/286-331---------------------SSCS-------------------------------------------------------
C5YFF1_SORBI/318-363---------------------KSLA-------------------------------------------------------
Q7FAF5_ORYSJ/265-310---------------------TATS-------------------------------------------------------
C5Y3U3_SORBI/280-325---------------------GKWA-------------------------------------------------------
C5XTT6_SORBI/292-337---------------------GLGA-------------------------------------------------------
C5WQ61_SORBI/286-331---------------------DLTA-------------------------------------------------------
Q9FEA0_ARATH/275-320---------------------TMMM-------------------------------------------------------
B9I0I4_POPTR/289-334---------------------SSWL-------------------------------------------------------
A5C0L0_VITVI/251-297---------------------EKRK-------------------------------------------------------
C5X3K2_SORBI/182-227---------------------PNLI-------------------------------------------------------
B9H509_POPTR/217-262---------------------KRMV-------------------------------------------------------
A9P9H0_POPTR/220-265---------------------MVMV-------------------------------------------------------
B9R8C8_RICCO/222-267---------------------KRMV-------------------------------------------------------
B9N2T7_POPTR/294-339---------------------GGPS-------------------------------------------------------
Q9FJQ8_ARATH/249-294---------------------IGPG-------------------------------------------------------
A8MRQ8_ARATH/191-237---------------------IGPS-------------------------------------------------------
A8MQI2_ARATH/158-204---------------------MSSC-------------------------------------------------------
A4HK37_LEIBR/127-171---------------------LNGR-------------------------------------------------------
A2EXP7_TRIVA/612-657---------------------PKPM-------------------------------------------------------
A0CAX1_PARTE/245-290---------------------QTLK-------------------------------------------------------
A0DHU7_PARTE/55-100---------------------DSLQ-------------------------------------------------------
A0BNR4_PARTE/562-612---------------------DKIK-------------------------------------------------------
A0E6W4_PARTE/182-227---------------------RQLK-------------------------------------------------------
C3ZJG2_BRAFL/282-331---------------------DRLL-------------------------------------------------------
C3YU07_BRAFL/338-391---------------------EWRL-------------------------------------------------------
A2DIY9_TRIVA/524-575---------------------IVKR-------------------------------------------------------
UNK_DROME/552-597---------------------NAKK-------------------------------------------------------
A7RKQ0_NEMVE/615-660---------------------QAYS-------------------------------------------------------
A8BNV2_GIAIC/200-247---------------------KYTK-------------------------------------------------------
Q4E0L2_TRYCC/240-288---------------------ERSK-------------------------------------------------------
Q4QGT3_LEIMA/221-269---------------------ERSK-------------------------------------------------------
B6Q7N1_PENMQ/895-945---------------------DGPQ-------------------------------------------------------
Q2H0W0_CHAGB/930-980---------------------DGPQ-------------------------------------------------------
C5MAE9_CANTT/731-781---------------------RSLD-------------------------------------------------------
A5D9Z2_PICGU/645-695---------------------IPYP-------------------------------------------------------
A7TKT9_VANPO/628-678---------------------FESL-------------------------------------------------------
C5DQ71_ZYGRC/577-627---------------------STFA-------------------------------------------------------
C5DI16_LACTC/585-635---------------------RDMT-------------------------------------------------------
C4R866_PICPG/593-643---------------------SLGN-------------------------------------------------------
Q6C5F9_YARLI/626-676---------------------ERRY-------------------------------------------------------
Q5KKN3_CRYNJ/726-779---------------------TKRT-------------------------------------------------------
B0DG87_LACBS/800-853---------------------LRHV-------------------------------------------------------
A7AMT1_BABBO/791-836---------------------AKLN-------------------------------------------------------
B5U8M8_CAEEL/44-94---------------------ARLQ-------------------------------------------------------
A8X2U5_CAEBR/166-216---------------------TRLQ-------------------------------------------------------
A8B9Y3_GIAIC/545-592---------------------CSPE-------------------------------------------------------
D2VDZ5_NAEGR/336-381---------------------EVEE-------------------------------------------------------
A0BLM2_PARTE/279-326---------------------DNYE-------------------------------------------------------
A0BRE5_PARTE/279-326---------------------NNYE-------------------------------------------------------
A0C478_PARTE/250-299---------------------EKEP-------------------------------------------------------
A0C829_PARTE/291-336---------------------KYRE-------------------------------------------------------
A0CDQ4_PARTE/258-305---------------------DQDI-------------------------------------------------------
IAP1_OSHVF/311-356---------------------NDEE-------------------------------------------------------
A8BPS6_GIAIC/687-738---------------------IEDT-------------------------------------------------------
RNGB_DICDI/893-938---------------------DQNS-------------------------------------------------------
Q17FP0_AEDAE/482-527---------------------REDS-------------------------------------------------------
Q1RPV0_CIOIN/514-559---------------------RADQ-------------------------------------------------------
B3WFX6_CAEEL/508-553---------------------PEDY-------------------------------------------------------
A7SP45_NEMVE/135-180---------------------SGEP-------------------------------------------------------
C3ZBL5_BRAFL/431-476---------------------KENC-------------------------------------------------------
D3B001_POLPA/201-250---------------------KERY-------------------------------------------------------
Q94491_DICDI/216-265---------------------REKF-------------------------------------------------------
Q380J4_ANOGA/501-546---------------------EAIT-------------------------------------------------------
Q17NT7_AEDAE/450-495---------------------EALT-------------------------------------------------------
MYLIB_DANRE/377-422---------------------EALT-------------------------------------------------------
A7RXW6_NEMVE/6-51---------------------NDLT-------------------------------------------------------
A7S3Y5_NEMVE/373-418---------------------DGLR-------------------------------------------------------
C3XU73_BRAFL/384-429---------------------EALL-------------------------------------------------------
B4J320_DROGR/398-443---------------------EEKL-------------------------------------------------------
A9V149_MONBE/508-556---------------------EANL-------------------------------------------------------
B4J9C7_DROGR/363-408---------------------EAMQ-------------------------------------------------------
A8HMX4_CHLRE/2800-2846---------------------SAWQ-------------------------------------------------------
A9SH61_PHYPA/4592-4636---------------------AAWT-------------------------------------------------------
C3ZK23_BRAFL/256-309---------------------KRER-------------------------------------------------------
A9UQI9_MONBE/498-545---------------------EEQA-------------------------------------------------------
CWC24_YARLI/202-250---------------------IPDT-------------------------------------------------------
B7XK28_ENTBH/436-487---------------------EYVY-------------------------------------------------------
A0D2U8_PARTE/380-428---------------------LRYL-------------------------------------------------------
A8BQV1_GIAIC/497-546---------------------SKNI-------------------------------------------------------
B5DJC0_DROPS/53-105---------------------SYPY-------------------------------------------------------
B7QLC6_IXOSC/166-211---------------------NIPT-------------------------------------------------------
C3Y1X2_BRAFL/433-483---------------------NKKD-------------------------------------------------------
D3YTR3_MOUSE/556-606---------------------LARE-------------------------------------------------------
Q29CJ9_DROPS/593-643---------------------IQRE-------------------------------------------------------
A0CCL0_PARTE/398-443---------------------HINK-------------------------------------------------------
A0CBN4_PARTE/432-477---------------------HIAK-------------------------------------------------------
XB34_ORYSJ/458-507---------------------PPGT-------------------------------------------------------
B9NBW1_POPTR/389-438---------------------GSSS-------------------------------------------------------
B9T1B4_RICCO/183-232---------------------GSSS-------------------------------------------------------
A9SAM3_PHYPA/418-467---------------------KSGQ-------------------------------------------------------
A9TAZ5_PHYPA/309-358---------------------KENR-------------------------------------------------------
XB34_ARATH/321-370---------------------EDGL-------------------------------------------------------
C1DZP8_MICSR/274-329---------------------GDEE-------------------------------------------------------
A2ENP8_TRIVA/471-523---------------------HKQM-------------------------------------------------------
Q9M2V1_ARATH/104-149---------------------GPFS-------------------------------------------------------
A4ID13_LEIIN/261-307---------------------LSHV-------------------------------------------------------
A4HPQ0_LEIBR/260-306---------------------HSNV-------------------------------------------------------
Q4D0Z8_TRYCC/234-280---------------------TPNF-------------------------------------------------------
A8J0L3_CHLRE/225-274---------------------DEHC-------------------------------------------------------
VF193_IIV3/153-201---------------------SKIM-------------------------------------------------------
D0NQR6_PHYIT/1091-1144---------------------EKTE-------------------------------------------------------
A0D1G8_PARTE/217-265---------------------QDTC-------------------------------------------------------
A2G3U3_TRIVA/649-698---------------------RESF-------------------------------------------------------
A2DM68_TRIVA/649-698---------------------REMI-------------------------------------------------------
A2FIP7_TRIVA/650-699---------------------KETP-------------------------------------------------------
A2DDV4_TRIVA/648-697---------------------KDTF-------------------------------------------------------
A4H3A8_LEIBR/832-887---------------------SAGC-------------------------------------------------------
C5KGH9_PERM5/282-328---------------------SSKM-------------------------------------------------------
A9V6F0_MONBE/813-860---------------------SEAL-------------------------------------------------------
A2EXP7_TRIVA/662-710---------------------DSGQ-------------------------------------------------------
C1N685_MICPC/735-790---------------------NELT-------------------------------------------------------
C1EI00_MICSR/584-639---------------------DELL-------------------------------------------------------
A4RRY6_OSTLU/291-343---------------------QEVL-------------------------------------------------------
Q011K3_OSTTA/431-485---------------------QEVL-------------------------------------------------------
Q0E527_SFAVA/200-245---------------------SEAK-------------------------------------------------------
A6QSL9_AJECN/126-171---------------------HQCQ-------------------------------------------------------
B6QDX9_PENMQ/218-270---------------------TYLL-------------------------------------------------------
B8M471_TALSN/214-267---------------------NILK-------------------------------------------------------
B8MPN3_TALSN/190-245---------------------NILK-------------------------------------------------------
A2FRF3_TRIVA/182-233---------------------SSHV-------------------------------------------------------
C5LB69_PERM5/20-68---------------------TDTV-------------------------------------------------------
Q4YUC0_PLABA/117-170---------------------NNVI-------------------------------------------------------
Q54X17_DICDI/400-449---------------------ENLI-------------------------------------------------------
Q9SAF3_ARATH/158-206---------------------REEE-------------------------------------------------------
A8XJR9_CAEBR/19-68---------------------DDVK-------------------------------------------------------
C4LX45_ENTHI/71-121---------------------NKRT-------------------------------------------------------
D2VUH3_NAEGR/128-177---------------------QLVK-------------------------------------------------------
A9TTF3_PHYPA/975-1020---------------------QPGI-------------------------------------------------------
D0NXH2_PHYIT/501-550---------------------QPDL-------------------------------------------------------
A0CRM9_PARTE/211-262---------------------EDKE-------------------------------------------------------
D0NG82_PHYIT/249-298---------------------EELQ-------------------------------------------------------
Q4H356_CIOIN/487-538---------------------KDSE-------------------------------------------------------
B7QCM6_IXOSC/35-84---------------------EDHL-------------------------------------------------------
B7PU01_IXOSC/401-451---------------------ADVD-------------------------------------------------------
C3YRC2_BRAFL/452-502---------------------GRSD-------------------------------------------------------
C3Y6P7_BRAFL/523-572---------------------REGH-------------------------------------------------------
C3Y611_BRAFL/502-551---------------------NDQM-------------------------------------------------------
A9TMM2_PHYPA/802-851---------------------EKGI-------------------------------------------------------
C5X980_SORBI/738-787---------------------KRGD-------------------------------------------------------
Q6NQ80_ARATH/672-721---------------------MKRK-------------------------------------------------------
B7PF95_IXOSC/251-296---------------------TDSR-------------------------------------------------------
C3YRB7_BRAFL/450-503---------------------HDTE-------------------------------------------------------
Q4H355_CIOIN/499-554---------------------TELE-------------------------------------------------------
Q175J8_AEDAE/472-517---------------------DARE-------------------------------------------------------
B4QH01_DROSI/447-492---------------------DARL-------------------------------------------------------
B4MQL3_DROWI/441-485---------------------DARL-------------------------------------------------------
A1YPR8_PIG/445-490---------------------EEKL-------------------------------------------------------
Q8UVF8_CHICK/442-487---------------------EEKL-------------------------------------------------------
C3Z5V2_BRAFL/340-389---------------------EERT-------------------------------------------------------
C3Z5N3_BRAFL/303-352---------------------EERQ-------------------------------------------------------
C3Z5V3_BRAFL/321-370---------------------EERM-------------------------------------------------------
A7T0Y6_NEMVE/281-326---------------------EERL-------------------------------------------------------
C3ZDH2_BRAFL/375-420---------------------EERC-------------------------------------------------------
C3ZDH3_BRAFL/810-855---------------------EEHT-------------------------------------------------------
RF298_ARATH/756-806---------------------RERE-------------------------------------------------------
A9SWJ7_PHYPA/400-450---------------------RDRE-------------------------------------------------------
Q6H4E3_ORYSJ/154-204---------------------RRRD-------------------------------------------------------
Q8L7B1_ARATH/680-730---------------------YDRE-------------------------------------------------------
B2YG55_MHVB/91-136---------------------FERV-------------------------------------------------------
D3BMT8_POLPA/752-797---------------------KARV-------------------------------------------------------
D3B0G3_POLPA/301-346---------------------QSKT-------------------------------------------------------
Q55EJ5_DICDI/318-363---------------------SKRS-------------------------------------------------------
A8BYS6_GIAIC/363-409---------------------DIQP-------------------------------------------------------
D2VG38_NAEGR/121-166---------------------RERN-------------------------------------------------------
332L_IIV6/181-226---------------------ETVR-------------------------------------------------------
O44624_CAEEL/348-395---------------------LVAE-------------------------------------------------------
A8B3E8_GIAIC/490-537---------------------RANA-------------------------------------------------------
MDM4_HUMAN/433-484---------------------LLKP-------------------------------------------------------
MDM4_DANRE/439-490---------------------LLEP-------------------------------------------------------
B7QMD7_IXOSC/391-442---------------------VQDP-------------------------------------------------------
B3RT05_TRIAD/399-452---------------------VDGM-------------------------------------------------------
D0N7P7_PHYIT/641-692---------------------DDLM-------------------------------------------------------
B7S448_PHATC/563-614---------------------LEDQ-------------------------------------------------------
A0E576_PARTE/650-695---------------------EKHL-------------------------------------------------------
Q54IT7_DICDI/506-551---------------------DDRC-------------------------------------------------------
CBLA_DICDI/614-659---------------------SKDL-------------------------------------------------------
D3B844_POLPA/641-686---------------------DKDL-------------------------------------------------------
Q16EA4_AEDAE/37-82---------------------SDDL-------------------------------------------------------
B7PKW4_IXOSC/293-338---------------------EEEL-------------------------------------------------------
A7RV74_NEMVE/252-297---------------------LDES-------------------------------------------------------
Q55CM4_DICDI/373-418---------------------ESDC-------------------------------------------------------
B9MVX8_POPTR/330-380---------------------DAKL-------------------------------------------------------
C5Z7Y7_SORBI/126-176---------------------SEKM-------------------------------------------------------
C7J222_ORYSJ/654-703---------------------GRHL-------------------------------------------------------
C5Z1C5_SORBI/284-333---------------------GGGG-------------------------------------------------------
A9SP35_PHYPA/429-478---------------------DHHL-------------------------------------------------------
A4VEG7_TETTS/185-235---------------------DSQL-------------------------------------------------------
A4ID13_LEIIN/107-152---------------------DKEL-------------------------------------------------------
B4FE85_MAIZE/315-365---------------------DGQL-------------------------------------------------------
B9GW13_POPTR/335-385---------------------EGQL-------------------------------------------------------
A9S6Y2_PHYPA/371-421---------------------DGEL-------------------------------------------------------
A9RL93_PHYPA/342-392---------------------EGEL-------------------------------------------------------
Q9SYH3_ARATH/327-377---------------------DGEL-------------------------------------------------------
A9RJ34_PHYPA/301-346---------------------TPDL-------------------------------------------------------
C5X430_SORBI/292-337---------------------VLDI-------------------------------------------------------
A9PFT8_POPTR/187-232---------------------IPDL-------------------------------------------------------
C4LUB1_ENTHI/101-146---------------------MNKI-------------------------------------------------------
A0DEI4_PARTE/163-210---------------------ADEM-------------------------------------------------------
A8B9D3_GIAIC/912-958---------------------VDTA-------------------------------------------------------
Q9U2C5_CAEEL/716-760---------------------LETN-------------------------------------------------------
B3RP37_TRIAD/597-642---------------------LSAE-------------------------------------------------------
A8HY85_CHLRE/42-92---------------------SDDT-------------------------------------------------------
Q08E63_BOVIN/672-717---------------------QTSE-------------------------------------------------------
A2CF42_DANRE/670-715---------------------FNSE-------------------------------------------------------
Q17KA2_AEDAE/659-704---------------------QFSE-------------------------------------------------------
A7RYU6_NEMVE/694-739---------------------LYPE-------------------------------------------------------
A7SA58_NEMVE/291-336---------------------QGTQ-------------------------------------------------------
C3YDJ4_BRAFL/246-293---------------------EEHA-------------------------------------------------------
MUL1A_DANRE/288-335---------------------VENA-------------------------------------------------------
Q580X7_TRYB2/183-230---------------------NNGQ-------------------------------------------------------
A9UW71_MONBE/179-233---------------------RHGE-------------------------------------------------------
A8BTP5_GIAIC/508-554---------------------HEFP-------------------------------------------------------
A8BF50_GIAIC/144-193---------------------PDGE-------------------------------------------------------
D2W5Y2_NAEGR/234-279---------------------EEQR-------------------------------------------------------
Q4E4Q1_TRYCC/67-117---------------------GHGL-------------------------------------------------------
Q4D0Q3_TRYCC/308-360---------------------DDSL-------------------------------------------------------
Q57UZ1_TRYB2/282-334---------------------SDLL-------------------------------------------------------
Y096_OSHVF/5-50---------------------DSNE-------------------------------------------------------
A8B916_GIAIC/483-532---------------------DIPT-------------------------------------------------------
A8BFH4_GIAIC/417-464---------------------DEGS-------------------------------------------------------
RKP_ARATH/1213-1261---------------------EDNT-------------------------------------------------------
Q7X8J6_ORYSJ/195-243---------------------EEDN-------------------------------------------------------
A7RTP5_NEMVE/1091-1139---------------------VDEL-------------------------------------------------------
B4GF46_DROPE/1249-1297---------------------EDSL-------------------------------------------------------
Q172Z5_AEDAE/1211-1259---------------------EDSL-------------------------------------------------------
D3BFC7_POLPA/945-993---------------------SDNL-------------------------------------------------------
A0DDH1_PARTE/752-797---------------------KENL-------------------------------------------------------
C1G5D5_PARBD/202-247---------------------EMDL-------------------------------------------------------
B8LWU9_TALSN/1261-1306---------------------EMDL-------------------------------------------------------
C5FIR2_ARTOC/1441-1486---------------------EMNL-------------------------------------------------------
B6HHQ4_PENCW/1154-1199---------------------ELDL-------------------------------------------------------
A0CXZ6_PARTE/629-674---------------------EFNL-------------------------------------------------------
095L_IIV6/35-79---------------------DIVM-------------------------------------------------------
A0DTE6_PARTE/310-359---------------------TSNI-------------------------------------------------------
A0BIJ5_PARTE/438-487---------------------SINL-------------------------------------------------------
A0DQT5_PARTE/433-482---------------------SINA-------------------------------------------------------
A0E0W7_PARTE/350-399---------------------SNNK-------------------------------------------------------
A0BRT5_PARTE/364-413---------------------SNQK-------------------------------------------------------
A0DKE3_PARTE/353-402---------------------SNNK-------------------------------------------------------
A0BXR0_PARTE/306-355---------------------SDCK-------------------------------------------------------
A0DCL7_PARTE/237-286---------------------KDTQ-------------------------------------------------------
A0E266_PARTE/386-435---------------------TLKQ-------------------------------------------------------
B9QR14_TOXGO/877-926---------------------EGDL-------------------------------------------------------
B6AHR5_CRYMR/424-473---------------------FDLS-------------------------------------------------------
A0D9J6_PARTE/386-435---------------------QNVL-------------------------------------------------------
A0D3H9_PARTE/407-456---------------------SQKL-------------------------------------------------------
A0DW47_PARTE/493-542---------------------TQDK-------------------------------------------------------
A0E9B5_PARTE/508-557---------------------NQDK-------------------------------------------------------
A0EDX3_PARTE/355-404---------------------SGDC-------------------------------------------------------
A0E7T4_PARTE/360-409---------------------SCDI-------------------------------------------------------
A0DGX9_PARTE/326-371---------------------EQNL-------------------------------------------------------
Q5CQ63_CRYPI/542-598---------------------SQFI-------------------------------------------------------
B6AAB1_CRYMR/645-701---------------------GNCY-------------------------------------------------------
Q6BZX0_YARLI/1057-1110---------------------EGFE-------------------------------------------------------
C3ZJP1_BRAFL/454-499---------------------SPNV-------------------------------------------------------
A0EEM4_PARTE/123-169---------------------DSSL-------------------------------------------------------
A0BUL0_PARTE/143-189---------------------DDKK-------------------------------------------------------
A0CHG4_PARTE/238-286---------------------ESEK-------------------------------------------------------
A0BWF0_PARTE/276-324---------------------EGEK-------------------------------------------------------
A9SFN3_PHYPA/878-930---------------------IGGM-------------------------------------------------------
Q54YP5_DICDI/37-90---------------------IKYE-------------------------------------------------------
Q4QBN7_LEIMA/2434-2479---------------------EVHM-------------------------------------------------------
Q4DEV7_TRYCC/938-983---------------------LVRM-------------------------------------------------------
B4LG30_DROVI/964-1009---------------------SLEE-------------------------------------------------------
Q7PZI6_ANOGA/923-968---------------------PLDE-------------------------------------------------------
B4LG30_DROVI/1011-1056---------------------KIDE-------------------------------------------------------
B0WW31_CULQU/928-973---------------------KIGE-------------------------------------------------------
B4KE70_DROMO/921-966---------------------NQQE-------------------------------------------------------
B0WPU4_CULQU/806-851---------------------IPQE-------------------------------------------------------
A2F0R0_TRIVA/448-496---------------------KTDN-------------------------------------------------------
C1EAH1_MICSR/417-462---------------------STAE-------------------------------------------------------
C1MHQ3_MICPC/448-493---------------------DAME-------------------------------------------------------
Q01FP0_OSTTA/472-517---------------------PDTE-------------------------------------------------------
A4H5U9_LEIBR/173-218---------------------DAVG-------------------------------------------------------
A2FJR6_TRIVA/40-88---------------------GDLT-------------------------------------------------------
A2FAQ1_TRIVA/178-227---------------------NDGM-------------------------------------------------------
A0DUV3_PARTE/152-197---------------------IQKF-------------------------------------------------------
A0CS68_PARTE/196-241---------------------IQKI-------------------------------------------------------
A1A5F8_XENTR/500-547---------------------..DE-------------------------------------------------------
A8B1R0_GIAIC/199-244---------------------...P-------------------------------------------------------
A8B9E6_GIAIC/351-396---------------------.SEV-------------------------------------------------------
A8NJ75_BRUMA/266-311---------------------..SE-------------------------------------------------------
A8PYM5_BRUMA/661-708---------------------..DE-------------------------------------------------------
B4HTJ4_DROSE/110-163---------------------.ALC-------------------------------------------------------
B4QQ20_DROSI/287-331---------------------.DQL-------------------------------------------------------
B9GIH6_POPTR/319-366---------------------..RL-------------------------------------------------------
B9H044_POPTR/672-720---------------------.DRE-------------------------------------------------------
B9HFX4_POPTR/1219-1265---------------------DDNT-------------------------------------------------------
C5LN27_PERM5/401-452---------------------..SE-------------------------------------------------------
D7M718_ARALL/391-438---------------------..YL-------------------------------------------------------
E1F5A9_GIAIA/347-394---------------------..GQ-------------------------------------------------------
E1GAB8_LOALO/85-132---------------------...T-------------------------------------------------------
E7KLV8_YEASL/60-109---------------------ENEL-------------------------------------------------------
E7KSP0_YEASL/566-612---------------------..LS-------------------------------------------------------
F1QJY3_DANRE/300-346---------------------..TA-------------------------------------------------------
F1QZ44_DANRE/466-513---------------------..EE-------------------------------------------------------
F4IHN6_ARATH/784-831---------------------.KGI-------------------------------------------------------
F4IIX4_ARATH/596-642---------------------..RK-------------------------------------------------------
F6Q0X6_CIOIN/671-715---------------------EENE-------------------------------------------------------
F6V562_XENTR/362-410---------------------...P-------------------------------------------------------
F6VVP4_CIOIN/828-872---------------------EERK-------------------------------------------------------
F6ZD85_XENTR/502-549---------------------..RD-------------------------------------------------------
G1R8W5_NOMLE/299-345---------------------..SA-------------------------------------------------------
H0V2W5_CAVPO/438-486---------------------..EP-------------------------------------------------------
H0WDM0_CAVPO/460-509---------------------.NGE-------------------------------------------------------
H3CQS4_TETNG/356-405---------------------.RKK-------------------------------------------------------
H3DCV6_TETNG/295-341---------------------.ENI-------------------------------------------------------
H3DPY2_TETNG/377-425---------------------..DP-------------------------------------------------------
H9GCR3_ANOCA/96-148---------------------..LC-------------------------------------------------------
I1JLP1_SOYBN/334-381---------------------..QL-------------------------------------------------------
I1QW19_ORYGL/297-343---------------------..RP-------------------------------------------------------
J3LIJ7_ORYBR/654-701---------------------.KGT-------------------------------------------------------
J9JVK3_ACYPI/243-291---------------------..DN-------------------------------------------------------
Q22CV7_TETTS/439-483---------------------.NDA-------------------------------------------------------
Q22NG2_TETTS/498-543---------------------...I-------------------------------------------------------
Q24BZ9_TETTS/694-741---------------------..ST-------------------------------------------------------
Q294I0_DROPS/710-759---------------------..AE-------------------------------------------------------
Q388Z7_TRYB2/96-140---------------------EKEE-------------------------------------------------------
U5GK99_POPTR/778-825---------------------.KGI-------------------------------------------------------
V4Z7N5_TOXGO/501-545---------------------.ETE-------------------------------------------------------

PF07800

M4CJA0_BRARP/50-200---------------------ENVI-------------------------------------------------------
J3MK74_ORYBR/23-223---------------------.RIS-------------------------------------------------------
I1K2V2_SOYBN/49-211---------------------EDVT-------------------------------------------------------
W5A7C3_WHEAT/23-231---------------------.RIS-------------------------------------------------------
F6HZY0_VITVI/22-260---------------------DDVS-------------------------------------------------------
M7Z892_TRIUA/9-237---------------------DDAR-------------------------------------------------------
Q9LRY5_ARATH/22-219---------------------DEVS-------------------------------------------------------
B9GUG0_POPTR/51-216---------------------.GAT-------------------------------------------------------
M1CGY7_SOLTU/46-208---------------------.GAT-------------------------------------------------------
K4CU07_SOLLC/16-249---------------------.GAS-------------------------------------------------------
I1N2C3_SOYBN/22-255---------------------DEVS-------------------------------------------------------
I1M9R8_SOYBN/11-171---------------------DDVA-------------------------------------------------------
M0RX91_MUSAM/44-191---------------------EEVR-------------------------------------------------------
M4D465_BRARP/25-184---------------------DDLV-------------------------------------------------------
M0U683_MUSAM/22-183---------------------DEVL-------------------------------------------------------
F6H968_VITVI/49-215---------------------EDAT-------------------------------------------------------
C5X4F2_SORBI/23-254---------------------.RIS-------------------------------------------------------
A9SF80_PHYPA/49-210---------------------EEAT-------------------------------------------------------
B9SEM7_RICCO/46-230---------------------EEAR-------------------------------------------------------
M1BUR7_SOLTU/46-233---------------------EDAR-------------------------------------------------------
F6HX92_VITVI/41-187---------------------EETR-------------------------------------------------------
M0RJN1_MUSAM/50-203---------------------.GAT-------------------------------------------------------
M0SRW7_MUSAM/22-177---------------------DETS-------------------------------------------------------
B6SUA2_MAIZE/30-197---------------------EDVA-------------------------------------------------------
I1KZC0_SOYBN/22-256---------------------DEVS-------------------------------------------------------
J3KUR8_ORYBR/26-254---------------------DDAL-------------------------------------------------------
M0U6C0_MUSAM/135-295---------------------DDIV-------------------------------------------------------
M1CSJ9_SOLTU/45-210---------------------EEAK-------------------------------------------------------
J3MH44_ORYBR/29-188---------------------EDVT-------------------------------------------------------
M4E8R7_BRARP/36-202---------------------EEAR-------------------------------------------------------
M0THX6_MUSAM/100-260---------------------KDVT-------------------------------------------------------
I1P4P1_ORYGL/48-211---------------------EDAN-------------------------------------------------------
W5C2K8_WHEAT/49-202---------------------.HAT-------------------------------------------------------
W1NJC5_AMBTC/57-230---------------------EDAT-------------------------------------------------------
B9SPP5_RICCO/28-184---------------------EEVV-------------------------------------------------------
F6H3B5_VITVI/28-194---------------------EDVT-------------------------------------------------------
J3LYB6_ORYBR/145-298---------------------.SAT-------------------------------------------------------
W1P3H0_AMBTC/37-183---------------------DDVR-------------------------------------------------------
K7KTN8_SOYBN/11-174---------------------EDVI-------------------------------------------------------
B9SZV8_RICCO/31-193---------------------EEVR-------------------------------------------------------
I1PLP2_ORYGL/49-202---------------------.RAT-------------------------------------------------------
Q9LUA0_ARATH/39-255---------------------EEAR-------------------------------------------------------
W1P964_AMBTC/48-238---------------------DDVR-------------------------------------------------------
F6H0M7_VITVI/115-281---------------------EDAT-------------------------------------------------------
B9GF75_POPTR/49-209---------------------ENVT-------------------------------------------------------
K3ZTK7_SETIT/23-255---------------------.RIS-------------------------------------------------------
M4DF02_BRARP/22-205---------------------DEVS-------------------------------------------------------
U5D0D1_AMBTC/32-284---------------------DDAS-------------------------------------------------------
F6HH69_VITVI/46-233---------------------EDAR-------------------------------------------------------
I1KSC4_SOYBN/46-217---------------------EEAR-------------------------------------------------------
M4D3C9_BRARP/51-199---------------------.DAV-------------------------------------------------------
C5Y9B2_SORBI/49-202---------------------.NAT-------------------------------------------------------
K7TN85_MAIZE/24-253---------------------DDVL-------------------------------------------------------
I1LMI1_SOYBN/43-250---------------------EEAR-------------------------------------------------------
M1CRX8_SOLTU/39-210---------------------EEAR-------------------------------------------------------
I1NPL5_ORYGL/52-207---------------------EDVR-------------------------------------------------------
B9S551_RICCO/22-258---------------------DEVS-------------------------------------------------------
I1KA51_SOYBN/47-210---------------------EDAT-------------------------------------------------------
K3YTM6_SETIT/49-212---------------------.GAT-------------------------------------------------------
Q7XP23_ORYSJ/26-252---------------------DDAL-------------------------------------------------------
W1NR99_AMBTC/24-180---------------------EEVT-------------------------------------------------------
B9GTE6_POPTR/22-235---------------------DEVS-------------------------------------------------------
I1HXY9_BRADI/26-254---------------------DDAR-------------------------------------------------------
B9RJB2_RICCO/51-216---------------------.SST-------------------------------------------------------
B9N5I9_POPTR/46-233---------------------EEAR-------------------------------------------------------
K4DHB9_SOLLC/16-172---------------------DDVF-------------------------------------------------------
W1P3L7_AMBTC/42-195---------------------EDAT-------------------------------------------------------
M0S465_MUSAM/48-212---------------------EDAT-------------------------------------------------------

PF14570

E3KCH5_PUCGT/25-72--------------------------------------------------------------------------------
C5Z2Q3_SORBI/153-202--------------------------------------------------------------------------------
A9SS17_PHYPA/149-197--------------------------------------------------------------------------------
A9TJ93_PHYPA/149-197--------------------------------------------------------------------------------
B9GZJ8_POPTR/106-155--------------------------------------------------------------------------------
A9TJ92_PHYPA/149-197--------------------------------------------------------------------------------
D8R581_SELML/140-188--------------------------------------------------------------------------------
A9S910_PHYPA/152-201--------------------------------------------------------------------------------
C7J5V0_ORYSJ/139-187--------------------------------------------------------------------------------
C5WQN8_SORBI/138-187--------------------------------------------------------------------------------
B4LR99_DROVI/14-61--------------------------------------------------------------------------------
D8QRL0_SELML/7-59--------------------------------------------------------------------------------
E3M500_CAERE/13-60--------------------------------------------------------------------------------
Q4PB17_USTMA/92-139--------------------------------------------------------------------------------
B6K5B3_SCHJY/18-65--------------------------------------------------------------------------------
D7TQA4_VITVI/2-51--------------------------------------------------------------------------------
D8SZU2_SELML/134-182--------------------------------------------------------------------------------
B7FS97_PHATC/4-51--------------------------------------------------------------------------------
D8SMF9_SELML/143-191--------------------------------------------------------------------------------
F2UBF0_SALR5/11-58--------------------------------------------------------------------------------
D7FLE0_ECTSI/18-65--------------------------------------------------------------------------------
E1Z5F3_CHLVA/7-59--------------------------------------------------------------------------------
B6KGI1_TOXGO/287-334--------------------------------------------------------------------------------
Q00YG3_OSTTA/4-56--------------------------------------------------------------------------------
B6AF72_CRYMR/35-82--------------------------------------------------------------------------------
A9RPN5_PHYPA/537-583--------------------------------------------------------------------------------
A7AQF3_BABBO/19-66--------------------------------------------------------------------------------
C0NRW9_AJECG/18-66--------------------------------------------------------------------------------
D2V231_NAEGR/12-58--------------------------------------------------------------------------------
B9R8Z9_RICCO/281-327--------------------------------------------------------------------------------
Q8I569_PLAF7/125-172--------------------------------------------------------------------------------
A2I1U4_TRIVA/15-62--------------------------------------------------------------------------------
A9SN46_PHYPA/683-731--------------------------------------------------------------------------------
C1FIH5_MICSR/14-66--------------------------------------------------------------------------------
E4XX29_OIKDI/13-59--------------------------------------------------------------------------------
D8LWI9_BLAHO/18-64--------------------------------------------------------------------------------
D7KS60_ARALL/216-262--------------------------------------------------------------------------------
D3B1B1_POLPA/10-57--------------------------------------------------------------------------------
D8UJD3_VOLCA/6-53--------------------------------------------------------------------------------
D8LZN3_BLAHO/13-59--------------------------------------------------------------------------------
E1F5J3_GIAIA/12-57--------------------------------------------------------------------------------
D8LYA2_BLAHO/6-52--------------------------------------------------------------------------------
B9RZ22_RICCO/108-151--------------------------------------------------------------------------------
C1NA27_MICPC/1777-1826--------------------------------------------------------------------------------
C1ECQ0_MICSR/1869-1919--------------------------------------------------------------------------------
B9IEK3_POPTR/279-325--------------------------------------------------------------------------------
C5Y9X2_SORBI/268-314--------------------------------------------------------------------------------
F6HT44_VITVI/117-166--------------------------------------------------------------------------------
G2QHA3_THIHA/15-59--------------------------------------------------------------------------------
G8YIU3_PICSO/17-66--------------------------------------------------------------------------------
M1BEF9_SOLTU/138-186--------------------------------------------------------------------------------
Q2QYY3_ORYSJ/12-64--------------------------------------------------------------------------------
Q5KM21_CRYNJ/64-110--------------------------------------------------------------------------------
CSLD1_ORYSJ/113-162--------------------------------------------------------------------------------

PF14569

B9IMB3_POPTR/27-104---------------KPLKNLDGQV-------------------------------------------------------
B9N4G3_POPTR/29-106---------------RSLERVSRQI-------------------------------------------------------
Q06FC6_PHYPA/29-106---------------RPENQVNELV-------------------------------------------------------
C5Z153_SORBI/31-108---------------KPAKSASGQV-------------------------------------------------------
B9SUE6_RICCO/13-88---------------KNAKQNAIQI-------------------------------------------------------
J3LUK4_ORYBR/29-106---------------KPLKHTNGQV-------------------------------------------------------
W5A591_WHEAT/10-81---------------......AAKV-------------------------------------------------------
M0SYV1_MUSAM/33-104---------------...SRANTRL-------------------------------------------------------
M4EY24_BRARP/19-90---------------.....FSAKI-------------------------------------------------------
D8QPL4_SELML/26-103---------------KPLNSVNSEM-------------------------------------------------------
D8QXH9_SELML/28-105---------------KPLKHLNGQV-------------------------------------------------------
M0S2A0_MUSAM/9-84---------------KPVKHSGGQV-------------------------------------------------------
A9T9M4_PHYPA/2-79---------------RPLSNVNSHI-------------------------------------------------------
M0TNJ9_MUSAM/32-107---------------...HDSNGQI-------------------------------------------------------
D7LYB5_ARALL/10-86---------------KPMKNVVPQI-------------------------------------------------------
D8R892_SELML/26-103---------------KPLSHCKSET-------------------------------------------------------
K4BTR6_SOLLC/29-106---------------KSMQQQSGHI-------------------------------------------------------
W1PN60_AMBTC/29-106---------------RPLQQLSGQI-------------------------------------------------------
D7LL56_ARALL/30-109---------------KPLKDLNGQI-------------------------------------------------------
U5DBY3_AMBTC/12-84---------------.....SRSKL-------------------------------------------------------
I1KTE1_SOYBN/29-106---------------KSVRELSGQI-------------------------------------------------------
CESAA_ARATH/23-100---------------KPLKDLNGQI-------------------------------------------------------
F6HB61_VITVI/10-87---------------KSLKGLGGQV-------------------------------------------------------
I1KRK2_SOYBN/23-97---------------.PTRQSASKV-------------------------------------------------------
I1N137_SOYBN/29-106---------------KPLKNLNGQI-------------------------------------------------------
T1MB14_TRIUA/28-100---------------.....ILRTV-------------------------------------------------------
K4A562_SETIT/14-87---------------....HRAGQV-------------------------------------------------------
M1BV52_SOLTU/29-106---------------KPLKPLNSQI-------------------------------------------------------
B9GRE7_POPTR/26-98---------------.....ATSKK-------------------------------------------------------
M4D4E1_BRARP/29-106---------------KPLKNMDREI-------------------------------------------------------
A9RUW7_PHYPA/28-105---------------KPLSQVNSQF-------------------------------------------------------

PF13923

A0DM57_PARTE/251-296--------------------------------------------------------------------------------
A0CF54_PARTE/232-272--------------------------------------------------------------------------------
A0DM57_PARTE/106-151--------------------------------------------------------------------------------
B4MJI2_DROWI/170-219--------------------------------------------------------------------------------
A7ANP1_BABBO/364-410--------------------------------------------------------------------------------
B6QUC4_PENMQ/146-199--------------------------------------------------------------------------------
E3VZ59_MIMIV/451-490--------------------------------------------------------------------------------
A8NIA6_COPC7/186-227--------------------------------------------------------------------------------
A0D443_PARTE/1032-1078--------------------------------------------------------------------------------
D0NMN9_PHYIT/121-160--------------------------------------------------------------------------------
Q98RQ9_GUITH/394-432--------------------------------------------------------------------------------
Q543N0_MOUSE/481-525--------------------------------------------------------------------------------
B6K3X8_SCHJY/273-310--------------------------------------------------------------------------------
A4RSH1_OSTLU/377-416--------------------------------------------------------------------------------
B7GAH4_PHATC/361-398--------------------------------------------------------------------------------
Q4S075_TETNG/294-332--------------------------------------------------------------------------------
C0HB20_SALSA/295-333--------------------------------------------------------------------------------
B0R157_DANRE/295-333--------------------------------------------------------------------------------
A9RSM9_PHYPA/340-378--------------------------------------------------------------------------------
Q9AV73_ORYSJ/315-353--------------------------------------------------------------------------------
B9IPB1_POPTR/334-372--------------------------------------------------------------------------------
D3B863_POLPA/337-374--------------------------------------------------------------------------------
A8NT78_BRUMA/274-312--------------------------------------------------------------------------------
B4KF78_DROMO/244-282--------------------------------------------------------------------------------
A0NDZ1_ANOGA/262-300--------------------------------------------------------------------------------
Q176A8_AEDAE/263-301--------------------------------------------------------------------------------
Q8RXZ1_ARATH/147-188--------------------------------------------------------------------------------
D0MZ54_PHYIT/581-619--------------------------------------------------------------------------------
B5DJC0_DROPS/57-98--------------------------------------------------------------------------------
B5X7I0_SALSA/75-116--------------------------------------------------------------------------------
D2VUH3_NAEGR/132-170--------------------------------------------------------------------------------
B0WU64_CULQU/24-64--------------------------------------------------------------------------------
B0W2B0_CULQU/33-78--------------------------------------------------------------------------------
A0DWJ9_PARTE/15-53--------------------------------------------------------------------------------
A9TT99_PHYPA/344-383--------------------------------------------------------------------------------
B0WPL9_CULQU/34-73--------------------------------------------------------------------------------
Q95LW3_MACFA/15-54--------------------------------------------------------------------------------
RAD5_USTMA/1108-1153--------------------------------------------------------------------------------
B5DJ77_DROPS/211-249--------------------------------------------------------------------------------
A7S6I7_NEMVE/19-58--------------------------------------------------------------------------------
Q380J4_ANOGA/505-539--------------------------------------------------------------------------------
B7FWC6_PHATC/205-239--------------------------------------------------------------------------------
A0CU32_PARTE/80-120--------------------------------------------------------------------------------
Q4RPK4_TETNG/757-803--------------------------------------------------------------------------------
A5DDL0_PICGU/810-861--------------------------------------------------------------------------------
B7FWI3_PHATC/1595-1637--------------------------------------------------------------------------------
B0E743_ENTDS/974-1011--------------------------------------------------------------------------------
A4RRY6_OSTLU/295-336--------------------------------------------------------------------------------
A9SNH3_PHYPA/1197-1234--------------------------------------------------------------------------------
C5X2L6_SORBI/68-105--------------------------------------------------------------------------------
A7RTP5_NEMVE/1095-1132--------------------------------------------------------------------------------
Q8SZS1_DROME/704-741--------------------------------------------------------------------------------
C9JI97_HUMAN/366-403--------------------------------------------------------------------------------
Q172Z5_AEDAE/1215-1252--------------------------------------------------------------------------------
A8BQV1_GIAIC/501-539--------------------------------------------------------------------------------
Q4H356_CIOIN/491-531--------------------------------------------------------------------------------
F5HDT7_CRYNB/404-442--------------------------------------------------------------------------------
C5LKK1_PERM5/207-243--------------------------------------------------------------------------------
TR64C_HUMAN/15-55--------------------------------------------------------------------------------
Q070K6_CPRVZ/419-458--------------------------------------------------------------------------------
A8Y1Q5_CAEBR/129-166--------------------------------------------------------------------------------
A8XWS0_CAEBR/239-284--------------------------------------------------------------------------------
B3RT05_TRIAD/403-445--------------------------------------------------------------------------------
B6JWP1_SCHJY/28-65--------------------------------------------------------------------------------
B5DYA8_DROPS/159-199--------------------------------------------------------------------------------
Q4N6R0_THEPA/105-143--------------------------------------------------------------------------------
C3ZJG2_BRAFL/286-324--------------------------------------------------------------------------------
A0C478_PARTE/254-292--------------------------------------------------------------------------------
B6AHT1_CRYMR/552-588--------------------------------------------------------------------------------
A2FAQ1_TRIVA/182-220--------------------------------------------------------------------------------
A7RWB7_NEMVE/456-496--------------------------------------------------------------------------------
C5LN26_PERM5/368-411--------------------------------------------------------------------------------
A4H9Q8_LEIBR/106-142--------------------------------------------------------------------------------
C1EAH1_MICSR/421-455--------------------------------------------------------------------------------
Q01FP0_OSTTA/476-510--------------------------------------------------------------------------------
Q5CL02_CRYHO/214-252--------------------------------------------------------------------------------
D3B0G5_POLPA/403-441--------------------------------------------------------------------------------
D0A5B8_TRYB9/267-305--------------------------------------------------------------------------------
D0MQ76_PHYIT/292-330--------------------------------------------------------------------------------
B6AAH4_CRYMR/250-288--------------------------------------------------------------------------------
A8NJ75_BRUMA/268-306--------------------------------------------------------------------------------
Q6P7J2_XENLA/238-276--------------------------------------------------------------------------------
A0A024XFA2_PLAFC/239-277--------------------------------------------------------------------------------
A4H6A2_LEIBR/307-345--------------------------------------------------------------------------------
Q4D0Q6_TRYCC/314-353--------------------------------------------------------------------------------
Q57UZ4_TRYB2/285-324--------------------------------------------------------------------------------
Q00TM5_OSTTA/325-366--------------------------------------------------------------------------------
B9IFM5_POPTR/296-334--------------------------------------------------------------------------------
Q75HV4_ORYSJ/37-75--------------------------------------------------------------------------------
D2J4P6_9BBAC/168-204--------------------------------------------------------------------------------
C3Y345_BRAFL/528-570--------------------------------------------------------------------------------
D2GYA5_AILME/381-422--------------------------------------------------------------------------------
Q4SPD0_TETNG/381-422--------------------------------------------------------------------------------
Q0VFN3_XENTR/391-432--------------------------------------------------------------------------------
D2VUY6_NAEGR/329-367--------------------------------------------------------------------------------
B7Z8S4_HUMAN/202-239--------------------------------------------------------------------------------
Q7Z0X5_PARTE/201-237--------------------------------------------------------------------------------
Q0IF35_AEDAE/289-324--------------------------------------------------------------------------------
D3TMJ3_GLOMM/290-325--------------------------------------------------------------------------------
B3NG13_DROER/290-325--------------------------------------------------------------------------------
C6LRH7_GIAIB/477-513--------------------------------------------------------------------------------
B4P6L3_DROYA/225-264--------------------------------------------------------------------------------
B4JAJ2_DROGR/238-278--------------------------------------------------------------------------------
B4LV95_DROVI/238-278--------------------------------------------------------------------------------
B4KIZ8_DROMO/238-278--------------------------------------------------------------------------------
B4MWC3_DROWI/225-264--------------------------------------------------------------------------------
A9V3B5_MONBE/31-69--------------------------------------------------------------------------------
Q54X17_DICDI/404-442--------------------------------------------------------------------------------
A0BTB6_PARTE/28-67--------------------------------------------------------------------------------
A0C4H9_PARTE/27-66--------------------------------------------------------------------------------
D2VJU3_NAEGR/41-75--------------------------------------------------------------------------------
A0DF02_PARTE/87-127--------------------------------------------------------------------------------
D2VR88_NAEGR/66-102--------------------------------------------------------------------------------
C5Z074_SORBI/182-219--------------------------------------------------------------------------------
C4LYH5_ENTHI/117-164--------------------------------------------------------------------------------
C1EGY6_MICSR/774-812--------------------------------------------------------------------------------
C4V958_NOSCE/198-231--------------------------------------------------------------------------------
B7ZR58_XENLA/44-80--------------------------------------------------------------------------------
A9TTF3_PHYPA/979-1013--------------------------------------------------------------------------------
B7GE72_PHATC/936-974--------------------------------------------------------------------------------
D3BQU7_POLPA/87-124--------------------------------------------------------------------------------
D3BF23_POLPA/30-67--------------------------------------------------------------------------------
Q559R2_DICDI/23-61--------------------------------------------------------------------------------
C1BTL6_LEPSM/304-342--------------------------------------------------------------------------------
A7S3R4_NEMVE/22-62--------------------------------------------------------------------------------
Q4Q7I1_LEIMA/35-73--------------------------------------------------------------------------------
A8XJR9_CAEBR/23-61--------------------------------------------------------------------------------
A0DCG8_PARTE/700-734--------------------------------------------------------------------------------
Y7813_DICDI/45-87--------------------------------------------------------------------------------
Q54YP5_DICDI/41-83--------------------------------------------------------------------------------
Y2340_DICDI/33-75--------------------------------------------------------------------------------
Y8444_DICDI/28-67--------------------------------------------------------------------------------
Y0965_DICDI/27-66--------------------------------------------------------------------------------
Q0R0E3_9DINO/54-98--------------------------------------------------------------------------------
Q16PP0_AEDAE/156-200--------------------------------------------------------------------------------
C3XUC3_BRAFL/62-106--------------------------------------------------------------------------------
A0BU81_PARTE/1039-1085--------------------------------------------------------------------------------
A0BXR5_PARTE/42-78--------------------------------------------------------------------------------
Q9CA44_ARATH/200-234--------------------------------------------------------------------------------
SINA1_ARATH/57-92--------------------------------------------------------------------------------
B2KZF7_PICAB/132-164--------------------------------------------------------------------------------
C4J1C6_MAIZE/345-377--------------------------------------------------------------------------------
C0P9L7_MAIZE/211-243--------------------------------------------------------------------------------
C5YMZ0_SORBI/363-395--------------------------------------------------------------------------------
B5DSB0_DROPS/736-777--------------------------------------------------------------------------------
D4ATB3_ARTBC/136-186--------------------------------------------------------------------------------
B9H5S5_POPTR/1076-1093--------------------------------------------------------------------------------
A2FYQ9_TRIVA/553-591--------------------------------------------------------------------------------
A2FIP7_TRIVA/654-692--------------------------------------------------------------------------------
A2G3U3_TRIVA/653-691--------------------------------------------------------------------------------
A7RKP3_NEMVE/27-64--------------------------------------------------------------------------------
A0DSS8_PARTE/225-265--------------------------------------------------------------------------------
A0BZ57_PARTE/273-314--------------------------------------------------------------------------------
A9TTF3_PHYPA/125-171--------------------------------------------------------------------------------
C1EI00_MICSR/588-632--------------------------------------------------------------------------------
C1N685_MICPC/739-783--------------------------------------------------------------------------------
C6LTE1_GIAIB/174-217--------------------------------------------------------------------------------
B8M471_TALSN/218-260--------------------------------------------------------------------------------
B8LVC4_TALSN/196-240--------------------------------------------------------------------------------
B8MPN3_TALSN/194-238--------------------------------------------------------------------------------
A7SGX8_NEMVE/16-50--------------------------------------------------------------------------------
A0CTG0_PARTE/45-83--------------------------------------------------------------------------------
C1FIU4_MICSR/123-173--------------------------------------------------------------------------------
Q22NC9_TETTS/55-92--------------------------------------------------------------------------------
D3B001_POLPA/205-243--------------------------------------------------------------------------------
D3ZVH5_RAT/405-445--------------------------------------------------------------------------------
A0D9J6_PARTE/390-428--------------------------------------------------------------------------------
A0DW47_PARTE/497-535--------------------------------------------------------------------------------
A0E9B5_PARTE/512-550--------------------------------------------------------------------------------
C3Y1X2_BRAFL/437-476--------------------------------------------------------------------------------
D3YTR3_MOUSE/560-599--------------------------------------------------------------------------------
A1A5J0_XENLA/776-814--------------------------------------------------------------------------------
A7S739_NEMVE/707-745--------------------------------------------------------------------------------
B4E0F9_HUMAN/339-377--------------------------------------------------------------------------------
UHRF1_XENLA/703-741--------------------------------------------------------------------------------
D0QWP4_DROMI/708-748--------------------------------------------------------------------------------
Q8H7Q8_ORYSJ/598-636--------------------------------------------------------------------------------
A9P8M8_POPTR/64-102--------------------------------------------------------------------------------
Q6NQ80_ARATH/676-714--------------------------------------------------------------------------------
C3YRC2_BRAFL/456-495--------------------------------------------------------------------------------
D2H5E9_AILME/448-487--------------------------------------------------------------------------------
B4K8G5_DROMO/73-112--------------------------------------------------------------------------------
Q9VFY3_DROME/85-124--------------------------------------------------------------------------------
A0EEM4_PARTE/127-162--------------------------------------------------------------------------------
A0CHG4_PARTE/242-279--------------------------------------------------------------------------------
A0BUL0_PARTE/147-182--------------------------------------------------------------------------------
A0D0Y2_PARTE/438-476--------------------------------------------------------------------------------
B9R7N4_RICCO/124-173--------------------------------------------------------------------------------
D0N844_PHYIT/1002-1040--------------------------------------------------------------------------------
C5L7V9_PERM5/133-175--------------------------------------------------------------------------------
Q4Z6K3_PLABA/1120-1161--------------------------------------------------------------------------------
C3ZK23_BRAFL/260-302--------------------------------------------------------------------------------
C1DZP8_MICSR/278-322--------------------------------------------------------------------------------
B7XK28_ENTBH/440-478--------------------------------------------------------------------------------
A8PYM5_BRUMA/663-701--------------------------------------------------------------------------------
B9QR14_TOXGO/881-919--------------------------------------------------------------------------------
A8BZD1_GIAIC/260-300--------------------------------------------------------------------------------
SHPRH_MOUSE/1423-1469--------------------------------------------------------------------------------
C6LP83_GIAIB/741-779--------------------------------------------------------------------------------
A0DKE3_PARTE/357-395--------------------------------------------------------------------------------
A0BRT5_PARTE/368-406--------------------------------------------------------------------------------
Q22NG2_TETTS/499-537--------------------------------------------------------------------------------
Q24BZ9_TETTS/696-734--------------------------------------------------------------------------------
A0DYF8_PARTE/437-475--------------------------------------------------------------------------------
A0BW00_PARTE/300-338--------------------------------------------------------------------------------
Q5C443_SCHJA/377-416--------------------------------------------------------------------------------
B6JYB1_SCHJY/146-190--------------------------------------------------------------------------------
A2EK74_TRIVA/538-575--------------------------------------------------------------------------------
C6THX2_SOYBN/69-103--------------------------------------------------------------------------------
C3Z5U0_BRAFL/457-495--------------------------------------------------------------------------------
Q7RC46_PLAYO/40-78--------------------------------------------------------------------------------
A9V149_MONBE/512-549--------------------------------------------------------------------------------
C5L4C0_PERM5/287-322--------------------------------------------------------------------------------
D0NXH2_PHYIT/505-543--------------------------------------------------------------------------------
Q8JRX3_9BBAC/193-232--------------------------------------------------------------------------------
C6LP72_GIAIB/436-471--------------------------------------------------------------------------------
Q91EW1_GVCPM/194-230--------------------------------------------------------------------------------
A2ENP8_TRIVA/532-570--------------------------------------------------------------------------------
B3S6I8_TRIAD/185-223--------------------------------------------------------------------------------
C6LUY8_GIAIB/168-204--------------------------------------------------------------------------------
Q00XZ6_OSTTA/268-308--------------------------------------------------------------------------------
D0NG82_PHYIT/253-291--------------------------------------------------------------------------------
Y118_OSHVF/78-113--------------------------------------------------------------------------------
A7S4Z9_NEMVE/259-297--------------------------------------------------------------------------------
A8J0L3_CHLRE/229-267--------------------------------------------------------------------------------
D2VG38_NAEGR/125-159--------------------------------------------------------------------------------
O82304_ARATH/657-696--------------------------------------------------------------------------------
A7S2I5_NEMVE/215-252--------------------------------------------------------------------------------
A9SXH9_PHYPA/400-438--------------------------------------------------------------------------------
A9TAZ5_PHYPA/313-351--------------------------------------------------------------------------------
XB34_ARATH/325-363--------------------------------------------------------------------------------
B9ILD2_POPTR/244-282--------------------------------------------------------------------------------
B9HKH1_POPTR/391-429--------------------------------------------------------------------------------
A9S6Y2_PHYPA/375-414--------------------------------------------------------------------------------
C5WVU4_SORBI/322-361--------------------------------------------------------------------------------
B9S5Q7_RICCO/335-374--------------------------------------------------------------------------------
A9NTV8_PICSI/342-381--------------------------------------------------------------------------------
C6LN18_GIAIB/199-237--------------------------------------------------------------------------------
B0WTA2_CULQU/342-380--------------------------------------------------------------------------------
175R_IIV6/137-169--------------------------------------------------------------------------------
Q5C5B5_SCHJA/135-167--------------------------------------------------------------------------------
Q16NN6_AEDAE/1098-1130--------------------------------------------------------------------------------
C6LSV4_GIAIB/777-820--------------------------------------------------------------------------------
A7S3Y5_NEMVE/377-411--------------------------------------------------------------------------------
Q9CAK3_ARATH/68-102--------------------------------------------------------------------------------
D1M869_HYDVU/379-413--------------------------------------------------------------------------------
Q06VP5_TNAVC/158-199--------------------------------------------------------------------------------
D2VAI7_NAEGR/10-48--------------------------------------------------------------------------------
A2FR15_TRIVA/585-618--------------------------------------------------------------------------------
Q2PQQ3_GLOMM/319-353--------------------------------------------------------------------------------
B7SVZ2_9ABAC/243-277--------------------------------------------------------------------------------
Q8QL95_9ABAC/229-263--------------------------------------------------------------------------------
Q968T8_BOMMO/299-333--------------------------------------------------------------------------------
A8BF50_GIAIC/148-186--------------------------------------------------------------------------------
A8B9E6_GIAIC/354-390--------------------------------------------------------------------------------
A1YJA1_NPVSF/240-274--------------------------------------------------------------------------------
BIRC8_HUMAN/189-223--------------------------------------------------------------------------------
B0XJ37_CULQU/458-492--------------------------------------------------------------------------------
B4MQL3_DROWI/445-478--------------------------------------------------------------------------------
Q6XIF1_DROYA/39-73--------------------------------------------------------------------------------
C3ZJQ8_BRAFL/216-254--------------------------------------------------------------------------------
C3Z5V2_BRAFL/344-382--------------------------------------------------------------------------------
Q4T660_TETNG/367-401--------------------------------------------------------------------------------
C3Z9S3_BRAFL/323-357--------------------------------------------------------------------------------
D4A690_RAT/117-150--------------------------------------------------------------------------------
Q1RPW2_CIOIN/832-866--------------------------------------------------------------------------------
B4L1M7_DROMO/141-175--------------------------------------------------------------------------------
Q4S2E9_TETNG/108-148--------------------------------------------------------------------------------
Q8L7L2_ARATH/295-333--------------------------------------------------------------------------------
Q1RQ04_CIOIN/76-114--------------------------------------------------------------------------------
D0N6K8_PHYIT/124-164--------------------------------------------------------------------------------
C5LYS2_PERM5/160-200--------------------------------------------------------------------------------
B8C319_THAPS/703-741--------------------------------------------------------------------------------
Q7RJH0_PLAYO/459-510--------------------------------------------------------------------------------
A8Q3B4_MALGO/319-358--------------------------------------------------------------------------------
Q7QJC5_ANOGA/1082-1126--------------------------------------------------------------------------------
Q17LA7_AEDAE/871-915--------------------------------------------------------------------------------
B0VZF2_CULQU/1030-1074--------------------------------------------------------------------------------
A1DE99_NEOFI/197-240--------------------------------------------------------------------------------
Q6CSC0_KLULA/132-177--------------------------------------------------------------------------------
D3BPM8_POLPA/543-581--------------------------------------------------------------------------------
B4LXC4_DROVI/352-390--------------------------------------------------------------------------------
Q54SL8_DICDI/701-739--------------------------------------------------------------------------------
B7Q9S2_IXOSC/170-208--------------------------------------------------------------------------------
B0WZT3_CULQU/329-367--------------------------------------------------------------------------------
RN220_HUMAN/514-552--------------------------------------------------------------------------------
C1E7V4_MICSR/171-211--------------------------------------------------------------------------------
CWC24_YARLI/206-243--------------------------------------------------------------------------------
A0E7N9_PARTE/987-1025--------------------------------------------------------------------------------
B4KVG3_DROMO/1146-1186--------------------------------------------------------------------------------
A0D1G8_PARTE/221-258--------------------------------------------------------------------------------
A8PYH1_MALGO/34-71--------------------------------------------------------------------------------
Q245H9_TETTS/243-280--------------------------------------------------------------------------------
B6K3C8_SCHJY/272-309--------------------------------------------------------------------------------
CWC24_SCHPO/254-291--------------------------------------------------------------------------------
Q54FF5_DICDI/584-624--------------------------------------------------------------------------------
D0NZU5_PHYIT/162-202--------------------------------------------------------------------------------
B7QCM6_IXOSC/39-77--------------------------------------------------------------------------------
B7PU01_IXOSC/405-444--------------------------------------------------------------------------------
RNF34_PONAB/325-359--------------------------------------------------------------------------------
A9NW00_PICSI/400-438--------------------------------------------------------------------------------
C5Z7Y7_SORBI/130-169--------------------------------------------------------------------------------
B9R739_RICCO/172-211--------------------------------------------------------------------------------
C5Z1C5_SORBI/288-326--------------------------------------------------------------------------------
A9SP35_PHYPA/433-471--------------------------------------------------------------------------------
B9IG95_POPTR/403-441--------------------------------------------------------------------------------
D0NTE7_PHYIT/21-61--------------------------------------------------------------------------------
A0CEH1_PARTE/53-91--------------------------------------------------------------------------------
A0C208_PARTE/199-232--------------------------------------------------------------------------------
B6HM97_PENCW/915-959--------------------------------------------------------------------------------
C5GL91_AJEDR/892-936--------------------------------------------------------------------------------
C4JRA8_UNCRE/881-925--------------------------------------------------------------------------------
Q0CWC5_ASPTN/903-947--------------------------------------------------------------------------------
A9ST23_PHYPA/10-52--------------------------------------------------------------------------------
C4V7R2_NOSCE/427-464--------------------------------------------------------------------------------
B9FSS0_ORYSJ/27-67--------------------------------------------------------------------------------
C5Z8M1_SORBI/38-78--------------------------------------------------------------------------------
B7G2V4_PHATC/444-486--------------------------------------------------------------------------------
Q8IJR5_PLAF7/30-67--------------------------------------------------------------------------------
A8B916_GIAIC/487-525--------------------------------------------------------------------------------
C6LSR9_GIAIB/487-525--------------------------------------------------------------------------------
Q5CQ63_CRYPI/546-591--------------------------------------------------------------------------------
B9S532_RICCO/13-52--------------------------------------------------------------------------------
B7SHK9_CUCSA/155-192--------------------------------------------------------------------------------
B7FKJ7_MEDTR/159-196--------------------------------------------------------------------------------
B0D7Z9_LACBS/763-801--------------------------------------------------------------------------------
Q4RTM4_TETNG/143-178--------------------------------------------------------------------------------
Q4QHY1_LEIMA/422-456--------------------------------------------------------------------------------
B4KYT6_DROMO/78-112--------------------------------------------------------------------------------
B3RLR7_TRIAD/51-85--------------------------------------------------------------------------------
A7UU20_ANOGA/80-114--------------------------------------------------------------------------------
Q9W699_TAKRU/306-344--------------------------------------------------------------------------------
Q90381_9CHON/297-335--------------------------------------------------------------------------------
A7XQ35_9SAUR/238-276--------------------------------------------------------------------------------
A7KFG5_PHACP/213-251--------------------------------------------------------------------------------
CBLA_DICDI/618-652--------------------------------------------------------------------------------
A8NF69_BRUMA/682-716--------------------------------------------------------------------------------
A8HPA3_CHLRE/764-796--------------------------------------------------------------------------------
A4VEG7_TETTS/189-228--------------------------------------------------------------------------------
C4J227_MAIZE/277-310--------------------------------------------------------------------------------
Q8L7C7_ARATH/574-607--------------------------------------------------------------------------------

PF11793

Q29B73_DROPS/306-375---------------------QEKH-------------------------------------------------------
Q7PSZ3_ANOGA/292-361---------------------GEDS-------------------------------------------------------
B9DHA4_ARATH/221-298---------------------QQVE-------------------------------------------------------
Q3MUH5_CHICK/301-369---------------------FTKD-------------------------------------------------------
A2EV24_TRIVA/268-336---------------------TEIE-------------------------------------------------------
Q8T913_DROME/307-376---------------------EELR-------------------------------------------------------
A7SDU3_NEMVE/301-369---------------------FSME-------------------------------------------------------
FANCL_MOUSE/303-371---------------------FSMD-------------------------------------------------------
Q17FW9_AEDAE/295-364---------------------DAIQ-------------------------------------------------------
F7DPP4_XENTR/296-363---------------------.SMD-------------------------------------------------------

PF14447

C3QFK8_9BACE/93-147----------------ETRLDHWIT-------------------------------------------------------
Q1CZ12_MYXXD/98-152----------------WLFQSPEQP-------------------------------------------------------
B1W1U9_STRGG/111-165----------------LLFQWPHQP-------------------------------------------------------
D6YAS6_THEBD/123-177----------------VLLQRPEQP-------------------------------------------------------
D2PZ71_KRIFD/120-174----------------RLLQEPEQP-------------------------------------------------------
A6G871_9DELT/134-188----------------HYLQQPDQP-------------------------------------------------------
D0LT74_HALO1/114-168----------------HFLQGPEQP-------------------------------------------------------
A1ZEU9_9BACT/91-145----------------GESIVDHIM-------------------------------------------------------
E2N0S4_CAPSP/122-176----------------YDYYQDEDE-------------------------------------------------------
D3ICY5_9BACT/98-152----------------IDHLITLFV-------------------------------------------------------

PF17121

G2Q0I8_THIHA/15-65----------------------EDM-------------------------------------------------------
B6QL88_PENMQ/14-64----------------------DEV-------------------------------------------------------
E9F746_METAR/26-76----------------------DET-------------------------------------------------------
G4UBK5_NEUT9/12-62----------------------DEM-------------------------------------------------------
L8FV55_PSED2/16-66----------------------DDI-------------------------------------------------------
TFB3_SCHPO/10-60----------------------DEK-------------------------------------------------------
N1QL18_SPHMS/21-71----------------------DDI-------------------------------------------------------

PF03854

Z_LYCVA/28-77---------------------GPLS-------------------------------------------------------
Z_TACVF/36-85---------------------GRYN-------------------------------------------------------
Z_LASSJ/27-76---------------------GPQF-------------------------------------------------------

PF02148

UBP44_MOUSE/26-88---------------C.....MVCN...........................TT..ES..................IWA.
HDAC6_HUMAN/1133-1195---------------C.....GDCG...........................TI..QE..................NWV.
HDAC6_MOUSE/1067-1129---------------C.....KTCG...........................TV..QE..................NWV.
Q7QEG4_ANOGA/63-151---------------C.....SKCADEQQAARGGS......YVNEPLKTPNDVNGDTS..................LWF.
Q7PS30_ANOGA/1015-1078---------------C.....SDCG...........................AE..VE..................NWI.
Q4WPT2_ASPFU/433-495---------------C.....SVCR...........................SE..VN..................LWI.
Q752M3_ASHGO/46-108---------------C.....SECF...........................QINCGS..................SFM.
Q55AP9_DICDI/92-190---------------C.....MVCN............................CFNGR..................LHI.
Q29G58_DROPS/978-1040---------------C.....GECI...........................SR..SE..................NWM.
UBPA_DICDI/191-266---------------CD...IEGCD...........................KV..EN..................LWL.
UBP45_MOUSE/62-139---------------C.....SECL...........................KE..RRFCDGQ.......PVLPADVWL.
UBP22_MOUSE/63-124---------------C.....HVCG...........................IH.LNR..................LHS.
A5DHG6_PICGU/209-286---------------C.....GACD...........................LK..QN..................LWI.
UBP16_HUMAN/48-128---------------C.....QDCKTDNKVKD.............KAEEETEEK..PS..................VWL.
Q6BU87_DEBHA/100-163---------------C.....TECS...........................LNNFHH..................NFI.
Q2LYY5_DROPS/46-106---------------C.....FECG...........................SA.SIQ..................LYA.
A5DPT2_PICGU/308-371---------------C.....ADCA...........................VD..NN..................LWI.
Q29I81_DROPS/77-163---------------C.....SQCQKNQGAASGSG......SGSGDLDCDFEID..ST..................LWL.
Q6BK37_DEBHA/91-153---------------C.....SITL...........................SN..VN..................VYC.
Q0UPU5_PHANO/195-257---------------C.....SVCG...........................ST..EN..................LWI.
A5DCQ5_PICGU/48-110---------------C.....SVSL...........................SK..SN..................VYC.
Q0UZD0_PHANO/143-217---------------C.....SECE...........................LN..EN..................LWL.
A5DJV9_PICGU/79-143---------------C.....SDCL...........................SNGFHQ..................TFV.
A4S4T6_OSTLU/23-87---------------C.....EACG...........................TR..RE..................LWR.
Q581T5_TRYB2/216-278---------------C.....EQCS...........................RT..GD..................PWI.
A7RU34_NEMVE/35-97---------------CS...ISLSH...............................IN..................VYA.
UBP14_ARATH/180-255---------------C.....SKCD...........................KT..EN..................LWL.
Q5KDF6_CRYNJ/396-460---------------C.....SMCS...........................ST..EN..................NWI.
UBP13_MOUSE/209-282---------------C.....ARCD...........................LR..EN..................LWL.
Q4E680_TRYCC/180-252---------------CA...LDGCE...........................CR..LN..................NWM.
Q6H890_ORYSJ/215-277---------------C.....SVCG...........................TS..EN..................LWI.
Q0IG52_AEDAE/51-111---------------C.....YKCG............................GSGPQ..................LYS.
Q1RL25_CIOIN/77-139---------------C.....NVCF...........................TT..ES..................VWA.
Q4DNU2_TRYCC/216-278---------------C.....GECH...........................LL..GD..................PWI.
Q17K27_AEDAE/77-139---------------CS...VSLTR...............................IN..................VYA.
Q5U4Y7_XENTR/62-139---------------C.....TECMKERR..................TQDGELVVPAE..................VWL.
A8BKG1_GIAIC/41-106---------------CA...ASRCN...........................KS.WKS..................LWM.
A7TLQ2_VANPO/49-111---------------CS...VTSSS...............................LN..................VYC.
UBP22_ARATH/56-116---------------C.....SYCS............................VYQKR..................LYI.
A7SXK5_NEMVE/193-255---------------C.....FMCD...........................SR..ES..................LWI.
ETP1_YEAST/301-363---------------C.....ATCG...........................ST..DN..................LWI.
Q7PYV7_ANOGA/248-310---------------C.....MECE...........................GT..EA..................LWI.
A0R482_MYCS2/16-85---------------C.....AECD...........................AA.G.G..................WWVH
UBP10_SCHPO/77-139---------------CS...VSLTN...............................LS..................VYA.
Q5CWL8_CRYPI/185-268---------------C.....ETCG...........................AS..TN..................LWL.
A5DUT2_LODEL/188-265---------------C.....HECE...........................LT..EN..................LWI.
Q5KF82_CRYNJ/109-183---------------C.....SSCD...........................LT..CN..................LWL.
Q1LM26_RALME/20-89---------------C.....EECL...........................NV.G.S..................TWVH
Q0J0M6_ORYSJ/91-194---------------C.....EHCRDDAPRKK............GGGKEKGGKQQQKKKGGGTKGSAAKAKVEKSDMWV.
Q54XH4_DICDI/293-355---------------CS...VSFHN...............................HN..................VYA.
Q5YNV2_NOCFA/18-88---------------C.....VECE...........................AS.G.G..................WWVH
A7S0W3_NEMVE/44-106---------------C.....HGCG............................TYSCR..................LHS.
A7AQH7_BABBO/198-279---------------C.....DRCG...........................AA..TN..................LWL.
UBP33_BOVIN/30-97---------------C.....QDCK............................VRGPN..................LWA.
UBP14_YEAST/192-265---------------C.....SSCD...........................LT..QN..................LWL.
Q00RU3_OSTTA/38-100---------------C.....ETCG...........................TT..SE..................LWA.
A3LW63_PICST/119-183---------------C.....TDCS...........................LNNFHH..................NFT.
A6R3J1_AJECN/127-189---------------CS...VSLSN...............................IN..................VYA.
Q750D2_ASHGO/186-260---------------C.....GDCD...........................LD..RN..................LWL.
A7TTD6_VANPO/191-264---------------C.....SSCN...........................LT..SN..................LWL.
Q4PG60_USTMA/168-244---------------C.....HTCH............................ADMLR..................PFI.
Q29E26_DROPS/206-280---------------C.....EKCD...........................LT..SN..................LWL.
Q4UGQ2_THEAN/189-270---------------C.....EKCN...........................ST..TN..................LWL.
A7TMH2_VANPO/46-108---------------C.....ADCH...........................QINEGT..................NFM.
Q6FIW7_CANGA/46-108---------------C.....STCK...........................EISNGS..................NFL.
Q6CCP5_YARLI/264-326---------------C.....TTCG...........................GT..EN..................TWI.
Q17MD0_AEDAE/958-1020---------------C.....TGCD...........................SA..IE..................NWV.
UBP20_BOVIN/30-97---------------C.....QSCG............................VSGPN..................LWA.
Q7PZW5_ANOGA/51-111---------------C.....YKCG............................SSGPQ..................LYC.
A0DKY3_PARTE/163-237---------------C.....RRCR...........................LS..TN..................LWL.
A8WUG0_CAEBR/958-1020---------------C.....SDCG...........................MS..ND..................LWI.
Q0S9I7_RHOSR/18-87---------------C.....AECD...........................RD.G.G..................WWVH
A4VF07_TETTS/119-181---------------CS...ISLAN...............................LN..................VYA.
Q38FD4_TRYB2/284-346---------------C.....NACG...........................TC..QD..................LWS.
EPT1_SCHPO/262-324---------------C.....TVCC...........................YD..KD..................LWI.
E9AE92_LEIMA/178-250---------------CS...VEMCG...........................CN..VN..................NWM.
Q59XT8_CANAL/147-211---------------C.....HQCH...........................LNNFGN..................SMI.
Q59ZS6_CANAL/28-90---------------CS...QTLSS...............................TN..................VYA.
A4IA95_LEIIN/261-323---------------C.....EACA...........................KA..GD..................PWI.
A2E0J2_TRIVA/180-241---------------C......TCG...........................EN..NN..................LWI.
Q6CIL3_KLULA/270-332---------------C.....LECG...........................ET..NN..................LWI.
A0CMR2_PARTE/34-96---------------CS...VTLSN...............................LN..................VYV.
Q751A3_ASHGO/268-330---------------C.....DVCG...........................SS..EN..................LWV.
Q6CJH1_KLULA/186-259---------------C.....NDCG...........................LT..SN..................LWL.
Q4PHW5_USTMA/186-260---------------C.....GKCE...........................LT..SN..................LWL.
A7E4F0_SCLS1/490-552---------------C.....SICD...........................CT..DD..................LWI.
A6WAE2_KINRD/21-93---------------C.....ADCE...........................VATPKG..................WWFH
Q17BE1_AEDAE/54-115---------------C.....AECS............................G..KD..................NWM.
A2F507_TRIVA/163-237---------------C.....SSCE...........................LE..NN..................LWL.
A7EYW2_SCLS1/175-249---------------C.....SLCD...........................LK..EN..................LWL.
A4S2V3_OSTLU/208-270---------------C.....ATCG...........................KD..HD..................LWV.
Q8IBN0_PLAF7/903-965---------------C.....KNCN...........................NV..DD..................IWL.
A5DYC5_LODEL/240-300---------------C.....TDCG...........................NSQFQE..................VLI.
Q4DD96_TRYCC/275-337---------------C.....YTCG...........................SC..SD..................LWT.
A4H369_LEIBR/325-387---------------C.....KVCG...........................TY..ED..................LWV.
A8B354_GIAIC/176-251---------------C.....ASCD...........................VS..NN..................LWL.
A5KC57_PLAVS/612-674---------------C.....RHCS...........................NV..DD..................VWL.
Q6BIP0_DEBHA/187-264---------------C.....AQCD...........................LK..EN..................LWI.
A6W560_KINRD/15-87---------------C.....ADCE...........................AAEPRG..................WWFH
Q4UFF9_THEAN/163-225---------------CS...ITLSN...............................VH..................VYA.
Q16V37_AEDAE/32-100---------------C.....TECD............................ANGPN..................LWI.
Q55EJ1_DICDI/941-1003---------------C.....TDCH...........................YT..HP..................LFL.
Q4Y3J9_PLACH/9-71---------------C.....KNCN...........................NI..DD..................LWL.
Q7Q848_ANOGA/57-120---------------A.....AKCS...........................IS..KD..................SWM.
Q9W4C3_DROME/70-164---------------C.....SQCQKLGKTAGSAAGAGASEGAVGPGGNPVTFEFDNT..................LWL.
A0BHH7_PARTE/29-97---------------CDNAKRQQCE.............................SDIE..................KWL.
Q4P7C0_USTMA/495-557---------------C.....AVCE...........................TQ..QD..................LWV.
A7REZ3_NEMVE/173-246---------------C.....ALCD...........................KT..DN..................LWL.
Q23RF9_TETTS/272-336---------------C.....HQCS...........................ESDLEG..................LWL.
Q4PGR6_USTMA/158-220---------------CS...VSLSN...............................IN..................VYA.
Q0SGQ5_RHOSR/26-95---------------C.....EGCL...........................AL..GT..................RWEH
A3LWP4_PICST/64-126---------------CS...VTLSN...............................TN..................VYC.
A7AU59_BABBO/59-121---------------CS...ITLSN...............................KH..................VYA.
Q4YCK5_PLABA/187-270---------------C.....AVCK...........................SK..KN..................LWL.
A1SM61_NOCSJ/18-87---------------C.....MECE...........................AT.G.G..................WWVH
A8XIA6_CAEBR/53-115---------------C.....DECD...........................NC..NK..................SLM.
Q1DFK0_MYXXD/21-90---------------C.....EECL...........................AM.G.A..................SWVH
Q5KKZ9_CRYNJ/100-162---------------CS...KSLSN...............................IN..................VYA.
A6W9F1_KINRD/23-92---------------C.....EDCL...........................RA.G.G..................QWVH
UBP1_ARATH/56-151---------------C.....GECNERVHVKRGSRWG..ASNRRDWYSSSDQNCARNA..................IWL.
Q582Q1_TRYB2/178-250---------------CV...VAGCG...........................CQ..TD..................NWM.
A0C6J0_PARTE/90-152---------------C.....VQCG...........................DA..SE..................NWV.
Q8SSA5_ENCCU/124-196---------------C.....NLCD...........................VK..TR..................LWV.
Q1MTK1_DANRE/26-88---------------C.....VDCD...........................TT..ES..................VWA.
Q01AE9_OSTTA/20-100---------------C.....EETG...........................ES..GN..................LWV.
Q2UMH5_ASPOR/176-250---------------C.....SMCD...........................LK..EN..................LWL.
B1AY15_MOUSE/192-253---------------C.....QICS............................THKNR..................LHS.
Q5ALK2_CANAL/329-392---------------C.....MECD...........................ET..EN..................LWI.
P91502_CAEEL/185-266---------------CE...VEGCG...........................LN..DN..................LWL.
UBP8_SCHPO/38-99---------------C.....STCKR.........................INKRSIR......................
SIR2A_DICDI/34-96---------------C.....HACN...........................DE..SE..................NWI.
A7RQL5_NEMVE/37-99---------------C.....ETCA...........................NV..GE..................NWL.
Q8IR38_DROME/1014-1076---------------C.....SVCG...........................ST..GE..................NWV.
A7H950_ANADF/23-92---------------C.....EECL...........................ES.G.D..................AWVH
Q6CEB0_YARLI/174-247---------------C.....AQCD...........................LK..EN..................LWL.
A4S4P2_OSTLU/20-82---------------CA...VSLSP...............................VH..................VYA.
Q55C68_DICDI/441-503---------------C.....STCQ...........................ST..ES..................LWI.
A3LTF5_PICST/186-263---------------C.....AECE...........................LT..EN..................LWI.
Q5KEY2_CRYNJ/82-153---------------C.....HTCK............................TPLSR..................PWA.
Q6CNA2_KLULA/57-121---------------CS...VTLSR...............................SN..................VYC.
Q6CU80_KLULA/45-107---------------C.....MDCG...........................EISCGS..................TFI.
UBP14_SCHPO/174-248---------------C.....SKCD...........................LA..EN..................LWM.
UBP16_DANRE/48-129---------------C.....QDCE...........................QDKPEEKQILEDQ....TDGESPAVWM.
Q6FRA4_CANGA/200-273---------------C.....SSCE...........................LT..QN..................LWI.
Q6C622_YARLI/29-91---------------CS...VSLSP...............................TN..................VYC.
D7TC41_VITVI/207-266---------------C.....FVCG...........................TS..EN..................LWV.
E5KGE0_ARATH/225-284---------------C.....SICG...........................KT..EN..................VWA.
E7QIK7_YEASZ/46-105---------------C.....GTCH...........................EINSGA..................TFM.
F0V7F7_NEOCL/86-147---------------C.....CICL...........................SN..QH..................VYA.
F4IHD8_ARATH/60-118---------------C.....SRCQ...........................NP..VE..................NWL.
F6SBG8_CIOIN/199-271---------------C.....CKCD...........................LT..SN..................LWL.
F6V8N9_CIOIN/219-278---------------C.....MVCG...........................SV..ED..................LWI.
F6WLJ5_XENTR/1088-1148---------------C.....AQCA...........................SE..LE..................NWV.
F7AYQ7_CALJA/29-106---------------C.....SVCR...........................SN..KS..................PWV.
F7DP39_XENTR/198-270---------------C.....SVCD...........................LR..EN..................LWL.
F7DQH6_XENTR/29-90---------------C.....VDCN...........................TT..ES..................VWA.
F8W4B7_DANRE/999-1059---------------C.....EECG...........................GE..AE..................NWI.
G1PW17_MYOLU/357-416---------------C.....FECG...........................VQ..EN..................LWI.
G4LXM5_SCHMA/205-277---------------C.....AKCD...........................LR..DN..................LWM.
G4VF40_SCHMA/27-88---------------C.....NNCH...........................TT..ES..................VWA.
H0Y8J5_HUMAN/29-105---------------C.....SECLK.........................ER....RFYDGQ.......LVLTSDIWL.
H2PJ11_PONAB/26-87---------------C.....LECA...........................TT..ES..................VWA.
H3C8M1_TETNG/1048-1107---------------C.....QDCG...........................SE..AE..................NWI.
H3CSL1_TETNG/29-108---------------C.....SVCR...........................SN..KS..................PWI.
H3DDM2_TETNG/196-268---------------C.....QKCE...........................MR..EN..................LWL.
H3DNW7_TETNG/48-132---------------C.....QDCR...........................NEEKKEGTSTCMQQGCGEEQETPGLWM.
I1PQ93_ORYGL/50-114---------------C.....SPCSS........................PTSS.SSR..................LYA.
I1QNV7_ORYGL/121-182---------------C.....SISL...........................SN..LN..................VYA.
Q22MQ4_TETTS/55-117---------------C.....SNCE...........................NV..GE..................NWF.

PF17034

M7NP39_PNEMU/806-922--------------------------------------------------------------------------------
B6JVZ6_SCHJY/505-623--------------------------------------------------------------------------------
YAG1_SCHPO/778-905--------------------------------------------------------------------------------

PF17120

YDSB_SCHPO/783-844-------------------VTSLKK-------------------------------------------------------
Q5A887_CANAL/1361-1417-------------------RQLLKY-------------------------------------------------------
WDR59_YEAST/1092-1147-------------------KFLARN-------------------------------------------------------
WDR59_SCHPO/1259-1318-------------------LVPRMS-------------------------------------------------------
Q750L2_ASHGO/1067-1122-------------------SAITHS-------------------------------------------------------
C4QVL2_PICPG/1135-1192-------------------SLRQRM-------------------------------------------------------
D5G7T3_TUBMM/1215-1272-------------------RQITMT-------------------------------------------------------
Q6CGJ6_YARLI/1169-1225-------------------PNNNKE-------------------------------------------------------
Q0UK84_PHANO/1304-1360-------------------PEPIYS-------------------------------------------------------

PF00097

PML_HUMAN/57-91--------------------------------------------------------------------------------
H2Q4Y2_PANTR/381-419--------------------------------------------------------------------------------
413R_IIV6/148-195--------------------------------------------------------------------------------
A33_PLEWA/163-202--------------------------------------------------------------------------------
RING1_HUMAN/48-87--------------------------------------------------------------------------------
BRE1_CAEEL/785-823--------------------------------------------------------------------------------
D0Z760_DROME/263-301--------------------------------------------------------------------------------
GOLI_DROME/303-343--------------------------------------------------------------------------------
F7DCK3_MACMU/16-56--------------------------------------------------------------------------------
NHL1_CAEEL/43-83--------------------------------------------------------------------------------
F6T905_MACMU/18-56--------------------------------------------------------------------------------
E1JH51_DROME/35-73--------------------------------------------------------------------------------
BRCA1_HUMAN/24-64--------------------------------------------------------------------------------
H2Q2Y1_PANTR/16-54--------------------------------------------------------------------------------
TR30A_MOUSE/15-58--------------------------------------------------------------------------------
RAD18_YEAST/28-65--------------------------------------------------------------------------------
YNN1_CAEEL/8-45--------------------------------------------------------------------------------
RAG1_CHICK/289-327--------------------------------------------------------------------------------
G2W9C0_YEASK/537-580--------------------------------------------------------------------------------
H0GK06_SACCK/914-960--------------------------------------------------------------------------------
PEX2_CRIGR/243-282--------------------------------------------------------------------------------
ESAG8_TRYBB/10-45--------------------------------------------------------------------------------
G8HBH2_HHV1/116-156--------------------------------------------------------------------------------
ICP0_BHV1J/13-51--------------------------------------------------------------------------------
ICP0_EHV1B/8-46--------------------------------------------------------------------------------
ICP0_SUHVF/46-84--------------------------------------------------------------------------------
IE61_VZVD/19-57--------------------------------------------------------------------------------
PE38_NPVAC/86-138--------------------------------------------------------------------------------
PE38_NPVOP/39-91--------------------------------------------------------------------------------
A0A023ZC77_YEASX/206-249--------------------------------------------------------------------------------
TRAF2_MOUSE/34-72--------------------------------------------------------------------------------
RAD5_SCHPO/877-922--------------------------------------------------------------------------------
A0A023ZDG1_YEASX/179-223--------------------------------------------------------------------------------
VCG3_NPVAC/8-62--------------------------------------------------------------------------------
VIE2_NPVOP/207-254--------------------------------------------------------------------------------

PF02891

Q6BIU5_DEBHA/323-372-------------------------------------------------------------------------------I
Q7QJ47_ANOGA/609-658-------------------------------------------------------------------------------V
Q4P867_USTMA/363-412-------------------------------------------------------------------------------M
Q2U9J1_ASPOR/299-348-------------------------------------------------------------------------------M
Q6FLD3_CANGA/338-387-------------------------------------------------------------------------------M
Q6CY92_KLULA/302-351-------------------------------------------------------------------------------M
SIZ1_YEAST/357-406-------------------------------------------------------------------------------M
SIZ2_YEAST/334-383-------------------------------------------------------------------------------L
Q6FUK3_CANGA/339-388-------------------------------------------------------------------------------I
PLI1_SCHPO/301-350-------------------------------------------------------------------------------I
Q6C4V7_YARLI/350-399-------------------------------------------------------------------------------L
Q7KNF5_DROME/321-370-------------------------------------------------------------------------------V
Q5VRS8_ORYSJ/318-367-------------------------------------------------------------------------------V
Q7JR52_DROME/714-763-------------------------------------------------------------------------------I
Q54UZ6_DICDI/63-112-------------------------------------------------------------------------------E
Q6BFZ0_PARTE/785-836-------------------------------------------------------------------------------V
Q555X5_DICDI/473-522-------------------------------------------------------------------------------L
Q54V57_DICDI/820-869-------------------------------------------------------------------------------I
SIZ1_ARATH/359-408-------------------------------------------------------------------------------V
Q4D897_TRYCC/311-360-------------------------------------------------------------------------------V
Q38DR7_TRYB2/457-506-------------------------------------------------------------------------------I
Q4E4T0_TRYCC/410-459-------------------------------------------------------------------------------I
E9AFM2_LEIMA/500-549-------------------------------------------------------------------------------I
Q586F5_TRYB2/424-473-------------------------------------------------------------------------------V
Q4CSC6_TRYCC/405-454-------------------------------------------------------------------------------V
Q4Q6T7_LEIMA/259-308-------------------------------------------------------------------------------V
Q4XYF2_PLACH/379-432-------------------------------------------------------------------------------I
Q5CG66_CRYHO/405-458-------------------------------------------------------------------------------L
Q4N5M9_THEPA/234-287-------------------------------------------------------------------------------M
F6W032_CIOIN/264-312-------------------------------------------------------------------------------L
F8W4G0_DANRE/271-319-------------------------------------------------------------------------------V
I3IVZ2_ORENI/628-676-------------------------------------------------------------------------------V
U9W851_NEUCR/331-379-------------------------------------------------------------------------------L

PF15227

F7CME7_ORNAN/11-52--------------------------------------------------------------------------------
RFPL3_HUMAN/40-81--------------------------------------------------------------------------------
F7F323_ORNAN/11-48--------------------------------------------------------------------------------
G7PI48_MACFA/23-64--------------------------------------------------------------------------------
G3VAS7_SARHA/17-57--------------------------------------------------------------------------------
G3UB63_LOXAF/16-60--------------------------------------------------------------------------------
F6Q3T5_HORSE/11-52--------------------------------------------------------------------------------
H0XJT9_OTOGA/23-64--------------------------------------------------------------------------------
H9KWF0_CALJA/16-56--------------------------------------------------------------------------------
D6RAS2_HUMAN/16-56--------------------------------------------------------------------------------
H3CZE1_TETNG/15-54--------------------------------------------------------------------------------

PF05290

IE0_NPVLD/108-250LRAMRAMSRFEHNVFVFLPYCKRLRALVELFRHDYCCQSTVAGCARALDETIADAQRHLLVVRSMSERAAVMLVFSDWVR
Q287C0_NPVAS/99-239IEHLKSQPKFQYNMFIFLPYIRQLRIINDLFANDYCCTAIVKFNANALAALCEEGDKYLHVIKLMKERMHLINVFTNP.K
I3XMH6_NPVMB/93-233IGHLNNQPKFQYNMYIFLPYVRQLRQINTLFLNDYCCSKIVKSNGAALDTLIAHCDKYLHVIASMNERMQLINVFTEP.K
Q0N487_9ABAC/128-269LLFVVQQEMYVHNVYIFLPYLRQLKQMLSNFVNDYCCSSVVQKCIQSVDSLMQRSTKYLEAIKFISDRLLVMNVFDDSIK
Q8QL66_9ABAC/93-233IGHLNNQPKFQYNMYIFLPYVRQLRQINTLFINDYCCSKIVKSNSAALDLLIAHCDKYLHVIASMNERMQLINVFTEP.K
Q0ILB1_NPVLS/143-285MENLYQIELYKLNYFVFIPYLKQLLAILNLFVNDACCKKYTRIAKDILEVSLKRSQEQLDCVQRITKTVQVMNVFLET.P
O10614_9ABAC/1-141MNFSDDEVNYVKPKVYFFTLLKYLNKILKLFQYDKCCAKLTKQLQAQLNTLLTQSADSCKHIHAINRQSQVLTVFLEN.P
Q462F6_9ABAC/132-272LQHVYRMPKFEYSTYVFMPYLKQIRKIIILFVNDFCCKKLVENYLITLDLMITNSLKLLETIEMINKRIDVMNVFLDR.R
Q8V5X4_9ABAC/135-275MNFSDDEVNYVKQKFIFLPYLKYLNKILKLFQYDKCCAKLTKQLQAQLNTLLTQSADSCKHIHAINRQSQVLTVFLEN.P
Q77KA3_9ABAC/135-275MNFSDDEVNYVKQKFIFLPYLKYLNKILKLFQYDKCCAKLTKQLQAQLNTLLTQSADSCKHIHAINRQSQVLTVFLEN.P
Q4KT70_9ABAC/161-301LQHVNRMSKFEYSMYVFMPYLKQIRKTIILFVNDFCCKKLVENYLLTLDAMIADSLKLLETIQMINKRVDVMNVFLDR.P
Q9IBQ9_9ABAC/99-239LEHLKSQPKFQYNMYIFMPYVKQIMVINDMFKNDFCCTAIVKTNSNALRELCERGEKYMHVIKLMNERMQIINVFTNP.K
A1YJD2_NPVSF/92-232IQNLNTQPKFQYNMYIFIPYIKQIRVINNMFVNDFCCSAIVKSNSVTLNDLYDRSEKYLHIIKLMNERMQLINVFTDP.K

PF12861

Q4WAI0_ASPFU/1-85-----------------------------------MKVTI-----KEWNAVATWRWDMPE.................D--
APC11_HUMAN/1-84-----------------------------------MKVKI-----KCWNGVATWLW.VAN.................D--
APC11_YEAST/1-102-----------------------------------MKVKI-----NEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDE--
Q5ACJ8_CANAL/1-91-----------------------------------MKVEI-----VEWKSYCTWHWDLASSD............GYVD--
APC11_SCHPO/1-85-----------------------------------MKVKI-----LRYHAIANWTWDTPK.................D--

PF08746

A2DRZ2_TRIVA/175-215--------------------------------------------------------------------------------
A7RM35_NEMVE/182-221--------------------------------------------------------------------------------
A7TJ64_VANPO/273-317--------------------------------------------------------------------------------
A8NFT1_COPC7/192-235--------------------------------------------------------------------------------
A8Q9P4_MALGO/157-197--------------------------------------------------------------------------------
A9TA79_PHYPA/196-239--------------------------------------------------------------------------------
B0CS87_LACBS/198-238--------------------------------------------------------------------------------
B0WPT4_CULQU/189-227--------------------------------------------------------------------------------
B0X5P6_CULQU/189-227--------------------------------------------------------------------------------
B2ASI6_PODAN/330-372--------------------------------------------------------------------------------
B3S2D3_TRIAD/163-203--------------------------------------------------------------------------------
B4GJ15_DROPE/181-219--------------------------------------------------------------------------------
B4HXW1_DROSE/184-222--------------------------------------------------------------------------------
B4LRG0_DROVI/184-222--------------------------------------------------------------------------------
B4MZ26_DROWI/184-222--------------------------------------------------------------------------------
B8NLA5_ASPFN/240-282--------------------------------------------------------------------------------
B9S6N4_RICCO/202-245--------------------------------------------------------------------------------
C4R0J5_PICPG/188-226--------------------------------------------------------------------------------
C4Y0S7_CLAL4/188-228--------------------------------------------------------------------------------
C5DCF6_LACTC/239-278--------------------------------------------------------------------------------
C5FGQ6_ARTOC/230-272--------------------------------------------------------------------------------
C6H5E2_AJECH/232-274--------------------------------------------------------------------------------
C7Z4L2_NECH7/227-269--------------------------------------------------------------------------------
C9SAU4_VERA1/243-283--------------------------------------------------------------------------------
D5G6C2_TUBMM/218-260--------------------------------------------------------------------------------
D7KGS3_ARALL/199-241--------------------------------------------------------------------------------
D7T1H8_VITVI/201-244--------------------------------------------------------------------------------
E0VUH9_PEDHC/177-217--------------------------------------------------------------------------------
E2ADT0_CAMFO/175-215--------------------------------------------------------------------------------
E3KXJ8_PUCGT/208-248--------------------------------------------------------------------------------
E3QA06_COLGM/234-276--------------------------------------------------------------------------------
E3RD04_PYRTT/237-281--------------------------------------------------------------------------------
E5A835_LEPMJ/260-304--------------------------------------------------------------------------------
E7KRF6_YEASL/106-159--------------------------------------------------------------------------------
E9CEP6_CAPO3/191-233--------------------------------------------------------------------------------
E9DEJ9_COCPS/231-273--------------------------------------------------------------------------------
E9ENE5_METAR/234-276--------------------------------------------------------------------------------
E9QJ95_DANRE/182-224--------------------------------------------------------------------------------
F0X8L7_GROCL/292-339--------------------------------------------------------------------------------
F4RKD7_MELLP/196-236--------------------------------------------------------------------------------
F7CBY5_XENTR/185-225--------------------------------------------------------------------------------
F9X440_MYCGM/235-278--------------------------------------------------------------------------------
G0RLM8_HYPJQ/225-267--------------------------------------------------------------------------------
G0S8A9_CHATD/237-279--------------------------------------------------------------------------------
G0SXD4_RHOG2/246-284--------------------------------------------------------------------------------
G0V5G7_NAUCC/285-341--------------------------------------------------------------------------------
G0W7Y8_NAUDC/281-337--------------------------------------------------------------------------------
G1N4R2_MELGA/191-231--------------------------------------------------------------------------------
G2RDX4_THITE/264-306--------------------------------------------------------------------------------
G2Y935_BOTF4/224-266--------------------------------------------------------------------------------
G3JDU4_CORMM/230-272--------------------------------------------------------------------------------
G3TL09_LOXAF/195-235--------------------------------------------------------------------------------
G4MZL2_MAGO7/234-276--------------------------------------------------------------------------------
G4UI54_NEUT9/253-296--------------------------------------------------------------------------------
G8C139_TETPH/290-341--------------------------------------------------------------------------------
G8YT41_PICSO/212-254--------------------------------------------------------------------------------
G8ZVJ6_TORDC/249-291--------------------------------------------------------------------------------
H0ZGS9_TAEGU/185-225--------------------------------------------------------------------------------
H2ATC7_KAZAF/250-298--------------------------------------------------------------------------------
H2UQ13_TAKRU/181-223--------------------------------------------------------------------------------
H2Z292_CIOSA/51-92--------------------------------------------------------------------------------
H6C926_EXODN/231-273--------------------------------------------------------------------------------
H9G7S4_ANOCA/180-220--------------------------------------------------------------------------------
I1HF27_BRADI/97-140--------------------------------------------------------------------------------
I1RYV1_GIBZE/227-269--------------------------------------------------------------------------------
I2H1A9_TETBL/266-313--------------------------------------------------------------------------------
I6NCS4_ERECY/251-302--------------------------------------------------------------------------------
J3P4X2_GAGT3/365-407--------------------------------------------------------------------------------
J4G7D8_FIBRA/180-220--------------------------------------------------------------------------------
J7S9R2_KAZNA/316-366--------------------------------------------------------------------------------
J9JWF5_ACYPI/161-201--------------------------------------------------------------------------------
K0K9Q2_WICCF/200-243--------------------------------------------------------------------------------
K1PRA0_CRAGI/211-250--------------------------------------------------------------------------------
K1XLK9_MARBU/225-268--------------------------------------------------------------------------------
K3YCH6_SETIT/181-223--------------------------------------------------------------------------------
K4ASI7_SOLLC/199-242--------------------------------------------------------------------------------
K7IS45_NASVI/176-216--------------------------------------------------------------------------------
K7N1S4_SOYBN/203-246--------------------------------------------------------------------------------
L0PCM3_PNEJ8/182-224--------------------------------------------------------------------------------
L8FQD9_PSED2/223-265--------------------------------------------------------------------------------
M2M890_BAUCO/233-276--------------------------------------------------------------------------------
M2ZXM0_MYCFI/230-273--------------------------------------------------------------------------------
M3AWI4_SPHMS/273-316--------------------------------------------------------------------------------
M3ZX46_XIPMA/185-227--------------------------------------------------------------------------------
M7SB58_EUTLA/232-274--------------------------------------------------------------------------------
N1JBI4_BLUG1/208-250--------------------------------------------------------------------------------
N1PJ33_MYCP1/222-264--------------------------------------------------------------------------------
Q0V1K7_PHANO/240-284--------------------------------------------------------------------------------
Q16PA4_AEDAE/195-233--------------------------------------------------------------------------------
Q5KC98_CRYNJ/208-250--------------------------------------------------------------------------------
Q6BH78_DEBHA/201-243--------------------------------------------------------------------------------
Q6FPU2_CANGA/325-366--------------------------------------------------------------------------------
Q759D3_ASHGO/220-269--------------------------------------------------------------------------------
Q84VP9_ARATH/198-240--------------------------------------------------------------------------------
R0ICN5_SETT2/247-291--------------------------------------------------------------------------------
R4XEW3_TAPDE/194-234--------------------------------------------------------------------------------
R7Z157_CONA1/233-275--------------------------------------------------------------------------------
R8BUZ2_TOGMI/229-271--------------------------------------------------------------------------------
S2KEM5_MUCC1/188-230--------------------------------------------------------------------------------
S3DCP8_GLAL2/235-277--------------------------------------------------------------------------------
S7Z8E9_PENO1/233-275--------------------------------------------------------------------------------
S8AAF4_DACHA/241-282--------------------------------------------------------------------------------
S8ETB8_FOMPI/193-233--------------------------------------------------------------------------------
T0LMX3_COLGC/228-270--------------------------------------------------------------------------------
T1HB85_RHOPR/177-218--------------------------------------------------------------------------------
T5AC96_OPHSC/228-270--------------------------------------------------------------------------------
U1GD89_ENDPU/227-269--------------------------------------------------------------------------------
U4LU38_PYROM/236-278--------------------------------------------------------------------------------
U9UNJ2_RHIID/187-229--------------------------------------------------------------------------------
V2XVD5_MONRO/138-178--------------------------------------------------------------------------------
W1NTZ6_AMBTC/198-241--------------------------------------------------------------------------------
W4W1Q3_ATTCE/175-215--------------------------------------------------------------------------------
W5K8T9_ASTMX/185-227--------------------------------------------------------------------------------
W5M8R4_LEPOC/185-227--------------------------------------------------------------------------------

PF12678

A0A023ZGL5_YEASX/34-111-----------------------------------RFEIK.....KWTAVAFWSWDI...................AV..
A0A024VDG3_PLAFA/12-97-----------------------------------IFKIH.....KWSAVAAWSWDI...................SV..
A0BNG9_PARTE/27-95-----------------------------------..........QLN................................
A0BUN1_PARTE/8-82-----------------------------------VFEIK.....KWNAVALWSWDI...................KV..
A0C6P3_PARTE/2-74-----------------------------------KVKIK.....EWNAVTSWIWSL...................DT..
A0CRQ4_PARTE/563-614-----------------------------------.VQIN....................................EV..
A0CXI2_PARTE/6-80-----------------------------------RIEIK.....SWQAVGVWRWNI...................KD..
A0E3I0_PARTE/8-82-----------------------------------RFEIK.....KWYPVAFWSWSL...................KV..
A2DPC7_TRIVA/9-85-----------------------------------RVHIK.....SWKCVASWKWDVA..................EE..
A2EBP4_TRIVA/31-105-----------------------------------MFVVY.....KFNPVYLSSWQG...................KQ..
A2F6A1_TRIVA/32-105-----------------------------------ELKIT.....KISAVYQEISSR...................VT..
A2G8G7_TRIVA/18-94-----------------------------------QFVIT.....KWNGVALWSWEM...................EQ..
A4HBJ7_LEIBR/17-93-----------------------------------RFQLK.....KWNAVALWSWDI...................QV..
A4HD23_LEIBR/320-386-----------------------------------.....................I...................EA..
A4IBZ0_LEIIN/2-77-----------------------------------DVKIK.....SVHLVAKWMWDC...................KG..
A5DCW0_PICGU/2-83-----------------------------------KVKIL.....DWHAVTFWHWDF..............ATHGYSD..
A5DTG2_LODEL/2-97-----------------------------------KVDIV.....EWRTYCTWHWDLSLSTSAQDRDNNNNNNNSFIE..
A5DXH4_LODEL/16-93-----------------------------------RKKIR.....KETSNTNFVTDI...................QI..
A6R079_AJECN/38-115-----------------------------------RFEVK.....KWNAVALWAWDI...................VV..
A7AP36_BABBO/9-89-----------------------------------RFTIK.....KWSAVALWNWKI...................AV..
A7SJC0_NEMVE/2-82-----------------------------------KVKIKRFHSGRWVGVATWKWMA...................ND..
A8B646_GIAIC/2-74-----------------------------------SLRTL.....AVNKFVAWRFAS...................EL..
A8B6R7_GIAIC/8-81-----------------------------------SITIK.....NWYAVVEWSYNI...................DE..
A8IW77_CHLRE/4-77-----------------------------------EIKVK.....KWHAVAAWTWE....................AD..
A8IY22_CHLRE/31-109-----------------------------------RFEIK.....KWNAVAMWSWAI...................CT..
A8JET6_CHLRE/7-50-----------------------------------.............................................
A8N0N8_COPC7/2-87-----------------------------------KVTVK.....HWHAVACWKWDTGKDEDSDDDE.........EG..
A8N6L4_COPC7/304-377-----------------------------------RYPNA.....DEQELAAM.......................SD..
A8PY40_BRUMA/296-372-----------------------------------KMTVL.....KWNVAASWKWMA...................GD..
A8QC12_BRUMA/38-114-----------------------------------KLSVR.....KWSVAAKWRWSI...................GE..
A8XSV6_CAEBR/49-127-----------------------------------KIAVK.....KLHVCGEWKWLQG..................GE..
A9BL34_HEMAN/3-87-----------------------------------KFKIL.....QIFAKKISNTST...................SF..
A9CRI2_ENTBH/166-228-----------------------------------IAGIS.....IINEVLEKEFRD...................NC..
A9CRX2_ENTBH/10-81-----------------------------------EIKIT.....KVYPRYAWKWDI...................RE..
A9NQM0_PICSI/2-76-----------------------------------KVKVI.....QWHAVASWTWDA...................KD..
A9UVJ0_MONBE/24-79-----------------------------------LPSIS....................................TD..
B0E7N2_ENTDS/8-84-----------------------------------KFEIK.....KWNAVALWSWDL...................QV..
B0WC49_CULQU/7-82-----------------------------------LSAVK.....HERAIDISSRVL...................SP..
B0YBV4_ASPFC/2-78-----------------------------------KVTIK.....EWNAVATWRWDMP..................ED..
B1Q490_CAPCH/131-183-----------------------------------..........PIIKSAE........................EE..
B3MLX9_DROAN/2-77-----------------------------------KVTIK.....SWTGVATWRWIA...................ND..
B3MSM2_DROAN/116-193-----------------------------------RFVVK.....EWSAVALWSWDV...................VV..
B3S5N1_TRIAD/19-93-----------------------------------LFTIK.....KWNAVALWSWDV...................TC..
B3S6B3_TRIAD/2-78-----------------------------------KVTIQ.....KWIGVASWKWQV...................ND..
B4GAP5_DROPE/24-103-----------------------------------MFTLK.....KWNAVAMWSWDV...................EC..
B4GB82_DROPE/15-92-----------------------------------RFVVK.....KWNAMATWRWDV...................DV..
B4J4L7_DROGR/24-101-----------------------------------RFILK.....KWHGVALWEWDI...................VV..
B4JD08_DROGR/72-149-----------------------------------RFTVK.....RWNSVAMWAWDI...................AV..
B4KMP2_DROMO/60-137-----------------------------------RFNVK.....KWNGVALWSWDI...................VV..
B4MAF8_DROVI/18-97-----------------------------------RFEIM.....NWNANALWSWDV...................QV..
B4N5A6_DROWI/37-113-----------------------------------RFAVK.....KWVVHGLWSWDV...................AV..
B4Q1V1_DROYA/51-127-----------------------------------RFVVK.....KWVARAIWAWDV...................AV..
B5LW90_9PHYC/103-160-----------------------------------..QVL.....RFKAIRVRKLD........................
B5Y4F3_PHATC/2-77-----------------------------------RVRIQ.....RYHGVAQWSWNA...................ND..
B6AI27_CRYMR/3-79-----------------------------------RVKIK.....KMWMIGYWNWLC...................GD..
B6JY13_SCHJY/2-78-----------------------------------RVKIK.....RYHAVANWTWTTP..................KD..
B6KLE6_TOXGO/35-116-----------------------------------RVRVR.....HVHFVGGWRWA....................GVPP
B6T5Q7_MAIZE/36-113-----------------------------------RFEIK.....KWNAVALWAWDI...................VV..
B6TT56_MAIZE/96-155-----------------------------------..........K..............................HD..
B8AHA4_ORYSI/80-146-----------------------------------SFG.......RDMALVEY.......................VE..
B8CBK3_THAPS/2-79-----------------------------------RLKIR.....RFHAVAKWTWNV...................GDDE
B8NSG4_ASPFN/33-110-----------------------------------KFEVK.....KWNAVALWAWDI...................VV..
B9RR99_RICCO/33-120-----------------------------------CFEIK.....KWNAVALWAWDI...................VV..
C1FDA6_MICSR/7-84-----------------------------------NFEVK.....RWNAVAVWSWSI...................CT..
C3YBG7_BRAFL/2-77-----------------------------------KVTVK.....SWTAVASWRWMA...................ND..
C4M0Z6_ENTHI/2-74-----------------------------------TVEII.....EWNEISSWSWDL...................LE..
C4R7W2_PICPG/31-108-----------------------------------RFEVK.....KWTAVAFWSWNM...................VV..
C4Y7N4_CLAL4/28-105-----------------------------------RFEVK.....KWTAVAFWSWDI...................VV..
C5DND5_LACTC/2-88-----------------------------------QLEFK.....KVYPVFSWSWDIPGDDDADRE....IG....DE..
C5DPN9_ZYGRC/2-90-----------------------------------KVDIE.....EVHSVFAWTWHIPKDNKDGS.....LEADD.DD..
C5K1R4_AJEDS/2-70-----------------------------------KVTLR.....EWNAVATWRWDMP..................ED..
C5KEJ9_PERM5/205-277-----------------------------------KIKVK.....KIHAVAAWRWKT...................AE..
C5L7F2_PERM5/103-179-----------------------------------..........EVMALVAASGPP.......................
C5MAB2_CANTT/26-103-----------------------------------KFEVK.....KWTAVAFWSWDM...................QI..
C5MI91_CANTT/2-89-----------------------------------KVKIL.....EWKGYSTWHWDLS.STAPQ.......SGYGYIE..
D0A1J4_TRYB9/20-96-----------------------------------RFVLK.....RWNAVALWSWDI...................EV..
M1K555_ENCCN/6-81-----------------------------------IIKLK.....KWNLVALWSLDM...................KI..
M9N2K6_ASHG1/2-92-----------------------------------QLQIN.....NIQCVASWYWDVPKELKRDSPV...YEDED.EE..
N1P7W6_YEASC/2-95-----------------------------------KVKIN.....EVHSVFAWSWHIPSTSDEDAANNDPIGNDE.DE..
P91404_CAEEL/29-102-----------------------------------PFVLK.....KWNALAVWAWDV...................EC..
Q0UH23_PHANO/15-71-----------------------------------..........RFLEGL.........................EV..
Q0V540_PHANO/2-78-----------------------------------KVTIR.....EWNAVAAWRWDMP..................DD..
Q109A4_ORYSJ/114-161-----------------------------------..PLV........................................
Q4D6X3_TRYCC/78-155-----------------------------------.IPVI.....MKEALLFFAYEH...................PVIG
Q4DH47_TRYCC/2-77-----------------------------------DVKIK.....GAHLVGRWLWDC...................RN..
Q4DSB2_TRYCC/227-286-----------------------------------..........QCMQDVPWP......................KE..
Q4N1R0_THEPA/9-91-----------------------------------RFVVK.....RWSAVAVWSWRM...................SV..
Q4QAH0_LEIMA/28-104-----------------------------------LFTVE.....EFYPVYFSAWER...................ET..
Q4QEV4_LEIMA/27-93-----------------------------------YVTAR.....SVPRETLL.......................MT..
Q4X393_PLACH/3-78-----------------------------------KVTVK.....KIHAVARWKWIGSS.................ID..
APC11_DICDI/2-77-----------------------------------KVTIK....SIWNTVSAWHWDV...................NE..
Q5DEI6_SCHJA/20-95-----------------------------------KLKIN.....HWFAVSSWKWCT...................ND..
Q5KCK0_CRYNJ/284-358-----------------------------------..........LYPDATEEELERS..................GD..
Q5M7C0_XENLA/2-77-----------------------------------KVRLK.....CWNGVASWQWVA...................ND..
UBC4_MIMIV/57-128-----------------------------------ELTMD.....VFKLVD....TT...................EN..
Q60DI8_ORYSJ/222-276-----------------------------------..........RAAAAA.........................EEQG
Q6BXZ1_DEBHA/2-90-----------------------------------KVNIV.....EWHGVTTWHWKLAPSEGSE.......NDSAYVD..
Q6C1E3_YARLI/2-78-----------------------------------KVKIK.....QWNAVSVWQWDVP..................ND..
Q6CE99_YARLI/30-106-----------------------------------RLEVK.....KWSAVAFWSWDI...................QV..
Q6CP68_KLULA/23-100-----------------------------------NFEIT.....KWTAVAFWSWDI...................DV..
Q6FQP6_CANGA/2-91-----------------------------------RIELT.....EVHGVFNWVWDIPKNEDRLDE....SMADE.DE..
Q6VFS1_9POXV/2-73-----------------------------------SVTIR.....FLSPVIQWSLPA...................AN..
Q7Q443_ANOGA/2-76-----------------------------------PLSFS.....GWMGVAVWKWLA...................ND..
Q86ZL9_PODAS/2-80-----------------------------------KVKIK.....RWNAVATWRWDLP..................ED..
Q9AVZ5_GUITH/3-87-----------------------------------RFKII.....NISINGEISLYY...................EN..
Q9FI95_ARATH/72-139-----------------------------------....M.....CPREIAAMIKDI...................VVDV
APC11_ARATH/2-77-----------------------------------KVKIL.....RWHAVASWTWDA...................QD..
Q9SVW0_ARATH/122-199-----------------------------------LVEVE.....VVLETLYSDWLRV..................ND..
APC11_SCHPO/2-78-----------------------------------KVKIL.....RYHAIANWTWDTP..................KD..

PF05883

Q91ES1_GVCPM/3-133-----------------------------------FITTQTE..CKAAAELIIREQFH..T-------------------
Q8B9J7_NPVR1/1-134-----------------------------------MFCTFCLKDRNYYMFKLFKDYWPTCA-------------------

PF14445

A7I4Q2_METB6/12-67--------------------------------------------------------------------------DPHSFA
Q2FKZ9_METHJ/22-77--------------------------------------------------------------------------DPESFS
L0HAQ6_METFS/42-97--------------------------------------------------------------------------DPRTFS

PF14634

E1C7D9_CHICK/6-48--------------------------------------------------------------------------------
E1FZW0_LOALO/6-50--------------------------------------------------------------------------------
E9GEC8_DAPPU/12-57--------------------------------------------------------------------------------
Q4QGD1_LEIMA/6-46--------------------------------------------------------------------------------
B0CSV8_LACBS/15-58--------------------------------------------------------------------------------
C4LXP1_ENTHI/207-247--------------------------------------------------------------------------------
B6IIE6_CAEBR/17-60--------------------------------------------------------------------------------
A8XMJ0_CAEBR/116-156--------------------------------------------------------------------------------
F2U6V3_SALR5/10-49--------------------------------------------------------------------------------
Q6FWV3_CANGA/12-51--------------------------------------------------------------------------------
A8XFZ9_CAEBR/5-45--------------------------------------------------------------------------------
Q9U3L0_CAEEL/5-45--------------------------------------------------------------------------------
Q8MYP1_CAEEL/5-51--------------------------------------------------------------------------------
A8XFY8_CAEBR/5-44--------------------------------------------------------------------------------
Q16ES6_AEDAE/8-51--------------------------------------------------------------------------------
E4XQK4_OIKDI/224-267--------------------------------------------------------------------------------
B5DY13_DROPS/25-73--------------------------------------------------------------------------------
A1CTV8_ASPCL/49-97--------------------------------------------------------------------------------
B3MST8_DROAN/9-53--------------------------------------------------------------------------------
E7F2P1_DANRE/6-47--------------------------------------------------------------------------------
B4GYG5_DROPE/27-77--------------------------------------------------------------------------------
C7Z911_NECH7/207-256--------------------------------------------------------------------------------
Q55DW8_DICDI/7-51--------------------------------------------------------------------------------
E3MCJ8_CAERE/17-68--------------------------------------------------------------------------------
B4NUQ8_DROSI/5-49--------------------------------------------------------------------------------
A8WJ97_CAEBR/8-50--------------------------------------------------------------------------------
E3NG56_CAERE/267-315--------------------------------------------------------------------------------
B3MUY6_DROAN/5-49--------------------------------------------------------------------------------
C5FK34_ARTOC/10-58--------------------------------------------------------------------------------
F1A3H2_DICPU/5-56--------------------------------------------------------------------------------
B0CWP3_LACBS/5-50--------------------------------------------------------------------------------
E3MBM8_CAERE/6-48--------------------------------------------------------------------------------
B6HJ02_PENCW/608-658--------------------------------------------------------------------------------
RN212_HUMAN/6-47--------------------------------------------------------------------------------
B4JEQ5_DROGR/5-48--------------------------------------------------------------------------------
Q6CWK7_KLULA/13-58--------------------------------------------------------------------------------
Y4613_DICDI/8-64--------------------------------------------------------------------------------
C3ZHE7_BRAFL/303-344--------------------------------------------------------------------------------
Q5TWF6_ANOGA/8-51--------------------------------------------------------------------------------
B4G2B4_DROPE/5-49--------------------------------------------------------------------------------
E9G342_DAPPU/16-63--------------------------------------------------------------------------------
Y121_OSHVF/52-106--------------------------------------------------------------------------------
P90905_CAEEL/5-44--------------------------------------------------------------------------------
A4RWU3_OSTLU/1786-1830--------------------------------------------------------------------------------
E0VQH4_PEDHC/5-47--------------------------------------------------------------------------------
B6ILY2_CAEBR/8-50--------------------------------------------------------------------------------
D8LDC0_ECTSI/14-64--------------------------------------------------------------------------------
E3LVG7_CAERE/5-45--------------------------------------------------------------------------------
E0VJY0_PEDHC/20-59--------------------------------------------------------------------------------
E1ZX87_CAMFO/5-46--------------------------------------------------------------------------------
F0VKM3_NEOCL/116-156--------------------------------------------------------------------------------
E1ZVC6_CAMFO/5-46--------------------------------------------------------------------------------
C3ZRQ6_BRAFL/6-49--------------------------------------------------------------------------------
C0NRS3_AJECG/10-58--------------------------------------------------------------------------------
E3MKE8_CAERE/9-49--------------------------------------------------------------------------------
B3MWG3_DROAN/9-59--------------------------------------------------------------------------------
E7A0E3_SPORE/17-84--------------------------------------------------------------------------------
B4MS95_DROWI/5-47--------------------------------------------------------------------------------
E3M3L5_CAERE/7-49--------------------------------------------------------------------------------
B4NE87_DROWI/45-107--------------------------------------------------------------------------------
F0ZEE6_DICPU/7-49--------------------------------------------------------------------------------
A8NYK0_COPC7/174-219--------------------------------------------------------------------------------
B0WY05_CULQU/8-51--------------------------------------------------------------------------------
C5L4C0_PERM5/179-224--------------------------------------------------------------------------------
E9CYQ8_COCPS/10-58--------------------------------------------------------------------------------
E9GED0_DAPPU/15-62--------------------------------------------------------------------------------
A2DG01_TRIVA/10-55--------------------------------------------------------------------------------
B4K9R1_DROMO/5-50--------------------------------------------------------------------------------
A8BW81_GIAIC/271-327--------------------------------------------------------------------------------
E9II61_SOLIN/7-48--------------------------------------------------------------------------------
D2VGX0_NAEGR/14-66--------------------------------------------------------------------------------
D8MAK7_BLAHO/6-49--------------------------------------------------------------------------------
Q8IMM9_DROME/5-49--------------------------------------------------------------------------------
Q16T22_AEDAE/9-56--------------------------------------------------------------------------------
A8PV49_BRUMA/15-64--------------------------------------------------------------------------------
C3YFB0_BRAFL/6-47--------------------------------------------------------------------------------
E3NG58_CAERE/270-317--------------------------------------------------------------------------------
D3B891_POLPA/3-46--------------------------------------------------------------------------------
D8QBA2_SCHCM/9-50--------------------------------------------------------------------------------
D6WWZ3_TRICA/13-55--------------------------------------------------------------------------------
Q4W4Z4_CAEEL/5-47--------------------------------------------------------------------------------
E3NQU5_CAERE/8-49--------------------------------------------------------------------------------
E4WWU4_OIKDI/70-127--------------------------------------------------------------------------------
H3D646_TETNG/10-52--------------------------------------------------------------------------------
TIF1B_RAT/66-124--------------------------------------------------------------------------------
O76908_DROME/20-70--------------------------------------------------------------------------------
RNF37_MOUSE/483-527--------------------------------------------------------------------------------
Q9VV48_DROME/13-53--------------------------------------------------------------------------------
U1M783_ASCSU/6-47--------------------------------------------------------------------------------
U1M983_ASCSU/6-49--------------------------------------------------------------------------------

PF14446

D4KCM5_9FIRM/3-56-----------------------------------------------------------------------------KYY
R5L268_9CLOT/4-54-----------------------------------------------------------------------------.YE
R6CMF0_9FIRM/3-56-----------------------------------------------------------------------------KYI
R6IX88_9FIRM/4-55-----------------------------------------------------------------------------..N
R6DEQ5_9CLOT/4-58-----------------------------------------------------------------------------NYK
R7F8M1_9FIRM/6-57-----------------------------------------------------------------------------..V
D4L8K9_9FIRM/2-55-----------------------------------------------------------------------------EFT
E6UEW2_RUMA7/3-55-----------------------------------------------------------------------------NYT
R6T2N4_9FIRM/3-56-----------------------------------------------------------------------------NYT
R6P286_9CLOT/3-55-----------------------------------------------------------------------------DYT
D4LCL0_RUMC1/2-55-----------------------------------------------------------------------------DYT
R6Y3H6_9FIRM/3-56-----------------------------------------------------------------------------DYT
R6EIU8_9FIRM/2-57-----------------------------------------------------------------------------NKF
R5MJ60_9FIRM/2-55-----------------------------------------------------------------------------DYR
R6Q9T1_9FIRM/3-56-----------------------------------------------------------------------------SYK
R7MRY6_9FIRM/2-55-----------------------------------------------------------------------------NYI
R6UCX1_9CLOT/2-55-----------------------------------------------------------------------------NYY
R6MU41_9FIRM/2-55-----------------------------------------------------------------------------DFY
R6NKW4_9CLOT/2-55-----------------------------------------------------------------------------KYN
R5UYS9_9FIRM/3-56-----------------------------------------------------------------------------DYT
R7KZN4_9FIRM/3-56-----------------------------------------------------------------------------NYT
R6DV58_9FIRM/2-55-----------------------------------------------------------------------------NYT
B5IDB3_ACIB4/1537-1587-----------------------------------------------------------------------------NKE
D4JWG4_9FIRM/4-56-----------------------------------------------------------------------------QFK
D2R359_PIRSD/219-268-----------------------------------------------------------------------------.DV
R5GQ20_9FIRM/3-56-----------------------------------------------------------------------------RFD
R7NJ19_9FIRM/2-55-----------------------------------------------------------------------------DYI
R6QRD2_9CLOT/2-55-----------------------------------------------------------------------------DYT

PF04641

A4S0T5_OSTLU/8-288------GGGDGGATGAESRSAYLEMYAWNGGTTFSRKKESLGGFVRYSAQSTVRDRD.EAEEDLARWFTCALTEEPLESG
A0DTQ1_PARTE/1-244------MGNDGGSF..AERAELVKL.........KKPEKRV...............E.SLLVAKQRAQFCSLTKEKLRK.
Q2UTA9_ASPOR/1-287------MGNDGGSI..PTRRELVRE.........AARAPSTAQ...........VKEAQRELQEHYWKTCPLSHKPLMR.
Q5SMK9_ORYSJ/84-335------GGGDGGATGAESRDCYLSMY.......LAKKPDKA...............D.PNEARLSRFTCCALSGEPLAA.
Q29KQ8_DROPS/1-280------MGCDGGTI..PKRDELVRV.........KQKPEQK...............D.KDAEREFRWLHCSLTQQRLQE.
Q17G64_AEDAE/1-281------MGCDGGTI..PRRDELVRL.........KKKPEQK...............D.KDAERQFRWKHCNLTQERLRQ.
Q014F8_OSTTA/47-326------GGGDGGSTGAESRSSYLEMYA....DPARRRKESLGGFVRYSTQSTVMDRD.VGEEDLARWFTCALTEEPLERG
A8XXP4_CAEBR/1-289------MGADGGTI..PKRCELVQQ.........KKKKEKL...............D.KHVKNATKWRNCQLTQLPLKK.
Q5K8P8_CRYNJ/1-310------MGADGGSI..PDRRDLVKT.........KGKTEQA...............D.KESLK.ALFFLCALSKKPLKK.
RTF2_DICDI/1-266------MGLDGGTI..PTRCELVKT.........KKKEVKV..............FD.KDQVDFGKWFLCALAQDTLSE.
Q23KD1_TETTS/1-249------MGNDGGSF..QTRTDLVKE.........KPKEVKI...............D.NTILAKFRARLCTLSKQRLKK.
RTF2_CHICK/1-289------MGCDGGTI..PKRHELVKG.........PRKAVKV...............D.KTAELVARWYYCTLSQEKLCR.
A7RZE6_NEMVE/1-286------MGCDGGTI..PTRDELVRM.........KKAPEKV...............E.KNYELNAKWFHCAISQEQLHS.
Q4P3H8_USTMA/1-280------MGNDGGAI..AKRDELVRT.........KATFEKV...............D.PELLRQSLWTVCSLSRQPLEP.
RTF2_SCHPO/1-239------MGNDGGSL..PTRNELVKEP.......GKVPPLDI...............DFKRSVKSSQFSQCAITDEPLYP.
F1QSV2_DANRE/1-293------MGCDGGTI..PKRHELVKG.........PKKVEKV...............D.KNAELAAKWKYCALSQEKLKR.
Q5TPA4_ANOGA/1-281------MGCDGGTI..PRRDELVRL.........KKKPEQK...............D.KDAERQFRWKHCALTQQRLQQ.
Q6NQ98_ARATH/84-337------GGGDGGATGAESRDCYLNMY.......AEKKPDKV...............D.PNEQRLSKWLNCALSNEPLAE.
RTF2_MOUSE/1-290------MGCDGGTI..PKRHELVKG.........PKKVEKV...............D.KDAELVAQWNYCTLSQEILRR.

PF13639

A0BF07_PARTE/123-166--------------------------------------------------------P-----------------------
A0BG06_PARTE/408-453--------------------------------------------------------G-----------------------
A0BG98_PARTE/975-1016--------------------------------------------------------T-----------------------
A0BHL9_PARTE/487-532--------------------------------------------------------M-----------------------
A0BKW2_PARTE/102-153--------------------------------------------------------G-----------------------
A0BW53_PARTE/242-287--------------------------------------------------------Q-----------------------
A0C065_PARTE/257-302--------------------------------------------------------I-----------------------
A0C4D0_PARTE/209-254--------------------------------------------------------Q-----------------------
A0CC15_PARTE/285-336--------------------------------------------------------P-----------------------
A0CM36_PARTE/389-430--------------------------------------------------------K-----------------------
A0CMQ6_PARTE/171-216--------------------------------------------------------E-----------------------
A0CP51_PARTE/704-750--------------------------------------------------------D-----------------------
A0CTC1_PARTE/316-359--------------------------------------------------------D-----------------------
A0CVE7_PARTE/479-524--------------------------------------------------------N-----------------------
A0CVK3_PARTE/111-153--------------------------------------------------------A-----------------------
A0D344_PARTE/265-310--------------------------------------------------------P-----------------------
A0D773_PARTE/151-197--------------------------------------------------------N-----------------------
A0D889_PARTE/141-192--------------------------------------------------------D-----------------------
A0DDR1_PARTE/271-312--------------------------------------------------------D-----------------------
A0DHK4_PARTE/374-426--------------------------------------------------------E-----------------------
A0DLJ4_PARTE/449-494--------------------------------------------------------G-----------------------
A0DTZ7_PARTE/342-387--------------------------------------------------------D-----------------------
A0DUT5_PARTE/364-405--------------------------------------------------------I-----------------------
A0DVR9_PARTE/275-320--------------------------------------------------------Q-----------------------
A0DWH0_PARTE/255-300--------------------------------------------------------N-----------------------
A0DZE8_PARTE/222-272--------------------------------------------------------I-----------------------
A0E6R8_PARTE/294-335--------------------------------------------------------K-----------------------
A0EGS5_PARTE/476-521--------------------------------------------------------Q-----------------------
A0ZT53_LOTJA/1119-1163--------------------------------------------------------M-----------------------
A2DXP7_TRIVA/48-97--------------------------------------------------------R-----------------------
A2E1G5_TRIVA/136-189--------------------------------------------------------D-----------------------
A2EWG4_TRIVA/521-562--------------------------------------------------------G-----------------------
A2F2I1_TRIVA/177-218--------------------------------------------------------N-----------------------
A2F4T4_TRIVA/6-48--------------------------------------------------------N-----------------------
A2G8K6_TRIVA/148-194--------------------------------------------------------E-----------------------
A2QWH0_ASPNC/192-240--------------------------------------------------------T-----------------------
A2XFQ9_ORYSI/404-448--------------------------------------------------------A-----------------------
A2YBE8_ORYSI/128-172--------------------------------------------------------V-----------------------
A2YDS6_ORYSI/84-128--------------------------------------------------------T-----------------------
A2ZFP9_ORYSI/149-193--------------------------------------------------------D-----------------------
A4D9H5_ASPFU/43-87--------------------------------------------------------L-----------------------
A4H5E8_LEIBR/271-315--------------------------------------------------------D-----------------------
A4H8Y3_LEIBR/904-958--------------------------------------------------------D-----------------------
A4S5N6_OSTLU/207-250--------------------------------------------------------T-----------------------
A4VB05_PLADU/14-67--------------------------------------------------------P-----------------------
A5D8N9_XENLA/125-178--------------------------------------------------------G-----------------------
A5DL42_PICGU/2-46--------------------------------------------------------E-----------------------
A5K888_PLAVS/225-277--------------------------------------------------------G-----------------------
A5KBD4_PLAVS/682-726--------------------------------------------------------P-----------------------
A5PMH4_DANRE/54-103--------------------------------------------------------L-----------------------
A7ASN3_BABBO/245-286--------------------------------------------------------R-----------------------
A7AUR5_BABBO/208-253--------------------------------------------------------H-----------------------
A7EE40_SCLS1/61-111--------------------------------------------------------D-----------------------
A7EV89_SCLS1/213-255--------------------------------------------------------D-----------------------
A7F7S5_SCLS1/79-114--------------------------------------------------------I-----------------------
A7RGT9_NEMVE/558-606--------------------------------------------------------G-----------------------
A7SE55_NEMVE/265-306--------------------------------------------------------L-----------------------
A7SV59_NEMVE/17-58--------------------------------------------------------K-----------------------
A7TEL4_VANPO/240-287--------------------------------------------------------N-----------------------
A7TNA9_VANPO/500-546--------------------------------------------------------E-----------------------
A8B1R0_GIAIC/198-239--------------------------------------------------------A-----------------------
A8BCR1_GIAIC/396-436--------------------------------------------------------Q-----------------------
A8BH29_GIAIC/526-564--------------------------------------------------------P-----------------------
A8BH48_GIAIC/167-206--------------------------------------------------------D-----------------------
A8BR45_GIAIC/756-798--------------------------------------------------------E-----------------------
A8HMI3_CHLRE/54-99--------------------------------------------------------E-----------------------
A8J2E4_CHLRE/27-70--------------------------------------------------------Q-----------------------
A8JD11_CHLRE/140-191--------------------------------------------------------E-----------------------
A8NNS3_COPC7/317-363--------------------------------------------------------G-----------------------
A8NRQ3_COPC7/82-124--------------------------------------------------------L-----------------------
A8PS53_MALGO/218-260--------------------------------------------------------P-----------------------
A8PW40_BRUMA/176-220--------------------------------------------------------Q-----------------------
A8WK80_CAEBR/59-103--------------------------------------------------------T-----------------------
HRDL1_CAEBR/348-388--------------------------------------------------------D-----------------------
A8X639_CAEBR/2090-2134--------------------------------------------------------D-----------------------
A8XCH4_CAEBR/391-437--------------------------------------------------------L-----------------------
A8XFE0_CAEBR/1272-1316--------------------------------------------------------S-----------------------
A8Y153_CAEBR/199-244--------------------------------------------------------I-----------------------
A8Y154_CAEBR/1055-1099--------------------------------------------------------P-----------------------
A8Y4G8_CAEBR/15-58--------------------------------------------------------A-----------------------
A9RKN3_PHYPA/1033-1075--------------------------------------------------------G-----------------------
A9S3J6_PHYPA/626-663--------------------------------------------------------S-----------------------
A9STB2_PHYPA/163-207--------------------------------------------------------S-----------------------
A9TAN5_PHYPA/110-151--------------------------------------------------------G-----------------------
A9UVL1_MONBE/57-98--------------------------------------------------------A-----------------------
A9UWA5_MONBE/146-191--------------------------------------------------------R-----------------------
A9V032_MONBE/60-114--------------------------------------------------------T-----------------------
A9V1C8_MONBE/81-124--------------------------------------------------------G-----------------------
A9V8U2_MONBE/25-68--------------------------------------------------------D-----------------------
B0D6B0_LACBS/8-50--------------------------------------------------------S-----------------------
B0D6D7_LACBS/8-54--------------------------------------------------------S-----------------------
B0DBT2_LACBS/509-550--------------------------------------------------------G-----------------------
B0DLM0_LACBS/1750-1799--------------------------------------------------------V-----------------------
B0E636_ENTDS/119-164--------------------------------------------------------G-----------------------
B0E6C2_ENTDS/10-50--------------------------------------------------------I-----------------------
B0W7P9_CULQU/1910-1963--------------------------------------------------------D-----------------------
B0WRM7_CULQU/22-63--------------------------------------------------------F-----------------------
B0WT52_CULQU/69-111--------------------------------------------------------S-----------------------
B0X025_CULQU/326-366--------------------------------------------------------F-----------------------
B1WBK9_XENTR/241-282--------------------------------------------------------P-----------------------
B2ARF0_PODAN/381-422--------------------------------------------------------P-----------------------
B2ARP1_PODAN/97-144--------------------------------------------------------D-----------------------
B2ATJ0_PODAN/192-247--------------------------------------------------------G-----------------------
B2VXK1_PYRTR/232-281--------------------------------------------------------V-----------------------
B2W0J7_PYRTR/26-77--------------------------------------------------------G-----------------------
B2W6U0_PYRTR/225-272--------------------------------------------------------S-----------------------
B2WHH7_PYRTR/224-275--------------------------------------------------------S-----------------------
B3RQ77_TRIAD/1191-1241--------------------------------------------------------D-----------------------
B3RXT9_TRIAD/16-56--------------------------------------------------------M-----------------------
B3RZR8_TRIAD/243-283--------------------------------------------------------I-----------------------
B3S2U3_TRIAD/573-620--------------------------------------------------------N-----------------------
B3S4V7_TRIAD/23-70--------------------------------------------------------P-----------------------
B4G588_DROPE/157-200--------------------------------------------------------Y-----------------------
B4GK50_DROPE/46-88--------------------------------------------------------A-----------------------
B4LI97_DROVI/204-249--------------------------------------------------------K-----------------------
B4LJF6_DROVI/121-187--------------------------------------------------------G-----------------------
B4LSA1_DROVI/268-313--------------------------------------------------------S-----------------------
B4MF50_DROVI/89-132--------------------------------------------------------R-----------------------
B4NYZ6_DROYA/170-215--------------------------------------------------------N-----------------------
B4PPX7_DROYA/57-102--------------------------------------------------------L-----------------------
B4USZ3_OTOGA/276-327--------------------------------------------------------Q-----------------------
B5YMI0_THAPS/374-418--------------------------------------------------------H-----------------------
B6H8U3_PENCW/360-405--------------------------------------------------------T-----------------------
B6JXH2_SCHJY/1111-1151--------------------------------------------------------Q-----------------------
B6K5J5_SCHJY/275-319--------------------------------------------------------C-----------------------
B6T6Y6_MAIZE/65-116--------------------------------------------------------Y-----------------------
B6T816_MAIZE/60-112--------------------------------------------------------R-----------------------
B6TXY1_MAIZE/327-371--------------------------------------------------------D-----------------------
B6U0S2_MAIZE/37-80--------------------------------------------------------K-----------------------
B7FGU2_MEDTR/198-241--------------------------------------------------------Q-----------------------
B7FVA2_PHATC/266-311--------------------------------------------------------R-----------------------
B7GBA9_PHATC/105-148--------------------------------------------------------R-----------------------
B7PCM1_IXOSC/51-101--------------------------------------------------------P-----------------------
B7PWV8_IXOSC/130-171--------------------------------------------------------F-----------------------
B7Q3P5_IXOSC/283-324--------------------------------------------------------Q-----------------------
B8AEZ2_ORYSI/71-115--------------------------------------------------------A-----------------------
B8AX25_ORYSI/203-251--------------------------------------------------------A-----------------------
B8C1B2_THAPS/134-178--------------------------------------------------------N-----------------------
B8C4N5_THAPS/695-742--------------------------------------------------------D-----------------------
B8LC63_THAPS/230-299--------------------------------------------------------I-----------------------
B8LCB2_THAPS/741-776--------------------------------------------------------D-----------------------
B8LCG6_THAPS/254-299--------------------------------------------------------N-----------------------
B8LQL1_PICSI/324-367--------------------------------------------------------E-----------------------
B8N2D7_ASPFN/129-176--------------------------------------------------------Q-----------------------
B9GM69_POPTR/210-253--------------------------------------------------------E-----------------------
B9H8Y6_POPTR/159-207--------------------------------------------------------T-----------------------
B9HCQ3_POPTR/262-307--------------------------------------------------------T-----------------------
B9HGN6_POPTR/520-566--------------------------------------------------------T-----------------------
B9HHT1_POPTR/105-149--------------------------------------------------------S-----------------------
B9HWB4_POPTR/83-127--------------------------------------------------------S-----------------------
B9I3L5_POPTR/156-196--------------------------------------------------------D-----------------------
B9QEB6_TOXGO/881-924--------------------------------------------------------P-----------------------
B9SHS5_RICCO/117-161--------------------------------------------------------G-----------------------
B9T2M7_RICCO/86-129--------------------------------------------------------D-----------------------
B9WBW7_CANDC/13-58--------------------------------------------------------E-----------------------
C0KYN2_ANACO/196-241--------------------------------------------------------H-----------------------
C0PD20_MAIZE/330-373--------------------------------------------------------A-----------------------
C0PT72_PICSI/214-257--------------------------------------------------------E-----------------------
C0S9I5_PARBP/209-259--------------------------------------------------------G-----------------------
C1C051_9MAXI/322-363--------------------------------------------------------S-----------------------
C1DZS1_MICSR/829-879--------------------------------------------------------A-----------------------
C1E1T7_MICSR/516-566--------------------------------------------------------L-----------------------
C1E5I3_MICSR/132-177--------------------------------------------------------V-----------------------
C1E6Q1_MICSR/94-150--------------------------------------------------------G-----------------------
C1EDK4_MICSR/193-237--------------------------------------------------------T-----------------------
C1FI85_MICSR/165-215--------------------------------------------------------S-----------------------
C1MTE8_MICPC/954-1004--------------------------------------------------------H-----------------------
C1MUH4_MICPC/1471-1527--------------------------------------------------------F-----------------------
C1MUQ4_MICPC/112-161--------------------------------------------------------G-----------------------
C1MV68_MICPC/95-145--------------------------------------------------------L-----------------------
C3XY44_BRAFL/375-426--------------------------------------------------------D-----------------------
C3YXH7_BRAFL/703-746--------------------------------------------------------E-----------------------
C3Z5V4_BRAFL/318-359--------------------------------------------------------R-----------------------
C4M8G3_ENTHI/51-96--------------------------------------------------------N-----------------------
C4M9D6_ENTHI/170-211--------------------------------------------------------N-----------------------
C4R4A1_PICPG/846-896--------------------------------------------------------T-----------------------
C4R4D1_PICPG/565-609--------------------------------------------------------A-----------------------
C4V6V3_NOSCE/233-278--------------------------------------------------------T-----------------------
C5DE05_LACTC/81-127--------------------------------------------------------D-----------------------
C5DQ62_ZYGRC/933-982--------------------------------------------------------L-----------------------
C5DQP9_ZYGRC/218-263--------------------------------------------------------S-----------------------
C5FMR2_ARTOC/431-479--------------------------------------------------------R-----------------------
C5FZ42_ARTOC/29-80--------------------------------------------------------L-----------------------
C5L005_PERM5/734-784--------------------------------------------------------V-----------------------
C5L6A3_PERM5/71-116--------------------------------------------------------E-----------------------
C5LDG0_PERM5/227-269--------------------------------------------------------S-----------------------
C5LHH0_PERM5/127-190--------------------------------------------------------D-----------------------
C5LPT2_PERM5/115-168--------------------------------------------------------A-----------------------
C5LUR4_PERM5/224-279--------------------------------------------------------A-----------------------
C5LZ25_PERM5/899-952--------------------------------------------------------R-----------------------
C5M287_CANTT/514-558--------------------------------------------------------S-----------------------
C5WTI2_SORBI/179-223--------------------------------------------------------L-----------------------
C5XUQ0_SORBI/467-510--------------------------------------------------------M-----------------------
C5Y3B4_SORBI/199-242--------------------------------------------------------E-----------------------
C5Y4M0_SORBI/235-278--------------------------------------------------------K-----------------------
C5Y9D9_SORBI/133-172--------------------------------------------------------L-----------------------
C5YBB8_SORBI/126-181--------------------------------------------------------Y-----------------------
C5YEN4_SORBI/144-188--------------------------------------------------------P-----------------------
C5YRP9_SORBI/195-241--------------------------------------------------------T-----------------------
C5YWB0_SORBI/157-202--------------------------------------------------------R-----------------------
C5Z417_SORBI/100-144--------------------------------------------------------A-----------------------
C6LTE2_GIAIB/100-146--------------------------------------------------------D-----------------------
C6LWE8_GIAIB/494-535--------------------------------------------------------N-----------------------
C6T8E1_SOYBN/131-171--------------------------------------------------------E-----------------------
C6TCS9_SOYBN/67-104--------------------------------------------------------L-----------------------
C9SCU3_VERA1/392-436--------------------------------------------------------C-----------------------
C9SGF6_VERA1/34-79--------------------------------------------------------D-----------------------
C9SPL0_VERA1/105-149--------------------------------------------------------F-----------------------
C9ZXJ2_TRYB9/230-274--------------------------------------------------------E-----------------------
D0A6K7_TRYB9/292-336--------------------------------------------------------I-----------------------
D0MUU8_PHYIT/693-736--------------------------------------------------------P-----------------------
D0N2B9_PHYIT/237-277--------------------------------------------------------F-----------------------
D0N7W5_PHYIT/251-294--------------------------------------------------------R-----------------------
D0NAT9_PHYIT/306-357--------------------------------------------------------D-----------------------
D0NBP0_PHYIT/117-157--------------------------------------------------------R-----------------------
D0NFZ0_PHYIT/39-82--------------------------------------------------------A-----------------------
D0NFZ8_PHYIT/358-399--------------------------------------------------------G-----------------------
D0NIU6_PHYIT/169-217--------------------------------------------------------E-----------------------
D0NS47_PHYIT/455-498--------------------------------------------------------K-----------------------
D2JY82_PLEOS/37-92--------------------------------------------------------D-----------------------
D2UYX3_NAEGR/281-324--------------------------------------------------------F-----------------------
D2V0Z7_NAEGR/342-386--------------------------------------------------------E-----------------------
D2V2X6_NAEGR/149-189--------------------------------------------------------N-----------------------
D2VNH8_NAEGR/318-358--------------------------------------------------------L-----------------------
D3B300_POLPA/5-54--------------------------------------------------------F-----------------------
D3BAF5_POLPA/618-671--------------------------------------------------------V-----------------------
D3BBP0_POLPA/337-378--------------------------------------------------------L-----------------------
D3BLH0_POLPA/50-100--------------------------------------------------------S-----------------------
D3KI90_GIAIC/92-137--------------------------------------------------------R-----------------------
M9MV27_ASHG1/1217-1257--------------------------------------------------------F-----------------------
O17099_CAEEL/132-179--------------------------------------------------------I-----------------------
O45195_CAEEL/898-942--------------------------------------------------------K-----------------------
YH73_SCHPO/19-61--------------------------------------------------------R-----------------------
FAP1H_SCHPO/195-247--------------------------------------------------------Y-----------------------
ZFPL1_DANRE/51-101--------------------------------------------------------P-----------------------
Q00Y10_OSTTA/828-872--------------------------------------------------------C-----------------------
Q00ZB3_OSTTA/289-333--------------------------------------------------------S-----------------------
Q00ZM7_OSTTA/560-603--------------------------------------------------------Y-----------------------
Q0UAU3_PHANO/38-88--------------------------------------------------------T-----------------------
Q0URI7_PHANO/311-361--------------------------------------------------------E-----------------------
Q0USC7_PHANO/302-346--------------------------------------------------------N-----------------------
Q16HN5_AEDAE/231-274--------------------------------------------------------L-----------------------
Q16LE4_AEDAE/38-85--------------------------------------------------------F-----------------------
ZFPL1_AEDAE/51-101--------------------------------------------------------S-----------------------
Q177I6_AEDAE/26-69--------------------------------------------------------L-----------------------
Q17E25_AEDAE/57-100--------------------------------------------------------E-----------------------
Q17GJ1_AEDAE/20-61--------------------------------------------------------L-----------------------
Q1JSG2_TOXGO/1199-1239--------------------------------------------------------A-----------------------
Q23CZ8_TETTS/474-517--------------------------------------------------------G-----------------------
Q23H35_TETTS/139-180--------------------------------------------------------Y-----------------------
Q23MB1_TETTS/202-222--------------------------------------------------------N-----------------------
Q23WM6_TETTS/1182-1231--------------------------------------------------------P-----------------------
Q245T2_TETTS/96-139--------------------------------------------------------F-----------------------
Q24E42_TETTS/276-321--------------------------------------------------------H-----------------------
Q2LZF1_DROPS/1026-1072--------------------------------------------------------R-----------------------
Q2QXY7_ORYSJ/142-187--------------------------------------------------------K-----------------------
Q387H5_TRYB2/690-736--------------------------------------------------------G-----------------------
Q38D94_TRYB2/172-228--------------------------------------------------------N-----------------------
Q38D94_TRYB2/462-518--------------------------------------------------------N-----------------------
Q38EC7_TRYB2/138-181--------------------------------------------------------T-----------------------
Q38F27_TRYB2/287-330--------------------------------------------------------P-----------------------
RN183_BOVIN/9-58--------------------------------------------------------P-----------------------
Q4D1E0_TRYCC/568-612--------------------------------------------------------L-----------------------
Q4DLF1_TRYCC/367-427--------------------------------------------------------N-----------------------
Q4E1P7_TRYCC/345-389--------------------------------------------------------D-----------------------
Q4EAJ7_9RICK/17-62--------------------------------------------------------N-----------------------
Q4H3Q5_CIOIN/319-379--------------------------------------------------------H-----------------------
Q4N5E1_THEPA/307-352--------------------------------------------------------F-----------------------
Q4PB72_USTMA/409-453--------------------------------------------------------L-----------------------
Q4PF69_USTMA/533-577--------------------------------------------------------D-----------------------
Q4QA61_LEIMA/537-581--------------------------------------------------------D-----------------------
Q4QDS7_LEIMA/298-339--------------------------------------------------------G-----------------------
Q4SNI8_TETNG/21-71--------------------------------------------------------L-----------------------
Q4YC89_PLABA/106-145--------------------------------------------------------L-----------------------
Q54N05_DICDI/1106-1146--------------------------------------------------------Q-----------------------
Q554L0_DICDI/6-51--------------------------------------------------------N-----------------------
Q557D0_DICDI/28-69--------------------------------------------------------I-----------------------
Q55DX7_DICDI/540-585--------------------------------------------------------V-----------------------
Q5A9Y7_CANAL/298-343--------------------------------------------------------N-----------------------
Q5BXK3_SCHJA/120-169--------------------------------------------------------E-----------------------
Q5C0J5_SCHJA/23-70--------------------------------------------------------S-----------------------
Q5CNZ4_CRYHO/310-355--------------------------------------------------------K-----------------------
Q5CYZ7_CRYPI/1736-1786--------------------------------------------------------D-----------------------
Q5DI39_SCHJA/247-287--------------------------------------------------------E-----------------------
Q5PQ78_XENLA/389-433--------------------------------------------------------K-----------------------
Q5TWM2_ANOGA/26-67--------------------------------------------------------L-----------------------
Q653G4_ORYSJ/321-365--------------------------------------------------------E-----------------------
Q69UB0_ORYSJ/107-151--------------------------------------------------------V-----------------------
Q6C0Q7_YARLI/147-195--------------------------------------------------------Q-----------------------
Q6C4M3_YARLI/513-557--------------------------------------------------------C-----------------------
Q6EU86_ORYSJ/89-133--------------------------------------------------------Q-----------------------
Q6I656_CITLA/31-75--------------------------------------------------------H-----------------------
Q6XLW4_9PHYC/461-505--------------------------------------------------------F-----------------------
Q6ZGW2_ORYSJ/19-63--------------------------------------------------------R-----------------------
Q7RTI8_PLAYO/580-623--------------------------------------------------------E-----------------------
Q7XJ11_ORYSJ/166-210--------------------------------------------------------G-----------------------
RN146_DANRE/40-80--------------------------------------------------------P-----------------------
Q8AYJ3_SQUAC/272-314--------------------------------------------------------P-----------------------
Q8IM37_PLAF7/668-713--------------------------------------------------------L-----------------------
Q8LA43_ARATH/51-104--------------------------------------------------------P-----------------------
Q8LDL6_ARATH/8-53--------------------------------------------------------E-----------------------
Q8QKU6_ESV1K/143-192--------------------------------------------------------S-----------------------
Q8QKY0_ESV1K/85-128--------------------------------------------------------E-----------------------
Q8QNP1_ESV1K/124-173--------------------------------------------------------T-----------------------
UHRF1_MOUSE/711-752--------------------------------------------------------F-----------------------
RNF25_HUMAN/133-202--------------------------------------------------------G-----------------------
Q9AV35_ORYSJ/95-144--------------------------------------------------------P-----------------------
RN186_MOUSE/37-85--------------------------------------------------------L-----------------------
Q9FFG2_ARATH/146-190--------------------------------------------------------N-----------------------
Q9FWA5_ARATH/333-376--------------------------------------------------------N-----------------------
ATL62_ARATH/77-121--------------------------------------------------------I-----------------------
Q9LKA8_ARATH/170-215--------------------------------------------------------S-----------------------
Q9LP87_ARATH/84-127--------------------------------------------------------K-----------------------
Q9N3H6_CAEEL/136-180--------------------------------------------------------A-----------------------
ZFPL1_CAEEL/51-101--------------------------------------------------------P-----------------------
Q9N5Y9_CAEEL/401-444--------------------------------------------------------T-----------------------
Q9NUW5_HUMAN/49-101--------------------------------------------------------S-----------------------
LOFG2_ARATH/317-358--------------------------------------------------------K-----------------------
Q9SH17_ARATH/127-171--------------------------------------------------------E-----------------------
Q9VZK5_DROME/99-144--------------------------------------------------------N-----------------------
S7UTV1_TOXGO/883-924--------------------------------------------------------D-----------------------
S7W9H4_TOXGO/934-978--------------------------------------------------------A-----------------------

PF14835

F1SSQ2_PIG/39-103--------------------------------------------------------------------------LARLEK

PF16685

B5DR75_DROPS/43-115--------------------------------------------------------------------------------
E2ACB4_CAMFO/91-160--------------------------------------------------------------------------------
B4MTK1_DROWI/41-113--------------------------------------------------------------------------------
G1QUV9_NOMLE/42-111--------------------------------------------------------------------------------
B0WV25_CULQU/55-124--------------------------------------------------------------------------------
M4A435_XIPMA/42-111--------------------------------------------------------------------------------
H2MDG1_ORYLA/42-111--------------------------------------------------------------------------------
D6W8B3_TRICA/39-108--------------------------------------------------------------------------------
B4KJL9_DROMO/40-112--------------------------------------------------------------------------------
E9HFH7_DAPPU/39-107--------------------------------------------------------------------------------
A7USF8_ANOGA/37-106--------------------------------------------------------------------------------
A5JPL8_BOMMO/39-108--------------------------------------------------------------------------------
B0V0X0_DANRE/42-111--------------------------------------------------------------------------------
B7QLX1_IXOSC/39-108--------------------------------------------------------------------------------
B4JBU9_DROGR/40-112--------------------------------------------------------------------------------
B4G866_DROPE/40-112--------------------------------------------------------------------------------
B4N486_DROWI/41-113--------------------------------------------------------------------------------

PF13445

Q6BTA8_DEBHA/130-181--------------------------------------------------------------------------------
YGI4_SCHPO/107-147--------------------------------------------------------------------------------
A8Y2J9_CAEBR/26-72--------------------------------------------------------------------------------
A0C1N2_PARTE/16-53--------------------------------------------------------------------------------
A5PLE6_DANRE/15-55--------------------------------------------------------------------------------
Q08C26_DANRE/18-55--------------------------------------------------------------------------------
Q4RGH6_TETNG/15-54--------------------------------------------------------------------------------
A2EG51_TRIVA/44-82--------------------------------------------------------------------------------
A2AGS0_MOUSE/21-63--------------------------------------------------------------------------------
Q5U366_RAT/16-54--------------------------------------------------------------------------------
C3YPJ4_BRAFL/16-59--------------------------------------------------------------------------------
C3Y6I5_BRAFL/16-57--------------------------------------------------------------------------------
C3YRX8_BRAFL/17-56--------------------------------------------------------------------------------
C3Z2Z2_BRAFL/21-58--------------------------------------------------------------------------------
A7S5F1_NEMVE/15-54--------------------------------------------------------------------------------
C3YDN1_BRAFL/18-57--------------------------------------------------------------------------------
C3ZYN2_BRAFL/18-55--------------------------------------------------------------------------------
C3Z055_BRAFL/303-340--------------------------------------------------------------------------------
C3YGP0_BRAFL/19-56--------------------------------------------------------------------------------
C3ZG71_BRAFL/39-82--------------------------------------------------------------------------------
C3XWV1_BRAFL/16-55--------------------------------------------------------------------------------
C3YEJ7_BRAFL/16-53--------------------------------------------------------------------------------
A0EIT1_PARTE/55-96--------------------------------------------------------------------------------
C4YEI1_CANAW/183-231--------------------------------------------------------------------------------
A5KA05_PLAVS/1738-1779--------------------------------------------------------------------------------
Q8SVR1_ENCCU/278-320--------------------------------------------------------------------------------
B6AIC5_CRYMR/509-552--------------------------------------------------------------------------------
A7ARX2_BABBO/898-940--------------------------------------------------------------------------------
Q4N7I4_THEPA/951-993--------------------------------------------------------------------------------
Q24DE5_TETTS/339-381--------------------------------------------------------------------------------
A0BIE5_PARTE/324-364--------------------------------------------------------------------------------
D2VJJ0_NAEGR/335-378--------------------------------------------------------------------------------
C4R3V1_PICPG/327-367--------------------------------------------------------------------------------
D0NTQ2_PHYIT/390-431--------------------------------------------------------------------------------
A0A023ZBH9_YEASX/361-402--------------------------------------------------------------------------------
C5DIC8_LACTC/342-383--------------------------------------------------------------------------------
Q22302_CAEEL/347-396--------------------------------------------------------------------------------
A8WS02_CAEBR/392-441--------------------------------------------------------------------------------
A8NSK9_BRUMA/461-517--------------------------------------------------------------------------------
B0X0I9_CULQU/337-376--------------------------------------------------------------------------------
A7RZE5_NEMVE/333-372--------------------------------------------------------------------------------
C3YJ40_BRAFL/346-385--------------------------------------------------------------------------------
C1C216_9MAXI/350-389--------------------------------------------------------------------------------
B7PXK2_IXOSC/329-368--------------------------------------------------------------------------------
B3ME92_DROAN/382-421--------------------------------------------------------------------------------
B6JYH5_SCHJY/321-362--------------------------------------------------------------------------------
A9VBL7_MONBE/312-352--------------------------------------------------------------------------------
Q6CGJ4_YARLI/332-374--------------------------------------------------------------------------------
A8JF09_CHLRE/87-128--------------------------------------------------------------------------------
A8NFK9_COPC7/331-371--------------------------------------------------------------------------------
C1EG72_MICSR/468-508--------------------------------------------------------------------------------
A9S273_PHYPA/329-370--------------------------------------------------------------------------------
Q9LXC7_ARATH/328-370--------------------------------------------------------------------------------
A2Q1B6_MEDTR/109-150--------------------------------------------------------------------------------
A9RK55_PHYPA/328-369--------------------------------------------------------------------------------
A2YEI9_ORYSI/329-370--------------------------------------------------------------------------------
Q8LA81_ARATH/324-365--------------------------------------------------------------------------------
B9I4M0_POPTR/331-372--------------------------------------------------------------------------------
D3BCK9_POLPA/377-418--------------------------------------------------------------------------------
Q555R9_DICDI/357-398--------------------------------------------------------------------------------
YB83_SCHPO/341-382--------------------------------------------------------------------------------
F5HE07_CRYNB/338-379--------------------------------------------------------------------------------
C7YIK3_NECH7/380-419--------------------------------------------------------------------------------
A1CRL3_ASPCL/356-395--------------------------------------------------------------------------------
Q4PAX6_USTMA/422-462--------------------------------------------------------------------------------
C9SQH7_VERA1/367-406--------------------------------------------------------------------------------
C1M2W1_SCHPM/105-142--------------------------------------------------------------------------------
A0E1J7_PARTE/103-142--------------------------------------------------------------------------------
C4R4E3_PICPG/212-251--------------------------------------------------------------------------------
B9GMV7_POPTR/263-299--------------------------------------------------------------------------------
Q1ENX4_MUSAC/228-264--------------------------------------------------------------------------------
A1DC75_NEOFI/127-164--------------------------------------------------------------------------------
C5FC09_ARTOC/124-161--------------------------------------------------------------------------------
NSE2_XENLA/162-204--------------------------------------------------------------------------------
A0A024R9J6_HUMAN/169-211--------------------------------------------------------------------------------
D3BEB0_POLPA/176-214--------------------------------------------------------------------------------
B0EFQ1_ENTDS/142-180--------------------------------------------------------------------------------

PF17122

M3HI18_CANMX/927-962--------------------------------------------------------------------------------
B6JYV2_SCHJY/783-817--------------------------------------------------------------------------------
PEP5L_SCHPO/780-814--------------------------------------------------------------------------------

PF11789

NSE2_SCHPO/166-220------DEVMVYS..A--------------------------------------------------------TFDN----
Q4WN41_ASPFU/329-400------DEIAIER..E--------------------------------------------------------RISL----
Q6BTN3_DEBHA/217-271------DELEVAG..G--------------------------------------------------------KISL----
Q0CK87_ASPTN/846-915------DDIAIER..E--------------------------------------------------------RISL----
A7URE5_ANOGA/120-176------GDLVMEA..D--------------------------------------------------------VGNM----
Q6FJV5_CANGA/174-230------DDIQIEG..G--------------------------------------------------------KIEL----
Q4UH75_THEAN/120-184------EELQIEELKS--------------------------------------------------------TFSD----
Q4X4I4_PLACH/87-151------DELVVDEEIG--------------------------------------------------------AFPT----
A6R9Q0_AJECN/331-406------DDLAIHS..E--------------------------------------------------------RASL----
Q5CJM4_CRYHO/101-167------QVSVVSR..K--------------------------------------------------------ILPK----
Q17L84_AEDAE/118-173------EEMQMEE..A--------------------------------------------------------IQDM----
NSE2_HUMAN/156-216------EDIIVTQ..S--------------------------------------------------------QTNF----
A2QVT0_ASPNC/323-396------DEIAIQT..E--------------------------------------------------------RISL----
NSE2_YEAST/171-227------DDLQIEG..G--------------------------------------------------------KIEL----
Q7RZA1_NEUCR/281-336------EDLIIER..E--------------------------------------------------------VQDL----
Q0U6V6_PHANO/293-363------DDIVMDK..A--------------------------------------------------------TISI----
Q757R5_ASHGO/117-172------EELKISG..G--------------------------------------------------------TIEL----
Q2GS77_CHAGB/246-301------DDLVVER..E--------------------------------------------------------IIDL----
Q5A2Z8_CANAL/182-236------DELNVSG..G--------------------------------------------------------KISL----
C8VKT8_EMENI/321-393------DDLAIER..E--------------------------------------------------------RISL----
H3DP52_TETNG/148-208------DEITVTQ..S--------------------------------------------------------QVNL----

PF09416

G8XZA4_PICSO/58-206------HACAYCGLHS--------------------------------------------PNS---------VVKC---H
Q582F1_TRYB2/29-174------.SCSYCSEES--------------------------------------------PTC---------LAFC---N
Q4PI26_USTMA/129-280------HACAYCGIFN--------------------------------------------PAC---------VVKC---L
J4G139_FIBRA/92-241------HACSYCGIHS--------------------------------------------PAS---------VVKC---I
C1EH82_MICSR/1-159------HACAYCGIRD--------------------------------------------PAC---------VVKC---V
C5GIH5_AJEDR/88-239------HSCAYCGIHN--------------------------------------------PSS---------VVKC---L
D8LYD6_BLAHO/22-163------.QCDYCKNRT--------------------------------------------GSS---------LVFC---R
S4BGP9_CAPO3/152-303------HACKYCGIHS--------------------------------------------PAS---------VVCC---L
M5E6X4_MALS4/48-199------HACAYCGIDD--------------------------------------------VNC---------VLQC---L
Q5KKH8_CRYNJ/82-233------HACSYCGIHN--------------------------------------------PQC---------VVKC---L
Q6C803_YARLI/59-205------HACVYCGESS--------------------------------------------PAS---------VVRC---L
R4XJ71_TAPDE/75-226------HACNYCGIHN--------------------------------------------PSC---------VVKC---L
E4XAF3_OIKDI/106-256------HACAYCGIHD--------------------------------------------PMY---------VVRC---Q
A8I9D7_CHLRE/1-148------...SYCGIHN--------------------------------------------PSC---------VVKC---L
F4QCN3_DICFS/186-340------HACRYCGLHD--------------------------------------------PLT---------VVRC---S
F0Y1L0_AURAN/48-196------.ACKYCGIRD--------------------------------------------PSA---------VVRC---V
K0KIK8_WICCF/99-247------HACAYCGIHN--------------------------------------------SSS---------VVKC---N
C4LXY5_ENTHI/10-148------.RCWYCGLAD--------------------------------------------KKK---------LIRC---G
F9WSH3_TRYVY/11-155------.SCAYCAESN--------------------------------------------FET---------LLRC---D
Q5A507_CANAL/91-239------HACAYCGIHN--------------------------------------------PNS---------VIKC---N
U6IJB2_HYMMI/107-256------HACAYCGISD--------------------------------------------PAC---------VVRC---N
F2U375_SALR5/211-362------HACKYCGIHD--------------------------------------------PKC---------VVKC---I
C4XY18_CLAL4/89-230------EACSYCSTSD--------------------------------------------PAS---------LARC---G
U1MDU3_ASCSU/84-235------HACRYCGIHD--------------------------------------------PSA---------VAMC---L
A8Q0S3_MALGO/97-248------HACAYCGLAD--------------------------------------------VDC---------VIKC---T
T1KCT3_TETUR/113-264------HACKYCGIHD--------------------------------------------PSC---------VVQC---N
W1Q6Y2_OGAPD/17-164------.ACAYCGISE--------------------------------------------PDS---------LVKC---N
H3E5K6_PRIPA/118-269------HACSYCGVHE--------------------------------------------TAS---------VAQC---S
I1GEP9_AMPQE/99-250------HACKYCGIHD--------------------------------------------PAA---------VVMC---N
D0NH56_PHYIT/117-268------HACAYCGLHD--------------------------------------------PAS---------VVKC---V
B6K5B6_SCHJY/44-195------ESCAYCGLSN--------------------------------------------PSA---------IVKC---L
B3RSL3_TRIAD/118-268------HACSYCGIHD--------------------------------------------PAA---------VVMC---N
G0V783_NAUCC/70-218------HACAYCGVDS--------------------------------------------PTC---------VIKC---N
I1BQX9_RHIO9/91-242------HACKYCGIHS--------------------------------------------PAS---------VVKC---V
A2E7Q0_TRIVA/6-146------.KCQYCGCEA--------------------------------------------EGS---------LAQC---A
D8M826_BLAHO/68-219------.ACCYCRNDD--------------------------------------------VTA---------VAQC---A
D7FN00_ECTSI/154-303------.ACRFCGIHD--------------------------------------------PAC---------VVRC---V
C4R568_PICPG/55-202------HACKYCGVSN--------------------------------------------PRC---------VVRC---D
Q011I9_OSTTA/78-231------HACAYCGISN--------------------------------------------ASC---------VAQC---V
F4P9D9_BATDJ/132-283------HACSYCGIHN--------------------------------------------VST---------VVRC---L
C5KF29_PERM5/152-303------HSCQYCYLSS--------------------------------------------PEC---------VVQC---N
A0C1B9_PARTE/33-175------...SYCLQSD--------------------------------------------VNA---------VAQC---L
S9W8D5_SCHCR/53-203------.CCAYCNVSN--------------------------------------------PNS---------IVKC---L
L0P928_PNEJ8/96-246------.ACSYCGIHT--------------------------------------------PSS---------VLKC---L
J9JMR3_ACYPI/116-266------.ACKYCGIHD--------------------------------------------PGC---------VVMC---N
A5DR11_PICGU/37-185------HACAYCGIHA--------------------------------------------TNC---------VVKC---N
W5BLX3_WHEAT/154-307------HACRYCGIHN--------------------------------------------PAC---------VARC---N
U6I120_ECHMU/100-249------HACAYCGISD--------------------------------------------PAS---------VVLC---T
F0VCC0_NEOCL/202-358------HACSYCGASS--------------------------------------------PEC---------VLKC---C
RENT1_DICDI/182-336------HACAYCATHE--------------------------------------------LST---------VVKC---M
K4DP20_TRYCR/40-185------.GCAYCGEAD--------------------------------------------PHS---------LVMC---I
D3B244_POLPA/160-313------HACRYCGLHD--------------------------------------------PST---------VVRC---M
E1ZMJ4_CHLVA/100-248------...DYCGIHN--------------------------------------------PAC---------VVKC---L
Q24GG1_TETTS/54-209------HACEYCGVHN--------------------------------------------KNS---------VIKC---L
U6GER8_EIMAC/206-358------.CCSYCGVSG--------------------------------------------AEV---------LMRC---D
U7Q7L3_SPOS1/104-255------HACVYCGIHS--------------------------------------------PAS---------VVKC---M
E5SQS0_TRISP/76-222------HACRYCGYHE--------------------------------------------PSS---------VVLC---N
RENT1_CAEEL/93-243------HACRYCGISD--------------------------------------------PLC---------VAKC---T
F4S1U3_MELLP/115-271------HACAYCGIHS--------------------------------------------PSS---------VVRC---L
A2DPW5_TRIVA/47-199------.CCSYCLCDI--------------------------------------------PEC---------LVKD---K
A9UPD7_MONBE/16-167------HACSYCGIHD--------------------------------------------PAS---------VVKC---L

PF01485

Q23RJ6_TETTS/555-575------......KLAD.......L..------------------------------........................
Q0UG70_PHANO/204-272------VDFDKALVKH.......L..------------------------------LSA.SPT.........FIAC.L.S
Q9VM88_DROME/67-124------QQYSNEPMKT.......TVI------------------------------RTK.TPD...N.....KLKC.T..
A7RZU5_NEMVE/129-194------SKYEDRLQEE.......ALS------------------------------LAE.MED.........LVRC.P..
Q2H650_CHAGB/77-137------AAYRARLAEH.......D..------------------------------....AAE.........KLYC...A
Q0UJR1_PHANO/59-128------DKFKILWNKK.......Y..------------------------------QEYTTAN.........RLYC.P.T
Q7S3S6_NEUCR/125-184------QAYEDMVEEL.......T..------------------------------....TSD.........PLYC.S.N
Q0UVP3_PHANO/341-395------ERREELGTSD..........------------------------------................RTYC...S
Q2UQ22_ASPOR/230-292------EEMIRKFEEK.......T..------------------------------VEHNDFN.........RTYC...A
A1DMT8_NEOFI/212-273------ARSQQFEEKA..........------------------------------IEFSDPH.........RTYC.S.N
Q1WMV1_COPDI/251-318------AQYLAKKAE...........------------------------------YDVSAQN.........RVYC.S.T
Q2U3I4_ASPOR/131-193------TEEKDAFQRA.......K..------------------------------IEFSTSN.........RTYC...S
Q2GWG6_CHAGB/257-321------TIVGQYQAKK..........------------------------------VEFETPN.........RTYC...Q
Q4WL53_ASPFU/238-296------EQYEKKKIEF.......E..------------------------------....TPN.........RTYC...Y
A7F8K5_SCLS1/296-359------QEFQRKVLER.......K..------------------------------VP..AGD.........RIYC.I.K
Q68ST7_PLEDJ/266-326------AEFQSKAREF.......ATP------------------------------ALQ.............RVYC.P.Q
B0YEB6_ASPFC/167-231------KALFKLKARE.......Y..------------------------------ATS.ARE.........RRYC.P.A
A6RDQ7_AJECN/243-309------DAF.RLKAQE..........------------------------------YSISEPH.........RVYC.P.E
Q9FLR7_ARATH/228-298------TMYKKASMIK.......AKV------------------------------LD..............FVCC.T..
A4VAL0_DANRE/80-142------SRFQQYVEAA.......Q.S------------------------------LKQ.HES.........LRRC.S.R
Q0IH68_XENLA/568-627------QEYLKVAKTL.......F..------------------------------...TDEA.........LKPC.P..
A7TMB6_VANPO/272-338------ERYKELHYNQ.......A..------------------------------ATK.LSK....HCTYACVTC.R.R
A2FQQ3_TRIVA/174-236------KKLEERISSL.......S..------------------------------ASM.SKT.........VRRC.I.N
Q7JR34_DROME/850-956------KKHHRYRLNR.......E..------------------------------IEL.DKT.........RTWC.P.R
Q7PQ32_ANOGA/514-613------...HRYRLNRGELVKNTQ..------------------------------VEL.DRF.........RTWC.P.K
Q9FHR4_ARATH/262-328------EMWKRKMEED..........------------------------------LIP.DAE.........KIYC.P.Y
Q9M1F6_ARATH/134-200------EMWEQRIKEE.......SIP------------------------------VCN.............RFHC.P.N
Q6L461_SOLDE/416-489------DIMKQRIKEA.......S..------------------------------IPV.TE..........KVYC.P.Y
Q0V1Z8_PHANO/170-230------EMYEVYKRDP..........------------------------------INK.............MIEC.I.A
Q0J5A0_ORYSJ/102-168------ERWCAALCEA..........------------------------------MFA.GAR.........RTYC.P.Y
A3CJQ1_ORYSJ/265-336------DSLERAFAEA..........------------------------------GTS.DME.........RFYC.P.F
O81849_ARATH/271-348------TTFKSFEEAN..........------------------------------VCSKNNG.........KIYC.P.Y
A0C9J1_PARTE/294-352------DRLEKIAFNQ.......Y..------------------------------LLQ.NPN.........VFQC.P.T
Q7T3F2_DANRE/81-146------ELYQRLRFER.......G..------------------------------VQL.DPS.........KAWC.P.V
Q4PBI8_USTMA/530-598------GKLDALTVKA.......K..------------------------------MEA.DPS.........VCYC.P.R
A0BX70_PARTE/182-243------TKYIKCHQNL.......E..------------------------------IAM.NPN.........KAWC.P.T
R144A_XENTR/91-156------QKYKKLQFEK.......E..------------------------------ILL.DPC.........RTWC.P.S
A0C0J8_PARTE/198-258------QLYKEILVKR.......M..------------------------------LDN.DSN.........YTWC.P.G
ITT1_SCHPO/246-308------NRYKELEEKR.......R..------------------------------YEN.DSN.........IIFC.P.R
Q0V3F8_PHANO/246-350------ERFVKIKRKK.......K..------------------------------IES.DPT.........IVYC.P.R
A1DLQ9_NEOFI/293-390------QRYVFLKRKK.......K..------------------------------LES.DKS.........TVYC.P.R
Q2HB83_CHAGB/279-383------KRYVTLKYKI.......E..------------------------------LES.DKN.........TIYC.P.R
Q5ANG1_CANAL/285-353------DRYYNLFKKS.......Q..------------------------------YEW.IGN....LLPNRLVKC.P.R
Q6CB97_YARLI/222-284------ERYQKLVHKR.......R..------------------------------LEK.DPN.........SVTC.P.R
Q20871_CAEEL/253-315------AKYEAHMLEK.......A..------------------------------IRE.MDD.........SMEC.P.N
Q5BZ98_SCHJA/46-106------NKYEYLVLKR.......G..------------------------------LDI.MPD.........IVNC.P.R
A2XX17_ORYSI/305-363------ERWERLTLQK.......T..------------------------------LDS.MSD.........VAYC.P..
Q5XH24_XENLA/283-344------SRYDRLLLQS.......S..------------------------------LDL.MAD.........VVYC.P.R
A4RSK7_OSTLU/306-365------EKYEATLLAR.......T..------------------------------LDS.MAD.........LVYC.P..
Q9NA71_CAEEL/882-946------RRLTDRAKQL..........------------------------------LIQTNED.........LAAC.P.S
A8XYZ1_CAEBR/896-960------LRILVHKTKD.......A..------------------------------ILAADPE.........LKNC.S.T
Q0V5B8_PHANO/216-277------VRYSKLHTKA..........------------------------------IYEKIPN.........WRWC...V
Q0V4X6_PHANO/367-428------QRFDDMMARN.......A..------------------------------IGE.DPN.........FEWC.R..
Q0UBQ8_PHANO/147-210------NRFDELSMRS.......F..------------------------------LSA.DAQ.........FRYC.L.S
A7EIK6_SCLS1/19-81------ERYCELALRN.......Y..------------------------------SRS..QA...K.....FNWC.LAS
Q2HFI8_CHAGB/572-633------NRYDTLVTRA.......A..------------------------------LTK.DPA.........FHFC.L.S
A1DL30_NEOFI/229-293------QAYDAKRTWQ.......I..------------------------------LEE..DA...E.....FVPC.V.R
A7F9A0_SCLS1/213-274------RKGRRTFIMS..........------------------------------LQH.LPN.........FTFC.L.N
Q2GN84_CHAGB/396-458------ERYQTLSFRS.......A..------------------------------ISS.SPN.........FIWC...T
Q5C0S0_SCHJA/113-178------ARYEEFLLQQ..........------------------------------VMSREPE.........ARWC.P.R
Q6CSC0_KLULA/197-269------KKHICLSFET.......F..------------------------------INKHSKN.........YKWC.P.Y
A0A023ZDG1_YEASX/242-314------SKLMDSSIKS.......F..------------------------------VQKHNRN.........YKWC.P.F
M9MYL8_ASHG1/233-305------ELLLLSSIKI.......F..------------------------------IQKHKHR.........YKWC.P.F
Q6M9E9_NEUCS/104-166------AKYEDFLTKN.......M..------------------------------LES.QEG.........FRWC.T.E
Q54LZ6_DICDI/472-536------AKYEDFLLKT.......T..------------------------------LEE.DPN.........SRFC.P.R
Q55AE0_DICDI/674-736------TKYEEFTFST.......F..------------------------------LMK.SPN.........YKWC.P.N
Q55CB4_DICDI/344-399------NRYQDYLKQQ..........------------------------------.....RG.........LVKC.L..
Q8K5C2_RAT/25-89------NRYQQYGAEE.......C..------------------------------VLQMGGV...........LC.P.R
A0CE10_PARTE/1763-1827------SKLLDQSFKR.......Y..------------------------------KDQHADE.........YIGC.L.T
A7RQ71_NEMVE/35-115------RKYEKFKTD...........------------------------------IEQ.NPN.........IKTC.P..
A0JMU3_XENLA/751-813------NLFHKKLTER.......T..------------------------------LMK.DPK.........FLWC.T..
Q1RL47_CIOIN/677-741------QLFQKKLRDQ.......T..------------------------------LMK.MPN.........FRWC.A..
Q230W2_TETTS/356-417------SKYLRFKSIS.......Q..------------------------------LKL.ENS.........ILFC.I.K
Q247S4_TETTS/293-353------QSYLDFKFDE..........------------------------------FRV.ENN.........IIYC.P.S
Q54MZ0_DICDI/178-246------EKYDKILVNV.......H..------------------------------LNK.DKN.........IRYC.P.E
Q22BP1_TETTS/607-681------KTLINQAISD.......I..------------------------------LNT..HN...S.....YSKC.P.S
A0BMN6_PARTE/106-169------NIYFSAQLDE.......L..------------------------------VIKHQNK.........FSCC.P.T
Q23WM6_TETTS/1249-1309------QKLTNLSLNK.......Y..------------------------------VSENGSS.........AQFC.F.T
A0CJN6_PARTE/1122-1184------ETLINLALNK.......F..------------------------------VQENNQS.........LTFC.Y.T
A0D443_PARTE/1097-1157------EKLVELSINK.......Y..------------------------------VNDMRGV.........LIFC.F.N
A0CYA7_PARTE/895-955------EKLIKLSINK.......Y..------------------------------LQDHAAQ.........IAFC.L.T
Q54QC7_DICDI/511-574------IKYQDYSFEK.......T..------------------------------IEINPDL.........FSFC.P.T
Q229A2_TETTS/252-314------EAYELKSLTA.......F..------------------------------FSQDQAL.........MKSC.P.T
Q229A4_TETTS/326-388------QRYEKFSLQN.......Y..------------------------------IDSNADE.........ISWC.P.T
A0CDV3_PARTE/213-277------DEFLNYTLNK.......F..------------------------------VDDHAAD.........MSWC.P.T
A0DMF5_PARTE/110-178------FEFQQYTFKQ.......Y..------------------------------VES.HGDEVIHNLIIKYSWC.P.T
A0E469_PARTE/256-316------QEFQILSLRA.......Y..------------------------------FSS.KKE.........YSCC.P.T
A7EFK2_SCLS1/395-455------D.LLEASFHS.......Y..------------------------------IRR.HPE...D.....FHYC.P.S
Q2HC35_CHAGB/712-789------STFEAILAAS.......FAA------------------------------HIRCHPT..L......FRYC.P.T
A0BMN6_PARTE/178-236------KENNEREFKK..........------------------------------LVE.NMN.........CKQC.T..
A6RDQ7_AJECN/317-367------ATLEEAEYHG..........------------------------------................WRRC.Y..
Q0WQ77_ARATH/358-417------ERYPDDITLH.......R..------------------------------LAR.YKR.........WRRC.Q..
Q0UKC8_PHANO/154-206------EKFQKLATEN.......G..------------------------------................YQNC.S..
Q9SJT6_ARATH/329-385------DPLYDVKLKS..........------------------------------LAN.KKK.........WRQC.V..
Q1PDR2_ARATH/324-383------RLVNDMMLKV.......L..------------------------------AND.QM..........WRQCS...
A3GHG7_PICST/408-467------EYQMDLLFNK.......M..------------------------------LKE.SNE.........VKEC.P..
Q6FKI3_CANGA/381-437------EYLADKMLDL.......A..------------------------------IEEKGSN.........LQRC.P..
Q0V4X6_PHANO/440-511------ERDQKAQEAA.......S..------------------------------LKAIGRM.........SKKC.P.G
A0BMU3_PARTE/314-372------DKYYELTLKQ.......L..------------------------------V...............IQRC.P..
A2DI48_TRIVA/264-325------VTNEDLMERR.......L..------------------------------L...NSE.........RKRC.P..
AKIB1_DANRE/500-559------EAYEDAANCL.......W..------------------------------LLSNSKP............C.A..
Q7RS61_PLAYO/361-426------QKWNQLQTKG.......DQN------------------------------IQWINAN.........TKKC.P..
O01963_CAEEL/257-324------KKWIKKCQDD.......SET------------------------------MNWINAN.........TKDC.P..
RBRA_DICDI/277-345------DKWLQKASDE.......SEN------------------------------VTWMLAN.........TKKC.P..
A7RN86_NEMVE/692-750------EKLLINERKE.......L..------------------------------INSVM...........VKNC.P..
Q2GN84_CHAGB/548-614------KKLEEEASTR.......T..------------------------------VGSTTKP............C.P..
Q22LZ5_TETTS/193-259------NLYKRFLIKD.......A..------------------------------FGQ.SET.........ILSC.P.Q
Q23AW5_TETTS/198-264------KVIFKFILKD..........------------------------------ILQKNKL.........ILTC.P.H
Q22R93_TETTS/290-354------EQAKNILFND.......Y..------------------------------LQI.SQK.........VKIC.P.L
Q4SJ42_TETNG/89-205------EKYEEFMLRR.......W..------------------------------LIT.EPD.........CRWC.P.A
Q229P0_TETTS/195-261------KDYCKFLEDD.......A..------------------------------LKI.ADY.........IIRC.P.S
A2DRX6_TRIVA/411-470------RLFQTEAMND.......V..------------------------------IKSGLPN.........LVKC.A..
Q585X6_TRYB2/200-265------KRAQQRFLTE.......Y..------------------------------LSN.HPS.........MRCC.P.N
A7RN86_NEMVE/613-678------PKFLKRKLNR.......A..------------------------------LEM.TSS.........WRWC.P.G
Q84RJ8_ARATH/352-411------LKSDAAILES.......F..------------------------------VKT..QG.........WKKC.S..
RN217_XENLA/69-136------K.YKYFLELS.......R..------------------------------MD....S...S.....TKPC.P..
A0BTN9_PARTE/136-197------KVYQQSYLLR.......L..------------------------------SKDYRIT.........VKCC...N
A7SFQ2_NEMVE/95-157------QNFQKMRAIK.......E..------------------------------IQI.SKS.........KAFC.P.K
A0DMT6_PARTE/176-237------EDYLKIVCRK.......F..------------------------------IET.NKA.........LAYC...Q
A0CBB0_PARTE/168-229------HEFENLLCRR.......F..------------------------------VDC.SRY.........LAYC...T
C4YFR1_CANAW/228-310------NPLLHSAARY.......L..------------------------------VNS.KPK.........YTHC.P.A
A4I5P6_LEIIN/216-281------KQIHRKYLTS.......F..------------------------------VET.CPT.........LHWC.P.N
A2E3Y3_TRIVA/264-326------ESYTNFLIES.......Q..------------------------------ISE.NPN.........LKHC.I.N
Q23TC9_TETTS/394-456------KKYKIFLRNT.......L..------------------------------INK.DPL.........KRFC.P.T
Q4Z6J6_PLABA/3-77------KQYKQLLLNV.......Y..------------------------------IKK.SSN.........LRNC.P.N
Y5521_DICDI/685-746------LKYQKFSMIA.......S..------------------------------LKT.EP..........IKWC.P.T
Q23PV0_TETTS/462-522------EKYMRFKKIM.......V..------------------------------LNQ.DPN.........IRWC.P.T
Q23GA0_TETTS/1925-1986------DKFKALRKIV..........------------------------------FKRMNPN.........VRYC.T.R
A0C6V8_PARTE/186-247------QKYLKFKNNI.......S..------------------------------VAT.STD.........RMWC.P.N
F5HFY9_CRYNB/212-281------DRYYNLLNAA.......F..------------------------------VSD.SPN.........LRWC.P.H
A0BUC0_PARTE/81-137------DKYAKLRTLQ.......Y..------------------------------GES.DPT.........LRHC.P.N
A0BCF4_PARTE/173-233------LKYQRFLLIK.......Q..------------------------------YEHVVNG..........KWC.P.R
A0C2Z0_PARTE/208-267------EKYKRFYNRQ.......V..------------------------------ISQ.NKN.........VRWC.P.K
A0E9B7_PARTE/246-307------QKYDKFKKQK.......L..------------------------------LDR.DET.........VRWC.I.K
A0BZF1_PARTE/238-298------RKYLNFKYKN.......E..------------------------------IQK.DPN.........KKWC.P.V
A0BW72_PARTE/251-311------QQYLVFKRKY.......E..------------------------------IEN.DPT.........KKWC.P.A
A0CX68_PARTE/223-282------QKLRRFRKIK.......Q..------------------------------LQQ.DPD.........IIWC.P.R
Q22XZ2_TETTS/376-436------QKYLKFKELK.......I..------------------------------INS.DPT.........LKWC...N
A4S4Y2_OSTLU/136-200------TKFDTFLRRS.......F..------------------------------LEN.NAK.........LRPC.I.G
Q7Q687_ANOGA/212-274------DKYQQFTFAD.......Y..------------------------------VKS.HPE.........LRFC.P.G
Q4S7W6_TETNG/199-261------DKYRRYLFRD.......Y..------------------------------IES.HFQ.........LQLC.P.G
A7RK36_NEMVE/187-249------EKFINFLFND.......Q..------------------------------IKT.FSK.........LRWC.P.G
A2DI48_TRIVA/190-255------DNLVNYLTDL.......Q..------------------------------ISI.SSD.........LRQC.P.N
CUL9_HUMAN/2140-2203------SKYEKALLRG.......Y..------------------------------VES.CSN.........LTWC.T.N
RBRA_DICDI/208-273------ERFNNFILKS.......Y..------------------------------VDD.NPQ.........VKWC.P.A
A5DH03_PICGU/210-282------TPFLNLVARS.......Y..------------------------------VDTNKQT.........MKWC.P.A
Q23FV5_TETTS/184-246------QDYKRNLGRV.......Y..------------------------------CSE.SKT.........MKWC.P.A
Q6C062_YARLI/216-283------AKYQSTLCTR.......Y..------------------------------VRA.HND.........MKWC.P.A
AKIB1_MOUSE/403-479------KRYLQFDIKA.......F..------------------------------VEN.NPA.........IKWC.P.T
Q54IL3_DICDI/455-551------EKYQIFSTKK.......F..------------------------------IQQ.NKQ.........LRYC.P.T
Q54XG4_DICDI/282-343------PKYLERLAQT.......Y..------------------------------VDQ.NPN.........MRWC.P.A
Q2LZK2_DROPS/219-280------GRYQQLITNT.......F..------------------------------VEC.NAL.........LRWC.P.A
Q2GQL4_CHAGB/211-278------ERYHELLHRT.......Y..------------------------------VED.KET.........LKWC.P.A
Q5B6Z1_EMENI/341-412------DRYQTLLTRT.......Y..------------------------------VDD.KEN.........LKWC.P.A
ARI16_ARATH/148-214------EMYENYILES.......F..------------------------------MECHKAT.........IKWC.P.A
Q653S8_ORYSJ/202-267------ERFGWFALRS.......Y..------------------------------VEE.SAG.........MRWC.P.G
ARI11_ARATH/208-271------DKYYRYFLRS.......Y..------------------------------VED.GKK.........MKWC.P.S
O01965_CAEEL/194-255------ATYRKLIVAS.......Y..------------------------------VET.NRL.........LKWC.P.G
A7SI45_NEMVE/209-270------SQYHHLIANS.......F..------------------------------VVS.NRL.........MKWC.P.G
Q8T2Q2_DICDI/210-273------SRYWYFICKD.......F..------------------------------VGN.NKN.........LEFC.P.N
Q54I29_DICDI/1407-1472------QRYIQMYVKS.......F..------------------------------VEF.NPK.........TRWC.T.N

PF17123

M9LQU8_PSEA3/670-698--------------------------------------------------------------------------------
G8YKW2_PICSO/433-461--------------------------------------------------------------------------------
E3RGC4_PYRTT/226-254--------------------------------------------------------------------------------
ZNRF3_HUMAN/292-320--------------------------------------------------------------------------------
A9SWZ3_PHYPA/4-32--------------------------------------------------------------------------------
D7LX71_ARALL/58-87--------------------------------------------------------------------------------
F2PPY3_TRIEC/318-343--------------------------------------------------------------------------------
B6Q6A7_PENMQ/360-389--------------------------------------------------------------------------------
E2BB02_HARSA/584-612--------------------------------------------------------------------------------
W5HU87_WHEAT/15-43--------------------------------------------------------------------------------
DMA1_SCHPO/191-219--------------------------------------------------------------------------------
DMA2_YEAST/432-460--------------------------------------------------------------------------------
I1MHZ7_SOYBN/154-182--------------------------------------------------------------------------------
D2V268_NAEGR/256-284--------------------------------------------------------------------------------
U9SZW1_RHIID/169-197--------------------------------------------------------------------------------
I1K7G8_SOYBN/73-102--------------------------------------------------------------------------------
G3JG23_CORMM/444-472--------------------------------------------------------------------------------
A9U391_PHYPA/31-60--------------------------------------------------------------------------------
M1A7J2_SOLTU/124-154--------------------------------------------------------------------------------
I1G7H3_AMPQE/29-57--------------------------------------------------------------------------------
M2MXX2_BAUCO/339-367--------------------------------------------------------------------------------
I7LWD8_TETTS/325-355--------------------------------------------------------------------------------
K7MP33_SOYBN/116-145--------------------------------------------------------------------------------
B9T4Z4_RICCO/180-208--------------------------------------------------------------------------------
K4ARP9_SOLLC/76-105--------------------------------------------------------------------------------
D8RN03_SELML/2-31--------------------------------------------------------------------------------
S2JCC5_MUCC1/165-193--------------------------------------------------------------------------------
T1J8S5_STRMM/73-101--------------------------------------------------------------------------------
D8R216_SELML/14-42--------------------------------------------------------------------------------
ATL74_ARATH/104-133--------------------------------------------------------------------------------
K1QTN7_CRAGI/43-71--------------------------------------------------------------------------------
H3H3V3_PHYRM/57-85--------------------------------------------------------------------------------
A8PX85_MALGO/344-372--------------------------------------------------------------------------------
M1BIA4_SOLTU/61-90--------------------------------------------------------------------------------
F6HT83_VITVI/58-87--------------------------------------------------------------------------------
M0T2R4_MUSAM/97-126--------------------------------------------------------------------------------
A0BDA6_PARTE/306-334--------------------------------------------------------------------------------
A1C708_ASPCL/313-341--------------------------------------------------------------------------------
G0VA53_NAUCC/344-372--------------------------------------------------------------------------------
N1J4Q3_BLUG1/324-352--------------------------------------------------------------------------------
I1MC10_SOYBN/70-99--------------------------------------------------------------------------------
M1D122_SOLTU/38-66--------------------------------------------------------------------------------
S7XNY3_SPRLO/155-183--------------------------------------------------------------------------------
G3MWN3_BOVIN/81-109--------------------------------------------------------------------------------
K3WXW1_PYTUL/219-247--------------------------------------------------------------------------------
M2NEX5_BAUCO/246-274--------------------------------------------------------------------------------
K7VH86_MAIZE/99-128--------------------------------------------------------------------------------
I1Q2T7_ORYGL/103-132--------------------------------------------------------------------------------
U6GNP0_EIMAC/552-580--------------------------------------------------------------------------------
Q8H5Z8_ORYSJ/207-235--------------------------------------------------------------------------------
M0ZSV0_SOLTU/178-206--------------------------------------------------------------------------------
M1E0I6_SOLTU/54-83--------------------------------------------------------------------------------
H9JRQ4_BOMMO/28-56--------------------------------------------------------------------------------
B0X690_CULQU/183-211--------------------------------------------------------------------------------
E5A6G0_LEPMJ/335-363--------------------------------------------------------------------------------
K4BU20_SOLLC/130-159--------------------------------------------------------------------------------
W5E190_WHEAT/113-142--------------------------------------------------------------------------------
M1CMY5_SOLTU/78-107--------------------------------------------------------------------------------
K7KU89_SOYBN/131-160--------------------------------------------------------------------------------
Q0UH23_PHANO/24-53--------------------------------------------------------------------------------
K1S2Y4_CRAGI/99-128--------------------------------------------------------------------------------
R4FMR7_RHOPR/87-115--------------------------------------------------------------------------------
ASR1_ASHGO/17-44--------------------------------------------------------------------------------
C8V1R9_EMENI/315-343--------------------------------------------------------------------------------
U7DVX6_POPTR/102-131--------------------------------------------------------------------------------
W1PRS8_AMBTC/47-75--------------------------------------------------------------------------------
T1F5S0_HELRO/45-74--------------------------------------------------------------------------------
A8NNS3_COPC7/318-346--------------------------------------------------------------------------------
S8B4E1_PENO1/304-332--------------------------------------------------------------------------------
Q59S20_CANAL/320-348--------------------------------------------------------------------------------
M1CT87_SOLTU/94-122--------------------------------------------------------------------------------
G6DJ91_DANPL/203-231--------------------------------------------------------------------------------
M4EN48_BRARP/131-161--------------------------------------------------------------------------------
K4AD29_SETIT/121-150--------------------------------------------------------------------------------
M0U0F9_MUSAM/137-166--------------------------------------------------------------------------------
I1H9P2_BRADI/112-141--------------------------------------------------------------------------------
G8ZPV5_TORDC/435-463--------------------------------------------------------------------------------
B9INM0_POPTR/100-129--------------------------------------------------------------------------------
A0BQ98_PARTE/104-133--------------------------------------------------------------------------------
Q6C175_YARLI/549-577--------------------------------------------------------------------------------
F0Y7A0_AURAN/186-212--------------------------------------------------------------------------------
M0W555_HORVD/117-146--------------------------------------------------------------------------------
M0ZSV5_SOLTU/55-83--------------------------------------------------------------------------------
B9HAE0_POPTR/152-180--------------------------------------------------------------------------------
Q0U9D9_PHANO/29-57--------------------------------------------------------------------------------
A0C9T4_PARTE/336-364--------------------------------------------------------------------------------
W4ZTE6_WHEAT/2-31--------------------------------------------------------------------------------
C5Y318_SORBI/116-145--------------------------------------------------------------------------------
D7G5M0_ECTSI/400-428--------------------------------------------------------------------------------
B9SM80_RICCO/199-227--------------------------------------------------------------------------------
U5CUY3_AMBTC/93-122--------------------------------------------------------------------------------
B9GEV4_POPTR/92-121--------------------------------------------------------------------------------
F2TXI0_SALR5/67-95--------------------------------------------------------------------------------
W5H303_WHEAT/7-36--------------------------------------------------------------------------------
K3YWG9_SETIT/58-86--------------------------------------------------------------------------------
F4NRC4_BATDJ/322-350--------------------------------------------------------------------------------
D8U3N4_VOLCA/359-385--------------------------------------------------------------------------------
M1CU46_SOLTU/5-35--------------------------------------------------------------------------------
M1CAK4_SOLTU/68-97--------------------------------------------------------------------------------
S2J9U7_MUCC1/259-287--------------------------------------------------------------------------------
I1CBQ0_RHIO9/176-204--------------------------------------------------------------------------------
V5FKW5_BYSSN/342-370--------------------------------------------------------------------------------
Q22BU9_TETTS/1146-1174--------------------------------------------------------------------------------
A7RGT9_NEMVE/559-587--------------------------------------------------------------------------------
I1NRQ7_ORYGL/116-145--------------------------------------------------------------------------------
C5KRX0_PERM5/8-36--------------------------------------------------------------------------------
K0P2Q1_9BACT/376-408--------------------------------------------------------------------------------
I1G069_AMPQE/315-343--------------------------------------------------------------------------------
F4NZG0_BATDJ/253-281--------------------------------------------------------------------------------
Y733_ENCCU/259-287--------------------------------------------------------------------------------
A9SET1_PHYPA/4-33--------------------------------------------------------------------------------
B9T8K2_RICCO/187-215--------------------------------------------------------------------------------
M0ZHN0_SOLTU/250-278--------------------------------------------------------------------------------
H6BRW0_EXODN/257-285--------------------------------------------------------------------------------
H3GHB5_PHYRM/6-32--------------------------------------------------------------------------------
A0E1F5_PARTE/371-399--------------------------------------------------------------------------------
W4ZBD1_STRPU/83-111--------------------------------------------------------------------------------
I4YHB9_WALSC/299-327--------------------------------------------------------------------------------
B9H0B9_POPTR/82-110--------------------------------------------------------------------------------
C4V879_NOSCE/161-189--------------------------------------------------------------------------------
M0VCP6_HORVD/2-31--------------------------------------------------------------------------------
B9H6Z2_POPTR/142-171--------------------------------------------------------------------------------
A9UV01_MONBE/4-32--------------------------------------------------------------------------------
ATL66_ARATH/106-135--------------------------------------------------------------------------------
W5D1Q1_WHEAT/22-51--------------------------------------------------------------------------------
M4FHC0_BRARP/121-151--------------------------------------------------------------------------------
D7FKZ7_ECTSI/326-354--------------------------------------------------------------------------------
T1FPU1_HELRO/105-132--------------------------------------------------------------------------------
A9SYM4_PHYPA/33-61--------------------------------------------------------------------------------
T1ELA1_HELRO/6-34--------------------------------------------------------------------------------
B7PZI8_IXOSC/89-117--------------------------------------------------------------------------------
J3M0W4_ORYBR/156-185--------------------------------------------------------------------------------
H3EYT8_PRIPA/153-181--------------------------------------------------------------------------------
M0YZY6_HORVD/5-34--------------------------------------------------------------------------------
F4P6A5_BATDJ/350-378--------------------------------------------------------------------------------
M0ZSX3_SOLTU/43-71--------------------------------------------------------------------------------
C5LJQ7_PERM5/159-187--------------------------------------------------------------------------------
H6BNB4_EXODN/362-390--------------------------------------------------------------------------------
I1GQM0_BRADI/116-145--------------------------------------------------------------------------------
H3EI77_PRIPA/42-70--------------------------------------------------------------------------------
Q9FFT1_ARATH/173-201--------------------------------------------------------------------------------
C1FH55_MICSR/4-33--------------------------------------------------------------------------------
D7KCM8_ARALL/83-111--------------------------------------------------------------------------------
M4DQ70_BRARP/48-78--------------------------------------------------------------------------------
H3EYU2_PRIPA/64-91--------------------------------------------------------------------------------
B0DRM3_LACBS/317-345--------------------------------------------------------------------------------
C4R4T4_PICPG/284-312--------------------------------------------------------------------------------
H9K7T4_APIME/53-81--------------------------------------------------------------------------------
K7LV20_SOYBN/161-190--------------------------------------------------------------------------------
M0SPK6_MUSAM/147-176--------------------------------------------------------------------------------

PF12906

SUD1_ARATH/68-114--------------------------------------------------------------------------------
Q18997_CAEEL/25-71--------------------------------------------------------------------------------
MIR1_HHV8P/9-53--------------------------------------------------------------------------------
LAP_MYXVL/23-68--------------------------------------------------------------------------------
Q9VQI2_DROME/392-442--------------------------------------------------------------------------------
MARH7_HUMAN/552-607--------------------------------------------------------------------------------
MARH8_MOUSE/76-122--------------------------------------------------------------------------------
DOA10_SCHPO/8-54--------------------------------------------------------------------------------
MARH2_MOUSE/64-109--------------------------------------------------------------------------------
Q9XWI0_CAEEL/194-247--------------------------------------------------------------------------------
Q9W3Y8_DROME/91-137--------------------------------------------------------------------------------
Q93227_CAEEL/13-67--------------------------------------------------------------------------------
DOA10_YEAST/39-93--------------------------------------------------------------------------------
O64633_ARATH/74-119--------------------------------------------------------------------------------
Q9SQT6_ARATH/218-264--------------------------------------------------------------------------------
Q21530_CAEEL/16-66--------------------------------------------------------------------------------
Q9W3I6_DROME/34-88--------------------------------------------------------------------------------
Q9VB61_DROME/23-78--------------------------------------------------------------------------------
Q39623_CHLRE/12-58--------------------------------------------------------------------------------
D7M801_ARALL/247-294--------------------------------------------------------------------------------
F4HXK4_ARATH/20-65--------------------------------------------------------------------------------

PF15906

E2R5E4_CANFA/120-194--------------------------------------------------------------------------------
NOSIP_DANRE/4-78--------------------------------------------------------------------------------

PF04564

UFD2_YEAST/881-953--------------------------------------------------------------------------------
PUB3_ARATH/238-310--------------------------------------------------------------------------------
Q9U4F8_DROME/915-987--------------------------------------------------------------------------------
UBE4A_HUMAN/988-1060--------------------------------------------------------------------------------
UBE4_CAEEL/906-977--------------------------------------------------------------------------------
WSDU1_MOUSE/402-474--------------------------------------------------------------------------------
UFD2_SCHPO/931-1003--------------------------------------------------------------------------------
Q9XYW6_DROME/213-285--------------------------------------------------------------------------------
O44007_DICDI/1016-1088--------------------------------------------------------------------------------
UBE4_ARATH/941-1013--------------------------------------------------------------------------------
UBE4B_HUMAN/1228-1299--------------------------------------------------------------------------------
CHIP_HUMAN/227-299--------------------------------------------------------------------------------
Q9VA79_DROME/222-300--------------------------------------------------------------------------------
RNF37_HUMAN/259-337--------------------------------------------------------------------------------
CHIP_ARATH/200-272--------------------------------------------------------------------------------
Q9VK44_DROME/1141-1212--------------------------------------------------------------------------------

PF13901

B7Q8K7_IXOSC/495-696YSYCP-------------.D--C.MRED.SHVIPARMVHNWDFRKH......PVSVE.....AKALLKKYESEPLL.DLR
Q9W3C9_DROME/619-824KYLCT-------------.G--C.HRNQ.ISAIPARILRSWDFRCY......PVCSF.....AYRLIEQMYAFPLF.HVP
H2WP71_CAEJA/258-466ELFCP-------------.N--C.HWND.TWSIPARIVHNLDANPR......PVCRA.....VKQLLSIVDHRPLI.DIN
B4JLA4_DROGR/709-910KYLCT-------------.G--C.HRNQ.LSAIPAKILQTWDFHSY......AVSSF.....AYRLIEQMYTFPLF.HVP
A0BWI8_PARTE/329-520LFFCR-------------.Q--C.ISNE.LSVIPHLILNKFDFNKY......QVSKE.....AFETIQKNMKKIIF.QIN
M4EY72_BRARP/290-495QLFCS-------------.S--C.HTND.MAVLPARVLHHWDFNPY......PVSQL.....AKSYLDSIHEQPML.CVS
I3KPJ5_ORENI/861-1062KYYCE-------------.S--C.HKGN.TSIIPSRMVHNWDVTQR......EVSKK.....ALWLLKQVEQEPLL.NLE
G7Y978_CLOSI/540-742RYFCC-------------.V--C.HANT.LMVLPGNLLTNWDFRMM......PVCNI.....ARDRLHQLHRQPLL.RWS
U1LYD3_ASCSU/245-449RYYCP-------------.R--C.HWND.EWIIPARIVHNWDCDKYKATALLKVCRA.....SKQLLAYIDRKPLL.NIT
B4I7Z9_DROSE/499-700SYYCN-------------.S--C.MDVE.MQLIPARIIYNWDFRKY......SVSKR.....AATFLAEFRSHPFL.DMQ
D6WGG5_TRICA/215-416LYYCT-------------.A--C.HWGS.SAVVPARVVHNWDLAPQ......PVCQA.....SLQQLRVTANRPLL.NLE
H3AQ72_LATCH/257-456KYFCD-------------.C--C.HSNE.ESFIPSRILMKWDFKKY......SVCNF.....SKQLLENIWQEPLF.NVS
W5MPN4_LEPOC/703-904RYFCQ-------------.C--C.HENS.QAVVPGRVLRRWDFSKQ......PVSNF.....ARDLLGKIAGDPLF.NLQ
D2H8H1_AILME/525-726WYYCS-------------.S--C.HVDD.TFLIPARIVHNWDTSKY......KVSKQ.....AKEFLEYVYEEPLI.DIQ
B7Q1L9_IXOSC/224-426RYYCS-------------.L--C.HWNS.HTIVPARVLHNWDFEPR......KVCRA.....SLQFLRLMVRKPIL.NLD
H2YN40_CIOSA/169-371LYYCP-------------.N--C.HWND.LVSTPARVLHNWDHTPY......KVSRG.....SYQLLKSSEKRALL.EVR
W5CJD8_WHEAT/308-510QLFCA-------------.S--C.HTND.TAVLPARVLHHWDFSLY......PVSQL.....AKAFLDSIYDQPML.CVT
D3BFT0_POLPA/795-997EWFCT-------------.K--C.HTNQ.KIMLPSRILYHWDYKLY......PVSNS.....SKQYILQNYNQPF..DIF
J9KYL6_ACYPI/640-840RYFCT-------------.G--C.HVDK.TAIIPGRIIGKWDFSKY......PVSCF.....SFTLLEKMLFDPLF.NIT
B0G190_DICDI/1180-1384KYYCH-------------.N--C.HSGQ.KSLIPARILWHWDFKLF......PVCDS.....AKSYITRNFSHPF..DIF
T1JKT5_STRMM/256-458LYLCP-------------.N--C.HWNS.QAIIPARVLHNWDFEPY......RVCRA.....SRQFLRLMRKKAVL.RID
T1FZW2_HELRO/83-284LFYCN-------------.K--C.HWND.SMAIPARIVYNWDFDLK......KVCRA.....SKSFLRMMSNRPVI.NIQ
T1L198_TETUR/170-375FNYCT-------------.E--C.HIDE.RWTIPARIVNNWDFKKY......PVANR.....NKKRLQLIESEPLI.DIK
Q7Q6B8_ANOGA/327-529LYYCP-------------.A--C.HWND.TSIIPARITNNWDFVPR......KVCRA.....SRQQINLLLAKPVI.RLE
E9FRK4_DAPPU/108-308NYFCS-------------.E--C.HWGS.LSVIPSRVVLNWDFHEY......PVSKG.....SKQYLNLMMKKSII.NLE
B4N298_DROWI/585-790KYLCT-------------.G--C.HRQQ.ISAIPSKILQSWDFRCY......PVSTF.....AYRLIEQMYTFPLF.NVR
U6HJ48_ECHMU/451-682RFFCC-------------.V--C.HANT.LMVVPGALLHAWSGAMY......PVSKF.....ARDILVRAYNRPLL.QST
B4MMN6_DROWI/248-450LYYCP-------------.S--C.HWGD.TFSVPARIIHNWDFTSR......RICRA.....SLQEIHLFLNKPLI.RLE
G6DK84_DANPL/508-709EYYCS-------------.N--C.MDPN.VFIIPARVIHNWDFKRY......PVSRK.....SAIFLLEFQHHPWI.DMK
A9T181_PHYPA/259-461QLYCS-------------.S--C.HLNE.TAVIPAYAVQHWDFGLR......PVSQL.....AKAYLDSIYDKPML.CVS
H2YFY0_CIOSA/55-253EYYCQ-------------.N--C.HLME.ENMIPARIIHNWDFRKH......KVSKR.....TMVYLTQQWRDPCI.QMD
B7PZV1_IXOSC/400-601KLFCR-------------.C--C.HGDA.RAMIPGRVLERWDFGLY......PVSNF.....ARDLLERMAPAPLF.NIR
W5LPV2_ASTMX/534-735QYYCE-------------.G--C.HHGD.TTIIPSRMVHNWDLTPR......EVSGP.....ALKLLANIKQEPLL.NLD
G3X7G7_BOVIN/852-1058LYYCD-------------.I--C.HQDD.VSVIPARIIHNWDLTKR......LVCSI.....FLFFRSGLRVEPST.SIK
H9K3M3_APIME/716-918RYFCT-------------.G--C.HTNQ.VALIPGKILSKWDFNRY......PVSNF.....SYRLLDQMTSDPLF.QIN
A9UU05_MONBE/125-326RYYCS-------------.A--C.FKAA.RSVTPARVVLSWDFSKQ......TMSQT.....SRDLIVAQMDKPLL.NLR
H3EAL3_PRIPA/754-955RYYCS-------------.E--CWQQGA.ERVVPSRMITSWDVRVR......KVSPR.....SRVFLDSIADKPML.HMD
H0YYN7_TAEGU/823-1024LYYCD-------------.S--C.HRDE.ETIIPSRLIHNWDLTKR......GVCKQ.....ALKFLTQIRNQPLI.DLR
E9CH38_CAPO3/757-957KYYCD-------------.E--C.HWNG.MQVIPARVIHNWDFKQY......KVSKT.....SKQLLTLLERKPIL.LVE
H3AA51_LATCH/845-1046LYYCD-------------.M--C.QGTE.SAVIPARILHSWDLTRR......PICKQ.....ALKFLHRIQNEPLI.SVE
K1S180_CRAGI/366-568QYFCE-------------.L--C.HWNN.TMVIPSRVLHNWDFEPR......KVSRA.....SKQFLKLMTSKAVI.RIQ
T1L3P9_TETUR/344-549KFFCR-------------VG--C.HSGR.KAILPAYVIHNWDFNCY......PLSNC.....AVNFLEKYRGEPLF.HIN
G3R769_GORGO/295-497QYYCS-------------.H--C.HWND.LAVIPARVVHNWDFEPR......KVSRC.....SMRYLALMVSRPVL.RLR
G3WFP8_SARHA/565-764KYFCD-------------.C--C.HNYA.ESYIPARILMKWDFRKY......HVSKF.....SKHLLDSIWHQPLF.NLL
E9BYG8_CAPO3/1395-1595KFFCA-------------.S--C.HSNS.VEIIPALVLHKWDFKPR......KVSNF.....AKELLHRIFSEPVY.NIG
I7MFD5_TETTS/395-585FWYCY-------------.N--C.IAVD.KKPIPWKALESFDLTSY......KVCKK.....AEKEINNLYAKPII.QFE
W1P5W0_AMBTC/840-1041QLFCT-------------.Y--C.HTND.TAVLPARVLQLWDFSQL......PVSQL.....AKAYLDSIYDQPML.CIS
A8P142_BRUMA/315-527RVFCQ-------------.R--C.HQGA.RSRIPARIVYQWNFKEY......PVSDI.....AHRFLLDNHRQPVI.NVS
F4PVD1_DICFS/686-883KYYCS-------------.G--C.HSKK.YWYIPGKILTNWDFKQY......YLANF.....YYEFLVEMEKEPVY.DLG
F1A452_DICPU/942-1142KYFCS-------------.T--C.HDKS.VYYIPSRIIHSWDFKKY......PIAKA.....NLEFLKEIEEEPLI.DIS
W4XSF2_STRPU/412-614LYYCS-------------.M--C.HWND.QEVIPARVIHNWDFEPR......IVCRQ.....SKQLLKLMCSKAVL.RIQ
G1KN51_ANOCA/851-1052LYYCD-------------.N--C.HQDD.ESVIPSRLIHNWDLARR......PVCRQ.....AVKFLNQIRNQPLI.DLK
J9JZL2_ACYPI/216-416KYYCP-------------.L--H.HWNN.TALIPARVLCNWQFEKK......FVSQA.....SFQLLNYKYKSKMY.NLE
H9JZI4_APIME/250-452LYYCQ-------------.R--C.HWNT.AMVIPARVIRNWDMESR......PVSRV.....AAQLLTLLEERSVL.LLE
R4FMB7_RHOPR/242-441RFYCP-------------.S--C.HWNT.LSVIPARVAHNWDFEQQ......PVSQA.....AYQLIRISKSRPMI.VLS
F7E023_ORNAN/420-619KYFCN-------------.S--C.HCDS.ESCIPARILMKWDFKKY......YVSNF.....SKHLLDSIWQQPVF.NLL
A8XHJ6_CAEBR/387-603LFFCS-------------.L--C.HGGE.KSIIPSRAITQWNFAEH......PVSDR.....AIRFLRAVRETPVF.KVR
H0ZH73_TAEGU/715-915KYFCQ-------------.C--C.HENA.QTVIPSRILRKWDFSKY......YVSNF.....SKDLLSKIWSDPLF.NVQ
F6ZK14_CIOIN/612-810EYYCS-------------.H--C.HLMD.EHIIPARIVHNWDFKKY......PVAKK.....SMIFLTQQWKDPCI.AMN
D7FQ81_ECTSI/1257-1460GLFCR-------------SY--C.HAED.RRVIPHRVVHHWDFVMH......RVCKD.....ARVFLDSTRFHPVF.DLP
E5S714_TRISP/197-388FYFCS-------------.V--C.HWND.EMVIPA.................RVSRS.....SRQFLRLMQKRPIL.RLE
A8XYD1_CAEBR/276-477KYYCP-------------.E--CMKPGG.KIPIPARVVMDWDWRER......SVSDR.....GRAWYEANQEKALI.NIK
J9JLP1_ACYPI/451-650CYYCV-------------.H--C.FGSE.TWAIPVKTLYNWDFNRY......PVSNS.....SSTFLSEIQYHPLF.NMR
T1HXH3_RHOPR/730-924RYFCT-------------.G--C.HSNK.QAVVPGRVIAKWDFTKY......GVSNF.....SYNLLEQMGTDPLF.TLC
M0UBC7_MUSAM/273-478QLFCA-------------.T--C.HTND.TSVLPAKILHLWDFSLY......PVSQL.....AKAYLDSIYDQPML.CVS
I1GFB5_AMPQE/599-798KYFCT-------------.T--C.HQNS.LSYIPAYIMSKWNFKKY......PVSNF.....ARDTLAEFEKEPHF.NLD
E1ZXM9_CAMFO/755-957RYFCT-------------.G--C.HTNQ.VAVIPGKILSKWDFNRY......PVSNF.....SYRLLDQMMSDPLF.QVN
Q16MZ5_AEDAE/483-680KYNCS-------------.G--C.HKNQ.MAAIPAKVIERWDFTFY......PVCTF.....AYRLLNDINAIPLY.RIN
K4BKD6_SOLLC/671-875QLYCS-------------.S--C.HTND.TAVLPARILHLWDFNQY......PVSQM.....AKSYLDSIYDQPML.CVS
G6DR39_DANPL/218-415MYFCG-------------.T--C.HWND.LSPIPARVVHNWDWEKR......YISRL.....AYQMLTLSWSRPYI.DVE
H2M7Y1_ORYLA/868-1069QYYCD-------------.S--C.HIGD.TSIIPSRMLHNWDLIPR......EVSKR.....AMRVLTHIHHEPLL.NLE
F2UDN1_SALR5/921-1126QHYCS-------------.T--C.HHDQ.RAVTPARVVRSWQFADM......PVCLQ.....ASEVLAATHDLPLL.EIR
F1RAA9_DANRE/73-272RYFCD-------------.G--C.HGGL.ETVIPGRVLNNWDFARY......PVCNF.....SRQLLDSIWEQPIF.KLT
B3S7P2_TRIAD/84-285CYYCS-------------.G--C.HDNGKFHVIPARLIHNWDSTEY......AVCHE.....NMKFLAMIKSEPLF.DIS
Q29GS8_DROPS/642-843KYLCT-------------.G--C.HRNQ.ISAIPAKILQNWDFRCY......PVSSF.....AYRLIEQMYTFPLF.HVP
B0W0J9_CULQU/596-795KYNCS-------------.G--C.HKDQ.MSAIPAKIIERWDFTFH......PVSSF.....AYHLLNDIATCPLY.SLD
E0VZS4_PEDHC/212-414KYYCT-------------.T--C.HWNS.TSVIPARVVLNWDFEER......VVCRA.....SKQILKLMAKLPIL.KLE
D2UZU6_NAEGR/962-1169KYYCT-------------.K--C.HSNTCTEVIPAKILGSWDFKPY......KVCDE.....ASKYLKSVHRQPII.CVS
F1Q4W5_DANRE/692-894RYFCQ-------------.C--C.HENA.QSVIPAKIIRKWDFSKS......YVSNF.....SRDLLAKISGDPLF.NLS
U3K0L4_FICAL/293-492KYFCD-------------.C--C.HSYA.QSSIPARILSKWDFKKY......YVCNF.....SKHLLDSIWQHPIF.NVS
J9EU11_WUCBA/2-201KYYCD-------------.G--CFSKGD.ESIIPSRLIRNWDRHPR......HVCRS.....NMAFIESIRDKAVL.RLD
A7SVS4_NEMVE/36-235GYYCY-------------.E--C.HMDE.DHVIPARVIYNWDLRKH......RVARC.....TKLFLLQIEEEPLL.NID
F5HJM0_ANOGA/399-591KYNCS-------------.G--C.HKNQ.MAIIPARVIQRWDFTVL......PVSVF.....AYRVLGDIWSTPLY.RVN
H2VVR0_CAEJA/379-592FYFCC-------------.L--C.HGNE.KSIIPARVINQWAFAEH......PVSDR.....AMRFLRAVRETPVF.RIQ
A0BU97_PARTE/109-299RYFCN-------------.D--C.MSVV.RMPIPWKALESFDLRHY......KVSKV.....AQSEIDKLYDLPIL.EIP
M4ATE6_XIPMA/868-1069QYYCE-------------.A--C.HKGD.TTIIPSRMVHNWDLTQR......EVSKK.....ALRLLAQIEKEPLM.NLE
E5SLH5_TRISP/488-680YYYCS-------------.A--C.HVDD.TMLIPARALLNWDFTPR......KVS..............IYDQPIF.HMN
W4XDG9_STRPU/79-271KYFCQ-------------.C--C.HTNA.SSPIPSRILRKWDFSRY......PISNF.....SHELLSKIQGDPVF.NVA
D8QPZ9_SELML/294-498QLYCV-------------.R--C.HLNE.TAILPARVLRSWDFTPR......VVSQL.....AKAYLDSIYDQPML.CVS
W5JEW3_ANODA/349-551LYYCP-------------.A--C.HWND.MSIIPARIMNNWDFVPR......KVCRA.....SRQQIALLRSRPVI.RLE
F1NS53_CHICK/781-982LYYCD-------------.S--C.HRDD.ETVIPSRLIHNWDLSKR......GVCRQ.....ALKFLTQICKQPLI.DLK
E1G3Q0_LOALO/235-437HYYCP-------------.R--C.HWND.EWFIPARIIHNWDFSKY......KVCRA.....SKQLLVIIERRPLF.SIL
W5MWV1_LEPOC/272-471KYFCD-------------.C--C.HNDS.ESVIPGHILMKWDFSKY......LVCNF.....SKHLLYSIWHNPLF.NVS
Q54BL5_DICDI/1135-1340KYFCS-------------.G--C.HDKS.VYYIPSRIVHNWDFKKY......SISKA.....SYEFLNSIEKDPLI.DLL
G3NH32_GASAC/866-1069QYYCD-------------.S--C.HHGD.TTVIPSRMVHNWDLTRR......EVSKK.....ALHLLAQVEQEPLL.NLE
E0VRE2_PEDHC/406-607EYYCV-------------.D--C.HLNE.TSVIPSRIIFNWDHKKY......PVCCK.....ASKYLNDIGNHFLI.DIK
T1IN68_STRMM/846-1047KYFCQ-------------.C--C.HSNH.QGFIPGKILRKWDFSKY......YVSNF.....SLDLLNKMYYDPLF.NIS
U6HKA0_ECHMU/286-475KRYCE-------------.R--C.HWGD.EWYIPANMLLLNDYAKH......PVSRS.....AYLLLRVLWDTAVL....
F2UD64_SALR5/665-865KYFCT-------------.S--C.HKQD.KAFIPARIVHFWDFRRY......PVSKF.....AAEVLVSIKDLPVF.DLQ
U6IB77_HYMMI/442-665RFFCS-------------.M--C.HSNT.LMALPGALVQTWSGAMY......PVSKF.....ARDLLTPLHNLPLL.HSA
B0WIJ1_CULQU/290-494LYYCT-------------.A--C.HWND.TSIIPARVVNNWDFVPR......KVGRA.....SLQQIRLLYERPLI.NLE
M3ZYS3_XIPMA/514-713RYFCD-------------.C--C.HSGS.EAVIPGRVLSNWDFSRY......SVSDF.....SKQLLDSVWSQPLF.DLS
H3AW67_LATCH/702-903KYFCQ-------------.C--C.HDNA.QSIIPSRLLRKWDFSKY......YVSNF.....SKDLLSKIWNDPLF.NIQ
X6NIC7_RETFI/99-294ALHCD-------------.S--C.HQLE.MAVIPHRVLQDLDCRPA......KVCKA.....AKRYLDQMFDIPCI.SIS
C3XVM6_BRAFL/226-428QYYCT-------------.S--C.HWND.TAVIPARVMHNWDFQPC......KVARQ.....SKQYLQLVFYKPLL.NPQ
E9H211_DAPPU/35-239GLYCS-------------.D--CHTDAD.EVIIPARVFLNGDYSKR......KVCRA.....VRQFFQDIEVDPAL.DAI
M3W8L8_FELCA/301-503LYYCD-------------.I--C.HQDD.ASVIPARIIHNWDLTKR......PICRQ.....ALKFLTQIRAQPLI.NLQ
H2S0U6_TAKRU/778-981QYYCQ-------------.S--C.HRGD.TTIIPSRMVHNWDLSPR......EVCTR.....ALWLLAQVEQEPLF.NLE
I3KKB8_ORENI/353-554WYYCQ-------------.S--C.HQDN.SFLIPARLLHNWDTSKH......KVSKQ.....AKEFLEFVYEEPLL.DIQ
B9I3B8_POPTR/793-999QLFCS-------------.S--C.HTNE.TAVLPARVLHYWDFNQY......PVSHL.....AKSYLDSIHEQPML.CVS
H2LST4_ORYLA/718-919RYFCQ-------------.C--C.HENA.QAVVPGRVLRKWDFSKY......YVSNF.....ARDLLSKIAGDPLF.NPN
T1L0C9_TETUR/212-411KYYCQ-------------.K--C.HSGD.TAVIPARIIHNWDFLPR......PVSKK.....SLLTINYIRSKPILFDIL
U1MIB3_ASCSU/827-1027KYYCE-------------.G--CSRKGE.TSVIPSRLIHNWDFQAR......PVCRA.....NMSFINAIADRPII.RID
H3FHB7_PRIPA/340-564AVFCM-------------.C--C.SFSA.KGVVPARILFHWNFREC......PLSDR.....AAAFLSQVYEKPVI.RMS
K7J291_NASVI/486-684DYFCC-------------.N--C.MSGE.EYLIPARVIHNWDLKRY......PVCIK.....AAKYLSE..CSTLL.DLK
F6S0C5_XENTR/726-926KYFCQ-------------.C--C.HENA.QSVIPGRIIRKWDFSKY......YVSNF.....SKDLLTKIWSDPLF.NLQ
F6ZX35_XENTR/773-974LYYCE-------------.W--C.HQDE.GSVIPSRMVHNWDLTEQ......AVSRP.....ALKFLNMVLNEPII.NVP
F4PGY6_DICFS/902-1102DWYCT-------------.T--C.HQND.KMILPSRIVNHWDFKVY......PICTQ.....AKLYITQHYSIPV..DIF
W5N6E1_LEPOC/842-1043MYYCD-------------.G--C.HRGD.VSVIPSRIIHNWDLSLR......EVSRK.....ALRFLSQIAHEPLI.DVE
A3KNA4_DANRE/635-836QQFCD-------------.S--C.HQGD.MSIIPSRMLHNWDLKTR......EVSRQ.....AFKLLTQIEHEPLL.NLA
E0VEL0_PEDHC/612-811KYFCT-------------.G--C.HSNQ.LSVIPGHILFKWSFKRH......PVSNF.....SYRLIDQMLTDPLF.PVK
E9CAV8_CAPO3/1008-1238RLLCS-------------AC--C....DRNFVIPARIVQRGDLTPH......VVCQA.....CEAHLQCHLYAPLI.ELN
F4WPF9_ACREC/488-687DYYCS-------------.K--C.MAEG.QYLIPSRMIHNWDLKQY......SISRK.....AASYLEG..KPALL.DIK
W5QGD3_SHEEP/744-931..YCT-------------.T--C.SQNG.TCCTLSQVLGDW.FA........YLCMFMPRSSSHSL......QPLT.LVQ
K7IQS8_NASVI/225-427LYYCQ-------------.R--C.HWNS.VAVIPARIIRNWDMEPR......KVSRA.....AYQLLTLLQNKPVL.MLD
B7ZBN5_HUMAN/293-492KYFCD-------------.C--C.HSYA.ESCIPARILMMWDFKKY......YVSNF.....SKQLLDSIWHQPIF.NLL

PF02591

D7CW01_TRURR/196-228--RCG--------------G--C------NVRLPIHVVQKA....R----------------------------------
E8RBW9_DESPD/198-230--VCQ--------------G--C------YMALPPQQVNEV....R----------------------------------
D5USN8_TSUPD/203-237--RCG--------------A--C------RLELDRGFLDTV....A----------------------------------
H8KX59_SOLCM/203-235--SCS--------------G--C------FNKIPPQRQADI....R----------------------------------
H2K064_STRHJ/154-188--TCQ--------------G--C------RQELAITELNEI....R----------------------------------
A6GYY0_FLAPJ/207-239--ASA--------------G--S------FFTIPPQIQMEI....A----------------------------------
A0R095_MYCS2/203-237--RCG--------------A--C------RIEIDRGEIARI....T----------------------------------
F4GK73_SPICD/198-230--VCQ--------------G--C------HMTLPVQFVNTV....R----------------------------------
D9QBM9_CORP2/199-233--SCG--------------G--C------FIILPPADISMI....R----------------------------------
D3SLT3_THEAH/194-225--TCS--------------Y--C------GTKLPSSLYSKV....I----------------------------------
C7M0A3_ACIFD/194-225--RCS--------------A--C------HMELSGAVLGAV....A----------------------------------
E1WZY1_BACMS/198-230--KCS--------------R--C------RFEASSSQVAEI....E----------------------------------
A1AU73_PELPD/198-230--YCL--------------G--C------NMNLPPQLFNTL....Y----------------------------------
H6L2M2_SAPGL/209-241--SCG--------------G--C------FNHIPPQTQLEI....N----------------------------------
B2V9X7_SULSY/199-231--VCT--------------G--C------YMVIPPKIFTEL....L----------------------------------
D6Z574_DESAT/198-230--VCR--------------G--C------FMNIPPQLYNDL....L----------------------------------
F0SP42_PLABD/198-229--ACN--------------N--C------FLQLTPQQRILI....K----------------------------------
C7LXG6_DESBD/201-233--VCL--------------G--C------HVVIPPQAFIDL....Q----------------------------------
B5HBP1_STRPR/205-239--RCE--------------G--C------QLELNITELNEV....R----------------------------------
A4J7B5_DESRM/199-231--ACS--------------G--C------HLGISFDKVKEL....K----------------------------------
E3IZA7_FRASU/205-239--RCE--------------G--C------HLELSGAELREV....A----------------------------------
F2NIX1_DESAR/198-230--VCQ--------------A--C------HMNLPPQQFIEL....Q----------------------------------
D7WEF2_9CORY/185-219--TCG--------------S--C------FLQLPPAERNEV....L----------------------------------
Q1MR74_LAWIP/201-233--VCG--------------G--C------HIVVPPQTYIEL....Q----------------------------------
C6VSB1_DYAFD/203-235--ACG--------------G--C------FSIVPPQRQADI....R----------------------------------
Q310X1_DESAG/201-233--ICS--------------G--C------HIAIPPQSFIDL....Q----------------------------------
B3QVG4_CHLT3/224-255--ACS--------------G--C------NTRVPTNRHAFI....L----------------------------------
O67273_AQUAE/199-231--ACA--------------G--C------GIKIPSVLLSKM....I----------------------------------
E4NAI7_KITSK/204-238--RCE--------------G--C------RTEFSITEFNAI....K----------------------------------
Q2LRB2_SYNAS/198-230--VCG--------------G--C------HMNIPPQLYNEL....Q----------------------------------
A7ZDY4_CAMC1/198-230--ACY--------------G--C------FMQINDKTFSAV....V----------------------------------
D1BFS0_SANKS/205-239--RCE--------------G--C------QLDMNQTDLSAI....R----------------------------------
D3PKG4_MEIRD/209-241--RCT--------------A--C------NVQLPMHVAQQV....H----------------------------------
F8E5M6_FLESM/198-230--TCT--------------G--C------YMKVPPQLYVEV....K----------------------------------
E1R070_OLSUV/200-232--VPS--------------V--C------RVKLQPGLYSDV....R----------------------------------
Q8FNL0_COREF/200-234--SCG--------------G--C------AMVLPAGMVSEV....R----------------------------------
E4TJQ2_CALNY/198-230--VCS--------------G--C------YMKIPPQLYVEV....K----------------------------------
C8W3J9_DESAS/199-229--ICS--------------G--C------HIGLSSGDAQKI....K----------------------------------
F7UUL4_EEGSY/204-236--SCG--------------V--C------RMVIEGGHLIDM....K----------------------------------
G8QW58_SPHPG/201-233--ICQ--------------G--C------HIVLPIQFVNDV....R----------------------------------
Q1IH82_KORVE/197-229--MCM--------------G--C------RVYLRPQVLQHV....H----------------------------------
F2IHQ3_FLUTR/210-242--SCG--------------G--C------FNKIPPQRQLDI....D----------------------------------
Q39YN1_GEOMG/198-230--NCS--------------G--C------NMNLPPQLYNSL....F----------------------------------
Q3A145_PELCD/203-235--NCT--------------G--C------HMHLPPQLFNSL....F----------------------------------
D6ZCR4_SEGRD/202-236--KCG--------------A--C------RLELTVSQMAEM....S----------------------------------
F0JJ48_DESDE/199-231--VCS--------------G--C------NIMIPPQAYNDL....Q----------------------------------
C7R4X6_JONDD/205-239--QCG--------------G--C------RLDLNAGDLDAI....R----------------------------------
B8E091_DICTD/203-234--VCE--------------G--C------KIAIPKVVLERV....K----------------------------------
D0LJD1_HALO1/197-229--TCL--------------G--C------HMALPPQLNNTL....A----------------------------------
B8FBL1_DESAA/198-230--VCK--------------A--C------HMGIPPQIYNEL....Q----------------------------------
D2QM72_SPILD/203-235--ACG--------------G--C------FNVVPPQRQADI....K----------------------------------
A1TB60_MYCVP/203-237--RCG--------------A--C------RIEIDQGESARI....A----------------------------------
I0AGC4_IGNAJ/198-230--ACS--------------G--C------HNIIPSQRQLEI....R----------------------------------
H5XB79_9PSEU/203-237--RCG--------------A--C------QLELDRAAIAEI....K----------------------------------
Q82B29_STRAW/154-188--RCE--------------G--C------HIELNITELNDV....R----------------------------------
F4CPL6_PSEUX/204-238--RCG--------------A--C------RLELDRTFIGQL....R----------------------------------
D9SW71_CLOC7/134-166--RCS--------------A--C------KHKIEDNEIYNI....N----------------------------------
F8KR50_HELBC/198-230--ACG--------------G--C------FIRINDRTYAEL....L----------------------------------
F2NRR6_TRES6/199-231--VCD--------------G--C------HMILPAQFANEV....H----------------------------------
H6RR27_BLASD/204-238--QCQ--------------G--C------RIELNGRELAAV....R----------------------------------
I0IQZ1_LEPFC/205-237--ACE--------------S--C------RITLPPRTVTEV....K----------------------------------
E8WWT9_ACISM/197-231--KCT--------------A--C------QMMLRPQRWNDIR..ER----------------------------------
B2HHN3_MYCMM/203-237--RCG--------------A--C------RIEIGRSELARI....S----------------------------------
D3Q8L5_STANL/203-237--RCE--------------S--C------RLEQSGAELADL....R----------------------------------
F4L5M1_HALH1/205-237--SCG--------------G--C------FNKIPPQVQLEI....S----------------------------------
E2SAW4_9ACTO/217-251--RCE--------------G--C------RLEINGADLREI....A----------------------------------
F8A8B3_THEID/198-230--VCD--------------G--C------HMNIPPQLYNEL....Q----------------------------------
C7QEZ0_CATAD/213-247--RCD--------------G--C------RLELDISEVNAI....K----------------------------------
C0QXL6_BRAHW/236-268--KCS--------------A--C------NVAIPKMTVNEV....R----------------------------------
E6X1V8_NITSE/198-230--ACY--------------G--C------YLKISDKTYSDV....I----------------------------------
C4LHY9_CORK4/204-238--VCQ--------------G--C------HMSLDNATLTAF....R----------------------------------
D1ABL3_THECD/205-239--RCQ--------------G--C------HLALNTVDLNRI....R----------------------------------
A5N6R6_CLOK5/198-230--VCL--------------G--C------KMKVSAMTIDNV....K----------------------------------
Q6AFH8_LEIXX/202-236--VSM--------------G--S------NVTLTESDLAEI....R----------------------------------
E3M712_CAERE/151-185--VSE--------------G--S------NMALAPAELMTI....R----------------------------------
Q892T4_CLOTE/202-233--VCD--------------G--C------KIRVAYEIKSEL....N----------------------------------
E4TZZ4_SULKY/198-230--ACM--------------G--C------YMAISDKVYSDV....I----------------------------------
F8C3W2_THEGP/198-230--VCE--------------G--C------HMAIPPQLYNEL....Q----------------------------------
D4H0K2_DENA2/198-230--TCT--------------G--C------YIKVPPQLYVEV....V----------------------------------
D1BU89_XYLCX/205-239--RCE--------------G--C------GLELNPGDLAVA....R----------------------------------
A0LTB4_ACIC1/195-229--QCQ--------------G--C------HLTLNPADLQRI....R----------------------------------
A1R7D0_ARTAT/204-238--KSE--------------G--S------GMMLSPGDLAEV....K----------------------------------
C0QQ58_PERMH/198-230--TCT--------------G--C------FMIIPPKVYSEL....V----------------------------------
F5XSN4_MICPN/218-252--RCT--------------G--C------RLEVNAADLRAF....A----------------------------------
B4U7G6_HYDS0/196-229--ACS--------------Y--C------GTILPIDFYNRL....I----------------------------------
A9GWK4_SORC5/199-231--TCL--------------G--C------HLSVPPMMFQKM....R----------------------------------
I0I5N9_CALAS/197-230--ACS--------------A--C------NMALPTGVISHA....R----------------------------------
E6SCX3_INTC7/204-238--RCG--------------G--C------RLELNNVDLDRI....R----------------------------------
D9QVH7_ACEAZ/200-232--YCM--------------G--C------RVGLPAKLIEDV....R----------------------------------
B0VEU1_CLOAI/198-230--SCG--------------A--C------GFVIRQQMRIEL....Q----------------------------------
E3PSL8_CLOSD/197-229--VCE--------------I--C------HMTLSTSLIEKV....E----------------------------------
D5SMG3_PLAL2/198-229--SCS--------------A--C------YLQLTQQLFMEL....R----------------------------------
B5YKU4_THEYD/198-230--ICQ--------------G--C------FLHIPPQLYVEI....K----------------------------------
F2N9J7_CORGP/199-231--TPS--------------I--C------RTTLQPSSLADI....R----------------------------------
A5D3S3_PELTS/200-232--TCM--------------G--C------RVAIPFNDLRLL....K----------------------------------
B1ZR74_OPITP/55-87--VCS--------------G--C------HLRVASGIVAAL....A----------------------------------
D2PXM0_KRIFD/210-244--RCM--------------G--C------RMELAPSDLNQI....K----------------------------------
F4KM12_PORAD/213-245--ACG--------------G--C------FNHIPPQRQLEV....K----------------------------------
Q4JWH7_CORJK/209-246--TCQ--------------A--C------FMELDPLSLKEI....D----------------------------------
A4FA30_SACEN/202-236--RCG--------------A--C------RIELDRSALAEV....R----------------------------------
D5V694_ARCNC/198-230--ACY--------------G--C------FMKISDQTYAEI....I----------------------------------
G8S6I4_ACTS5/202-236--RCG--------------A--C------RIELYGADLNRV....K----------------------------------
F4H288_CELFA/205-239--RCE--------------G--C------RLELNPLDLDAI....R----------------------------------
C1A4A7_GEMAT/199-231--SCG--------------A--C------DTAIPTQRRLAM....A----------------------------------
C8WAM4_ATOPD/199-231--VPS--------------V--C------RVKLQPSSFYDL....Q----------------------------------
F4LT01_TEPAE/203-235--KCS--------------G--C------MTEISVMIALEV....K----------------------------------
F6FX24_ISOV2/205-239--RCE--------------G--C------RLELNAGDLAAV....R----------------------------------
D6E737_9ACTN/204-236--RCG--------------V--C------RTVIDGGRLIDL....K----------------------------------
B2A1Z6_NATTJ/202-233--VTC--------------A--C------GLELSTERYSRL....Q----------------------------------
I0GKK5_CALEA/198-232--HCG--------------N--C------GVKLPIEFVEFL....K----------------------------------
E8T3Z5_THEA1/196-230--ACE--------------G--C------GMTFSPAEFKELLKNLT----------------------------------
F0RPE1_DEIPM/221-254--RCS--------------A--C------NVSLPVNIQQRV....S----------------------------------
D7B0S9_NOCDD/205-239--RCG--------------G--C------KLALSTVELNEI....R----------------------------------
I0IBX2_PHYMF/204-237--TCG--------------G--C------YMSLPVQAVNAT....L----------------------------------
B9M160_GEODF/198-230--CCL--------------G--C------NMNLPPQVYNLL....F----------------------------------
A6WDB0_KINRD/205-239--RCE--------------G--C------RLELNASDLGVI....R----------------------------------
E1QGT3_DESB2/198-230--SCG--------------V--C------HMNMPPQQYNEL....Q----------------------------------
F0S1X1_DESTD/196-230--ACE--------------G--C------GITYSSAEYRELLSKLK----------------------------------
D2B5L8_STRRD/204-238--RCL--------------G--C------RTSLSIAEINRI....K----------------------------------
C7N548_SLAHD/204-236--RCS--------------V--C------RTAVDADRLLSV....K----------------------------------
G0HE53_CORVD/203-237--TCR--------------C--C------CIELDHSAARRI....A----------------------------------
D7GEZ5_PROFC/205-239--RCG--------------G--C------GLEIDSAELHRI....A----------------------------------
E8R2V5_ISOPI/212-244--VCT--------------G--C------YVQITQQSFNDL....H----------------------------------
C8WYS1_DESRD/201-233--ICC--------------G--C------NISIPPQKFNEL....Q----------------------------------
H1XNL8_9BACT/198-230--VCG--------------G--C------FSHIPPQKIVEV....R----------------------------------
H6RB51_NOCCG/203-237--RCG--------------A--C------RIELDRGEIARI....A----------------------------------
F5YHY4_TREPZ/200-232--VCM--------------G--C------HMILPAQFANLV....R----------------------------------
E8N603_ANATU/201-233--SCS--------------A--C------GATIRASEVQAA....R----------------------------------
B1H0J8_UNCTG/201-233--SCE--------------C--C------GMMLRPQLINQA....Y----------------------------------
B1ZTK1_OPITP/198-236--KCG--------------G--C------HLKVSSEVESAS....R----------------------------------
Q47NI2_THEFY/205-239--RCE--------------G--C------KLQLSAAELREM....R----------------------------------
D5EJ60_CORAD/200-232--KCG--------------G--C------HLRVSNEVSRDA....M----------------------------------
Q02AV0_SOLUE/198-230--RCT--------------A--C------HIVLRLQYFQDL....K----------------------------------
D6Y3S0_THEBD/204-238--RCL--------------G--C------QTALSIADLNAI....R----------------------------------
Q9RXL9_DEIRA/202-235--RCS--------------A--C------NVMLPVNVQQKV....A----------------------------------
F8DZM6_CORRG/160-194--TCQ--------------G--C------FMELDPMTMKEF....R----------------------------------
C7MNB6_CRYCD/204-236--RCG--------------A--C------RSTIEPNRFLQV....E----------------------------------
Q3AEW5_CARHZ/190-223--TCY--------------G--C------FMSLPFELTKKLKLGQG----------------------------------
F6DN00_DESRL/200-232--VCS--------------G--C------HLAINFDKLKQL....K----------------------------------
E8NEW2_MICTS/211-245--ACE--------------A--C------RMVLPPSDLANV....R----------------------------------
D2R6Q9_PIRSD/198-229--TCG--------------G--C------FTMLSPQTIDQL....R----------------------------------
A1SI89_NOCSJ/192-226--RCT--------------G--C------QLGIDNAELAVI....K----------------------------------
F3ZEA3_9ACTO/247-281--RCE--------------G--C------RLELNITEANEV....K----------------------------------
D5MKY7_9BACT/198-230--SCE--------------G--C------HVTLTPQLYLEI....R----------------------------------
D5XA06_THEPJ/201-235--TCT--------------G--C------NMVLSIETVKRL....K----------------------------------
C1CYG9_DEIDV/201-234--RCT--------------G--C------NVVLPVNVQQRA....A----------------------------------
Q6AQL1_DESPS/198-230--VCQ--------------G--C------YMAIPPQRYNML....L----------------------------------
F6EEJ8_AMYSD/203-237--RCG--------------A--C------RIELDRGELERI....K----------------------------------
A9WV12_RENSM/203-237--TSE--------------G--S------GMQLSPGDLADL....A----------------------------------
B2GJM7_KOCRD/206-240--TCG--------------A--C------GTRLSPADAAALEATPE----------------------------------
D8PBZ4_9BACT/198-230--ICV--------------G--C------RLQLPPQLVSQV....K----------------------------------
B2UPD4_AKKM8/206-238--HCG--------------G--C------HMVITDNARMKV....L----------------------------------
C8XD03_NAKMY/205-239--RCE--------------A--C------RMDLDRSALNDI....W----------------------------------
D8K3D7_DEHLB/196-227--ICR--------------A--C------GIAVTVAWLHRA....R----------------------------------
A8ZUC1_DESOH/203-235--VCQ--------------G--C------FMNIPPQTYNEL....H----------------------------------
B3E3Z4_GEOLS/198-230--SCM--------------G--C------NMQLPPQLYNML....F----------------------------------
A0LHK0_SYNFM/198-230--VCQ--------------V--C------HLNIPPQKFIEL....Q----------------------------------
C9ZFS7_STRSW/154-188--TCQ--------------G--C------RQELSITDFNDV....R----------------------------------
B3ERJ2_AMOA5/203-235--ACG--------------G--C------FTIIYPQMQAEI....K----------------------------------
H9UJ68_SPIAZ/199-231--TCS--------------G--C------HMMLPNQLVNDV....R----------------------------------
C6WMA7_ACTMD/203-237--RCG--------------A--C------RIELDRSAIAKV....K----------------------------------
D3DIT4_HYDTT/201-232--ACG--------------G--C------GMTLPATLYSKV....V----------------------------------
D3UJC4_HELM1/198-230--ACG--------------G--C------FIRINDRVFAEV....K----------------------------------
G8NXJ9_GRAMM/202-237--KCS--------------A--C------QMMVRPQRWNDLTGREH----------------------------------
F2LX23_HIPMA/198-230--ACY--------------G--C------FMKLTPQVLTLL....E----------------------------------
E4U6K4_OCEP5/208-240--RCS--------------A--C------SVQLPTHVAQRV....Y----------------------------------
C0QJZ7_DESAH/202-234--LCR--------------G--C------FMSIPHQLYIEV....Q----------------------------------
F3ZXL4_MAHA5/200-232--KCS--------------G--C------NMSLPSAILTAV....K----------------------------------
A4XA49_SALTO/203-237--RCG--------------G--C------RLELSGADRARI....R----------------------------------
A5I614_CLOBH/200-232--VCT--------------G--C------RVRVSSMILDKI....R----------------------------------
A8EW76_ARCB4/198-230--ACY--------------G--C------FMKINDKTYAEV....L----------------------------------
B0RBZ5_CLAMS/216-247--...--------------G--S------NIALHQSDLDAL....R----------------------------------
B1MNT6_MYCA9/203-237--KCG--------------A--C------RIELDRGELARI....S----------------------------------
B1VZB7_STRGG/205-239--RCE--------------G--C------RLELNMAEVGDV....R----------------------------------
B5EBN9_GEOBB/199-230--.CM--------------G--C------NMHLPPQLYNTL....F----------------------------------
B9L658_NAUPA/198-230--ACS--------------G--C------NMKINDKIFSEV....I----------------------------------
C3PHN4_CORA7/199-233--ACG--------------G--C------FIVLPPAEQNAV....R----------------------------------
C5ZXZ9_9HELI/198-230--ACG--------------G--C------FIRINDKIYSDV....I----------------------------------
E3FII3_STIAD/206-238--TCQ--------------G--C------NMNVPPQLYNQL....R----------------------------------
E9T6R3_COREQ/203-237--RCG--------------A--C------RIEIDRGELARI....A----------------------------------
F9D1I3_PREDD/209-241--ACG--------------G--C------FNKIPPQRQLDI....K----------------------------------
G0GDN6_SPITZ/200-232--VCQ--------------G--C------FMLLPREFVNRI....R----------------------------------
G2LF52_CHLTF/198-230--TCS--------------A--C------RMRLRPQVYSLV....R----------------------------------
H6MTK0_GORPV/203-237--RCG--------------A--C------RMELDRGTLAGI....A----------------------------------
I0FDE6_BORCA/197-230--VCK--------------G--C------HMILPVEFANKV....R----------------------------------
I7GYL8_9HELI/198-230--ACG--------------G--C------FMKLNDTIYNEI....I----------------------------------
J9ZCR4_LEPFM/169-201--ACE--------------A--C------RMTLPPRTVTEV....K----------------------------------
M4ZSY7_9FLAO/214-243--...--------------G--S------YLAITPQKYSEL....I----------------------------------
O25612_HELPY/198-230--ACG--------------G--C------FIRLNDKIYTEV....L----------------------------------
O83507_TREPA/200-232--VCA--------------G--C------HMILPAQFSTGV....R----------------------------------
Q2INW5_ANADE/216-248--TCD--------------G--C------HRHIPPQLAITL....Q----------------------------------
Q3Z9J3_DEHM1/198-228--.CR--------------G--C------GLKLTPAWIQRA....R----------------------------------
Q6AA08_PROAC/204-238--VCE--------------G--C------GIATNAADLRRY....E----------------------------------
Q73N09_TREDE/199-231--VCM--------------G--C------HMILPAQFVNEV....R----------------------------------
Q7UQ03_RHOBA/205-236--SCG--------------G--C------YQTLTTQVLNQV....M----------------------------------
Q83GK9_TROWT/198-232--TCT--------------G--C------CLTLNCSDIQRW....Q----------------------------------
Q8NNG7_CORGL/200-234--SCS--------------G--C------AMVLPATGISDI....R----------------------------------
Q97JH9_CLOAB/202-233--.CG--------------G--C------RMKVSSMTIDDL....I----------------------------------
Y1638_MYCLE/190-223--RCG--------------A--C------RSEIGRGELSCI....S----------------------------------
R5ZHZ8_9ACTN/201-232--..T--------------V--C------HTALQASSMSDL....N----------------------------------
R7JLD2_9BACT/212-244--ACG--------------G--C------FNRIPPQRQMEI....R----------------------------------
U5RWI1_9CLOT/198-230--VCS--------------G--C------KMKVSAVTVDDI....K----------------------------------
V9XG76_9NOCA/203-237--RCG--------------A--C------RLELDRGEIARI....A----------------------------------
W0EZD5_9SPHI/207-239--ACG--------------G--C------FYSIPPQKQSEI....K----------------------------------
W5XSH9_9CORY/203-237--TCG--------------S--C------SMVLPPAERAAI....A----------------------------------

PF13920

B6K124_SCHJY/78-128---CF--------------I--C-------------------A-------------------------------------
YJ01_SCHPO/77-127---CF--------------I--C-------------------A-------------------------------------
Q0CN45_ASPTN/467-517---CF--------------I--C-------------------A-------------------------------------
A8Q0G3_MALGO/102-152---CF--------------I--C-------------------A-------------------------------------
Q4P332_USTMA/106-156---CF--------------I--C-------------------A-------------------------------------
C5DTT6_ZYGRC/62-112---CI--------------I--C-------------------A-------------------------------------
A5E539_LODEL/84-134---CL--------------I--C-------------------A-------------------------------------
A3LV07_PICST/58-108---CI--------------I--C-------------------A-------------------------------------
Q6BL77_DEBHA/44-94---CI--------------I--C-------------------A-------------------------------------
C4QYV6_PICPG/48-98---CI--------------I--C-------------------A-------------------------------------
Q6CMY9_KLULA/85-135---CL--------------I--C-------------------A-------------------------------------
D0N6K8_PHYIT/120-171---CI--------------L--C-------------------A-------------------------------------
C5LYS2_PERM5/156-207---CS--------------L--C-------------------M-------------------------------------
B4LJJ4_DROVI/48-98---CV--------------V--C-------------------F-------------------------------------
Q7QJY2_ANOGA/21-71---CV--------------V--C-------------------F-------------------------------------
Q54UX1_DICDI/728-773---CV--------------V--C-------------------V-------------------------------------
A7S739_NEMVE/703-752---CV--------------C--C-------------------Q-------------------------------------
Q22W29_TETTS/178-228---CV--------------V--C-------------------I-------------------------------------
Q4QHY1_LEIMA/418-463---CI--------------V--C-------------------M-------------------------------------
D2VIL5_NAEGR/915-962---CI--------------V--C-------------------M-------------------------------------
Q1RL83_CIOIN/726-771---CT--------------I--C-------------------M-------------------------------------
RNF26_HUMAN/376-428---CV--------------I--C-------------------Q-------------------------------------
D2HCL2_AILME/270-315---CV--------------V--C-------------------Q-------------------------------------
C3XYZ2_BRAFL/80-125---CV--------------V--C-------------------Q-------------------------------------
B7PQN0_IXOSC/155-200---CV--------------V--C-------------------Q-------------------------------------
C3Y345_BRAFL/524-577---CV--------------V--C-------------------Q-------------------------------------
B8C513_THAPS/1796-1843---CV--------------V--C-------------------E-------------------------------------
A7RWB7_NEMVE/452-503---CV--------------I--C-------------------A-------------------------------------
B0WTA2_CULQU/338-387---CI--------------I--C-------------------E-------------------------------------
Q5KMN2_CRYNJ/400-449---CV--------------V--C-------------------Q-------------------------------------
D0MRP4_PHYIT/742-789---CV--------------I--C-------------------L-------------------------------------
B5DIZ4_DROPS/288-334---CV--------------V--C-------------------A-------------------------------------
B0WPA5_CULQU/285-331---CV--------------V--C-------------------V-------------------------------------
Q4D380_TRYCC/244-288---CV--------------V--C-------------------F-------------------------------------
Q75HV4_ORYSJ/33-82---CV--------------I--C-------------------L-------------------------------------
MGRN1_HUMAN/274-323---CV--------------V--C-------------------L-------------------------------------
B4JL40_DROGR/312-361---CV--------------I--C-------------------M-------------------------------------
D3B0G5_POLPA/399-448---CV--------------V--C-------------------L-------------------------------------
Q55DC5_DICDI/356-405---CV--------------A--C-------------------L-------------------------------------
Q8I660_PLAF7/235-284---CV--------------I--C-------------------L-------------------------------------
Q4D0Q6_TRYCC/310-360---CV--------------I--C-------------------L-------------------------------------
Q4QHA0_LEIMA/308-357---CV--------------I--C-------------------L-------------------------------------
Q57UZ4_TRYB2/281-331---CV--------------V--C-------------------L-------------------------------------
D0MQ76_PHYIT/288-337---CI--------------I--C-------------------L-------------------------------------
Q00TM5_OSTTA/321-373---CV--------------I--C-------------------L-------------------------------------
Q4E000_TRYCC/296-345---CV--------------I--C-------------------L-------------------------------------
Q5CL02_CRYHO/210-259---CV--------------I--C-------------------L-------------------------------------
B6AAH4_CRYMR/246-295---CV--------------I--C-------------------L-------------------------------------
A4H9Q8_LEIBR/102-149---CV--------------I--C-------------------L-------------------------------------
Q4CVI6_TRYCC/107-152---CV--------------V--C-------------------M-------------------------------------
B7PKQ1_IXOSC/144-193---CV--------------V--C-------------------M-------------------------------------
B3S6I8_TRIAD/181-230---CA--------------I--C-------------------M-------------------------------------
A7S4Z9_NEMVE/255-304---CV--------------V--C-------------------M-------------------------------------
Q5CJY8_CRYHO/629-676---CL--------------I--C-------------------M-------------------------------------
C5KK04_PERM5/366-413---CM--------------I--C-------------------Y-------------------------------------
B7QP11_IXOSC/231-276---CA--------------V--C-------------------L-------------------------------------
D2VUY6_NAEGR/325-374---CV--------------V--C-------------------Q-------------------------------------
A0BTS1_PARTE/375-420---CI--------------I--C-------------------F-------------------------------------
A0DZP3_PARTE/363-408---CT--------------L--C-------------------N-------------------------------------
A0DSA8_PARTE/389-434---CI--------------I--C-------------------I-------------------------------------
B4MWC3_DROWI/221-271---CV--------------I--C-------------------M-------------------------------------
B3MJU2_DROAN/218-268---CV--------------V--C-------------------L-------------------------------------
B4KIZ8_DROMO/234-285---CV--------------V--C-------------------L-------------------------------------
B4LV95_DROVI/234-285---CV--------------V--C-------------------L-------------------------------------
B4JAJ2_DROGR/234-285---CV--------------V--C-------------------L-------------------------------------
B4G746_DROPE/150-202---CV--------------V--C-------------------M-------------------------------------
A8B237_GIAIC/880-926---CC--------------I--C-------------------M-------------------------------------
Q4CMQ0_TRYCC/661-713---CV--------------I--C-------------------L-------------------------------------
A9SHG7_PHYPA/405-450---CR--------------V--C-------------------F-------------------------------------
Q8LBF1_ARATH/416-461---CR--------------V--C-------------------F-------------------------------------
Q0J1V3_ORYSJ/63-108---CR--------------I--C-------------------F-------------------------------------
C5XC80_SORBI/53-98---CR--------------I--C-------------------F-------------------------------------
Q4N6R0_THEPA/101-150---CA--------------I--C-------------------L-------------------------------------
C5L3T8_PERM5/394-443---CK--------------V--C-------------------F-------------------------------------
C5LA51_PERM5/115-168---CS--------------V--C-------------------L-------------------------------------
C5LTS1_PERM5/447-500---CS--------------V--C-------------------L-------------------------------------
C5LZC2_PERM5/112-165---CS--------------I--C-------------------L-------------------------------------
B2YG41_MHVB/210-258---CP--------------V--C-------------------L-------------------------------------
A9SEP3_PHYPA/195-240---CR--------------V--C-------------------R-------------------------------------
B9HU58_POPTR/288-333---CR--------------A--C-------------------K-------------------------------------
B9RB10_RICCO/250-295---CR--------------A--C-------------------K-------------------------------------
B9I3B5_POPTR/306-351---CR--------------A--C-------------------K-------------------------------------
B3H4E5_ARATH/232-277---CK--------------M--C-------------------N-------------------------------------
Q4TU35_ARATH/289-334---CK--------------L--C-------------------N-------------------------------------
C5XTA8_SORBI/271-318---CR--------------W--C-------------------G-------------------------------------
C5XTB1_SORBI/370-415---CR--------------A--C-------------------G-------------------------------------
C5YFF0_SORBI/286-331---CK--------------A--C-------------------G-------------------------------------
C5YFF1_SORBI/318-363---CK--------------S--C-------------------G-------------------------------------
Q7FAF5_ORYSJ/265-310---CK--------------A--C-------------------R-------------------------------------
C5Y3U3_SORBI/280-325---CK--------------A--C-------------------G-------------------------------------
C5XTT6_SORBI/292-337---CR--------------W--C-------------------G-------------------------------------
C5WQ61_SORBI/286-331---CR--------------V--C-------------------K-------------------------------------
Q9FEA0_ARATH/275-320---CR--------------F--C-------------------G-------------------------------------
B9I0I4_POPTR/289-334---CR--------------N--C-------------------N-------------------------------------
A5C0L0_VITVI/251-297---CR--------------K--C-------------------G-------------------------------------
C5X3K2_SORBI/182-227---CK--------------V--C-------------------N-------------------------------------
B9H509_POPTR/217-262---CK--------------G--C-------------------N-------------------------------------
A9P9H0_POPTR/220-265---CK--------------R--C-------------------N-------------------------------------
B9R8C8_RICCO/222-267---CK--------------G--C-------------------S-------------------------------------
B9N2T7_POPTR/294-339---CK--------------A--C-------------------R-------------------------------------
Q9FJQ8_ARATH/249-294---CR--------------I--C-------------------R-------------------------------------
A8MRQ8_ARATH/191-237---CR--------------I--C-------------------R-------------------------------------
A8MQI2_ARATH/158-204---CC--------------N--C-------------------G-------------------------------------
A4HK37_LEIBR/127-171---CC--------------G--C-------------------G-------------------------------------
A2EXP7_TRIVA/612-657---CF--------------K--C-------------------K-------------------------------------
A0CAX1_PARTE/245-290---CF--------------Q--C-------------------K-------------------------------------
A0DHU7_PARTE/55-100---CQ--------------E--C-------------------K-------------------------------------
A0BNR4_PARTE/562-612---CK--------------A--C-------------------K-------------------------------------
A0E6W4_PARTE/182-227---CK--------------I--C-------------------K-------------------------------------
C3ZJG2_BRAFL/282-331---CT--------------V--C-------------------H-------------------------------------
C3YU07_BRAFL/338-391---CS--------------L--C-------------------G-------------------------------------
A2DIY9_TRIVA/524-575---CL--------------K--C-------------------D-------------------------------------
UNK_DROME/552-597---CM--------------K--C-------------------E-------------------------------------
A7RKQ0_NEMVE/615-660---CS--------------K--C-------------------Q-------------------------------------
A8BNV2_GIAIC/200-247---CV--------------K--C-------------------R-------------------------------------
Q4E0L2_TRYCC/240-288---CM--------------I--C-------------------H-------------------------------------
Q4QGT3_LEIMA/221-269---CM--------------L--C-------------------H-------------------------------------
B6Q7N1_PENMQ/895-945---CV--------------I--C-------------------Q-------------------------------------
Q2H0W0_CHAGB/930-980---CV--------------V--C-------------------Q-------------------------------------
C5MAE9_CANTT/731-781---CV--------------I--C-------------------Q-------------------------------------
A5D9Z2_PICGU/645-695---CV--------------V--C-------------------Q-------------------------------------
A7TKT9_VANPO/628-678---CV--------------V--C-------------------K-------------------------------------
C5DQ71_ZYGRC/577-627---CV--------------V--C-------------------K-------------------------------------
C5DI16_LACTC/585-635---CV--------------V--C-------------------K-------------------------------------
C4R866_PICPG/593-643---CV--------------V--C-------------------Q-------------------------------------
Q6C5F9_YARLI/626-676---CV--------------V--C-------------------Q-------------------------------------
Q5KKN3_CRYNJ/726-779---CV--------------V--C-------------------M-------------------------------------
B0DG87_LACBS/800-853---CV--------------V--C-------------------T-------------------------------------
A7AMT1_BABBO/791-836---CI--------------I--C-------------------F-------------------------------------
B5U8M8_CAEEL/44-94---CF--------------L--C-------------------K-------------------------------------
A8X2U5_CAEBR/166-216---CY--------------L--C-------------------K-------------------------------------
A8B9Y3_GIAIC/545-592---CV--------------V--C-------------------L-------------------------------------
D2VDZ5_NAEGR/336-381---CI--------------V--C-------------------F-------------------------------------
A0BLM2_PARTE/279-326---CQ--------------I--C-------------------Y-------------------------------------
A0BRE5_PARTE/279-326---CQ--------------V--C-------------------F-------------------------------------
A0C478_PARTE/250-299---CR--------------I--C-------------------L-------------------------------------
A0C829_PARTE/291-336---CV--------------V--C-------------------V-------------------------------------
A0CDQ4_PARTE/258-305---CV--------------I--C-------------------L-------------------------------------
IAP1_OSHVF/311-356---CV--------------I--C-------------------L-------------------------------------
A8BPS6_GIAIC/687-738---CA--------------I--C-------------------L-------------------------------------
RNGB_DICDI/893-938---CV--------------I--C-------------------A-------------------------------------
Q17FP0_AEDAE/482-527---CT--------------L--C-------------------F-------------------------------------
Q1RPV0_CIOIN/514-559---CD--------------L--C-------------------C-------------------------------------
B3WFX6_CAEEL/508-553---CT--------------I--C-------------------F-------------------------------------
A7SP45_NEMVE/135-180---CK--------------I--C-------------------F-------------------------------------
C3ZBL5_BRAFL/431-476---CN--------------L--C-------------------F-------------------------------------
D3B001_POLPA/201-250---CG--------------I--C-------------------Q-------------------------------------
Q94491_DICDI/216-265---CH--------------I--C-------------------E-------------------------------------
Q380J4_ANOGA/501-546---CP--------------I--C-------------------A-------------------------------------
Q17NT7_AEDAE/450-495---CI--------------I--C-------------------A-------------------------------------
MYLIB_DANRE/377-422---CA--------------L--C-------------------C-------------------------------------
A7RXW6_NEMVE/6-51---CQ--------------I--C-------------------M-------------------------------------
A7S3Y5_NEMVE/373-418---CK--------------V--C-------------------M-------------------------------------
C3XU73_BRAFL/384-429---CR--------------V--C-------------------M-------------------------------------
B4J320_DROGR/398-443---CK--------------I--C-------------------Y-------------------------------------
A9V149_MONBE/508-556---CS--------------Y--C-------------------Y-------------------------------------
B4J9C7_DROGR/363-408---CK--------------I--C-------------------M-------------------------------------
A8HMX4_CHLRE/2800-2846---CK--------------I--C-------------------F-------------------------------------
A9SH61_PHYPA/4592-4636---CR--------------V--C-------------------L-------------------------------------
C3ZK23_BRAFL/256-309---CA--------------V--C-------------------L-------------------------------------
A9UQI9_MONBE/498-545---CR--------------I--C-------------------L-------------------------------------
CWC24_YARLI/202-250---CP--------------I--C-------------------Q-------------------------------------
B7XK28_ENTBH/436-487---CP--------------L--C-------------------K-------------------------------------
A0D2U8_PARTE/380-428---CR--------------I--C-------------------K-------------------------------------
A8BQV1_GIAIC/497-546---CR--------------I--C-------------------R-------------------------------------
B5DJC0_DROPS/53-105---CR--------------V--C-------------------R-------------------------------------
B7QLC6_IXOSC/166-211---CI--------------V--C-------------------K-------------------------------------
C3Y1X2_BRAFL/433-483---CM--------------I--C-------------------Y-------------------------------------
D3YTR3_MOUSE/556-606---CV--------------V--C-------------------S-------------------------------------
Q29CJ9_DROPS/593-643---CF--------------V--C-------------------N-------------------------------------
A0CCL0_PARTE/398-443---CR--------------I--C-------------------M-------------------------------------
A0CBN4_PARTE/432-477---CR--------------I--C-------------------L-------------------------------------
XB34_ORYSJ/458-507---CV--------------I--C-------------------L-------------------------------------
B9NBW1_POPTR/389-438---CV--------------I--C-------------------L-------------------------------------
B9T1B4_RICCO/183-232---CI--------------I--C-------------------W-------------------------------------
A9SAM3_PHYPA/418-467---CV--------------V--C-------------------W-------------------------------------
A9TAZ5_PHYPA/309-358---CV--------------V--C-------------------W-------------------------------------
XB34_ARATH/321-370---CV--------------I--C-------------------V-------------------------------------
C1DZP8_MICSR/274-329---CV--------------V--C-------------------A-------------------------------------
A2ENP8_TRIVA/471-523---CM--------------I--C-------------------H-------------------------------------
Q9M2V1_ARATH/104-149---CM--------------L--C-------------------Q-------------------------------------
A4ID13_LEIIN/261-307---CL--------------E--C-------------------G-------------------------------------
A4HPQ0_LEIBR/260-306---CL--------------E--C-------------------G-------------------------------------
Q4D0Z8_TRYCC/234-280---CI--------------E--C-------------------R-------------------------------------
A8J0L3_CHLRE/225-274---CI--------------A--C-------------------M-------------------------------------
VF193_IIV3/153-201---CV--------------V--C-------------------Q-------------------------------------
D0NQR6_PHYIT/1091-1144---CV--------------V--C-------------------K-------------------------------------
A0D1G8_PARTE/217-265---CI--------------I--C-------------------M-------------------------------------
A2G3U3_TRIVA/649-698---CL--------------Y--C-------------------K-------------------------------------
A2DM68_TRIVA/649-698---CL--------------L--C-------------------K-------------------------------------
A2FIP7_TRIVA/650-699---CL--------------L--C-------------------R-------------------------------------
A2DDV4_TRIVA/648-697---CL--------------L--C-------------------R-------------------------------------
A4H3A8_LEIBR/832-887---CL--------------Y--C-------------------M-------------------------------------
C5KGH9_PERM5/282-328---CP--------------V--C-------------------E-------------------------------------
A9V6F0_MONBE/813-860---CR--------------F--C-------------------G-------------------------------------
A2EXP7_TRIVA/662-710---CL--------------I--C-------------------Y-------------------------------------
C1N685_MICPC/735-790---CQ--------------I--C-------------------F-------------------------------------
C1EI00_MICSR/584-639---CQ--------------I--C-------------------F-------------------------------------
A4RRY6_OSTLU/291-343---CT--------------I--C-------------------Y-------------------------------------
Q011K3_OSTTA/431-485---CT--------------I--C-------------------Y-------------------------------------
Q0E527_SFAVA/200-245---CC--------------V--C-------------------L-------------------------------------
A6QSL9_AJECN/126-171---CQ--------------I--C-------------------Y-------------------------------------
B6QDX9_PENMQ/218-270---CQ--------------G--C-------------------G-------------------------------------
B8M471_TALSN/214-267---CV--------------V--C-------------------H-------------------------------------
B8MPN3_TALSN/190-245---CV--------------L--C-------------------H-------------------------------------
A2FRF3_TRIVA/182-233---CC--------------L--C-------------------N-------------------------------------
C5LB69_PERM5/20-68---CK--------------C--C-------------------H-------------------------------------
Q4YUC0_PLABA/117-170---CP--------------L--C-------------------V-------------------------------------
Q54X17_DICDI/400-449---CG--------------I--C-------------------Q-------------------------------------
Q9SAF3_ARATH/158-206---CG--------------I--C-------------------L-------------------------------------
A8XJR9_CAEBR/19-68---CN--------------V--C-------------------F-------------------------------------
C4LX45_ENTHI/71-121---CS--------------I--C-------------------G-------------------------------------
D2VUH3_NAEGR/128-177---CF--------------L--C-------------------F-------------------------------------
A9TTF3_PHYPA/975-1020---CA--------------V--C-------------------Y-------------------------------------
D0NXH2_PHYIT/501-550---CG--------------I--C-------------------D-------------------------------------
A0CRM9_PARTE/211-262---CV--------------I--C-------------------F-------------------------------------
D0NG82_PHYIT/249-298---CS--------------I--C-------------------Y-------------------------------------
Q4H356_CIOIN/487-538---CS--------------L--C-------------------V-------------------------------------
B7QCM6_IXOSC/35-84---CR--------------L--C-------------------F-------------------------------------
B7PU01_IXOSC/401-451---CR--------------I--C-------------------F-------------------------------------
C3YRC2_BRAFL/452-502---CT--------------I--C-------------------Y-------------------------------------
C3Y6P7_BRAFL/523-572---CL--------------I--C-------------------L-------------------------------------
C3Y611_BRAFL/502-551---CA--------------I--C-------------------Y-------------------------------------
A9TMM2_PHYPA/802-851---CC--------------I--C-------------------C-------------------------------------
C5X980_SORBI/738-787---CC--------------I--C-------------------H-------------------------------------
Q6NQ80_ARATH/672-721---CC--------------V--C-------------------D-------------------------------------
B7PF95_IXOSC/251-296---CL--------------L--C-------------------H-------------------------------------
C3YRB7_BRAFL/450-503---CS--------------M--C-------------------Y-------------------------------------
Q4H355_CIOIN/499-554---CL--------------M--C-------------------F-------------------------------------
Q175J8_AEDAE/472-517---CK--------------I--C-------------------M-------------------------------------
B4QH01_DROSI/447-492---CK--------------V--C-------------------L-------------------------------------
B4MQL3_DROWI/441-485---CK--------------V--C-------------------L-------------------------------------
A1YPR8_PIG/445-490---CK--------------I--C-------------------M-------------------------------------
Q8UVF8_CHICK/442-487---CK--------------I--C-------------------M-------------------------------------
C3Z5V2_BRAFL/340-389---CK--------------I--C-------------------M-------------------------------------
C3Z5N3_BRAFL/303-352---CK--------------V--C-------------------L-------------------------------------
C3Z5V3_BRAFL/321-370---CK--------------I--C-------------------M-------------------------------------
A7T0Y6_NEMVE/281-326---CK--------------I--C-------------------M-------------------------------------
C3ZDH2_BRAFL/375-420---CK--------------V--C-------------------M-------------------------------------
C3ZDH3_BRAFL/810-855---CK--------------V--C-------------------F-------------------------------------
RF298_ARATH/756-806---CV--------------M--C-------------------L-------------------------------------
A9SWJ7_PHYPA/400-450---CV--------------M--C-------------------M-------------------------------------
Q6H4E3_ORYSJ/154-204---CV--------------I--C-------------------K-------------------------------------
Q8L7B1_ARATH/680-730---CL--------------I--C-------------------M-------------------------------------
B2YG55_MHVB/91-136---CK--------------I--C-------------------Y-------------------------------------
D3BMT8_POLPA/752-797---CV--------------I--C-------------------S-------------------------------------
D3B0G3_POLPA/301-346---CI--------------I--C-------------------Y-------------------------------------
Q55EJ5_DICDI/318-363---CS--------------I--C-------------------Y-------------------------------------
A8BYS6_GIAIC/363-409---CA--------------V--C-------------------L-------------------------------------
D2VG38_NAEGR/121-166---CI--------------V--C-------------------M-------------------------------------
332L_IIV6/181-226---CA--------------V--C-------------------L-------------------------------------
O44624_CAEEL/348-395---CC--------------I--C-------------------L-------------------------------------
A8B3E8_GIAIC/490-537---CL--------------V--C-------------------L-------------------------------------
MDM4_HUMAN/433-484---CS--------------L--C-------------------E-------------------------------------
MDM4_DANRE/439-490---CK--------------L--C-------------------R-------------------------------------
B7QMD7_IXOSC/391-442---CS--------------M--C-------------------L-------------------------------------
B3RT05_TRIAD/399-452---CM--------------I--C-------------------L-------------------------------------
D0N7P7_PHYIT/641-692---CL--------------V--C-------------------D-------------------------------------
B7S448_PHATC/563-614---CL--------------V--C-------------------L-------------------------------------
A0E576_PARTE/650-695---CK--------------I--C-------------------F-------------------------------------
Q54IT7_DICDI/506-551---CK--------------V--C-------------------W-------------------------------------
CBLA_DICDI/614-659---CT--------------V--C-------------------M-------------------------------------
D3B844_POLPA/641-686---CV--------------V--C-------------------M-------------------------------------
Q16EA4_AEDAE/37-82---CR--------------I--C-------------------M-------------------------------------
B7PKW4_IXOSC/293-338---CK--------------I--C-------------------M-------------------------------------
A7RV74_NEMVE/252-297---CK--------------V--C-------------------M-------------------------------------
Q55CM4_DICDI/373-418---CT--------------I--C-------------------F-------------------------------------
B9MVX8_POPTR/330-380---CV--------------I--C-------------------Y-------------------------------------
C5Z7Y7_SORBI/126-176---CR--------------I--C-------------------Y-------------------------------------
C7J222_ORYSJ/654-703---CV--------------V--C-------------------C-------------------------------------
C5Z1C5_SORBI/284-333---CV--------------L--C-------------------C-------------------------------------
A9SP35_PHYPA/429-478---CN--------------I--C-------------------L-------------------------------------
A4VEG7_TETTS/185-235---CA--------------I--C-------------------S-------------------------------------
A4ID13_LEIIN/107-152---CL--------------V--C-------------------M-------------------------------------
B4FE85_MAIZE/315-365---CV--------------V--C-------------------L-------------------------------------
B9GW13_POPTR/335-385---CV--------------I--C-------------------L-------------------------------------
A9S6Y2_PHYPA/371-421---CV--------------V--C-------------------L-------------------------------------
A9RL93_PHYPA/342-392---CV--------------V--C-------------------L-------------------------------------
Q9SYH3_ARATH/327-377---CV--------------I--C-------------------V-------------------------------------
A9RJ34_PHYPA/301-346---CV--------------I--C-------------------L-------------------------------------
C5X430_SORBI/292-337---CV--------------I--C-------------------L-------------------------------------
A9PFT8_POPTR/187-232---CV--------------I--C-------------------L-------------------------------------
C4LUB1_ENTHI/101-146---CK--------------V--C-------------------L-------------------------------------
A0DEI4_PARTE/163-210---CV--------------I--C-------------------L-------------------------------------
A8B9D3_GIAIC/912-958---CI--------------I--C-------------------M-------------------------------------
Q9U2C5_CAEEL/716-760---CA--------------I--C-------------------M-------------------------------------
B3RP37_TRIAD/597-642---CS--------------I--C-------------------M-------------------------------------
A8HY85_CHLRE/42-92---CI--------------I--C-------------------L-------------------------------------
Q08E63_BOVIN/672-717---CV--------------V--C-------------------L-------------------------------------
A2CF42_DANRE/670-715---CV--------------V--C-------------------M-------------------------------------
Q17KA2_AEDAE/659-704---CV--------------V--C-------------------L-------------------------------------
A7RYU6_NEMVE/694-739---CV--------------I--C-------------------L-------------------------------------
A7SA58_NEMVE/291-336---CV--------------I--C-------------------L-------------------------------------
C3YDJ4_BRAFL/246-293---CV--------------V--C-------------------Q-------------------------------------
MUL1A_DANRE/288-335---CV--------------I--C-------------------L-------------------------------------
Q580X7_TRYB2/183-230---CC--------------I--C-------------------L-------------------------------------
A9UW71_MONBE/179-233---CC--------------V--C-------------------S-------------------------------------
A8BTP5_GIAIC/508-554---CC--------------V--C-------------------I-------------------------------------
A8BF50_GIAIC/144-193---CC--------------V--C-------------------L-------------------------------------
D2W5Y2_NAEGR/234-279---CC--------------I--C-------------------M-------------------------------------
Q4E4Q1_TRYCC/67-117---CC--------------V--C-------------------H-------------------------------------
Q4D0Q3_TRYCC/308-360---CF--------------L--C-------------------L-------------------------------------
Q57UZ1_TRYB2/282-334---CH--------------L--C-------------------L-------------------------------------
Y096_OSHVF/5-50---CV--------------V--C-------------------M-------------------------------------
A8B916_GIAIC/483-532---CS--------------V--C-------------------L-------------------------------------
A8BFH4_GIAIC/417-464---CA--------------I--C-------------------L-------------------------------------
RKP_ARATH/1213-1261---CC--------------I--C-------------------Y-------------------------------------
Q7X8J6_ORYSJ/195-243---CC--------------I--C-------------------Y-------------------------------------
A7RTP5_NEMVE/1091-1139---CP--------------I--C-------------------C-------------------------------------
B4GF46_DROPE/1249-1297---CP--------------I--C-------------------C-------------------------------------
Q172Z5_AEDAE/1211-1259---CP--------------I--C-------------------Y-------------------------------------
D3BFC7_POLPA/945-993---CN--------------I--C-------------------Y-------------------------------------
A0DDH1_PARTE/752-797---CL--------------N--C-------------------D-------------------------------------
C1G5D5_PARBD/202-247---CQ--------------I--C-------------------Y-------------------------------------
B8LWU9_TALSN/1261-1306---CQ--------------I--C-------------------Y-------------------------------------
C5FIR2_ARTOC/1441-1486---CQ--------------I--C-------------------Y-------------------------------------
B6HHQ4_PENCW/1154-1199---CQ--------------I--C-------------------Y-------------------------------------
A0CXZ6_PARTE/629-674---CQ--------------I--C-------------------Q-------------------------------------
095L_IIV6/35-79---CP--------------I--W-------------------Y-------------------------------------
A0DTE6_PARTE/310-359---CI--------------V--C-------------------Y-------------------------------------
A0BIJ5_PARTE/438-487---CC--------------I--C-------------------Y-------------------------------------
A0DQT5_PARTE/433-482---CC--------------I--C-------------------F-------------------------------------
A0E0W7_PARTE/350-399---CI--------------I--C-------------------C-------------------------------------
A0BRT5_PARTE/364-413---CI--------------I--C-------------------C-------------------------------------
A0DKE3_PARTE/353-402---CI--------------I--C-------------------C-------------------------------------
A0BXR0_PARTE/306-355---CI--------------I--C-------------------C-------------------------------------
A0DCL7_PARTE/237-286---CF--------------N--C-------------------Y-------------------------------------
A0E266_PARTE/386-435---CF--------------N--C-------------------F-------------------------------------
B9QR14_TOXGO/877-926---CI--------------I--C-------------------F-------------------------------------
B6AHR5_CRYMR/424-473---CM--------------I--C-------------------Y-------------------------------------
A0D9J6_PARTE/386-435---CL--------------V--C-------------------Y-------------------------------------
A0D3H9_PARTE/407-456---CL--------------V--C-------------------Y-------------------------------------
A0DW47_PARTE/493-542---CL--------------I--C-------------------Y-------------------------------------
A0E9B5_PARTE/508-557---CL--------------V--C-------------------Y-------------------------------------
A0EDX3_PARTE/355-404---CL--------------I--C-------------------F-------------------------------------
A0E7T4_PARTE/360-409---CL--------------I--C-------------------F-------------------------------------
A0DGX9_PARTE/326-371---CV--------------I--C-------------------Q-------------------------------------
Q5CQ63_CRYPI/542-598---CN--------------I--C-------------------F-------------------------------------
B6AAB1_CRYMR/645-701---CS--------------I--C-------------------F-------------------------------------
Q6BZX0_YARLI/1057-1110---CP--------------I--C-------------------T-------------------------------------
C3ZJP1_BRAFL/454-499---CS--------------L--C-------------------H-------------------------------------
A0EEM4_PARTE/123-169---CQ--------------I--C-------------------F-------------------------------------
A0BUL0_PARTE/143-189---CQ--------------I--C-------------------F-------------------------------------
A0CHG4_PARTE/238-286---CQ--------------I--C-------------------F-------------------------------------
A0BWF0_PARTE/276-324---CQ--------------I--C-------------------F-------------------------------------
A9SFN3_PHYPA/878-930---CE--------------M--C-------------------F-------------------------------------
Q54YP5_DICDI/37-90---CD--------------I--C-------------------N-------------------------------------
Q4QBN7_LEIMA/2434-2479---CW--------------R--C-------------------L-------------------------------------
Q4DEV7_TRYCC/938-983---CW--------------L--C-------------------M-------------------------------------
B4LG30_DROVI/964-1009---CL--------------V--C-------------------S-------------------------------------
Q7PZI6_ANOGA/923-968---CL--------------L--C-------------------S-------------------------------------
B4LG30_DROVI/1011-1056---CV--------------V--C-------------------S-------------------------------------
B0WW31_CULQU/928-973---CL--------------V--C-------------------S-------------------------------------
B4KE70_DROMO/921-966---CI--------------V--C-------------------N-------------------------------------
B0WPU4_CULQU/806-851---CI--------------V--C-------------------N-------------------------------------
A2F0R0_TRIVA/448-496---CV--------------I--C-------------------M-------------------------------------
C1EAH1_MICSR/417-462---CT--------------V--C-------------------M-------------------------------------
C1MHQ3_MICPC/448-493---CT--------------V--C-------------------M-------------------------------------
Q01FP0_OSTTA/472-517---CV--------------V--C-------------------M-------------------------------------
A4H5U9_LEIBR/173-218---CV--------------I--C-------------------C-------------------------------------
A2FJR6_TRIVA/40-88---CK--------------V--C-------------------L-------------------------------------
A2FAQ1_TRIVA/178-227---CL--------------I--C-------------------C-------------------------------------
A0DUV3_PARTE/152-197---CV--------------I--C-------------------L-------------------------------------
A0CS68_PARTE/196-241---CV--------------I--C-------------------M-------------------------------------
A1A5F8_XENTR/500-547---CT--------------I--C-------------------Y-------------------------------------
A8B1R0_GIAIC/199-244---CV--------------I--C-------------------M-------------------------------------
A8B9E6_GIAIC/351-396---CC--------------I--C-------------------L-------------------------------------
A8NJ75_BRUMA/266-311---CI--------------I--C-------------------M-------------------------------------
A8PYM5_BRUMA/661-708---CR--------------I--C-------------------M-------------------------------------
B4HTJ4_DROSE/110-163---CA--------------V--C-------------------L-------------------------------------
B4QQ20_DROSI/287-331---CV--------------V--C-------------------S-------------------------------------
B9GIH6_POPTR/319-366---CV--------------I--C-------------------F-------------------------------------
B9H044_POPTR/672-720---CM--------------I--C-------------------L-------------------------------------
B9HFX4_POPTR/1219-1265---CC--------------I--C-------------------Y-------------------------------------
C5LN27_PERM5/401-452---CV--------------I--C-------------------L-------------------------------------
D7M718_ARALL/391-438---CA--------------I--C-------------------Y-------------------------------------
E1F5A9_GIAIA/347-394---CS--------------I--C-------------------L-------------------------------------
E1GAB8_LOALO/85-132---CC--------------I--C-------------------F-------------------------------------
E7KLV8_YEASL/60-109---CV--------------I--C-------------------A-------------------------------------
E7KSP0_YEASL/566-612---CA--------------V--C-------------------K-------------------------------------
F1QJY3_DANRE/300-346---CT--------------I--C-------------------L-------------------------------------
F1QZ44_DANRE/466-513---CL--------------I--C-------------------C-------------------------------------
F4IHN6_ARATH/784-831---CC--------------V--C-------------------C-------------------------------------
F4IIX4_ARATH/596-642---CC--------------V--C-------------------N-------------------------------------
F6Q0X6_CIOIN/671-715---CV--------------V--C-------------------L-------------------------------------
F6V562_XENTR/362-410---CR--------------L--C-------------------Q-------------------------------------
F6VVP4_CIOIN/828-872---CK--------------I--C-------------------L-------------------------------------
F6ZD85_XENTR/502-549---CV--------------V--C-------------------C-------------------------------------
G1R8W5_NOMLE/299-345---CV--------------V--C-------------------L-------------------------------------
H0V2W5_CAVPO/438-486---CV--------------I--C-------------------Q-------------------------------------
H0WDM0_CAVPO/460-509---CT--------------V--C-------------------F-------------------------------------
H3CQS4_TETNG/356-405---CV--------------I--C-------------------Q-------------------------------------
H3DCV6_TETNG/295-341---CV--------------I--C-------------------Y-------------------------------------
H3DPY2_TETNG/377-425---CL--------------I--C-------------------Q-------------------------------------
H9GCR3_ANOCA/96-148---CT--------------V--C-------------------L-------------------------------------
I1JLP1_SOYBN/334-381---CV--------------I--C-------------------L-------------------------------------
I1QW19_ORYGL/297-343---CR--------------T--C-------------------R-------------------------------------
J3LIJ7_ORYBR/654-701---CC--------------V--C-------------------C-------------------------------------
J9JVK3_ACYPI/243-291---CN--------------I--C-------------------F-------------------------------------
Q22CV7_TETTS/439-483---CF--------------I--C-------------------F-------------------------------------
Q22NG2_TETTS/498-543---CL--------------V--C-------------------F-------------------------------------
Q24BZ9_TETTS/694-741---CL--------------V--C-------------------F-------------------------------------
Q294I0_DROPS/710-759---CT--------------I--C-------------------Y-------------------------------------
Q388Z7_TRYB2/96-140---CV--------------V--C-------------------L-------------------------------------
U5GK99_POPTR/778-825---CC--------------I--C-------------------C-------------------------------------
V4Z7N5_TOXGO/501-545---CL--------------V--C-------------------M-------------------------------------

PF07800

M4CJA0_BRARP/50-200---CS--------------V--C-------------------M-------------------------------------
J3MK74_ORYBR/23-223---CP--------------I--C-------------------M-------------------------------------
I1K2V2_SOYBN/49-211---CS--------------V--C-------------------M-------------------------------------
W5A7C3_WHEAT/23-231---CP--------------I--C-------------------M-------------------------------------
F6HZY0_VITVI/22-260---CP--------------I--C-------------------M-------------------------------------
M7Z892_TRIUA/9-237---CP--------------I--C-------------------M-------------------------------------
Q9LRY5_ARATH/22-219---CP--------------V--C-------------------M-------------------------------------
B9GUG0_POPTR/51-216---CS--------------I--C-------------------L-------------------------------------
M1CGY7_SOLTU/46-208---CS--------------V--C-------------------M-------------------------------------
K4CU07_SOLLC/16-249---CP--------------I--C-------------------M-------------------------------------
I1N2C3_SOYBN/22-255---CP--------------I--C-------------------M-------------------------------------
I1M9R8_SOYBN/11-171---CP--------------I--C-------------------L-------------------------------------
M0RX91_MUSAM/44-191---CP--------------V--C-------------------M-------------------------------------
M4D465_BRARP/25-184---CP--------------I--C-------------------L-------------------------------------
M0U683_MUSAM/22-183---CP--------------I--C-------------------M-------------------------------------
F6H968_VITVI/49-215---CS--------------V--C-------------------M-------------------------------------
C5X4F2_SORBI/23-254---CP--------------I--C-------------------M-------------------------------------
A9SF80_PHYPA/49-210---CP--------------V--C-------------------M-------------------------------------
B9SEM7_RICCO/46-230---CP--------------V--C-------------------M-------------------------------------
M1BUR7_SOLTU/46-233---CP--------------V--C-------------------M-------------------------------------
F6HX92_VITVI/41-187---CP--------------I--C-------------------W-------------------------------------
M0RJN1_MUSAM/50-203---CP--------------V--C-------------------M-------------------------------------
M0SRW7_MUSAM/22-177---CP--------------I--C-------------------M-------------------------------------
B6SUA2_MAIZE/30-197---CP--------------I--C-------------------L-------------------------------------
I1KZC0_SOYBN/22-256---CP--------------I--C-------------------M-------------------------------------
J3KUR8_ORYBR/26-254---CP--------------I--C-------------------M-------------------------------------
M0U6C0_MUSAM/135-295---CP--------------I--C-------------------L-------------------------------------
M1CSJ9_SOLTU/45-210---CP--------------I--C-------------------L-------------------------------------
J3MH44_ORYBR/29-188---CP--------------I--C-------------------L-------------------------------------
M4E8R7_BRARP/36-202---CP--------------V--C-------------------M-------------------------------------
M0THX6_MUSAM/100-260---CS--------------I--C-------------------L-------------------------------------
I1P4P1_ORYGL/48-211---CS--------------V--C-------------------M-------------------------------------
W5C2K8_WHEAT/49-202---CP--------------I--C-------------------L-------------------------------------
W1NJC5_AMBTC/57-230---CS--------------V--C-------------------M-------------------------------------
B9SPP5_RICCO/28-184---CP--------------I--C-------------------L-------------------------------------
F6H3B5_VITVI/28-194---CP--------------I--C-------------------L-------------------------------------
J3LYB6_ORYBR/145-298---CS--------------I--C-------------------L-------------------------------------
W1P3H0_AMBTC/37-183---CT--------------V--C-------------------L-------------------------------------
K7KTN8_SOYBN/11-174---CP--------------I--C-------------------L-------------------------------------
B9SZV8_RICCO/31-193---CP--------------I--C-------------------M-------------------------------------
I1PLP2_ORYGL/49-202---CS--------------I--C-------------------L-------------------------------------
Q9LUA0_ARATH/39-255---CP--------------V--C-------------------M-------------------------------------
W1P964_AMBTC/48-238---CP--------------V--C-------------------M-------------------------------------
F6H0M7_VITVI/115-281---CS--------------V--C-------------------M-------------------------------------
B9GF75_POPTR/49-209---CS--------------V--C-------------------M-------------------------------------
K3ZTK7_SETIT/23-255---CP--------------I--C-------------------M-------------------------------------
M4DF02_BRARP/22-205---CP--------------V--C-------------------M-------------------------------------
U5D0D1_AMBTC/32-284---CP--------------I--C-------------------I-------------------------------------
F6HH69_VITVI/46-233---CP--------------V--C-------------------M-------------------------------------
I1KSC4_SOYBN/46-217---CP--------------I--C-------------------M-------------------------------------
M4D3C9_BRARP/51-199---CS--------------V--C-------------------M-------------------------------------
C5Y9B2_SORBI/49-202---CS--------------I--C-------------------L-------------------------------------
K7TN85_MAIZE/24-253---CP--------------I--C-------------------M-------------------------------------
I1LMI1_SOYBN/43-250---CP--------------V--C-------------------M-------------------------------------
M1CRX8_SOLTU/39-210---CA--------------I--C-------------------M-------------------------------------
I1NPL5_ORYGL/52-207---CP--------------V--C-------------------M-------------------------------------
B9S551_RICCO/22-258---CP--------------I--C-------------------M-------------------------------------
I1KA51_SOYBN/47-210---CS--------------V--C-------------------M-------------------------------------
K3YTM6_SETIT/49-212---CP--------------V--C-------------------L-------------------------------------
Q7XP23_ORYSJ/26-252---CP--------------I--C-------------------M-------------------------------------
W1NR99_AMBTC/24-180---CP--------------I--C-------------------L-------------------------------------
B9GTE6_POPTR/22-235---CP--------------I--C-------------------L-------------------------------------
I1HXY9_BRADI/26-254---CP--------------I--C-------------------M-------------------------------------
B9RJB2_RICCO/51-216---CS--------------V--C-------------------L-------------------------------------
B9N5I9_POPTR/46-233---CP--------------V--C-------------------M-------------------------------------
K4DHB9_SOLLC/16-172---CP--------------I--C-------------------L-------------------------------------
W1P3L7_AMBTC/42-195---CS--------------V--C-------------------M-------------------------------------
M0S465_MUSAM/48-212---CS--------------V--C-------------------M-------------------------------------

PF14570

E3KCH5_PUCGT/25-72---CP--------------L--C-------------------M-------------------------------------
C5Z2Q3_SORBI/153-202---VN--------------G--C-------------------D-------------------------------------
A9SS17_PHYPA/149-197---ME--------------G--C-------------------D-------------------------------------
A9TJ93_PHYPA/149-197---VE--------------G--C-------------------D-------------------------------------
B9GZJ8_POPTR/106-155---VP--------------G--C-------------------D-------------------------------------
A9TJ92_PHYPA/149-197---CK--------------G--C-------------------D-------------------------------------
D8R581_SELML/140-188---VE--------------G--C-------------------D-------------------------------------
A9S910_PHYPA/152-201---VV--------------G--C-------------------D-------------------------------------
C7J5V0_ORYSJ/139-187---MP--------------A--C-------------------D-------------------------------------
C5WQN8_SORBI/138-187---VE--------------G--C-------------------D-------------------------------------
B4LR99_DROVI/14-61---CP--------------L--C-------------------M-------------------------------------
D8QRL0_SELML/7-59---CP--------------L--C-------------------M-------------------------------------
E3M500_CAERE/13-60---CP--------------L--C-------------------M-------------------------------------
Q4PB17_USTMA/92-139---CP--------------L--C-------------------L-------------------------------------
B6K5B3_SCHJY/18-65---CP--------------L--C-------------------M-------------------------------------
D7TQA4_VITVI/2-51---CP--------------L--C-------------------T-------------------------------------
D8SZU2_SELML/134-182---VR--------------G--C-------------------D-------------------------------------
B7FS97_PHATC/4-51---CP--------------L--C-------------------C-------------------------------------
D8SMF9_SELML/143-191---IA--------------G--C-------------------D-------------------------------------
F2UBF0_SALR5/11-58---CP--------------L--C-------------------M-------------------------------------
D7FLE0_ECTSI/18-65---CP--------------L--C-------------------C-------------------------------------
E1Z5F3_CHLVA/7-59---CP--------------L--C-------------------C-------------------------------------
B6KGI1_TOXGO/287-334---CP--------------L--C-------------------L-------------------------------------
Q00YG3_OSTTA/4-56---CP--------------L--C-------------------C-------------------------------------
B6AF72_CRYMR/35-82---CP--------------L--C-------------------M-------------------------------------
A9RPN5_PHYPA/537-583---CP--------------I--C-------------------T-------------------------------------
A7AQF3_BABBO/19-66---CP--------------L--C-------------------M-------------------------------------
C0NRW9_AJECG/18-66---CP--------------L--C-------------------I-------------------------------------
D2V231_NAEGR/12-58---CP--------------I--C-------------------C-------------------------------------
B9R8Z9_RICCO/281-327---CP--------------I--C-------------------C-------------------------------------
Q8I569_PLAF7/125-172---CP--------------L--C-------------------V-------------------------------------
A2I1U4_TRIVA/15-62---CP--------------L--C-------------------I-------------------------------------
A9SN46_PHYPA/683-731---VV--------------N--Y-------------------Y-------------------------------------
C1FIH5_MICSR/14-66---CP--------------L--C-------------------C-------------------------------------
E4XX29_OIKDI/13-59---CP--------------L--C-------------------I-------------------------------------
D8LWI9_BLAHO/18-64---CP--------------I--C-------------------C-------------------------------------
D7KS60_ARALL/216-262---CP--------------I--C-------------------S-------------------------------------
D3B1B1_POLPA/10-57---CP--------------L--C-------------------V-------------------------------------
D8UJD3_VOLCA/6-53---CP--------------L--C-------------------V-------------------------------------
D8LZN3_BLAHO/13-59---CP--------------L--C-------------------A-------------------------------------
E1F5J3_GIAIA/12-57---CP--------------L--C-------------------C-------------------------------------
D8LYA2_BLAHO/6-52---CP--------------M--C-------------------F-------------------------------------
B9RZ22_RICCO/108-151---VP--------------A--S-------------------D-------------------------------------
C1NA27_MICPC/1777-1826---CP--------------I--C-------------------A-------------------------------------
C1ECQ0_MICSR/1869-1919---CP--------------L--C-------------------T-------------------------------------
B9IEK3_POPTR/279-325---CP--------------I--C-------------------T-------------------------------------
C5Y9X2_SORBI/268-314---CP--------------I--C-------------------C-------------------------------------
F6HT44_VITVI/117-166---IP--------------G--C-------------------D-------------------------------------
G2QHA3_THIHA/15-59---CP--------------L--C-------------------I-------------------------------------
G8YIU3_PICSO/17-66---CP--------------L--C-------------------V-------------------------------------
M1BEF9_SOLTU/138-186---MP--------------A--C-------------------D-------------------------------------
Q2QYY3_ORYSJ/12-64---CP--------------L--C-------------------A-------------------------------------
Q5KM21_CRYNJ/64-110---CL--------------L--C-------------------A-------------------------------------
CSLD1_ORYSJ/113-162---VQ--------------G--C-------------------G-------------------------------------

PF14569

B9IMB3_POPTR/27-104---CE--------------I--C-------------------G-------------------------------------
B9N4G3_POPTR/29-106---CH--------------I--C-------------------G-------------------------------------
Q06FC6_PHYPA/29-106---CQ--------------I--C-------------------G-------------------------------------
C5Z153_SORBI/31-108---CQ--------------I--C-------------------G-------------------------------------
B9SUE6_RICCO/13-88---CQ--------------I--C-------------------S-------------------------------------
J3LUK4_ORYBR/29-106---CQ--------------I--C-------------------G-------------------------------------
W5A591_WHEAT/10-81---CR--------------A--C-------------------G-------------------------------------
M0SYV1_MUSAM/33-104---CR--------------V--C-------------------G-------------------------------------
M4EY24_BRARP/19-90---CR--------------I--C-------------------R-------------------------------------
D8QPL4_SELML/26-103---CQ--------------I--C-------------------G-------------------------------------
D8QXH9_SELML/28-105---CQ--------------I--C-------------------G-------------------------------------
M0S2A0_MUSAM/9-84---CQ--------------I--C-------------------G-------------------------------------
A9T9M4_PHYPA/2-79---CQ--------------I--C-------------------G-------------------------------------
M0TNJ9_MUSAM/32-107---CQ--------------I--C-------------------G-------------------------------------
D7LYB5_ARALL/10-86---CQ--------------I--C-------------------S-------------------------------------
D8R892_SELML/26-103---CQ--------------I--C-------------------G-------------------------------------
K4BTR6_SOLLC/29-106---CK--------------I--C-------------------G-------------------------------------
W1PN60_AMBTC/29-106---CQ--------------I--C-------------------G-------------------------------------
D7LL56_ARALL/30-109---CQ--------------I--C-------------------G-------------------------------------
U5DBY3_AMBTC/12-84---CC--------------V--C-------------------G-------------------------------------
I1KTE1_SOYBN/29-106---CQ--------------I--C-------------------G-------------------------------------
CESAA_ARATH/23-100---CQ--------------I--C-------------------G-------------------------------------
F6HB61_VITVI/10-87---CQ--------------I--C-------------------G-------------------------------------
I1KRK2_SOYBN/23-97---CR--------------V--C-------------------S-------------------------------------
I1N137_SOYBN/29-106---CQ--------------I--C-------------------G-------------------------------------
T1MB14_TRIUA/28-100---CQ--------------F--C-------------------G-------------------------------------
K4A562_SETIT/14-87---CQ--------------I--C-------------------G-------------------------------------
M1BV52_SOLTU/29-106---CQ--------------I--C-------------------G-------------------------------------
B9GRE7_POPTR/26-98---CR--------------V--C-------------------G-------------------------------------
M4D4E1_BRARP/29-106---CQ--------------I--C-------------------G-------------------------------------
A9RUW7_PHYPA/28-105---CQ--------------I--C-------------------G-------------------------------------

PF13923

A0DM57_PARTE/251-296---CL--------------Y--C-------------------G...----------------------------------
A0CF54_PARTE/232-272---CD--------------Y--C-------------------N...----------------------------------
A0DM57_PARTE/106-151---CY--------------E--C-------------------N...----------------------------------
B4MJI2_DROWI/170-219---CP--------------V--C-------------------A...----------------------------------
A7ANP1_BABBO/364-410---CI--------------V--C-------------------N...----------------------------------
B6QUC4_PENMQ/146-199---CN--------------I--C-------------------V...----------------------------------
E3VZ59_MIMIV/451-490---CF--------------I--C-------------------T...----------------------------------
A8NIA6_COPC7/186-227---CG--------------I--C-------------------F...----------------------------------
A0D443_PARTE/1032-1078---CC--------------Y--C-------------------L...----------------------------------
D0NMN9_PHYIT/121-160---CP--------------I--C-------------------M...----------------------------------
Q98RQ9_GUITH/394-432---CP--------------V--L-------------------K...----------------------------------
Q543N0_MOUSE/481-525---CA--------------S--C-------------------K...----------------------------------
B6K3X8_SCHJY/273-310---CR--------------I--C-------------------G...----------------------------------
A4RSH1_OSTLU/377-416---CP--------------L--C-------------------R...----------------------------------
B7GAH4_PHATC/361-398---CS--------------L--C-------------------R...----------------------------------
Q4S075_TETNG/294-332---CP--------------L--C-------------------R...----------------------------------
C0HB20_SALSA/295-333---CP--------------L--C-------------------C...----------------------------------
B0R157_DANRE/295-333---CP--------------I--C-------------------R...----------------------------------
A9RSM9_PHYPA/340-378---CP--------------L--C-------------------L...----------------------------------
Q9AV73_ORYSJ/315-353---CP--------------L--C-------------------C...----------------------------------
B9IPB1_POPTR/334-372---CP--------------L--C-------------------S...----------------------------------
D3B863_POLPA/337-374---CP--------------L--C-------------------L...----------------------------------
A8NT78_BRUMA/274-312---CP--------------L--C-------------------L...----------------------------------
B4KF78_DROMO/244-282---CP--------------V--C-------------------L...----------------------------------
A0NDZ1_ANOGA/262-300---CP--------------I--C-------------------L...----------------------------------
Q176A8_AEDAE/263-301---CP--------------L--C-------------------L...----------------------------------
Q8RXZ1_ARATH/147-188---CP--------------I--C-------------------Y...----------------------------------
D0MZ54_PHYIT/581-619---CI--------------S--C-------------------H...----------------------------------
B5DJC0_DROPS/57-98---CR--------------V--C-------------------R...----------------------------------
B5X7I0_SALSA/75-116---CP--------------T--C-------------------K...----------------------------------
D2VUH3_NAEGR/132-170---CF--------------L--C-------------------F...----------------------------------
B0WU64_CULQU/24-64---CQ--------------I--C-------------------L...----------------------------------
B0W2B0_CULQU/33-78---CT--------------I--C-------------------L...----------------------------------
A0DWJ9_PARTE/15-53---CF--------------I--C-------------------L...----------------------------------
A9TT99_PHYPA/344-383---CF--------------I--C-------------------L...----------------------------------
B0WPL9_CULQU/34-73---CF--------------I--C-------------------M...----------------------------------
Q95LW3_MACFA/15-54---CF--------------I--C-------------------M...----------------------------------
RAD5_USTMA/1108-1153---CP--------------I--C-------------------L...----------------------------------
B5DJ77_DROPS/211-249---CS--------------L--C-------------------Q...----------------------------------
A7S6I7_NEMVE/19-58---CP--------------I--C-------------------Q...----------------------------------
Q380J4_ANOGA/505-539---CP--------------I--C-------------------A...----------------------------------
B7FWC6_PHATC/205-239---CP--------------C--C-------------------L...----------------------------------
A0CU32_PARTE/80-120---CP--------------I--C-------------------S...----------------------------------
Q4RPK4_TETNG/757-803---CS--------------I--C-------------------F...----------------------------------
A5DDL0_PICGU/810-861---CP--------------L--C-------------------Y...----------------------------------
B7FWI3_PHATC/1595-1637---CV--------------V--C-------------------L...----------------------------------
B0E743_ENTDS/974-1011---CF--------------I--C-------------------C...----------------------------------
A4RRY6_OSTLU/295-336---CT--------------I--C-------------------Y...----------------------------------
A9SNH3_PHYPA/1197-1234---CT--------------I--C-------------------Y...----------------------------------
C5X2L6_SORBI/68-105---CC--------------I--C-------------------Y...----------------------------------
A7RTP5_NEMVE/1095-1132---CP--------------I--C-------------------C...----------------------------------
Q8SZS1_DROME/704-741---CP--------------I--C-------------------C...----------------------------------
C9JI97_HUMAN/366-403---CP--------------I--C-------------------Y...----------------------------------
Q172Z5_AEDAE/1215-1252---CP--------------I--C-------------------Y...----------------------------------
A8BQV1_GIAIC/501-539---CR--------------I--C-------------------R...----------------------------------
Q4H356_CIOIN/491-531---CS--------------L--C-------------------V...----------------------------------
F5HDT7_CRYNB/404-442---CV--------------V--C-------------------Q...----------------------------------
C5LKK1_PERM5/207-243---CV--------------R--C-------------------S...----------------------------------
TR64C_HUMAN/15-55---CC--------------I--C-------------------V...----------------------------------
Q070K6_CPRVZ/419-458---CV--------------I--C-------------------M...----------------------------------
A8Y1Q5_CAEBR/129-166---CN--------------A--C-------------------Y...----------------------------------
A8XWS0_CAEBR/239-284---CE--------------I--C-------------------MIQC----------------------------------
B3RT05_TRIAD/403-445---CM--------------I--C-------------------L...----------------------------------
B6JWP1_SCHJY/28-65---CP--------------I--C-------------------H...----------------------------------
B5DYA8_DROPS/159-199---CP--------------I--C-------------------F...----------------------------------
Q4N6R0_THEPA/105-143---CA--------------I--C-------------------L...----------------------------------
C3ZJG2_BRAFL/286-324---CT--------------V--C-------------------H...----------------------------------
A0C478_PARTE/254-292---CR--------------I--C-------------------L...----------------------------------
B6AHT1_CRYMR/552-588---CL--------------I--C-------------------M...----------------------------------
A2FAQ1_TRIVA/182-220---CL--------------I--C-------------------C...----------------------------------
A7RWB7_NEMVE/456-496---CV--------------I--C-------------------A...----------------------------------
C5LN26_PERM5/368-411---CV--------------I--C-------------------L...----------------------------------
A4H9Q8_LEIBR/106-142---CV--------------I--C-------------------L...----------------------------------
C1EAH1_MICSR/421-455---CT--------------V--C-------------------M...----------------------------------
Q01FP0_OSTTA/476-510---CV--------------V--C-------------------M...----------------------------------
Q5CL02_CRYHO/214-252---CV--------------I--C-------------------L...----------------------------------
D3B0G5_POLPA/403-441---CV--------------V--C-------------------L...----------------------------------
D0A5B8_TRYB9/267-305---CV--------------I--C-------------------L...----------------------------------
D0MQ76_PHYIT/292-330---CI--------------I--C-------------------L...----------------------------------
B6AAH4_CRYMR/250-288---CV--------------I--C-------------------L...----------------------------------
A8NJ75_BRUMA/268-306---CI--------------I--C-------------------M...----------------------------------
Q6P7J2_XENLA/238-276---CV--------------V--C-------------------L...----------------------------------
A0A024XFA2_PLAFC/239-277---CV--------------I--C-------------------L...----------------------------------
A4H6A2_LEIBR/307-345---CV--------------I--C-------------------L...----------------------------------
Q4D0Q6_TRYCC/314-353---CV--------------I--C-------------------L...----------------------------------
Q57UZ4_TRYB2/285-324---CV--------------V--C-------------------L...----------------------------------
Q00TM5_OSTTA/325-366---CV--------------I--C-------------------L...----------------------------------
B9IFM5_POPTR/296-334---CV--------------I--C-------------------L...----------------------------------
Q75HV4_ORYSJ/37-75---CV--------------I--C-------------------L...----------------------------------
D2J4P6_9BBAC/168-204---CV--------------I--C-------------------F...----------------------------------
C3Y345_BRAFL/528-570---CV--------------V--C-------------------Q...----------------------------------
D2GYA5_AILME/381-422---CV--------------I--C-------------------Q...----------------------------------
Q4SPD0_TETNG/381-422---CV--------------I--C-------------------Q...----------------------------------
Q0VFN3_XENTR/391-432---CV--------------I--C-------------------Q...----------------------------------
D2VUY6_NAEGR/329-367---CV--------------V--C-------------------Q...----------------------------------
B7Z8S4_HUMAN/202-239---CV--------------V--C-------------------L...----------------------------------
Q7Z0X5_PARTE/201-237---CQ--------------I--C-------------------Y...----------------------------------
Q0IF35_AEDAE/289-324---CV--------------V--C-------------------V...----------------------------------
D3TMJ3_GLOMM/290-325---CV--------------V--C-------------------T...----------------------------------
B3NG13_DROER/290-325---CV--------------V--C-------------------S...----------------------------------
C6LRH7_GIAIB/477-513---CV--------------V--C-------------------L...----------------------------------
B4P6L3_DROYA/225-264---CV--------------V--C-------------------M...----------------------------------
B4JAJ2_DROGR/238-278---CV--------------V--C-------------------L...----------------------------------
B4LV95_DROVI/238-278---CV--------------V--C-------------------L...----------------------------------
B4KIZ8_DROMO/238-278---CV--------------V--C-------------------L...----------------------------------
B4MWC3_DROWI/225-264---CV--------------I--C-------------------M...----------------------------------
A9V3B5_MONBE/31-69---CN--------------I--C-------------------L...----------------------------------
Q54X17_DICDI/404-442---CG--------------I--C-------------------Q...----------------------------------
A0BTB6_PARTE/28-67---CL--------------I--C-------------------Q...----------------------------------
A0C4H9_PARTE/27-66---CV--------------I--C-------------------E...----------------------------------
D2VJU3_NAEGR/41-75---CP--------------I--C-------------------F...----------------------------------
A0DF02_PARTE/87-127---CP--------------I--C-------------------F...----------------------------------
D2VR88_NAEGR/66-102---CS--------------L--C-------------------Y...----------------------------------
C5Z074_SORBI/182-219---CS--------------I--C-------------------Y...----------------------------------
C4LYH5_ENTHI/117-164---CS--------------I--C-------------------Y...----------------------------------
C1EGY6_MICSR/774-812---CS--------------V--C-------------------N...----------------------------------
C4V958_NOSCE/198-231---CS--------------I--C-------------------N...----------------------------------
B7ZR58_XENLA/44-80---CS--------------K--C-------------------M...----------------------------------
A9TTF3_PHYPA/979-1013---CA--------------V--C-------------------Y...----------------------------------
B7GE72_PHATC/936-974---CP--------------V--C-------------------H...----------------------------------
D3BQU7_POLPA/87-124---CP--------------I--C-------------------Q...----------------------------------
D3BF23_POLPA/30-67---CG--------------I--C-------------------L...----------------------------------
Q559R2_DICDI/23-61---CG--------------I--C-------------------L...----------------------------------
C1BTL6_LEPSM/304-342---CS--------------V--C-------------------L...----------------------------------
A7S3R4_NEMVE/22-62---CP--------------I--C-------------------T...----------------------------------
Q4Q7I1_LEIMA/35-73---CL--------------I--C-------------------A...----------------------------------
A8XJR9_CAEBR/23-61---CN--------------V--C-------------------F...----------------------------------
A0DCG8_PARTE/700-734---CP--------------I--C-------------------L...----------------------------------
Y7813_DICDI/45-87---CD--------------I--C-------------------TLEL----------------------------------
Q54YP5_DICDI/41-83---CD--------------I--C-------------------N...----------------------------------
Y2340_DICDI/33-75---CP--------------I--C-------------------E...----------------------------------
Y8444_DICDI/28-67---CS--------------I--C-------------------Y...----------------------------------
Y0965_DICDI/27-66---CP--------------I--C-------------------F...----------------------------------
Q0R0E3_9DINO/54-98---CT--------------V--C-------------------L...----------------------------------
Q16PP0_AEDAE/156-200---CA--------------V--C-------------------L...----------------------------------
C3XUC3_BRAFL/62-106---CT--------------V--C-------------------L...----------------------------------
A0BU81_PARTE/1039-1085---CP--------------I--C-------------------F...----------------------------------
A0BXR5_PARTE/42-78---CP--------------I--C-------------------L...----------------------------------
Q9CA44_ARATH/200-234---CR--------------V--C-------------------F...----------------------------------
SINA1_ARATH/57-92---CP--------------V--C-------------------T...----------------------------------
B2KZF7_PICAB/132-164---CP--------------V--C-------------------L...----------------------------------
C4J1C6_MAIZE/345-377---CP--------------I--C-------------------L...----------------------------------
C0P9L7_MAIZE/211-243---CP--------------I--C-------------------M...----------------------------------
C5YMZ0_SORBI/363-395---CP--------------I--C-------------------L...----------------------------------
B5DSB0_DROPS/736-777---CD--------------I--C-------------------R...----------------------------------
D4ATB3_ARTBC/136-186---CD--------------I--C-------------------C...----------------------------------
B9H5S5_POPTR/1076-1093---CN--------------D--C-------------------W...----------------------------------
A2FYQ9_TRIVA/553-591---CL--------------L--C-------------------R...----------------------------------
A2FIP7_TRIVA/654-692---CL--------------L--C-------------------R...----------------------------------
A2G3U3_TRIVA/653-691---CL--------------Y--C-------------------K...----------------------------------
A7RKP3_NEMVE/27-64---CS--------------I--C-------------------F...----------------------------------
A0DSS8_PARTE/225-265---CY--------------A--C-------------------N...----------------------------------
A0BZ57_PARTE/273-314---CA--------------H--C-------------------K...----------------------------------
A9TTF3_PHYPA/125-171---CD--------------I--C-------------------M...----------------------------------
C1EI00_MICSR/588-632---CQ--------------I--C-------------------F...----------------------------------
C1N685_MICPC/739-783---CQ--------------I--C-------------------F...----------------------------------
C6LTE1_GIAIB/174-217---CL--------------I--C-------------------L...----------------------------------
B8M471_TALSN/218-260---CV--------------V--C-------------------H...----------------------------------
B8LVC4_TALSN/196-240---CA--------------L--C-------------------H...----------------------------------
B8MPN3_TALSN/194-238---CV--------------L--C-------------------H...----------------------------------
A7SGX8_NEMVE/16-50---CS--------------H--C-------------------R...----------------------------------
A0CTG0_PARTE/45-83---CS--------------I--C-------------------G...----------------------------------
C1FIU4_MICSR/123-173---CS--------------V--C-------------------Y...----------------------------------
Q22NC9_TETTS/55-92---CA--------------I--C-------------------L...----------------------------------
D3B001_POLPA/205-243---CG--------------I--C-------------------Q...----------------------------------
D3ZVH5_RAT/405-445---CV--------------I--C-------------------Q...----------------------------------
A0D9J6_PARTE/390-428---CL--------------V--C-------------------Y...----------------------------------
A0DW47_PARTE/497-535---CL--------------I--C-------------------Y...----------------------------------
A0E9B5_PARTE/512-550---CL--------------V--C-------------------Y...----------------------------------
C3Y1X2_BRAFL/437-476---CM--------------I--C-------------------Y...----------------------------------
D3YTR3_MOUSE/560-599---CV--------------V--C-------------------S...----------------------------------
A1A5J0_XENLA/776-814---CV--------------C--C-------------------Q...----------------------------------
A7S739_NEMVE/707-745---CV--------------C--C-------------------Q...----------------------------------
B4E0F9_HUMAN/339-377---CI--------------C--C-------------------Q...----------------------------------
UHRF1_XENLA/703-741---CI--------------C--C-------------------Q...----------------------------------
D0QWP4_DROMI/708-748---CT--------------I--C-------------------Y...----------------------------------
Q8H7Q8_ORYSJ/598-636---CC--------------I--C-------------------C...----------------------------------
A9P8M8_POPTR/64-102---CC--------------I--C-------------------Y...----------------------------------
Q6NQ80_ARATH/676-714---CC--------------V--C-------------------D...----------------------------------
C3YRC2_BRAFL/456-495---CT--------------I--C-------------------Y...----------------------------------
D2H5E9_AILME/448-487---CT--------------V--C-------------------F...----------------------------------
B4K8G5_DROMO/73-112---CN--------------V--C-------------------Q...----------------------------------
Q9VFY3_DROME/85-124---CN--------------E--C-------------------N...----------------------------------
A0EEM4_PARTE/127-162---CQ--------------I--C-------------------F...----------------------------------
A0CHG4_PARTE/242-279---CQ--------------I--C-------------------F...----------------------------------
A0BUL0_PARTE/147-182---CQ--------------I--C-------------------F...----------------------------------
A0D0Y2_PARTE/438-476---CF--------------N--C-------------------Y...----------------------------------
B9R7N4_RICCO/124-173---CT--------------I--C-------------------F...----------------------------------
D0N844_PHYIT/1002-1040---CF--------------V--C-------------------Y...----------------------------------
C5L7V9_PERM5/133-175---CP--------------V--C-------------------C...----------------------------------
Q4Z6K3_PLABA/1120-1161---CV--------------I--C-------------------L...----------------------------------
C3ZK23_BRAFL/260-302---CA--------------V--C-------------------L...----------------------------------
C1DZP8_MICSR/278-322---CV--------------V--C-------------------A...----------------------------------
B7XK28_ENTBH/440-478---CP--------------L--C-------------------K...----------------------------------
A8PYM5_BRUMA/663-701---CR--------------I--C-------------------M...----------------------------------
B9QR14_TOXGO/881-919---CI--------------I--C-------------------F...----------------------------------
A8BZD1_GIAIC/260-300---CI--------------I--C-------------------L...----------------------------------
SHPRH_MOUSE/1423-1469---CP--------------I--C-------------------A...----------------------------------
C6LP83_GIAIB/741-779---CN--------------I--C-------------------L...----------------------------------
A0DKE3_PARTE/357-395---CI--------------I--C-------------------C...----------------------------------
A0BRT5_PARTE/368-406---CI--------------I--C-------------------C...----------------------------------
Q22NG2_TETTS/499-537---CL--------------V--C-------------------F...----------------------------------
Q24BZ9_TETTS/696-734---CL--------------V--C-------------------F...----------------------------------
A0DYF8_PARTE/437-475---CC--------------I--C-------------------F...----------------------------------
A0BW00_PARTE/300-338---CI--------------V--C-------------------Y...----------------------------------
Q5C443_SCHJA/377-416---CC--------------K--C-------------------S...----------------------------------
B6JYB1_SCHJY/146-190---CP--------------A--C-------------------E...----------------------------------
A2EK74_TRIVA/538-575---CP--------------L--C-------------------E...----------------------------------
C6THX2_SOYBN/69-103---CT--------------V--C-------------------Q...----------------------------------
C3Z5U0_BRAFL/457-495---CP--------------K--C-------------------N...----------------------------------
Q7RC46_PLAYO/40-78---CP--------------E--C-------------------N...----------------------------------
A9V149_MONBE/512-549---CS--------------Y--C-------------------Y...----------------------------------
C5L4C0_PERM5/287-322---CP--------------V--C-------------------E...----------------------------------
D0NXH2_PHYIT/505-543---CG--------------I--C-------------------D...----------------------------------
Q8JRX3_9BBAC/193-232---CV--------------I--C-------------------L...----------------------------------
C6LP72_GIAIB/436-471---CC--------------I--C-------------------L...----------------------------------
Q91EW1_GVCPM/194-230---CV--------------I--C-------------------L...----------------------------------
A2ENP8_TRIVA/532-570---CQ--------------I--C-------------------C...----------------------------------
B3S6I8_TRIAD/185-223---CA--------------I--C-------------------M...----------------------------------
C6LUY8_GIAIB/168-204---CV--------------I--C-------------------L...----------------------------------
Q00XZ6_OSTTA/268-308---CS--------------I--C-------------------N...----------------------------------
D0NG82_PHYIT/253-291---CS--------------I--C-------------------Y...----------------------------------
Y118_OSHVF/78-113---CC--------------I--C-------------------M...----------------------------------
A7S4Z9_NEMVE/259-297---CV--------------V--C-------------------M...----------------------------------
A8J0L3_CHLRE/229-267---CI--------------A--C-------------------M...----------------------------------
D2VG38_NAEGR/125-159---CI--------------V--C-------------------M...----------------------------------
O82304_ARATH/657-696---CL--------------I--C-------------------M...----------------------------------
A7S2I5_NEMVE/215-252---CP--------------I--C-------------------S...----------------------------------
A9SXH9_PHYPA/400-438---CV--------------V--C-------------------W...----------------------------------
A9TAZ5_PHYPA/313-351---CV--------------V--C-------------------W...----------------------------------
XB34_ARATH/325-363---CV--------------I--C-------------------V...----------------------------------
B9ILD2_POPTR/244-282---CI--------------I--C-------------------W...----------------------------------
B9HKH1_POPTR/391-429---CV--------------I--C-------------------L...----------------------------------
A9S6Y2_PHYPA/375-414---CV--------------V--C-------------------L...----------------------------------
C5WVU4_SORBI/322-361---CV--------------V--C-------------------L...----------------------------------
B9S5Q7_RICCO/335-374---CV--------------I--C-------------------L...----------------------------------
A9NTV8_PICSI/342-381---CV--------------V--C-------------------L...----------------------------------
C6LN18_GIAIB/199-237---CV--------------I--C-------------------M...----------------------------------
B0WTA2_CULQU/342-380---CI--------------I--C-------------------E...----------------------------------
175R_IIV6/137-169---CP--------------V--C-------------------L...----------------------------------
Q5C5B5_SCHJA/135-167---CP--------------I--C-------------------L...----------------------------------
Q16NN6_AEDAE/1098-1130---CP--------------V--C-------------------F...----------------------------------
C6LSV4_GIAIB/777-820---CN--------------I--C-------------------Y...----------------------------------
A7S3Y5_NEMVE/377-411---CK--------------V--C