Sequence alignment for CL0229

PF15227

F7CME7_ORNAN/11-52--------------------------------------------------------------------------------
RFPL3_HUMAN/40-81--------------------------------------------------------------------------------
F7F323_ORNAN/11-48--------------------------------------------------------------------------------
G7PI48_MACFA/23-64--------------------------------------------------------------------------------
G3VAS7_SARHA/17-57--------------------------------------------------------------------------------
G3UB63_LOXAF/16-60--------------------------------------------------------------------------------
F6Q3T5_HORSE/11-52--------------------------------------------------------------------------------
H0XJT9_OTOGA/23-64--------------------------------------------------------------------------------
H9KWF0_CALJA/16-56--------------------------------------------------------------------------------
D6RAS2_HUMAN/16-56--------------------------------------------------------------------------------
H3CZE1_TETNG/15-54--------------------------------------------------------------------------------

PF13445

Q5XIP3_RAT/129-168--------------------------------------------------------------------------------
H2U4S0_TAKRU/12-54--------------------------------------------------------------------------------
K2SS04_MACPH/92-138--------------------------------------------------------------------------------
G1MUP8_MELGA/12-50--------------------------------------------------------------------------------
R4XGI6_TAPDE/192-231--------------------------------------------------------------------------------
W4YI58_STRPU/16-53--------------------------------------------------------------------------------
G0MPF4_CAEBE/491-535--------------------------------------------------------------------------------
F6VLT2_XENTR/28-71--------------------------------------------------------------------------------
A8XHU9_CAEBR/11-55--------------------------------------------------------------------------------
F6V6N2_XENTR/12-53--------------------------------------------------------------------------------
M2RK82_CERS8/4-45--------------------------------------------------------------------------------
A9SQJ9_PHYPA/12-64--------------------------------------------------------------------------------
G1NRB9_MELGA/10-55--------------------------------------------------------------------------------
G1R3M4_NOMLE/37-73--------------------------------------------------------------------------------
E9PJJ9_HUMAN/16-58--------------------------------------------------------------------------------
G5E5F1_BOVIN/21-57--------------------------------------------------------------------------------
K0SPM9_THAOC/145-191--------------------------------------------------------------------------------
W4Y956_STRPU/19-57--------------------------------------------------------------------------------
A0E1J7_PARTE/103-142--------------------------------------------------------------------------------
RNFT1_DANRE/359-394--------------------------------------------------------------------------------
A0BTR3_PARTE/55-96--------------------------------------------------------------------------------
A7S4D3_NEMVE/10-49--------------------------------------------------------------------------------
T1L2A6_TETUR/85-129--------------------------------------------------------------------------------
A8E7M3_DANRE/17-57--------------------------------------------------------------------------------
C4QVD1_PICPG/131-170--------------------------------------------------------------------------------
A0DRL5_PARTE/27-64--------------------------------------------------------------------------------
W5D6D5_WHEAT/162-200--------------------------------------------------------------------------------
F0ZWT0_DICPU/6-44--------------------------------------------------------------------------------
D8SZY1_SELML/288-327--------------------------------------------------------------------------------
A3LTM3_PICST/59-107--------------------------------------------------------------------------------
G3TCL0_LOXAF/21-63--------------------------------------------------------------------------------
Q22GY2_TETTS/78-114--------------------------------------------------------------------------------
W5KEH2_ASTMX/36-69--------------------------------------------------------------------------------
Q0UD97_PHANO/225-273--------------------------------------------------------------------------------
C3YS34_BRAFL/17-57--------------------------------------------------------------------------------
G0N804_CAEBE/271-314--------------------------------------------------------------------------------
I3ISM8_DANRE/14-51--------------------------------------------------------------------------------
F8PR62_SERL3/741-783--------------------------------------------------------------------------------
M4CHX3_BRARP/59-112--------------------------------------------------------------------------------
K1QS25_CRAGI/33-70--------------------------------------------------------------------------------
V8NH63_OPHHA/76-119--------------------------------------------------------------------------------
W5M316_LEPOC/54-99--------------------------------------------------------------------------------
H0W4R9_CAVPO/45-83--------------------------------------------------------------------------------
F7F374_ORNAN/11-50--------------------------------------------------------------------------------
G1KD08_ANOCA/15-54--------------------------------------------------------------------------------
X6LNY8_RETFI/31-66--------------------------------------------------------------------------------
C3XQ13_BRAFL/418-455--------------------------------------------------------------------------------
A0DYA3_PARTE/317-357--------------------------------------------------------------------------------
H2MPK1_ORYLA/10-49--------------------------------------------------------------------------------
E3NLR0_CAERE/132-173--------------------------------------------------------------------------------
C4LWT0_ENTHI/22-62--------------------------------------------------------------------------------
H2LHW9_ORYLA/18-55--------------------------------------------------------------------------------
A0A098DZP0_GIBZA/106-145--------------------------------------------------------------------------------
W5LPC4_ASTMX/14-58--------------------------------------------------------------------------------
A7RRQ3_NEMVE/16-56--------------------------------------------------------------------------------
M4B7N8_HYAAE/32-88--------------------------------------------------------------------------------
I1GDC1_AMPQE/18-59--------------------------------------------------------------------------------
K5Y1G6_AGABU/3-55--------------------------------------------------------------------------------
W4Y4S3_STRPU/40-78--------------------------------------------------------------------------------
RAD18_CANGA/27-62--------------------------------------------------------------------------------
E3N4M3_CAERE/13-40--------------------------------------------------------------------------------
C3YHG3_BRAFL/20-58--------------------------------------------------------------------------------
H2U6M1_TAKRU/11-48--------------------------------------------------------------------------------
A0CKT1_PARTE/19-57--------------------------------------------------------------------------------
W4YH05_STRPU/19-59--------------------------------------------------------------------------------
M0XDV5_HORVD/329-370--------------------------------------------------------------------------------
F7HQP6_MACMU/23-63--------------------------------------------------------------------------------
C3Y3Q8_BRAFL/823-861--------------------------------------------------------------------------------
K5X9X6_AGABU/24-64--------------------------------------------------------------------------------
H0UZE1_CAVPO/16-59--------------------------------------------------------------------------------
M0W5B0_HORVD/368-422--------------------------------------------------------------------------------
M3K141_CANMX/59-112--------------------------------------------------------------------------------
G3WXC1_SARHA/5-44--------------------------------------------------------------------------------
Q6Z8T9_ORYSJ/100-139--------------------------------------------------------------------------------
C3Z9P0_BRAFL/17-57--------------------------------------------------------------------------------
W5LW03_LEPOC/12-50--------------------------------------------------------------------------------
B6IGT1_CAEBR/2-57--------------------------------------------------------------------------------
I3MBB3_SPETR/15-53--------------------------------------------------------------------------------
Q54DE4_DICDI/7-42--------------------------------------------------------------------------------
D4ANH0_ARTBC/208-243--------------------------------------------------------------------------------
A8NFK9_COPC7/331-371--------------------------------------------------------------------------------
H2QS69_PANTR/29-79--------------------------------------------------------------------------------
E3NBL3_CAERE/246-287--------------------------------------------------------------------------------
W5PWF8_SHEEP/29-67--------------------------------------------------------------------------------
M3B3C8_SPHMS/376-416--------------------------------------------------------------------------------
C4R3V1_PICPG/327-367--------------------------------------------------------------------------------
V2WR56_MONRO/5-46--------------------------------------------------------------------------------
B5DJC3_DROPS/23-63--------------------------------------------------------------------------------
Q6MAM3_PARUW/97-138--------------------------------------------------------------------------------
A9S273_PHYPA/329-370--------------------------------------------------------------------------------
I1EPR1_AMPQE/90-125--------------------------------------------------------------------------------
I3JRP9_ORENI/20-62--------------------------------------------------------------------------------
H2ATW4_KAZAF/33-73--------------------------------------------------------------------------------
F1A268_DICPU/60-100--------------------------------------------------------------------------------
K1QL17_CRAGI/138-178--------------------------------------------------------------------------------
U5HBL1_USTV1/83-123--------------------------------------------------------------------------------
I1EV64_AMPQE/40-77--------------------------------------------------------------------------------
A9UXJ6_MONBE/34-75--------------------------------------------------------------------------------
G0PB00_CAEBE/92-135--------------------------------------------------------------------------------
K1QJ51_CRAGI/16-59--------------------------------------------------------------------------------
W5JZW7_ASTMX/23-63--------------------------------------------------------------------------------
E9GED8_DAPPU/17-57--------------------------------------------------------------------------------
F6YGB6_CALJA/15-57--------------------------------------------------------------------------------
E9J606_SOLIN/133-171--------------------------------------------------------------------------------
C3ZI51_BRAFL/16-58--------------------------------------------------------------------------------
F7VRY5_SORMK/730-765--------------------------------------------------------------------------------
F6QH43_CIOIN/18-55--------------------------------------------------------------------------------
H2S3V3_TAKRU/15-52--------------------------------------------------------------------------------
Q1JPC8_BOVIN/282-324--------------------------------------------------------------------------------
E9GEC4_DAPPU/13-57--------------------------------------------------------------------------------
M4DVG3_BRARP/196-236--------------------------------------------------------------------------------
I3NEE4_SPETR/16-54--------------------------------------------------------------------------------
M2TAV9_COCH5/15-57--------------------------------------------------------------------------------
T1EZ91_HELRO/15-55--------------------------------------------------------------------------------
D8QLY5_SCHCM/10-49--------------------------------------------------------------------------------
K3YIC8_SETIT/10-46--------------------------------------------------------------------------------
A0D4J1_PARTE/9-51--------------------------------------------------------------------------------
H9G3X6_ANOCA/17-55--------------------------------------------------------------------------------
E9I564_DAPPU/12-52--------------------------------------------------------------------------------
A5KA05_PLAVS/1738-1779--------------------------------------------------------------------------------
D7TX82_VITVI/6-49--------------------------------------------------------------------------------
G0MZV1_CAEBE/18-64--------------------------------------------------------------------------------
C3XUI1_BRAFL/14-51--------------------------------------------------------------------------------
A2EJL6_TRIVA/6-41--------------------------------------------------------------------------------
A8N8Q9_COPC7/5-46--------------------------------------------------------------------------------
C5LDU0_PERM5/132-173--------------------------------------------------------------------------------
H3BB17_LATCH/14-53--------------------------------------------------------------------------------
C3Y770_BRAFL/22-63--------------------------------------------------------------------------------
F6ZES7_MONDO/11-50--------------------------------------------------------------------------------
Q557I6_DICDI/500-535--------------------------------------------------------------------------------
E3LHN6_CAERE/165-206--------------------------------------------------------------------------------
C3XSU0_BRAFL/19-70--------------------------------------------------------------------------------
G3ILU9_CRIGR/12-48--------------------------------------------------------------------------------
W4XDD6_STRPU/19-64--------------------------------------------------------------------------------
I1EDY3_AMPQE/9-46--------------------------------------------------------------------------------
G1SZ36_RABIT/16-54--------------------------------------------------------------------------------
H3AS96_LATCH/17-57--------------------------------------------------------------------------------
C3YJ40_BRAFL/346-387--------------------------------------------------------------------------------
A8BYH8_GIAIC/88-128--------------------------------------------------------------------------------
E3QH28_COLGM/19-58--------------------------------------------------------------------------------
C3YCK8_BRAFL/18-55--------------------------------------------------------------------------------
E3MD67_CAERE/243-288--------------------------------------------------------------------------------
A2BFT4_DANRE/12-52--------------------------------------------------------------------------------
H9GCA4_ANOCA/6-45--------------------------------------------------------------------------------
K2R6E5_MACPH/29-67--------------------------------------------------------------------------------
F6Q9Y4_XENTR/12-53--------------------------------------------------------------------------------
H0XIJ0_OTOGA/11-50--------------------------------------------------------------------------------
K1R237_CRAGI/11-55--------------------------------------------------------------------------------
A5DNE9_PICGU/483-538--------------------------------------------------------------------------------
Q6IZ49_XENTR/24-60--------------------------------------------------------------------------------
T1FTH2_HELRO/43-88--------------------------------------------------------------------------------
E4XZU1_OIKDI/249-293--------------------------------------------------------------------------------
F6WZL0_MONDO/16-53--------------------------------------------------------------------------------
P91482_CAEEL/116-162--------------------------------------------------------------------------------
C4LU11_ENTHI/142-180--------------------------------------------------------------------------------
M4D5N6_BRARP/323-365--------------------------------------------------------------------------------
B6AIC5_CRYMR/509-552--------------------------------------------------------------------------------
A0A0D2WQV5_CAPO3/360-400--------------------------------------------------------------------------------
F6XK31_XENTR/26-73--------------------------------------------------------------------------------
A7RLP8_NEMVE/17-55--------------------------------------------------------------------------------
I1F402_AMPQE/15-53--------------------------------------------------------------------------------
K1QMJ9_CRAGI/17-61--------------------------------------------------------------------------------
K1QI57_CRAGI/14-58--------------------------------------------------------------------------------
A9S1L1_PHYPA/191-243--------------------------------------------------------------------------------
H2PL69_PONAB/11-50--------------------------------------------------------------------------------
C4LXJ9_ENTHI/319-354--------------------------------------------------------------------------------
W4ZVJ4_WHEAT/365-400--------------------------------------------------------------------------------
H9GBR8_ANOCA/18-57--------------------------------------------------------------------------------
RN186_MOUSE/39-82--------------------------------------------------------------------------------
HRD1_CAEEL/292-330--------------------------------------------------------------------------------
K1R2N9_CRAGI/11-51--------------------------------------------------------------------------------
B9I9W3_POPTR/164-204--------------------------------------------------------------------------------
E5S3N4_TRISP/53-97--------------------------------------------------------------------------------
E1G217_LOALO/57-95--------------------------------------------------------------------------------
A7SX53_NEMVE/329-370--------------------------------------------------------------------------------
K7JHE6_NASVI/79-123--------------------------------------------------------------------------------
E3LLW6_CAERE/25-77--------------------------------------------------------------------------------
F9XL86_ZYMTI/147-183--------------------------------------------------------------------------------
A0C1N2_PARTE/16-53--------------------------------------------------------------------------------
Q9U1S9_CAEEL/183-225--------------------------------------------------------------------------------
V5FT15_BYSSN/39-80--------------------------------------------------------------------------------
W4ZK58_STRPU/11-51--------------------------------------------------------------------------------
C3ZQ23_BRAFL/132-166--------------------------------------------------------------------------------
U3JIN8_FICAL/156-198--------------------------------------------------------------------------------
W4XDW4_STRPU/70-107--------------------------------------------------------------------------------
G0SHW4_CHATD/317-357--------------------------------------------------------------------------------
A7RQ72_NEMVE/158-198--------------------------------------------------------------------------------
F1N8I5_CHICK/24-63--------------------------------------------------------------------------------
G0MUK6_CAEBE/202-243--------------------------------------------------------------------------------
F6SDB1_XENTR/184-221--------------------------------------------------------------------------------
B0DBN6_LACBS/365-406--------------------------------------------------------------------------------
K1PUY4_CRAGI/18-64--------------------------------------------------------------------------------
A7S4Y4_NEMVE/22-62--------------------------------------------------------------------------------
T1FYV1_HELRO/274-309--------------------------------------------------------------------------------
A9UPI2_MONBE/165-203--------------------------------------------------------------------------------
A7SP16_NEMVE/14-51--------------------------------------------------------------------------------
G0MZ61_CAEBE/163-204--------------------------------------------------------------------------------
H2LUA9_ORYLA/26-61--------------------------------------------------------------------------------
K1QE01_CRAGI/16-61--------------------------------------------------------------------------------
A5DY58_LODEL/80-127--------------------------------------------------------------------------------
K0TA34_THAOC/42-81--------------------------------------------------------------------------------
A0A0E1S0L2_COCIM/323-358--------------------------------------------------------------------------------
K1QCU6_CRAGI/16-59--------------------------------------------------------------------------------
K1QJZ4_CRAGI/7-53--------------------------------------------------------------------------------
C3ZKR2_BRAFL/41-82--------------------------------------------------------------------------------
C4R4E3_PICPG/212-251--------------------------------------------------------------------------------
H0ZD31_TAEGU/7-53--------------------------------------------------------------------------------
A8XTA5_CAEBR/3-47--------------------------------------------------------------------------------
S8ADC7_DACHA/248-289--------------------------------------------------------------------------------
A0A0D2VU52_CAPO3/162-201--------------------------------------------------------------------------------
D8RT29_SELML/3-46--------------------------------------------------------------------------------
B9SAM1_RICCO/138-173--------------------------------------------------------------------------------
S8DX13_FOMPI/61-100--------------------------------------------------------------------------------
W4Y1J6_STRPU/11-49--------------------------------------------------------------------------------
G1P3G4_MYOLU/10-49--------------------------------------------------------------------------------
E3NLH7_CAERE/261-302--------------------------------------------------------------------------------
B4H0Q4_DROPE/25-67--------------------------------------------------------------------------------
F1N9Y8_CHICK/61-99--------------------------------------------------------------------------------
A7S8N9_NEMVE/27-71--------------------------------------------------------------------------------
G0N3Q9_CAEBE/6-48--------------------------------------------------------------------------------
K4BZ63_SOLLC/46-84--------------------------------------------------------------------------------
G4V7T9_SCHMA/36-76--------------------------------------------------------------------------------
S8EPB2_FOMPI/10-46--------------------------------------------------------------------------------
H2T1K1_TAKRU/12-53--------------------------------------------------------------------------------
A8XEF1_CAEBR/134-180--------------------------------------------------------------------------------
T1IPK5_STRMM/160-206--------------------------------------------------------------------------------
D8TYN7_VOLCA/202-229--------------------------------------------------------------------------------
G3N6A5_GASAC/15-55--------------------------------------------------------------------------------
C4LW51_ENTHI/88-126--------------------------------------------------------------------------------
J0CWR5_AURDE/10-52--------------------------------------------------------------------------------
H3CPP0_TETNG/18-57--------------------------------------------------------------------------------
G3WKM1_SARHA/16-52--------------------------------------------------------------------------------
E3N6R1_CAERE/139-180--------------------------------------------------------------------------------
F4PZ55_DICFS/507-542--------------------------------------------------------------------------------
I1EWH7_AMPQE/22-59--------------------------------------------------------------------------------
K7J0H9_NASVI/98-137--------------------------------------------------------------------------------
W5N297_LEPOC/11-49--------------------------------------------------------------------------------
I7LUI0_TETTS/226-264--------------------------------------------------------------------------------
C3ZGA7_BRAFL/18-55--------------------------------------------------------------------------------
G4NE79_MAGO7/671-707--------------------------------------------------------------------------------
Q231T2_TETTS/85-124--------------------------------------------------------------------------------
W5Q3S2_SHEEP/14-51--------------------------------------------------------------------------------
E3MMY9_CAERE/25-66--------------------------------------------------------------------------------
C3YPJ4_BRAFL/16-59--------------------------------------------------------------------------------
D6WLM7_TRICA/66-101--------------------------------------------------------------------------------
R7YHI3_CONA1/116-155--------------------------------------------------------------------------------
H0WKK6_OTOGA/16-54--------------------------------------------------------------------------------
I3JLY3_ORENI/20-56--------------------------------------------------------------------------------
W4WQC2_ATTCE/10-49--------------------------------------------------------------------------------
D2VJL1_NAEGR/382-417--------------------------------------------------------------------------------
I1FJM3_AMPQE/18-57--------------------------------------------------------------------------------
F6PP99_XENTR/15-56--------------------------------------------------------------------------------
F6TDF7_CIOIN/62-106--------------------------------------------------------------------------------
Q23DE8_TETTS/254-293--------------------------------------------------------------------------------
Q28DP5_XENTR/12-52--------------------------------------------------------------------------------
D8Q1Q7_SCHCM/3-43--------------------------------------------------------------------------------
E9GBM9_DAPPU/330-375--------------------------------------------------------------------------------
V2XQW9_MONRO/257-296--------------------------------------------------------------------------------
K1R3B6_CRAGI/30-89--------------------------------------------------------------------------------
G3RSL6_GORGO/51-99--------------------------------------------------------------------------------
W5KSC8_ASTMX/16-54--------------------------------------------------------------------------------
H3G1R5_PRIPA/39-77--------------------------------------------------------------------------------
D7LV06_ARALL/360-401--------------------------------------------------------------------------------
G8BIU0_CANPC/49-93--------------------------------------------------------------------------------
A9VBL7_MONBE/312-352--------------------------------------------------------------------------------
H6C4C8_EXODN/771-813--------------------------------------------------------------------------------
G5AM83_HETGA/27-75--------------------------------------------------------------------------------
J4I996_FIBRA/727-777--------------------------------------------------------------------------------
W4YUR8_STRPU/14-53--------------------------------------------------------------------------------
D2W6L8_NAEGR/140-179--------------------------------------------------------------------------------
A8XYR8_CAEBR/161-204--------------------------------------------------------------------------------
M0YDD9_HORVD/149-184--------------------------------------------------------------------------------
G0MPF4_CAEBE/168-212--------------------------------------------------------------------------------
E3LXX4_CAERE/25-65--------------------------------------------------------------------------------
H2W0A6_CAEJA/15-59--------------------------------------------------------------------------------
A2EQ53_TRIVA/191-228--------------------------------------------------------------------------------
I1G585_AMPQE/166-206--------------------------------------------------------------------------------
R0K4D0_ANAPL/8-54--------------------------------------------------------------------------------
A7S4W1_NEMVE/16-56--------------------------------------------------------------------------------
G0P807_CAEBE/23-75--------------------------------------------------------------------------------
M2LBA6_BAUCO/23-60--------------------------------------------------------------------------------
W5NEU2_LEPOC/17-55--------------------------------------------------------------------------------
E7FES6_DANRE/13-53--------------------------------------------------------------------------------
A0D5N3_PARTE/19-54--------------------------------------------------------------------------------
H9GD26_ANOCA/16-61--------------------------------------------------------------------------------
M7UTJ4_BOTF1/255-289--------------------------------------------------------------------------------
G0NML6_CAEBE/27-70--------------------------------------------------------------------------------
T1GWB5_MEGSC/39-81--------------------------------------------------------------------------------
E3MGC8_CAERE/19-62--------------------------------------------------------------------------------
H2UNP4_TAKRU/10-53--------------------------------------------------------------------------------
T1EKY6_HELRO/6-42--------------------------------------------------------------------------------
A7RP04_NEMVE/17-76--------------------------------------------------------------------------------
G0P1H8_CAEBE/97-141--------------------------------------------------------------------------------
C3XPM5_BRAFL/21-58--------------------------------------------------------------------------------
G0N3S4_CAEBE/130-172--------------------------------------------------------------------------------
M0SG32_MUSAM/228-264--------------------------------------------------------------------------------
H2LQL7_ORYLA/15-56--------------------------------------------------------------------------------
W5KNR6_ASTMX/267-307--------------------------------------------------------------------------------
A7SFU8_NEMVE/7-45--------------------------------------------------------------------------------
W4YX39_STRPU/17-57--------------------------------------------------------------------------------
W5M1Y5_LEPOC/13-53--------------------------------------------------------------------------------
A8XYQ1_CAEBR/115-156--------------------------------------------------------------------------------
K1QTR1_CRAGI/16-60--------------------------------------------------------------------------------
F6WIL5_MONDO/16-54--------------------------------------------------------------------------------
M4BF24_HYAAE/296-336--------------------------------------------------------------------------------
F7E0S6_ORNAN/13-51--------------------------------------------------------------------------------
L8WWQ4_THACA/165-203--------------------------------------------------------------------------------
H3F0Q7_PRIPA/60-101--------------------------------------------------------------------------------
E9GE44_DAPPU/15-55--------------------------------------------------------------------------------
E7QD38_YEASZ/230-271--------------------------------------------------------------------------------
H3AW60_LATCH/15-53--------------------------------------------------------------------------------
I1EYH9_AMPQE/14-55--------------------------------------------------------------------------------
E3LM12_CAERE/290-332--------------------------------------------------------------------------------
A0C9I8_PARTE/106-147--------------------------------------------------------------------------------
A3KQE0_DANRE/11-50--------------------------------------------------------------------------------
K3WTC4_PYTUL/8-61--------------------------------------------------------------------------------
H9GRA4_ANOCA/20-72--------------------------------------------------------------------------------
H2KYH9_CAEEL/6-48--------------------------------------------------------------------------------
E3MIX2_CAERE/1146-1188--------------------------------------------------------------------------------
H3ARK8_LATCH/31-69--------------------------------------------------------------------------------
K1Q9B6_CRAGI/675-717--------------------------------------------------------------------------------
H3B2S6_LATCH/22-61--------------------------------------------------------------------------------
E3NIP7_CAERE/74-116--------------------------------------------------------------------------------
W4Z1I9_STRPU/14-54--------------------------------------------------------------------------------
K1QBI4_CRAGI/866-912--------------------------------------------------------------------------------
F7CI92_XENTR/12-50--------------------------------------------------------------------------------
G0N3R0_CAEBE/6-48--------------------------------------------------------------------------------
G0NCQ3_CAEBE/156-195--------------------------------------------------------------------------------
W4YIM6_STRPU/29-67--------------------------------------------------------------------------------
B4I484_DROSE/276-313--------------------------------------------------------------------------------
B9S2U6_RICCO/6-48--------------------------------------------------------------------------------
H2MTV3_ORYLA/15-55--------------------------------------------------------------------------------
A0A068YFW4_ECHMU/435-478--------------------------------------------------------------------------------
C3ZGA6_BRAFL/18-55--------------------------------------------------------------------------------
I4YBZ0_WALSC/93-137--------------------------------------------------------------------------------
Q20369_CAEEL/199-240--------------------------------------------------------------------------------
A8XYQ0_CAEBR/165-206--------------------------------------------------------------------------------
A8XMM8_CAEBR/395-438--------------------------------------------------------------------------------
Q9N3T6_CAEEL/10-57--------------------------------------------------------------------------------
V8NXX1_OPHHA/10-54--------------------------------------------------------------------------------
V4ZAP5_TOXGO/3834-3876--------------------------------------------------------------------------------
N1PNP8_DOTSN/39-76--------------------------------------------------------------------------------
B7FZ09_PHATC/103-139--------------------------------------------------------------------------------
W5KC55_ASTMX/19-53--------------------------------------------------------------------------------
A0A068XST2_HYMMI/437-482--------------------------------------------------------------------------------
B2W2B2_PYRTR/29-69--------------------------------------------------------------------------------
A7RTP3_NEMVE/20-60--------------------------------------------------------------------------------
K1RLX1_CRAGI/17-58--------------------------------------------------------------------------------
W5MRG0_LEPOC/14-51--------------------------------------------------------------------------------
S8EG65_FOMPI/5-40--------------------------------------------------------------------------------
C3YMN9_BRAFL/10-49--------------------------------------------------------------------------------
W4XQL8_STRPU/208-263--------------------------------------------------------------------------------
G1PFP9_MYOLU/14-54--------------------------------------------------------------------------------
I3KEQ7_ORENI/15-56--------------------------------------------------------------------------------
K1QII5_CRAGI/9-51--------------------------------------------------------------------------------
W4XQY2_STRPU/19-63--------------------------------------------------------------------------------
S8E3I6_FOMPI/513-562--------------------------------------------------------------------------------
G0M6U5_CAEBE/114-166--------------------------------------------------------------------------------
D8TM91_VOLCA/21-62--------------------------------------------------------------------------------
U3KNP9_RABIT/59-97--------------------------------------------------------------------------------
T1JAV6_STRMM/20-64--------------------------------------------------------------------------------
F1R269_DANRE/16-62--------------------------------------------------------------------------------
G3WFD2_SARHA/31-73--------------------------------------------------------------------------------
E4X9B8_OIKDI/311-349--------------------------------------------------------------------------------
C3XSK7_BRAFL/16-53--------------------------------------------------------------------------------
C3Y7X3_BRAFL/19-56--------------------------------------------------------------------------------
K1R6M8_CRAGI/21-65--------------------------------------------------------------------------------
H0ZKG4_TAEGU/8-45--------------------------------------------------------------------------------
W5MD82_LEPOC/37-85--------------------------------------------------------------------------------
T1EIS8_HELRO/13-55--------------------------------------------------------------------------------
W4ZGM2_STRPU/900-940--------------------------------------------------------------------------------
I1EKI7_AMPQE/15-52--------------------------------------------------------------------------------
F6UD02_CIOIN/10-57--------------------------------------------------------------------------------
G0MWU0_CAEBE/260-305--------------------------------------------------------------------------------
A7S113_NEMVE/16-55--------------------------------------------------------------------------------
A7RK42_NEMVE/22-60--------------------------------------------------------------------------------
C3XZN4_BRAFL/10-62--------------------------------------------------------------------------------
D2VJJ0_NAEGR/335-378--------------------------------------------------------------------------------
G0PB02_CAEBE/137-180--------------------------------------------------------------------------------
K1VT53_TRIAC/33-71--------------------------------------------------------------------------------
Q22GU7_TETTS/11-54--------------------------------------------------------------------------------
G0PG13_CAEBE/6-49--------------------------------------------------------------------------------
W4XRM7_STRPU/11-51--------------------------------------------------------------------------------
T1F8U2_HELRO/22-67--------------------------------------------------------------------------------
E3MPV3_CAERE/3-46--------------------------------------------------------------------------------
Q57VJ2_TRYB2/65-103--------------------------------------------------------------------------------
F6YT78_XENTR/13-55--------------------------------------------------------------------------------
A8BHM8_GIAIC/616-652--------------------------------------------------------------------------------
A0A068XK70_HYMMI/11-46--------------------------------------------------------------------------------
E3LFV0_CAERE/299-341--------------------------------------------------------------------------------
I1FA65_AMPQE/60-100--------------------------------------------------------------------------------
G0MUL2_CAEBE/194-235--------------------------------------------------------------------------------
C3YDS0_BRAFL/16-53--------------------------------------------------------------------------------
C3Y5W8_BRAFL/16-54--------------------------------------------------------------------------------
S8BCS0_PENO1/36-78--------------------------------------------------------------------------------
A0A068YFT4_ECHMU/14-54--------------------------------------------------------------------------------
H6BZK9_EXODN/769-804--------------------------------------------------------------------------------
D3BEB0_POLPA/176-214--------------------------------------------------------------------------------
E5A7L1_LEPMJ/55-97--------------------------------------------------------------------------------
G4VDE0_SCHMA/77-123--------------------------------------------------------------------------------
F4P0A7_BATDJ/205-245--------------------------------------------------------------------------------
E3MVZ4_CAERE/17-59--------------------------------------------------------------------------------
A0BVF4_PARTE/7-44--------------------------------------------------------------------------------
A0A068X361_HYMMI/45-80--------------------------------------------------------------------------------
A2F584_TRIVA/298-335--------------------------------------------------------------------------------
I3JWD3_ORENI/10-51--------------------------------------------------------------------------------
I1F5F6_AMPQE/18-60--------------------------------------------------------------------------------
A8Y1L9_CAEBR/19-71--------------------------------------------------------------------------------
C3XXP0_BRAFL/16-53--------------------------------------------------------------------------------
S3D0X6_GLAL2/203-245--------------------------------------------------------------------------------
Q17PC3_AEDAE/64-101--------------------------------------------------------------------------------
A0DLF5_PARTE/6-50--------------------------------------------------------------------------------
B6AGJ6_CRYMR/252-290--------------------------------------------------------------------------------
W5JZH8_ASTMX/14-51--------------------------------------------------------------------------------
C3YMQ6_BRAFL/17-56--------------------------------------------------------------------------------
W5NL94_LEPOC/15-55--------------------------------------------------------------------------------
A7SIN0_NEMVE/18-58--------------------------------------------------------------------------------
R7YV55_CONA1/41-81--------------------------------------------------------------------------------
C3Y2A3_BRAFL/17-57--------------------------------------------------------------------------------
W5LU92_ASTMX/102-146--------------------------------------------------------------------------------
J0WP15_AURDE/169-206--------------------------------------------------------------------------------
G0MUL8_CAEBE/134-181--------------------------------------------------------------------------------
Q6CGJ4_YARLI/332-374--------------------------------------------------------------------------------
C5LVJ3_PERM5/242-279--------------------------------------------------------------------------------
K5UXB5_PHACS/16-52--------------------------------------------------------------------------------
G0N7Z7_CAEBE/250-292--------------------------------------------------------------------------------
X1WBW4_DANRE/13-53--------------------------------------------------------------------------------
G8JNC7_ERECY/182-243--------------------------------------------------------------------------------
E5SBW1_TRISP/33-76--------------------------------------------------------------------------------
W5LZP8_LEPOC/16-56--------------------------------------------------------------------------------
W5NLA7_LEPOC/18-67--------------------------------------------------------------------------------
A7STB0_NEMVE/23-62--------------------------------------------------------------------------------
W4YJ36_STRPU/16-54--------------------------------------------------------------------------------
G0P866_CAEBE/32-78--------------------------------------------------------------------------------
YGI4_SCHPO/107-147--------------------------------------------------------------------------------
H3C6F8_TETNG/16-52--------------------------------------------------------------------------------
W5KS92_ASTMX/13-53--------------------------------------------------------------------------------
G0N3R6_CAEBE/13-59--------------------------------------------------------------------------------
F4Q6G6_DICFS/57-93--------------------------------------------------------------------------------
C3XV33_BRAFL/55-99--------------------------------------------------------------------------------
A7S7Q5_NEMVE/7-67--------------------------------------------------------------------------------
W4XYF8_STRPU/14-54--------------------------------------------------------------------------------
M4AQ73_XIPMA/20-58--------------------------------------------------------------------------------
H2LNJ3_ORYLA/14-54--------------------------------------------------------------------------------
F8PKA0_SERL3/755-798--------------------------------------------------------------------------------
C4M901_ENTHI/65-100--------------------------------------------------------------------------------
C9SDW7_VERA1/257-303--------------------------------------------------------------------------------
K0TML9_THAOC/142-179--------------------------------------------------------------------------------
F4RNK4_MELLP/95-127--------------------------------------------------------------------------------
R4XL14_TAPDE/318-355--------------------------------------------------------------------------------
G0M7D3_CAEBE/125-166--------------------------------------------------------------------------------
C3YDU6_BRAFL/10-56--------------------------------------------------------------------------------
N1PGE4_DOTSN/29-64--------------------------------------------------------------------------------
W5N2W9_LEPOC/16-51--------------------------------------------------------------------------------
I1GCQ6_AMPQE/15-59--------------------------------------------------------------------------------
C5FXX8_ARTOC/59-97--------------------------------------------------------------------------------
A0A023BAT6_GRENI/4-46--------------------------------------------------------------------------------
G3VAC4_SARHA/23-65--------------------------------------------------------------------------------
Q9VJB0_DROME/178-215--------------------------------------------------------------------------------
D8TKP2_VOLCA/9-45--------------------------------------------------------------------------------
W5NBG3_LEPOC/16-56--------------------------------------------------------------------------------
D2VQ69_NAEGR/372-411--------------------------------------------------------------------------------
C1DZC6_MICSR/25-65--------------------------------------------------------------------------------
B4IY65_DROGR/1051-1092--------------------------------------------------------------------------------
C3YEX1_BRAFL/16-53--------------------------------------------------------------------------------
C5DQY2_ZYGRC/118-159--------------------------------------------------------------------------------
E9GNY7_DAPPU/15-56--------------------------------------------------------------------------------
F2ULB9_SALR5/405-444--------------------------------------------------------------------------------
G4TAL9_PIRID/10-51--------------------------------------------------------------------------------
I1F754_AMPQE/13-54--------------------------------------------------------------------------------
H2U3Q0_TAKRU/20-60--------------------------------------------------------------------------------
P91131_CAEEL/88-129--------------------------------------------------------------------------------
K0RCJ2_THAOC/101-145--------------------------------------------------------------------------------
H1V5X9_COLHI/439-482--------------------------------------------------------------------------------
M2QRU5_CERS8/496-540--------------------------------------------------------------------------------
G0N810_CAEBE/264-307--------------------------------------------------------------------------------
K1QPR4_CRAGI/15-59--------------------------------------------------------------------------------
H3DU94_PRIPA/23-64--------------------------------------------------------------------------------
F6T524_HORSE/66-107--------------------------------------------------------------------------------
A2EG51_TRIVA/44-82--------------------------------------------------------------------------------
F4PX82_DICFS/315-350--------------------------------------------------------------------------------
X6LMB4_RETFI/210-252--------------------------------------------------------------------------------
A7SY92_NEMVE/3-38--------------------------------------------------------------------------------
Q1RLI9_CIOIN/45-83--------------------------------------------------------------------------------
F2TYA1_SALR5/90-128--------------------------------------------------------------------------------
S7ZPY1_PENO1/118-155--------------------------------------------------------------------------------
Q0UAN7_PHANO/238-296--------------------------------------------------------------------------------
Q6CVX5_KLULA/30-71--------------------------------------------------------------------------------
K7J0B5_NASVI/71-109--------------------------------------------------------------------------------
G0SZW5_RHOG2/209-242--------------------------------------------------------------------------------
E5SA13_TRISP/76-113--------------------------------------------------------------------------------
F7ED51_ORNAN/35-79--------------------------------------------------------------------------------
H9GCM8_ANOCA/17-55--------------------------------------------------------------------------------
Q9U5C2_CAEEL/6-48--------------------------------------------------------------------------------
J9JWZ8_ACYPI/311-350--------------------------------------------------------------------------------
G1KU39_ANOCA/13-61--------------------------------------------------------------------------------
Q5KI05_CRYNJ/338-379--------------------------------------------------------------------------------
K0RDY0_THAOC/79-121--------------------------------------------------------------------------------
K4DBT6_SOLLC/270-308--------------------------------------------------------------------------------
YT44_CAEEL/154-196--------------------------------------------------------------------------------
A4F321_CAEEL/26-71--------------------------------------------------------------------------------
A8PKF8_BRUMA/28-67--------------------------------------------------------------------------------
X6MFQ8_RETFI/114-158--------------------------------------------------------------------------------
F1QS36_DANRE/13-51--------------------------------------------------------------------------------
V8NQZ9_OPHHA/88-126--------------------------------------------------------------------------------
H3B217_LATCH/15-53--------------------------------------------------------------------------------
I1F696_AMPQE/16-54--------------------------------------------------------------------------------
I1CGZ9_RHIO9/5-48--------------------------------------------------------------------------------
H2WLU7_CAEJA/109-151--------------------------------------------------------------------------------
G0N7Y6_CAEBE/122-163--------------------------------------------------------------------------------
E3NG77_CAERE/222-264--------------------------------------------------------------------------------
D7LWT3_ARALL/58-101--------------------------------------------------------------------------------
H2MQ22_ORYLA/17-54--------------------------------------------------------------------------------
U3J553_ANAPL/11-46--------------------------------------------------------------------------------
A5PMH5_DANRE/56-100--------------------------------------------------------------------------------
C3YT46_BRAFL/18-55--------------------------------------------------------------------------------
Q293B6_DROPS/31-70--------------------------------------------------------------------------------
W4XMW3_STRPU/18-54--------------------------------------------------------------------------------
N1QDJ8_SPHMS/49-94--------------------------------------------------------------------------------
U3K2J3_FICAL/20-61--------------------------------------------------------------------------------
T1IJA1_STRMM/108-146--------------------------------------------------------------------------------
M0Z6Q8_HORVD/16-62--------------------------------------------------------------------------------
A0A087W136_ECHMU/5-41--------------------------------------------------------------------------------
Q8IID0_PLAF7/225-260--------------------------------------------------------------------------------
W1QF39_OGAPD/28-63--------------------------------------------------------------------------------
H3BGJ6_LATCH/17-64--------------------------------------------------------------------------------
B3RRI7_TRIAD/193-231--------------------------------------------------------------------------------
A0A068YES4_ECHMU/57-106--------------------------------------------------------------------------------
C5L2J7_PERM5/9-53--------------------------------------------------------------------------------
A7ARX2_BABBO/898-940--------------------------------------------------------------------------------
E5A7J3_LEPMJ/25-68--------------------------------------------------------------------------------
L8G0G4_PSED2/232-267--------------------------------------------------------------------------------
I1FK14_AMPQE/48-88--------------------------------------------------------------------------------
E7F7E4_DANRE/11-49--------------------------------------------------------------------------------
G1P2E7_MYOLU/21-58--------------------------------------------------------------------------------
C3ZG71_BRAFL/39-82--------------------------------------------------------------------------------
K1R320_CRAGI/11-50--------------------------------------------------------------------------------
W4Z0J1_STRPU/19-65--------------------------------------------------------------------------------
H3F9C8_PRIPA/114-157--------------------------------------------------------------------------------
K7IU46_NASVI/67-110--------------------------------------------------------------------------------
G0PAY7_CAEBE/123-163--------------------------------------------------------------------------------
W4Z726_STRPU/15-55--------------------------------------------------------------------------------
A7STH6_NEMVE/14-54--------------------------------------------------------------------------------
W4Y9I9_STRPU/19-59--------------------------------------------------------------------------------
H0EQA8_GLAL7/21-62--------------------------------------------------------------------------------
G0PDI7_CAEBE/62-107--------------------------------------------------------------------------------
C3ZJI4_BRAFL/16-53--------------------------------------------------------------------------------
Q59RB2_CANAL/510-558--------------------------------------------------------------------------------
F7DSK6_XENTR/5-44--------------------------------------------------------------------------------
W4YM48_STRPU/14-56--------------------------------------------------------------------------------
K0RTA4_THAOC/18-58--------------------------------------------------------------------------------
K1RB60_CRAGI/157-200--------------------------------------------------------------------------------
D8UJ60_VOLCA/183-225--------------------------------------------------------------------------------
B6JYH5_SCHJY/321-362--------------------------------------------------------------------------------
F6V897_XENTR/12-53--------------------------------------------------------------------------------
E3MGW9_CAERE/21-63--------------------------------------------------------------------------------
Q8SVE9_ENCCU/7-49--------------------------------------------------------------------------------
C3YJB4_BRAFL/19-58--------------------------------------------------------------------------------
H0XR22_OTOGA/11-50--------------------------------------------------------------------------------
W1NUC9_AMBTC/16-51--------------------------------------------------------------------------------
I3KZ62_ORENI/19-54--------------------------------------------------------------------------------
H3F6B6_PRIPA/94-133--------------------------------------------------------------------------------
I7MEF6_TETTS/24-64--------------------------------------------------------------------------------
A9SDU8_PHYPA/224-262--------------------------------------------------------------------------------
B2AXP0_PODAN/48-85--------------------------------------------------------------------------------
T1EKZ0_HELRO/2-40--------------------------------------------------------------------------------
T1FXD0_HELRO/23-58--------------------------------------------------------------------------------
M4AAW1_XIPMA/23-63--------------------------------------------------------------------------------
F6UI49_MONDO/16-53--------------------------------------------------------------------------------
H9G3J3_ANOCA/17-55--------------------------------------------------------------------------------
B7PDB4_IXOSC/176-217--------------------------------------------------------------------------------
K1R7E6_CRAGI/85-143--------------------------------------------------------------------------------
C4V8Q4_NOSCE/35-71--------------------------------------------------------------------------------
F4RFV8_MELLP/132-191--------------------------------------------------------------------------------
O16616_CAEEL/6-49--------------------------------------------------------------------------------
D3B5I5_POLPA/145-185--------------------------------------------------------------------------------
H3B8D8_LATCH/17-57--------------------------------------------------------------------------------
E0VVI1_PEDHC/29-78--------------------------------------------------------------------------------
G4NJG4_MAGO7/959-1004--------------------------------------------------------------------------------
Q0UGJ5_PHANO/24-66--------------------------------------------------------------------------------
A7S9R7_NEMVE/68-107--------------------------------------------------------------------------------
C3YDX6_BRAFL/10-57--------------------------------------------------------------------------------
J9KA33_ACYPI/134-169--------------------------------------------------------------------------------
G0N7H0_CAEBE/98-142--------------------------------------------------------------------------------
D7L5T1_ARALL/198-235--------------------------------------------------------------------------------
H2VQ39_CAEJA/121-162--------------------------------------------------------------------------------
I1GEZ3_AMPQE/33-73--------------------------------------------------------------------------------
B0CTH0_LACBS/4-38--------------------------------------------------------------------------------
H2M0J4_ORYLA/30-69--------------------------------------------------------------------------------
G0N825_CAEBE/249-293--------------------------------------------------------------------------------
C8VRE2_EMENI/104-152--------------------------------------------------------------------------------
E3MSH8_CAERE/60-98--------------------------------------------------------------------------------
A7SVR6_NEMVE/25-65--------------------------------------------------------------------------------
A4IG09_DANRE/8-48--------------------------------------------------------------------------------
E3MMX8_CAERE/120-161--------------------------------------------------------------------------------
E4XGE3_OIKDI/6-45--------------------------------------------------------------------------------
C3YDN2_BRAFL/17-56--------------------------------------------------------------------------------
F4RAV6_MELLP/41-77--------------------------------------------------------------------------------
C3ZYG5_BRAFL/17-52--------------------------------------------------------------------------------
T1G136_HELRO/50-88--------------------------------------------------------------------------------
V6DHC5_9DELT/188-230--------------------------------------------------------------------------------
H2SKQ3_TAKRU/30-70--------------------------------------------------------------------------------
H2WLV3_CAEJA/141-184--------------------------------------------------------------------------------
H3AYG0_LATCH/8-46--------------------------------------------------------------------------------
W4YM36_STRPU/18-59--------------------------------------------------------------------------------
C5KHW7_PERM5/170-210--------------------------------------------------------------------------------
C1N5X1_MICPC/233-279--------------------------------------------------------------------------------
A0A0C4DRB5_MAGP6/901-954--------------------------------------------------------------------------------
H0YAI5_HUMAN/48-90--------------------------------------------------------------------------------
E3MDV5_CAERE/131-173--------------------------------------------------------------------------------
K5X1A7_PHACS/917-967--------------------------------------------------------------------------------
H0W448_CAVPO/13-51--------------------------------------------------------------------------------
C3Y9M5_BRAFL/16-56--------------------------------------------------------------------------------
E4WQ42_OIKDI/268-311--------------------------------------------------------------------------------
W4Y0G5_STRPU/15-56--------------------------------------------------------------------------------
A8XQX2_CAEBR/48-96--------------------------------------------------------------------------------

PF13923

L5KXI3_PTEAL/50-90--------------------------------------------------------------------------------
V8P853_OPHHA/702-741--------------------------------------------------------------------------------
F4WIJ4_ACREC/356-389--------------------------------------------------------------------------------
M9LX19_PSEA3/698-736--------------------------------------------------------------------------------
H0Y340_HUMAN/40-78--------------------------------------------------------------------------------
L9KQ74_TUPCH/255-295--------------------------------------------------------------------------------
RNG1L_ARATH/215-256--------------------------------------------------------------------------------
RN220_HUMAN/513-552--------------------------------------------------------------------------------
S9X0A4_SCHCR/176-214--------------------------------------------------------------------------------
RAD18_KLULA/31-69--------------------------------------------------------------------------------

PF00097

PML_HUMAN/57-91--------------------------------------------------------------------------------
H2Q4Y2_PANTR/381-419--------------------------------------------------------------------------------
413R_IIV6/148-195--------------------------------------------------------------------------------
A33_PLEWA/163-202--------------------------------------------------------------------------------
RING1_HUMAN/48-87--------------------------------------------------------------------------------
BRE1_CAEEL/785-823--------------------------------------------------------------------------------
D0Z760_DROME/263-301--------------------------------------------------------------------------------
GOLI_DROME/303-343--------------------------------------------------------------------------------
F7DCK3_MACMU/16-56--------------------------------------------------------------------------------
NHL1_CAEEL/43-83--------------------------------------------------------------------------------
F6T905_MACMU/18-56--------------------------------------------------------------------------------
E1JH51_DROME/35-73--------------------------------------------------------------------------------
BRCA1_HUMAN/24-64--------------------------------------------------------------------------------
H2Q2Y1_PANTR/16-54--------------------------------------------------------------------------------
TR30A_MOUSE/15-58--------------------------------------------------------------------------------
RAD18_YEAST/28-65--------------------------------------------------------------------------------
YNN1_CAEEL/8-45--------------------------------------------------------------------------------
RAG1_CHICK/289-327--------------------------------------------------------------------------------
G2W9C0_YEASK/537-580--------------------------------------------------------------------------------
H0GK06_SACCK/914-960--------------------------------------------------------------------------------
PEX2_CRIGR/243-282--------------------------------------------------------------------------------
ESAG8_TRYBB/10-45--------------------------------------------------------------------------------
G8HBH2_HHV1/116-156--------------------------------------------------------------------------------
ICP0_BHV1J/13-51--------------------------------------------------------------------------------
ICP0_EHV1B/8-46--------------------------------------------------------------------------------
ICP0_SUHVF/46-84--------------------------------------------------------------------------------
IE61_VZVD/19-57--------------------------------------------------------------------------------
PE38_NPVAC/86-138--------------------------------------------------------------------------------
PE38_NPVOP/39-91--------------------------------------------------------------------------------
A0A023ZC77_YEASX/206-249--------------------------------------------------------------------------------
TRAF2_MOUSE/34-72--------------------------------------------------------------------------------
RAD5_SCHPO/877-922--------------------------------------------------------------------------------
A0A023ZDG1_YEASX/179-223--------------------------------------------------------------------------------
VCG3_NPVAC/8-62--------------------------------------------------------------------------------
VIE2_NPVOP/207-254--------------------------------------------------------------------------------

PF14634

E1C7D9_CHICK/6-48--------------------------------------------------------------------------------
E1FZW0_LOALO/6-50--------------------------------------------------------------------------------
E9GEC8_DAPPU/12-57--------------------------------------------------------------------------------
Q4QGD1_LEIMA/6-46--------------------------------------------------------------------------------
B0CSV8_LACBS/15-58--------------------------------------------------------------------------------
C4LXP1_ENTHI/207-247--------------------------------------------------------------------------------
B6IIE6_CAEBR/17-60--------------------------------------------------------------------------------
A8XMJ0_CAEBR/116-156--------------------------------------------------------------------------------
F2U6V3_SALR5/10-49--------------------------------------------------------------------------------
Q6FWV3_CANGA/12-51--------------------------------------------------------------------------------
A8XFZ9_CAEBR/5-45--------------------------------------------------------------------------------
Q9U3L0_CAEEL/5-45--------------------------------------------------------------------------------
Q8MYP1_CAEEL/5-51--------------------------------------------------------------------------------
A8XFY8_CAEBR/5-44--------------------------------------------------------------------------------
Q16ES6_AEDAE/8-51--------------------------------------------------------------------------------
E4XQK4_OIKDI/224-267--------------------------------------------------------------------------------
B5DY13_DROPS/25-73--------------------------------------------------------------------------------
A1CTV8_ASPCL/49-97--------------------------------------------------------------------------------
B3MST8_DROAN/9-53--------------------------------------------------------------------------------
E7F2P1_DANRE/6-47--------------------------------------------------------------------------------
B4GYG5_DROPE/27-77--------------------------------------------------------------------------------
C7Z911_NECH7/207-256--------------------------------------------------------------------------------
Q55DW8_DICDI/7-51--------------------------------------------------------------------------------
E3MCJ8_CAERE/17-68--------------------------------------------------------------------------------
B4NUQ8_DROSI/5-49--------------------------------------------------------------------------------
A8WJ97_CAEBR/8-50--------------------------------------------------------------------------------
E3NG56_CAERE/267-315--------------------------------------------------------------------------------
B3MUY6_DROAN/5-49--------------------------------------------------------------------------------
C5FK34_ARTOC/10-58--------------------------------------------------------------------------------
F1A3H2_DICPU/5-56--------------------------------------------------------------------------------
B0CWP3_LACBS/5-50--------------------------------------------------------------------------------
E3MBM8_CAERE/6-48--------------------------------------------------------------------------------
B6HJ02_PENCW/608-658--------------------------------------------------------------------------------
RN212_HUMAN/6-47--------------------------------------------------------------------------------
B4JEQ5_DROGR/5-48--------------------------------------------------------------------------------
Q6CWK7_KLULA/13-58--------------------------------------------------------------------------------
Y4613_DICDI/8-64--------------------------------------------------------------------------------
C3ZHE7_BRAFL/303-344--------------------------------------------------------------------------------
Q5TWF6_ANOGA/8-51--------------------------------------------------------------------------------
B4G2B4_DROPE/5-49--------------------------------------------------------------------------------
E9G342_DAPPU/16-63--------------------------------------------------------------------------------
Y121_OSHVF/52-106--------------------------------------------------------------------------------
P90905_CAEEL/5-44--------------------------------------------------------------------------------
A4RWU3_OSTLU/1786-1830--------------------------------------------------------------------------------
E0VQH4_PEDHC/5-47--------------------------------------------------------------------------------
B6ILY2_CAEBR/8-50--------------------------------------------------------------------------------
D8LDC0_ECTSI/14-64--------------------------------------------------------------------------------
E3LVG7_CAERE/5-45--------------------------------------------------------------------------------
E0VJY0_PEDHC/20-59--------------------------------------------------------------------------------
E1ZX87_CAMFO/5-46--------------------------------------------------------------------------------
F0VKM3_NEOCL/116-156--------------------------------------------------------------------------------
E1ZVC6_CAMFO/5-46--------------------------------------------------------------------------------
C3ZRQ6_BRAFL/6-49--------------------------------------------------------------------------------
C0NRS3_AJECG/10-58--------------------------------------------------------------------------------
E3MKE8_CAERE/9-49--------------------------------------------------------------------------------
B3MWG3_DROAN/9-59--------------------------------------------------------------------------------
E7A0E3_SPORE/17-84--------------------------------------------------------------------------------
B4MS95_DROWI/5-47--------------------------------------------------------------------------------
E3M3L5_CAERE/7-49--------------------------------------------------------------------------------
B4NE87_DROWI/45-107--------------------------------------------------------------------------------
F0ZEE6_DICPU/7-49--------------------------------------------------------------------------------
A8NYK0_COPC7/174-219--------------------------------------------------------------------------------
B0WY05_CULQU/8-51--------------------------------------------------------------------------------
C5L4C0_PERM5/179-224--------------------------------------------------------------------------------
E9CYQ8_COCPS/10-58--------------------------------------------------------------------------------
E9GED0_DAPPU/15-62--------------------------------------------------------------------------------
A2DG01_TRIVA/10-55--------------------------------------------------------------------------------
B4K9R1_DROMO/5-50--------------------------------------------------------------------------------
A8BW81_GIAIC/271-327--------------------------------------------------------------------------------
E9II61_SOLIN/7-48--------------------------------------------------------------------------------
D2VGX0_NAEGR/14-66--------------------------------------------------------------------------------
D8MAK7_BLAHO/6-49--------------------------------------------------------------------------------
Q8IMM9_DROME/5-49--------------------------------------------------------------------------------
Q16T22_AEDAE/9-56--------------------------------------------------------------------------------
A8PV49_BRUMA/15-64--------------------------------------------------------------------------------
C3YFB0_BRAFL/6-47--------------------------------------------------------------------------------
E3NG58_CAERE/270-317--------------------------------------------------------------------------------
D3B891_POLPA/3-46--------------------------------------------------------------------------------
D8QBA2_SCHCM/9-50--------------------------------------------------------------------------------
D6WWZ3_TRICA/13-55--------------------------------------------------------------------------------
Q4W4Z4_CAEEL/5-47--------------------------------------------------------------------------------
E3NQU5_CAERE/8-49--------------------------------------------------------------------------------
E4WWU4_OIKDI/70-127--------------------------------------------------------------------------------
H3D646_TETNG/10-52--------------------------------------------------------------------------------
TIF1B_RAT/66-124--------------------------------------------------------------------------------
O76908_DROME/20-70--------------------------------------------------------------------------------
RNF37_MOUSE/483-527--------------------------------------------------------------------------------
Q9VV48_DROME/13-53--------------------------------------------------------------------------------
U1M783_ASCSU/6-47--------------------------------------------------------------------------------
U1M983_ASCSU/6-49--------------------------------------------------------------------------------

PF11789

NSE2_SCHPO/166-220--------------------------------------------------------------------DEVMVYS..ATF
Q4WN41_ASPFU/329-400--------------------------------------------------------------------DEIAIER..ERI
Q6BTN3_DEBHA/217-271--------------------------------------------------------------------DELEVAG..GKI
Q0CK87_ASPTN/846-915--------------------------------------------------------------------DDIAIER..ERI
A7URE5_ANOGA/120-176--------------------------------------------------------------------GDLVMEA..DVG
Q6FJV5_CANGA/174-230--------------------------------------------------------------------DDIQIEG..GKI
Q4UH75_THEAN/120-184--------------------------------------------------------------------EELQIEELKSTF
Q4X4I4_PLACH/87-151--------------------------------------------------------------------DELVVDEEIGAF
A6R9Q0_AJECN/331-406--------------------------------------------------------------------DDLAIHS..ERA
Q17L84_AEDAE/118-173--------------------------------------------------------------------EEMQMEE..AIQ
NSE2_HUMAN/156-216--------------------------------------------------------------------EDIIVTQ..SQT
A2QVT0_ASPNC/323-396--------------------------------------------------------------------DEIAIQT..ERI
NSE2_YEAST/171-227--------------------------------------------------------------------DDLQIEG..GKI
Q7RZA1_NEUCR/281-336--------------------------------------------------------------------EDLIIER..EVQ
Q0U6V6_PHANO/293-363--------------------------------------------------------------------DDIVMDK..ATI
Q757R5_ASHGO/117-172--------------------------------------------------------------------EELKISG..GTI
Q2GS77_CHAGB/246-301--------------------------------------------------------------------DDLVVER..EII
Q5A2Z8_CANAL/182-236--------------------------------------------------------------------DELNVSG..GKI
C8VKT8_EMENI/321-393--------------------------------------------------------------------DDLAIER..ERI
H3DP52_TETNG/148-208--------------------------------------------------------------------DEITVTQ..SQV

PF14835

F1SSQ2_PIG/39-103--------------------------------------------------------------------------LARLEK

PF02891

Q6BIU5_DEBHA/323-372-------------------------------------------------------------------------------I
Q7QJ47_ANOGA/609-658-------------------------------------------------------------------------------V
A0A0D1C349_USTMA/363-412-------------------------------------------------------------------------------M
Q2U9J1_ASPOR/299-348-------------------------------------------------------------------------------M
Q6FLD3_CANGA/338-387-------------------------------------------------------------------------------M
Q6CY92_KLULA/302-351-------------------------------------------------------------------------------M
SIZ1_YEAST/357-406-------------------------------------------------------------------------------M
SIZ2_YEAST/334-383-------------------------------------------------------------------------------L
Q6FUK3_CANGA/339-388-------------------------------------------------------------------------------I
PLI1_SCHPO/301-350-------------------------------------------------------------------------------I
Q6C4V7_YARLI/350-399-------------------------------------------------------------------------------L
Q7KNF5_DROME/321-370-------------------------------------------------------------------------------V
Q5VRS8_ORYSJ/318-367-------------------------------------------------------------------------------V
Q7JR52_DROME/714-763-------------------------------------------------------------------------------I
Q54UZ6_DICDI/63-112-------------------------------------------------------------------------------E
Q6BFZ0_PARTE/785-836-------------------------------------------------------------------------------V
Q555X5_DICDI/473-522-------------------------------------------------------------------------------L
Q54V57_DICDI/820-869-------------------------------------------------------------------------------I
SIZ1_ARATH/359-408-------------------------------------------------------------------------------V
Q4D897_TRYCC/311-360-------------------------------------------------------------------------------V
Q38DR7_TRYB2/457-506-------------------------------------------------------------------------------I
Q4E4T0_TRYCC/410-459-------------------------------------------------------------------------------I
E9AFM2_LEIMA/500-549-------------------------------------------------------------------------------I
Q586F5_TRYB2/424-473-------------------------------------------------------------------------------V
Q4CSC6_TRYCC/405-454-------------------------------------------------------------------------------V
Q4Q6T7_LEIMA/259-308-------------------------------------------------------------------------------V
Q4XYF2_PLACH/379-432-------------------------------------------------------------------------------I
Q4N5M9_THEPA/234-287-------------------------------------------------------------------------------M
F6W032_CIOIN/264-312-------------------------------------------------------------------------------L
F8W4G0_DANRE/271-319-------------------------------------------------------------------------------V
I3IVZ2_ORENI/628-676-------------------------------------------------------------------------------V
U9W851_NEUCR/331-379-------------------------------------------------------------------------------L

PF17122

M3HI18_CANMX/927-962--------------------------------------------------------------------------------
B6JYV2_SCHJY/783-817--------------------------------------------------------------------------------
PEP5L_SCHPO/780-814--------------------------------------------------------------------------------

PF17121

G2Q0I8_THIHA/15-65--------------------------------------------------------------------------------
B6QL88_PENMQ/14-64--------------------------------------------------------------------------------
E9F746_METRA/26-76--------------------------------------------------------------------------------
G4UBK5_NEUT9/12-62--------------------------------------------------------------------------------
L8FV55_PSED2/16-66--------------------------------------------------------------------------------
TFB3_SCHPO/10-60--------------------------------------------------------------------------------
N1QL18_SPHMS/21-71--------------------------------------------------------------------------------

PF16685

B5DR75_DROPS/43-115--------------------------------------------------------------------------------
E2ACB4_CAMFO/91-160--------------------------------------------------------------------------------
B4MTK1_DROWI/41-113--------------------------------------------------------------------------------
G1QUV9_NOMLE/42-111--------------------------------------------------------------------------------
B0WV25_CULQU/55-124--------------------------------------------------------------------------------
M4A435_XIPMA/42-111--------------------------------------------------------------------------------
H2MDG1_ORYLA/42-111--------------------------------------------------------------------------------
D6W8B3_TRICA/39-108--------------------------------------------------------------------------------
B4KJL9_DROMO/40-112--------------------------------------------------------------------------------
E9HFH7_DAPPU/39-107--------------------------------------------------------------------------------
A7USF8_ANOGA/37-106--------------------------------------------------------------------------------
A5JPL8_BOMMO/39-108--------------------------------------------------------------------------------
B0V0X0_DANRE/42-111--------------------------------------------------------------------------------
B7QLX1_IXOSC/39-108--------------------------------------------------------------------------------
B4JBU9_DROGR/40-112--------------------------------------------------------------------------------
B4G866_DROPE/40-112--------------------------------------------------------------------------------
B4N486_DROWI/41-113--------------------------------------------------------------------------------

PF04564

UFD2_YEAST/881-953-----------------------------------------------------------------------------VPD
PUB3_ARATH/238-310-----------------------------------------------------------------------------IPP
Q9U4F8_DROME/915-987-----------------------------------------------------------------------------APE
UBE4A_HUMAN/988-1060-----------------------------------------------------------------------------ACD
UBE4_CAEEL/906-977-----------------------------------------------------------------------------VPE
WSDU1_MOUSE/402-474-----------------------------------------------------------------------------IPD
UFD2_SCHPO/931-1003-----------------------------------------------------------------------------IPD
Q9XYW6_DROME/213-285-----------------------------------------------------------------------------VPD
O44007_DICDI/1016-1088-----------------------------------------------------------------------------IPD
UBE4_ARATH/941-1013-----------------------------------------------------------------------------IPD
UBE4B_HUMAN/1228-1299-----------------------------------------------------------------------------APD
CHIP_HUMAN/227-299-----------------------------------------------------------------------------IPD
Q9VA79_DROME/222-300-----------------------------------------------------------------------------IPE
RNF37_HUMAN/259-337-----------------------------------------------------------------------------VPE
CHIP_ARATH/200-272-----------------------------------------------------------------------------VPD
Q9VK44_DROME/1141-1212-----------------------------------------------------------------------------APD

PF15906

E2R5E4_CANFA/120-194-------------------------------------------------------------------------------H
NOSIP_DANRE/4-78-------------------------------------------------------------------------------H

PF04641

A4S0T5_OSTLU/8-288--------------------GGGDGGATGAESRSAYLEMYAWNGGTTFSRKKESLGGFVRYSAQSTVRDRD.EAEEDLAR
A0DTQ1_PARTE/1-244--------------------MGNDGGSF..AERAELVKL.........KKPEKRV...............E.SLLVAKQR
Q2UTA9_ASPOR/1-287--------------------MGNDGGSI..PTRRELVRE.........AARAPSTAQ...........VKEAQRELQEHY
Q5SMK9_ORYSJ/84-335--------------------GGGDGGATGAESRDCYLSMY.......LAKKPDKA...............D.PNEARLSR
Q29KQ8_DROPS/1-280--------------------MGCDGGTI..PKRDELVRV.........KQKPEQK...............D.KDAEREFR
Q17G64_AEDAE/1-281--------------------MGCDGGTI..PRRDELVRL.........KKKPEQK...............D.KDAERQFR
A8XXP4_CAEBR/1-289--------------------MGADGGTI..PKRCELVQQ.........KKKKEKL...............D.KHVKNATK
Q5K8P8_CRYNJ/1-310--------------------MGADGGSI..PDRRDLVKT.........KGKTEQA...............D.KESLK.AL
RTF2_DICDI/1-266--------------------MGLDGGTI..PTRCELVKT.........KKKEVKV..............FD.KDQVDFGK
Q23KD1_TETTS/1-249--------------------MGNDGGSF..QTRTDLVKE.........KPKEVKI...............D.NTILAKFR
RTF2_CHICK/1-289--------------------MGCDGGTI..PKRHELVKG.........PRKAVKV...............D.KTAELVAR
A7RZE6_NEMVE/1-286--------------------MGCDGGTI..PTRDELVRM.........KKAPEKV...............E.KNYELNAK
A0A0D1DPG3_USTMA/1-280--------------------MGNDGGAI..AKRDELVRT.........KATFEKV...............D.PELLRQSL
RTF2_SCHPO/1-239--------------------MGNDGGSL..PTRNELVKEP.......GKVPPLDI...............DFKRSVKSSQ
F1QSV2_DANRE/1-293--------------------MGCDGGTI..PKRHELVKG.........PKKVEKV...............D.KNAELAAK
Q5TPA4_ANOGA/1-281--------------------MGCDGGTI..PRRDELVRL.........KKKPEQK...............D.KDAERQFR
Q6NQ98_ARATH/84-337--------------------GGGDGGATGAESRDCYLNMY.......AEKKPDKV...............D.PNEQRLSK
RTF2_MOUSE/1-290--------------------MGCDGGTI..PKRHELVKG.........PKKVEKV...............D.KDAELVAQ

PF07800

M4CJA0_BRARP/50-200-------------------------------------------------------------------------------E
J3MK74_ORYBR/23-223-------------------------------------------------------------------------------.
I1K2V2_SOYBN/49-211-------------------------------------------------------------------------------E
A0A096UKJ4_WHEAT/23-231-------------------------------------------------------------------------------.
F6HZY0_VITVI/22-260-------------------------------------------------------------------------------D
M7Z892_TRIUA/9-237-------------------------------------------------------------------------------D
Q9LRY5_ARATH/22-219-------------------------------------------------------------------------------D
B9GUG0_POPTR/51-216-------------------------------------------------------------------------------.
M1CGY7_SOLTU/46-208-------------------------------------------------------------------------------.
K4CU07_SOLLC/16-249-------------------------------------------------------------------------------.
I1N2C3_SOYBN/22-255-------------------------------------------------------------------------------D
I1M9R8_SOYBN/11-171-------------------------------------------------------------------------------D
M0RX91_MUSAM/44-191-------------------------------------------------------------------------------E
M4D465_BRARP/25-184-------------------------------------------------------------------------------D
M0U683_MUSAM/22-183-------------------------------------------------------------------------------D
F6H968_VITVI/49-215-------------------------------------------------------------------------------E
C5X4F2_SORBI/23-254-------------------------------------------------------------------------------.
A9SF80_PHYPA/49-210-------------------------------------------------------------------------------E
B9SEM7_RICCO/46-230-------------------------------------------------------------------------------E
M1BUR7_SOLTU/46-233-------------------------------------------------------------------------------E
F6HX92_VITVI/41-187-------------------------------------------------------------------------------E
M0RJN1_MUSAM/50-203-------------------------------------------------------------------------------.
M0SRW7_MUSAM/22-177-------------------------------------------------------------------------------D
B6SUA2_MAIZE/30-197-------------------------------------------------------------------------------E
I1KZC0_SOYBN/22-256-------------------------------------------------------------------------------D
J3KUR8_ORYBR/26-254-------------------------------------------------------------------------------D
M0U6C0_MUSAM/135-295-------------------------------------------------------------------------------D
M1CSJ9_SOLTU/45-210-------------------------------------------------------------------------------E
J3MH44_ORYBR/29-188-------------------------------------------------------------------------------E
M4E8R7_BRARP/36-202-------------------------------------------------------------------------------E
M0THX6_MUSAM/100-260-------------------------------------------------------------------------------K
I1P4P1_ORYGL/48-211-------------------------------------------------------------------------------E
W1NJC5_AMBTC/57-230-------------------------------------------------------------------------------E
B9SPP5_RICCO/28-184-------------------------------------------------------------------------------E
F6H3B5_VITVI/28-194-------------------------------------------------------------------------------E
J3LYB6_ORYBR/145-298-------------------------------------------------------------------------------.
W1P3H0_AMBTC/37-183-------------------------------------------------------------------------------D
K7KTN8_SOYBN/11-174-------------------------------------------------------------------------------E
B9SZV8_RICCO/31-193-------------------------------------------------------------------------------E
I1PLP2_ORYGL/49-202-------------------------------------------------------------------------------.
Q9LUA0_ARATH/39-255-------------------------------------------------------------------------------E
W1P964_AMBTC/48-238-------------------------------------------------------------------------------D
F6H0M7_VITVI/115-281-------------------------------------------------------------------------------E
B9GF75_POPTR/49-209-------------------------------------------------------------------------------E
K3ZTK7_SETIT/23-255-------------------------------------------------------------------------------.
M4DF02_BRARP/22-205-------------------------------------------------------------------------------D
U5D0D1_AMBTC/32-284-------------------------------------------------------------------------------D
F6HH69_VITVI/46-233-------------------------------------------------------------------------------E
I1KSC4_SOYBN/46-217-------------------------------------------------------------------------------E
M4D3C9_BRARP/51-199-------------------------------------------------------------------------------.
C5Y9B2_SORBI/49-202-------------------------------------------------------------------------------.
K7TN85_MAIZE/24-253-------------------------------------------------------------------------------D
I1LMI1_SOYBN/43-250-------------------------------------------------------------------------------E
M1CRX8_SOLTU/39-210-------------------------------------------------------------------------------E
I1NPL5_ORYGL/52-207-------------------------------------------------------------------------------E
B9S551_RICCO/22-258-------------------------------------------------------------------------------D
I1KA51_SOYBN/47-210-------------------------------------------------------------------------------E
K3YTM6_SETIT/49-212-------------------------------------------------------------------------------.
Q7XP23_ORYSJ/26-252-------------------------------------------------------------------------------D
W1NR99_AMBTC/24-180-------------------------------------------------------------------------------E
B9GTE6_POPTR/22-235-------------------------------------------------------------------------------D
I1HXY9_BRADI/26-254-------------------------------------------------------------------------------D
B9RJB2_RICCO/51-216-------------------------------------------------------------------------------.
B9N5I9_POPTR/46-233-------------------------------------------------------------------------------E
K4DHB9_SOLLC/16-172-------------------------------------------------------------------------------D
W1P3L7_AMBTC/42-195-------------------------------------------------------------------------------E
M0S465_MUSAM/48-212-------------------------------------------------------------------------------E

PF02148

UBP44_MOUSE/26-88--------------------------------------------------------------------------------
HDAC6_HUMAN/1133-1195--------------------------------------------------------------------------------
HDAC6_MOUSE/1067-1129--------------------------------------------------------------------------------
Q7QEG4_ANOGA/63-151--------------------------------------------------------------------------------
Q7PS30_ANOGA/1015-1078--------------------------------------------------------------------------------
Q4WPT2_ASPFU/433-495--------------------------------------------------------------------------------
Q752M3_ASHGO/46-108--------------------------------------------------------------------------------
Q55AP9_DICDI/92-190--------------------------------------------------------------------------------
Q29G58_DROPS/978-1040--------------------------------------------------------------------------------
UBPA_DICDI/191-266--------------------------------------------------------------------------------
UBP45_MOUSE/62-139--------------------------------------------------------------------------------
UBP22_MOUSE/63-124--------------------------------------------------------------------------------
A5DHG6_PICGU/209-286--------------------------------------------------------------------------------
UBP16_HUMAN/48-128--------------------------------------------------------------------------------
Q6BU87_DEBHA/100-163--------------------------------------------------------------------------------
Q2LYY5_DROPS/46-106--------------------------------------------------------------------------------
A5DPT2_PICGU/308-371--------------------------------------------------------------------------------
Q29I81_DROPS/77-163--------------------------------------------------------------------------------
Q6BK37_DEBHA/91-153--------------------------------------------------------------------------------
Q0UPU5_PHANO/195-257--------------------------------------------------------------------------------
A5DCQ5_PICGU/48-110--------------------------------------------------------------------------------
Q0UZD0_PHANO/143-217--------------------------------------------------------------------------------
A5DJV9_PICGU/79-143--------------------------------------------------------------------------------
A4S4T6_OSTLU/23-87--------------------------------------------------------------------------------
Q581T5_TRYB2/216-278--------------------------------------------------------------------------------
A7RU34_NEMVE/35-97--------------------------------------------------------------------------------
UBP14_ARATH/180-255--------------------------------------------------------------------------------
Q5KDF6_CRYNJ/396-460--------------------------------------------------------------------------------
UBP13_MOUSE/209-282--------------------------------------------------------------------------------
Q4E680_TRYCC/180-252--------------------------------------------------------------------------------
Q6H890_ORYSJ/215-277--------------------------------------------------------------------------------
Q0IG52_AEDAE/51-111--------------------------------------------------------------------------------
Q1RL25_CIOIN/77-139--------------------------------------------------------------------------------
Q4DNU2_TRYCC/216-278--------------------------------------------------------------------------------
Q17K27_AEDAE/77-139--------------------------------------------------------------------------------
Q5U4Y7_XENTR/62-139--------------------------------------------------------------------------------
A8BKG1_GIAIC/41-106--------------------------------------------------------------------------------
A7TLQ2_VANPO/49-111--------------------------------------------------------------------------------
UBP22_ARATH/56-116--------------------------------------------------------------------------------
A7SXK5_NEMVE/193-255--------------------------------------------------------------------------------
ETP1_YEAST/301-363--------------------------------------------------------------------------------
Q7PYV7_ANOGA/248-310--------------------------------------------------------------------------------
A0R482_MYCS2/16-85--------------------------------------------------------------------------------
UBP10_SCHPO/77-139--------------------------------------------------------------------------------
Q5CWL8_CRYPI/185-268--------------------------------------------------------------------------------
A5DUT2_LODEL/188-265--------------------------------------------------------------------------------
Q5KF82_CRYNJ/109-183--------------------------------------------------------------------------------
Q1LM26_RALME/20-89--------------------------------------------------------------------------------
Q0J0M6_ORYSJ/91-194--------------------------------------------------------------------------------
Q54XH4_DICDI/293-355--------------------------------------------------------------------------------
Q5YNV2_NOCFA/18-88--------------------------------------------------------------------------------
A7S0W3_NEMVE/44-106--------------------------------------------------------------------------------
A7AQH7_BABBO/198-279--------------------------------------------------------------------------------
UBP33_BOVIN/30-97--------------------------------------------------------------------------------
UBP14_YEAST/192-265--------------------------------------------------------------------------------
Q00RU3_OSTTA/38-100--------------------------------------------------------------------------------
A3LW63_PICST/119-183--------------------------------------------------------------------------------
A6R3J1_AJECN/127-189--------------------------------------------------------------------------------
Q750D2_ASHGO/186-260--------------------------------------------------------------------------------
A7TTD6_VANPO/191-264--------------------------------------------------------------------------------
A0A0D1E9C8_USTMA/168-244--------------------------------------------------------------------------------
Q29E26_DROPS/206-280--------------------------------------------------------------------------------
Q4UGQ2_THEAN/189-270--------------------------------------------------------------------------------
A7TMH2_VANPO/46-108--------------------------------------------------------------------------------
Q6FIW7_CANGA/46-108--------------------------------------------------------------------------------
Q6CCP5_YARLI/264-326--------------------------------------------------------------------------------
Q17MD0_AEDAE/958-1020--------------------------------------------------------------------------------
UBP20_BOVIN/30-97--------------------------------------------------------------------------------
Q7PZW5_ANOGA/51-111--------------------------------------------------------------------------------
A0DKY3_PARTE/163-237--------------------------------------------------------------------------------
A8WUG0_CAEBR/958-1020--------------------------------------------------------------------------------
Q0S9I7_RHOJR/18-87--------------------------------------------------------------------------------
A4VF07_TETTS/119-181--------------------------------------------------------------------------------
Q38FD4_TRYB2/284-346--------------------------------------------------------------------------------
EPT1_SCHPO/262-324--------------------------------------------------------------------------------
E9AE92_LEIMA/178-250--------------------------------------------------------------------------------
Q59XT8_CANAL/147-211--------------------------------------------------------------------------------
Q59ZS6_CANAL/28-90--------------------------------------------------------------------------------
A4IA95_LEIIN/261-323--------------------------------------------------------------------------------
A2E0J2_TRIVA/180-241--------------------------------------------------------------------------------
Q6CIL3_KLULA/270-332--------------------------------------------------------------------------------
A0CMR2_PARTE/34-96--------------------------------------------------------------------------------
Q751A3_ASHGO/268-330--------------------------------------------------------------------------------
Q6CJH1_KLULA/186-259--------------------------------------------------------------------------------
A0A0D1EBZ2_USTMA/186-260--------------------------------------------------------------------------------
A7E4F0_SCLS1/490-552--------------------------------------------------------------------------------
A6WAE2_KINRD/21-93--------------------------------------------------------------------------------
Q17BE1_AEDAE/54-115--------------------------------------------------------------------------------
A2F507_TRIVA/163-237--------------------------------------------------------------------------------
A7EYW2_SCLS1/175-249--------------------------------------------------------------------------------
A4S2V3_OSTLU/208-270--------------------------------------------------------------------------------
Q8IBN0_PLAF7/903-965--------------------------------------------------------------------------------
A5DYC5_LODEL/240-300--------------------------------------------------------------------------------
Q4DD96_TRYCC/275-337--------------------------------------------------------------------------------
A4H369_LEIBR/325-387--------------------------------------------------------------------------------
A8B354_GIAIC/176-251--------------------------------------------------------------------------------
A5KC57_PLAVS/612-674--------------------------------------------------------------------------------
Q6BIP0_DEBHA/187-264--------------------------------------------------------------------------------
A6W560_KINRD/15-87--------------------------------------------------------------------------------
Q4UFF9_THEAN/163-225--------------------------------------------------------------------------------
Q16V37_AEDAE/32-100--------------------------------------------------------------------------------
Q55EJ1_DICDI/941-1003--------------------------------------------------------------------------------
Q4Y3J9_PLACH/9-71--------------------------------------------------------------------------------
Q7Q848_ANOGA/57-120--------------------------------------------------------------------------------
Q9W4C3_DROME/70-164--------------------------------------------------------------------------------
A0BHH7_PARTE/29-97--------------------------------------------------------------------------------
A7REZ3_NEMVE/173-246--------------------------------------------------------------------------------
Q23RF9_TETTS/272-336--------------------------------------------------------------------------------
Q0SGQ5_RHOJR/26-95--------------------------------------------------------------------------------
A3LWP4_PICST/64-126--------------------------------------------------------------------------------
A7AU59_BABBO/59-121--------------------------------------------------------------------------------
Q4YCK5_PLABA/187-270--------------------------------------------------------------------------------
A1SM61_NOCSJ/18-87--------------------------------------------------------------------------------
A8XIA6_CAEBR/53-115--------------------------------------------------------------------------------
Q1DFK0_MYXXD/21-90--------------------------------------------------------------------------------
Q5KKZ9_CRYNJ/100-162--------------------------------------------------------------------------------
A6W9F1_KINRD/23-92--------------------------------------------------------------------------------
UBP1_ARATH/56-151--------------------------------------------------------------------------------
Q582Q1_TRYB2/178-250--------------------------------------------------------------------------------
A0C6J0_PARTE/90-152--------------------------------------------------------------------------------
Q8SSA5_ENCCU/124-196--------------------------------------------------------------------------------
Q1MTK1_DANRE/26-88--------------------------------------------------------------------------------
Q2UMH5_ASPOR/176-250--------------------------------------------------------------------------------
B1AY15_MOUSE/192-253--------------------------------------------------------------------------------
Q5ALK2_CANAL/329-392--------------------------------------------------------------------------------
P91502_CAEEL/185-266--------------------------------------------------------------------------------
UBP8_SCHPO/38-99--------------------------------------------------------------------------------
SIR2A_DICDI/34-96--------------------------------------------------------------------------------
A7RQL5_NEMVE/37-99--------------------------------------------------------------------------------
Q8IR38_DROME/1014-1076--------------------------------------------------------------------------------
A7H950_ANADF/23-92--------------------------------------------------------------------------------
Q6CEB0_YARLI/174-247--------------------------------------------------------------------------------
A4S4P2_OSTLU/20-82--------------------------------------------------------------------------------
Q55C68_DICDI/441-503--------------------------------------------------------------------------------
A3LTF5_PICST/186-263--------------------------------------------------------------------------------
Q5KEY2_CRYNJ/82-153--------------------------------------------------------------------------------
Q6CNA2_KLULA/57-121--------------------------------------------------------------------------------
Q6CU80_KLULA/45-107--------------------------------------------------------------------------------
UBP14_SCHPO/174-248--------------------------------------------------------------------------------
UBP16_DANRE/48-129--------------------------------------------------------------------------------
Q6FRA4_CANGA/200-273--------------------------------------------------------------------------------
Q6C622_YARLI/29-91--------------------------------------------------------------------------------
D7TC41_VITVI/207-266--------------------------------------------------------------------------------
E5KGE0_ARATH/225-284--------------------------------------------------------------------------------
E7QIK7_YEASZ/46-105--------------------------------------------------------------------------------
F0V7F7_NEOCL/86-147--------------------------------------------------------------------------------
F4IHD8_ARATH/60-118--------------------------------------------------------------------------------
F6SBG8_CIOIN/199-271--------------------------------------------------------------------------------
F6V8N9_CIOIN/219-278--------------------------------------------------------------------------------
F6WLJ5_XENTR/1088-1148--------------------------------------------------------------------------------
F7AYQ7_CALJA/29-106--------------------------------------------------------------------------------
F7DP39_XENTR/198-270--------------------------------------------------------------------------------
F7DQH6_XENTR/29-90--------------------------------------------------------------------------------
F8W4B7_DANRE/999-1059--------------------------------------------------------------------------------
G1PW17_MYOLU/357-416--------------------------------------------------------------------------------
G4LXM5_SCHMA/205-277--------------------------------------------------------------------------------
G4VF40_SCHMA/27-88--------------------------------------------------------------------------------
H0Y8J5_HUMAN/29-105--------------------------------------------------------------------------------
H2PJ11_PONAB/26-87--------------------------------------------------------------------------------
H3C8M1_TETNG/1048-1107--------------------------------------------------------------------------------
H3CSL1_TETNG/29-108--------------------------------------------------------------------------------
H3DDM2_TETNG/196-268--------------------------------------------------------------------------------
H3DNW7_TETNG/48-132--------------------------------------------------------------------------------
I1PQ93_ORYGL/50-114--------------------------------------------------------------------------------
I1QNV7_ORYGL/121-182--------------------------------------------------------------------------------
Q22MQ4_TETTS/55-117--------------------------------------------------------------------------------

PF14446

D4KCM5_9FIRM/3-56--------------------------------------------------------------------KYY---------
R5L268_9CLOT/4-54--------------------------------------------------------------------.YE---------
R6CMF0_9FIRM/3-56--------------------------------------------------------------------KYI---------
R6IX88_9FIRM/4-55--------------------------------------------------------------------..N---------
R6DEQ5_9CLOT/4-58--------------------------------------------------------------------NYK---------
R7F8M1_9FIRM/6-57--------------------------------------------------------------------..V---------
D4L8K9_9FIRM/2-55--------------------------------------------------------------------EFT---------
E6UEW2_RUMA7/3-55--------------------------------------------------------------------NYT---------
R6T2N4_9FIRM/3-56--------------------------------------------------------------------NYT---------
R6P286_9CLOT/3-55--------------------------------------------------------------------DYT---------
D4LCL0_RUMC1/2-55--------------------------------------------------------------------DYT---------
R6Y3H6_9FIRM/3-56--------------------------------------------------------------------DYT---------
R6EIU8_9FIRM/2-57--------------------------------------------------------------------NKF---------
R5MJ60_9FIRM/2-55--------------------------------------------------------------------DYR---------
R6Q9T1_9FIRM/3-56--------------------------------------------------------------------SYK---------
R7MRY6_9FIRM/2-55--------------------------------------------------------------------NYI---------
R6UCX1_9CLOT/2-55--------------------------------------------------------------------NYY---------
R6MU41_9FIRM/2-55--------------------------------------------------------------------DFY---------
R6NKW4_9CLOT/2-55--------------------------------------------------------------------KYN---------
R5UYS9_9FIRM/3-56--------------------------------------------------------------------DYT---------
R7KZN4_9FIRM/3-56--------------------------------------------------------------------NYT---------
R6DV58_9FIRM/2-55--------------------------------------------------------------------NYT---------
B5IDB3_ACIB4/1537-1587--------------------------------------------------------------------NKE---------
D4JWG4_9FIRM/4-56--------------------------------------------------------------------QFK---------
D2R359_PIRSD/219-268--------------------------------------------------------------------.DV---------
R5GQ20_9FIRM/3-56--------------------------------------------------------------------RFD---------
R7NJ19_9FIRM/2-55--------------------------------------------------------------------DYI---------
R6QRD2_9CLOT/2-55--------------------------------------------------------------------DYT---------

PF02591

D7CW01_TRURR/196-228--------------------------------------------------------------------------------
E8RBW9_DESPD/198-230--------------------------------------------------------------------------------
D5USN8_TSUPD/203-237--------------------------------------------------------------------------------
H8KX59_SOLCM/203-235--------------------------------------------------------------------------------
H2K064_STRHJ/154-188--------------------------------------------------------------------------------
A6GYY0_FLAPJ/207-239--------------------------------------------------------------------------------
A0R095_MYCS2/203-237--------------------------------------------------------------------------------
F4GK73_SPHCD/198-230--------------------------------------------------------------------------------
D9QBM9_CORP2/199-233--------------------------------------------------------------------------------
D3SLT3_THEAH/194-225--------------------------------------------------------------------------------
C7M0A3_ACIFD/194-225--------------------------------------------------------------------------------
E1WZY1_HALMS/198-230--------------------------------------------------------------------------------
A1AU73_PELPD/198-230--------------------------------------------------------------------------------
H6L2M2_SAPGL/209-241--------------------------------------------------------------------------------
B2V9X7_SULSY/199-231--------------------------------------------------------------------------------
D6Z574_DESAT/198-230--------------------------------------------------------------------------------
F0SP42_RUBBR/198-229--------------------------------------------------------------------------------
C7LXG6_DESBD/201-233--------------------------------------------------------------------------------
B5HBP1_STRPR/205-239--------------------------------------------------------------------------------
A4J7B5_DESRM/199-231--------------------------------------------------------------------------------
E3IZA7_FRASU/205-239--------------------------------------------------------------------------------
F2NIX1_DESAR/198-230--------------------------------------------------------------------------------
D7WEF2_9CORY/185-219--------------------------------------------------------------------------------
Q1MR74_LAWIP/201-233--------------------------------------------------------------------------------
C6VSB1_DYAFD/203-235--------------------------------------------------------------------------------
Q310X1_DESAG/201-233--------------------------------------------------------------------------------
B3QVG4_CHLT3/224-255--------------------------------------------------------------------------------
O67273_AQUAE/199-231--------------------------------------------------------------------------------
E4NAI7_KITSK/204-238--------------------------------------------------------------------------------
Q2LRB2_SYNAS/198-230--------------------------------------------------------------------------------
A7ZDY4_CAMC1/198-230--------------------------------------------------------------------------------
D1BFS0_SANKS/205-239--------------------------------------------------------------------------------
D3PKG4_MEIRD/209-241--------------------------------------------------------------------------------
F8E5M6_FLESM/198-230--------------------------------------------------------------------------------
E1R070_OLSUV/200-232--------------------------------------------------------------------------------
Q8FNL0_COREF/200-234--------------------------------------------------------------------------------
E4TJQ2_CALNY/198-230--------------------------------------------------------------------------------
C8W3J9_DESAS/199-229--------------------------------------------------------------------------------
F7UUL4_EEGSY/204-236--------------------------------------------------------------------------------
G8QW58_SPHPG/201-233--------------------------------------------------------------------------------
Q1IH82_KORVE/197-229--------------------------------------------------------------------------------
F2IHQ3_FLUTR/210-242--------------------------------------------------------------------------------
Q39YN1_GEOMG/198-230--------------------------------------------------------------------------------
Q3A145_PELCD/203-235--------------------------------------------------------------------------------
D6ZCR4_SEGRD/202-236--------------------------------------------------------------------------------
F0JJ48_DESDE/199-231--------------------------------------------------------------------------------
C7R4X6_JONDD/205-239--------------------------------------------------------------------------------
B8E091_DICTD/203-234--------------------------------------------------------------------------------
D0LJD1_HALO1/197-229--------------------------------------------------------------------------------
B8FBL1_DESAA/198-230--------------------------------------------------------------------------------
D2QM72_SPILD/203-235--------------------------------------------------------------------------------
A1TB60_MYCVP/203-237--------------------------------------------------------------------------------
I0AGC4_IGNAJ/198-230--------------------------------------------------------------------------------
H5XB79_9PSEU/203-237--------------------------------------------------------------------------------
Q82B29_STRAW/154-188--------------------------------------------------------------------------------
F4CPL6_PSEUX/204-238--------------------------------------------------------------------------------
D9SW71_CLOC7/134-166--------------------------------------------------------------------------------
F8KR50_HELBC/198-230--------------------------------------------------------------------------------
F2NRR6_TRES6/199-231--------------------------------------------------------------------------------
H6RR27_BLASD/204-238--------------------------------------------------------------------------------
I0IQZ1_LEPFC/205-237--------------------------------------------------------------------------------
E8WWT9_GRATM/197-231--------------------------------------------------------------------------------
B2HHN3_MYCMM/203-237--------------------------------------------------------------------------------
D3Q8L5_STANL/203-237--------------------------------------------------------------------------------
F4L5M1_HALH1/205-237--------------------------------------------------------------------------------
E2SAW4_9ACTN/217-251--------------------------------------------------------------------------------
F8A8B3_THEID/198-230--------------------------------------------------------------------------------
C7QEZ0_CATAD/213-247--------------------------------------------------------------------------------
C0QXL6_BRAHW/236-268--------------------------------------------------------------------------------
E6X1V8_NITSE/198-230--------------------------------------------------------------------------------
C4LHY9_CORK4/204-238--------------------------------------------------------------------------------
D1ABL3_THECD/205-239--------------------------------------------------------------------------------
A5N6R6_CLOK5/198-230--------------------------------------------------------------------------------
Q6AFH8_LEIXX/202-236--------------------------------------------------------------------------------
E3M712_CAERE/151-185--------------------------------------------------------------------------------
Q892T4_CLOTE/202-233--------------------------------------------------------------------------------
E4TZZ4_SULKY/198-230--------------------------------------------------------------------------------
F8C3W2_THEGP/198-230--------------------------------------------------------------------------------
D4H0K2_DENA2/198-230--------------------------------------------------------------------------------
D1BU89_XYLCX/205-239--------------------------------------------------------------------------------
A0LTB4_ACIC1/195-229--------------------------------------------------------------------------------
A1R7D0_ARTAT/204-238--------------------------------------------------------------------------------
C0QQ58_PERMH/198-230--------------------------------------------------------------------------------
F5XSN4_MICPN/218-252--------------------------------------------------------------------------------
B4U7G6_HYDS0/196-229--------------------------------------------------------------------------------
A9GWK4_SORC5/199-231--------------------------------------------------------------------------------
I0I5N9_CALAS/197-230--------------------------------------------------------------------------------
E6SCX3_INTC7/204-238--------------------------------------------------------------------------------
D9QVH7_ACEAZ/200-232--------------------------------------------------------------------------------
B0VEU1_CLOAI/198-230--------------------------------------------------------------------------------
E3PSL8_CLOSD/197-229--------------------------------------------------------------------------------
D5SMG3_PLAL2/198-229--------------------------------------------------------------------------------
B5YKU4_THEYD/198-230--------------------------------------------------------------------------------
F2N9J7_CORGP/199-231--------------------------------------------------------------------------------
A5D3S3_PELTS/200-232--------------------------------------------------------------------------------
B1ZR74_OPITP/55-87--------------------------------------------------------------------------------
D2PXM0_KRIFD/210-244--------------------------------------------------------------------------------
F4KM12_PORAD/213-245--------------------------------------------------------------------------------
Q4JWH7_CORJK/209-246--------------------------------------------------------------------------------
A4FA30_SACEN/202-236--------------------------------------------------------------------------------
D5V694_ARCNC/198-230--------------------------------------------------------------------------------
G8S6I4_ACTS5/202-236--------------------------------------------------------------------------------
F4H288_CELFA/205-239--------------------------------------------------------------------------------
C1A4A7_GEMAT/199-231--------------------------------------------------------------------------------
C8WAM4_ATOPD/199-231--------------------------------------------------------------------------------
F4LT01_TEPAE/203-235--------------------------------------------------------------------------------
F6FX24_ISOV2/205-239--------------------------------------------------------------------------------
D6E737_9ACTN/204-236--------------------------------------------------------------------------------
B2A1Z6_NATTJ/202-233--------------------------------------------------------------------------------
I0GKK5_CALEA/198-232--------------------------------------------------------------------------------
E8T3Z5_THEA1/196-230--------------------------------------------------------------------------------
F0RPE1_DEIPM/221-254--------------------------------------------------------------------------------
D7B0S9_NOCDD/205-239--------------------------------------------------------------------------------
I0IBX2_PHYMF/204-237--------------------------------------------------------------------------------
B9M160_GEODF/198-230--------------------------------------------------------------------------------
A6WDB0_KINRD/205-239--------------------------------------------------------------------------------
E1QGT3_DESB2/198-230--------------------------------------------------------------------------------
F0S1X1_DESTD/196-230--------------------------------------------------------------------------------
D2B5L8_STRRD/204-238--------------------------------------------------------------------------------
C7N548_SLAHD/204-236--------------------------------------------------------------------------------
G0HE53_CORVD/203-237--------------------------------------------------------------------------------
D7GEZ5_PROFC/205-239--------------------------------------------------------------------------------
E8R2V5_ISOPI/212-244--------------------------------------------------------------------------------
C8WYS1_DESRD/201-233--------------------------------------------------------------------------------
H1XNL8_9BACT/198-230--------------------------------------------------------------------------------
H6RB51_NOCCG/203-237--------------------------------------------------------------------------------
F5YHY4_TREPZ/200-232--------------------------------------------------------------------------------
E8N603_ANATU/201-233--------------------------------------------------------------------------------
B1H0J8_UNCTG/201-233--------------------------------------------------------------------------------
B1ZTK1_OPITP/198-236--------------------------------------------------------------------------------
Q47NI2_THEFY/205-239--------------------------------------------------------------------------------
D5EJ60_CORAD/200-232--------------------------------------------------------------------------------
Q02AV0_SOLUE/198-230--------------------------------------------------------------------------------
D6Y3S0_THEBD/204-238--------------------------------------------------------------------------------
Q9RXL9_DEIRA/202-235--------------------------------------------------------------------------------
F8DZM6_CORRG/160-194--------------------------------------------------------------------------------
C7MNB6_CRYCD/204-236--------------------------------------------------------------------------------
Q3AEW5_CARHZ/190-223--------------------------------------------------------------------------------
F6DN00_DESRL/200-232--------------------------------------------------------------------------------
E8NEW2_MICTS/211-245--------------------------------------------------------------------------------
D2R6Q9_PIRSD/198-229--------------------------------------------------------------------------------
A1SI89_NOCSJ/192-226--------------------------------------------------------------------------------
F3ZEA3_9ACTN/247-281--------------------------------------------------------------------------------
D5MKY7_9BACT/198-230--------------------------------------------------------------------------------
D5XA06_THEPJ/201-235--------------------------------------------------------------------------------
C1CYG9_DEIDV/201-234--------------------------------------------------------------------------------
Q6AQL1_DESPS/198-230--------------------------------------------------------------------------------
F6EEJ8_AMYSD/203-237--------------------------------------------------------------------------------
A9WV12_RENSM/203-237--------------------------------------------------------------------------------
B2GJM7_KOCRD/206-240--------------------------------------------------------------------------------
D8PBZ4_9BACT/198-230--------------------------------------------------------------------------------
B2UPD4_AKKM8/206-238--------------------------------------------------------------------------------
C8XD03_NAKMY/205-239--------------------------------------------------------------------------------
D8K3D7_DEHLB/196-227--------------------------------------------------------------------------------
A8ZUC1_DESOH/203-235--------------------------------------------------------------------------------
B3E3Z4_GEOLS/198-230--------------------------------------------------------------------------------
A0LHK0_SYNFM/198-230--------------------------------------------------------------------------------
C9ZFS7_STRSW/154-188--------------------------------------------------------------------------------
B3ERJ2_AMOA5/203-235--------------------------------------------------------------------------------
H9UJ68_SPIAZ/199-231--------------------------------------------------------------------------------
C6WMA7_ACTMD/203-237--------------------------------------------------------------------------------
D3DIT4_HYDTT/201-232--------------------------------------------------------------------------------
D3UJC4_HELM1/198-230--------------------------------------------------------------------------------
G8NXJ9_GRAMM/202-237--------------------------------------------------------------------------------
F2LX23_HIPMA/198-230--------------------------------------------------------------------------------
E4U6K4_OCEP5/208-240--------------------------------------------------------------------------------
C0QJZ7_DESAH/202-234--------------------------------------------------------------------------------
F3ZXL4_MAHA5/200-232--------------------------------------------------------------------------------
A4XA49_SALTO/203-237--------------------------------------------------------------------------------
A5I614_CLOBH/200-232--------------------------------------------------------------------------------
A8EW76_ARCB4/198-230--------------------------------------------------------------------------------
B0RBZ5_CLAMS/216-247--------------------------------------------------------------------------------
B1MNT6_MYCA9/203-237--------------------------------------------------------------------------------
B1VZB7_STRGG/205-239--------------------------------------------------------------------------------
B5EBN9_GEOBB/199-230--------------------------------------------------------------------------------
B9L658_NAUPA/198-230--------------------------------------------------------------------------------
C3PHN4_CORA7/199-233--------------------------------------------------------------------------------
C5ZXZ9_9HELI/198-230--------------------------------------------------------------------------------
E3FII3_STIAD/206-238--------------------------------------------------------------------------------
E9T6R3_RHOHA/203-237--------------------------------------------------------------------------------
F9D1I3_PREDD/209-241--------------------------------------------------------------------------------
G0GDN6_SPITZ/200-232--------------------------------------------------------------------------------
G2LF52_CHLTF/198-230--------------------------------------------------------------------------------
H6MTK0_GORPV/203-237--------------------------------------------------------------------------------
I0FDE6_BORCA/197-230--------------------------------------------------------------------------------
I7GYL8_9HELI/198-230--------------------------------------------------------------------------------
J9ZCR4_LEPFM/169-201--------------------------------------------------------------------------------
M4ZSY7_9FLAO/214-243--------------------------------------------------------------------------------
O25612_HELPY/198-230--------------------------------------------------------------------------------
O83507_TREPA/200-232--------------------------------------------------------------------------------
Q2INW5_ANADE/216-248--------------------------------------------------------------------------------
Q3Z9J3_DEHM1/198-228--------------------------------------------------------------------------------
Q6AA08_PROAC/204-238--------------------------------------------------------------------------------
Q73N09_TREDE/199-231--------------------------------------------------------------------------------
Q7UQ03_RHOBA/205-236--------------------------------------------------------------------------------
Q83GK9_TROWT/198-232--------------------------------------------------------------------------------
Q8NNG7_CORGL/200-234--------------------------------------------------------------------------------
Q97JH9_CLOAB/202-233--------------------------------------------------------------------------------
Y1638_MYCLE/190-223--------------------------------------------------------------------------------
R5ZHZ8_9ACTN/201-232--------------------------------------------------------------------------------
R7JLD2_9BACT/212-244--------------------------------------------------------------------------------
U5RWI1_9CLOT/198-230--------------------------------------------------------------------------------
V9XG76_9NOCA/203-237--------------------------------------------------------------------------------
W0EZD5_9SPHI/207-239--------------------------------------------------------------------------------
W5XSH9_9CORY/203-237--------------------------------------------------------------------------------

PF13901

B7Q8K7_IXOSC/495-696----------------------------------------------------------------HVCTYDG---------
Q9W3C9_DROME/619-824----------------------------------------------------------------RYCTYLG---------
H2WP71_CAEJA/258-466----------------------------------------------------------------RLCDYSG---------
B4JLA4_DROGR/709-910----------------------------------------------------------------RYCNYLG---------
A0BWI8_PARTE/329-520----------------------------------------------------------------.YCHYSG---------
M4EY72_BRARP/290-495----------------------------------------------------------------RLCEYTG---------
I3KPJ5_ORENI/861-1062----------------------------------------------------------------RLCEFSG---------
G7Y978_CLOSI/540-742----------------------------------------------------------------RFCEFFG---------
U1LYD3_ASCSU/245-449----------------------------------------------------------------RLCDYNG---------
B4I7Z9_DROSE/499-700----------------------------------------------------------------QVCAFSG---------
D6WGG5_TRICA/215-416----------------------------------------------------------------RKCDYSG---------
H3AQ72_LATCH/257-456----------------------------------------------------------------RYCEYLG---------
W5MPN4_LEPOC/703-904----------------------------------------------------------------RYCEYLG---------
D2H8H1_AILME/525-726----------------------------------------------------------------KVCNYSG---------
B7Q1L9_IXOSC/224-426----------------------------------------------------------------RRCEYTG---------
H2YN40_CIOSA/169-371----------------------------------------------------------------RLCDYNG---------
W5CJD8_WHEAT/308-510----------------------------------------------------------------RFCAYTG---------
D3BFT0_POLPA/795-997----------------------------------------------------------------RFCYYTG---------
J9KYL6_ACYPI/640-840----------------------------------------------------------------RYCFYLG---------
B0G190_DICDI/1180-1384----------------------------------------------------------------KICYYTG---------
T1JKT5_STRMM/256-458----------------------------------------------------------------RMCDYSG---------
T1FZW2_HELRO/83-284----------------------------------------------------------------RQCDYDG---------
T1L198_TETUR/170-375----------------------------------------------------------------RVCEFDG---------
Q7Q6B8_ANOGA/327-529----------------------------------------------------------------RLCDYTG---------
E9FRK4_DAPPU/108-308----------------------------------------------------------------.LCDYSG---------
B4N298_DROWI/585-790----------------------------------------------------------------RYCTYLG---------
A0A087W276_ECHMU/451-682----------------------------------------------------------------RFCEYFG---------
B4MMN6_DROWI/248-450----------------------------------------------------------------RLCDYNG---------
G6DK84_DANPL/508-709----------------------------------------------------------------KVCGFTG---------
A9T181_PHYPA/259-461----------------------------------------------------------------RWCEYSG---------
H2YFY0_CIOSA/55-253----------------------------------------------------------------RLCWYTG---------
B7PZV1_IXOSC/400-601----------------------------------------------------------------RYCSYLG---------
W5LPV2_ASTMX/534-735----------------------------------------------------------------RLCEFSG---------
G3X7G7_BOVIN/852-1058----------------------------------------------------------------KLCAFSG---------
A9UU05_MONBE/125-326----------------------------------------------------------------HLCDYSG---------
H3EAL3_PRIPA/754-955----------------------------------------------------------------.VCALDG---------
H0YYN7_TAEGU/823-1024----------------------------------------------------------------KLCSFSG---------
A0A0D2X512_CAPO3/757-957----------------------------------------------------------------RTCDYSG---------
H3AA51_LATCH/845-1046----------------------------------------------------------------KLCAFSG---------
K1S180_CRAGI/366-568----------------------------------------------------------------RLCDYSG---------
T1L3P9_TETUR/344-549----------------------------------------------------------------.YCYYTG---------
G3R769_GORGO/295-497----------------------------------------------------------------RQCDYTG---------
G3WFP8_SARHA/565-764----------------------------------------------------------------RYCDYLG---------
I7MFD5_TETTS/395-585----------------------------------------------------------------.FCHYTG---------
W1P5W0_AMBTC/840-1041----------------------------------------------------------------RLCEYTG---------
A8P142_BRUMA/315-527----------------------------------------------------------------RYCDYYG---------
F4PVD1_DICFS/686-883----------------------------------------------------------------RYCEYSG---------
F1A452_DICPU/942-1142----------------------------------------------------------------RLCDYSG---------
W4XSF2_STRPU/412-614----------------------------------------------------------------RLCDYSG---------
G1KN51_ANOCA/851-1052----------------------------------------------------------------KLCSFTG---------
J9JZL2_ACYPI/216-416----------------------------------------------------------------RLCDYDG---------
R4FMB7_RHOPR/242-441----------------------------------------------------------------RKCDYNG---------
F7E023_ORNAN/420-619----------------------------------------------------------------RYCDYLG---------
A8XHJ6_CAEBR/387-603----------------------------------------------------------------KFCDYYG---------
H0ZH73_TAEGU/715-915----------------------------------------------------------------RYCEYLG---------
F6ZK14_CIOIN/612-810----------------------------------------------------------------RLCYFTG---------
D7FQ81_ECTSI/1257-1460----------------------------------------------------------------..CRYAD---------
E5S714_TRISP/197-388----------------------------------------------------------------RLCHYSG---------
A8XYD1_CAEBR/276-477----------------------------------------------------------------.TCAIDS---------
J9JLP1_ACYPI/451-650----------------------------------------------------------------..CNFTA---------
T1HXH3_RHOPR/730-924----------------------------------------------------------------RYCEYLA---------
M0UBC7_MUSAM/273-478----------------------------------------------------------------RFCEYSG---------
I1GFB5_AMPQE/599-798----------------------------------------------------------------RFCYYIG---------
E1ZXM9_CAMFO/755-957----------------------------------------------------------------RYCEYLG---------
Q16MZ5_AEDAE/483-680----------------------------------------------------------------RYCHYLG---------
K4BKD6_SOLLC/671-875----------------------------------------------------------------RFCEYSG---------
G6DR39_DANPL/218-415----------------------------------------------------------------RLCDYTG---------
H2M7Y1_ORYLA/868-1069----------------------------------------------------------------RLCEFSG---------
F2UDN1_SALR5/921-1126----------------------------------------------------------------KLCDYTG---------
F1RAA9_DANRE/73-272----------------------------------------------------------------RYCDYLG---------
B3S7P2_TRIAD/84-285----------------------------------------------------------------.VCNFDG---------
Q29GS8_DROPS/642-843----------------------------------------------------------------RYCSYLG---------
B0W0J9_CULQU/596-795----------------------------------------------------------------RYCHYLG---------
E0VZS4_PEDHC/212-414----------------------------------------------------------------RLCDYTG---------
D2UZU6_NAEGR/962-1169----------------------------------------------------------------RYCNYTN---------
F1Q4W5_DANRE/692-894----------------------------------------------------------------RYCEYLG---------
U3K0L4_FICAL/293-492----------------------------------------------------------------RYCDYLG---------
J9EU11_WUCBA/2-201----------------------------------------------------------------..CGFDE---------
A7SVS4_NEMVE/36-235----------------------------------------------------------------KVCSYDG---------
F5HJM0_ANOGA/399-591----------------------------------------------------------------RYCHYTG---------
H2VVR0_CAEJA/379-592----------------------------------------------------------------RFCDYFG---------
A0BU97_PARTE/109-299----------------------------------------------------------------.LCFFHG---------
M4ATE6_XIPMA/868-1069----------------------------------------------------------------RLCEFSG---------
E5SLH5_TRISP/488-680----------------------------------------------------------------KVCNFDG---------
W4XDG9_STRPU/79-271----------------------------------------------------------------RYCEYLG---------
D8QPZ9_SELML/294-498----------------------------------------------------------------RFCEYTG---------
W5JEW3_ANODA/349-551----------------------------------------------------------------RLCDYTG---------
F1NS53_CHICK/781-982----------------------------------------------------------------KLCAYSG---------
E1G3Q0_LOALO/235-437----------------------------------------------------------------RLCDYNG---------
W5MWV1_LEPOC/272-471----------------------------------------------------------------RYCEYLG---------
Q54BL5_DICDI/1135-1340----------------------------------------------------------------RFCDYSG---------
G3NH32_GASAC/866-1069----------------------------------------------------------------RLCEFSG---------
E0VRE2_PEDHC/406-607----------------------------------------------------------------RLCYFTG---------
T1IN68_STRMM/846-1047----------------------------------------------------------------RYCEYLG---------
A0A068Y4E2_ECHMU/286-475----------------------------------------------------------------.VCHFTK---------
F2UD64_SALR5/665-865----------------------------------------------------------------RWCEYTG---------
A0A068X7K2_HYMMI/442-665----------------------------------------------------------------RFCEYFG---------
B0WIJ1_CULQU/290-494----------------------------------------------------------------RLCDYSG---------
M3ZYS3_XIPMA/514-713----------------------------------------------------------------RHCEYLG---------
H3AW67_LATCH/702-903----------------------------------------------------------------RYCEYLG---------
X6NIC7_RETFI/99-294----------------------------------------------------------------HYCRYTG---------
C3XVM6_BRAFL/226-428----------------------------------------------------------------RQCDYTG---------
E9H211_DAPPU/35-239----------------------------------------------------------------RVCNFSG---------
M3W8L8_FELCA/301-503----------------------------------------------------------------KLCAFSG---------
H2S0U6_TAKRU/778-981----------------------------------------------------------------RLCHFSG---------
I3KKB8_ORENI/353-554----------------------------------------------------------------KVCYYSG---------
B9I3B8_POPTR/793-999----------------------------------------------------------------RLCEYTG---------
H2LST4_ORYLA/718-919----------------------------------------------------------------RYCEYLG---------
T1L0C9_TETUR/212-411----------------------------------------------------------------.LCDYDG---------
U1MIB3_ASCSU/827-1027----------------------------------------------------------------.VCALDA---------
H3FHB7_PRIPA/340-564----------------------------------------------------------------RFCDYYG---------
K7J291_NASVI/486-684----------------------------------------------------------------.VCCFSG---------
F6S0C5_XENTR/726-926----------------------------------------------------------------RYCEYLG---------
F6ZX35_XENTR/773-974----------------------------------------------------------------KHCAYSA---------
F4PGY6_DICFS/902-1102----------------------------------------------------------------..CFNKC---------
W5N6E1_LEPOC/842-1043----------------------------------------------------------------RLCEYSG---------
A3KNA4_DANRE/635-836----------------------------------------------------------------RLCEFSG---------
E0VEL0_PEDHC/612-811----------------------------------------------------------------RYCEYLG---------
A0A0D2WSD5_CAPO3/1008-1238----------------------------------------------------------------.HCGYCG---------
F4WPF9_ACREC/488-687----------------------------------------------------------------HVCAYSG---------
W5QGD3_SHEEP/744-931----------------------------------------------------------------.......---------
K7IQS8_NASVI/225-427----------------------------------------------------------------RLCDYTG---------
B7ZBN5_HUMAN/293-492----------------------------------------------------------------RYCEYLG---------

PF01485

Q23RJ6_TETTS/555-575--------------------------------------------......KLAD.......L..................
Q0UG70_PHANO/204-272--------------------------------------------VDFDKALVKH.......L..LSA.SPT.........
Q9VM88_DROME/67-124--------------------------------------------QQYSNEPMKT.......TVIRTK.TPD...N.....
A7RZU5_NEMVE/129-194--------------------------------------------SKYEDRLQEE.......ALSLAE.MED.........
Q2H650_CHAGB/77-137--------------------------------------------AAYRARLAEH.......D......AAE.........
Q0UJR1_PHANO/59-128--------------------------------------------DKFKILWNKK.......Y..QEYTTAN.........
Q7S3S6_NEUCR/125-184--------------------------------------------QAYEDMVEEL.......T......TSD.........
Q0UVP3_PHANO/341-395--------------------------------------------ERREELGTSD..........................
Q2UQ22_ASPOR/230-292--------------------------------------------EEMIRKFEEK.......T..VEHNDFN.........
A1DMT8_NEOFI/212-273--------------------------------------------ARSQQFEEKA..........IEFSDPH.........
Q1WMV1_COPDI/251-318--------------------------------------------AQYLAKKAE...........YDVSAQN.........
Q2U3I4_ASPOR/131-193--------------------------------------------TEEKDAFQRA.......K..IEFSTSN.........
Q2GWG6_CHAGB/257-321--------------------------------------------TIVGQYQAKK..........VEFETPN.........
Q4WL53_ASPFU/238-296--------------------------------------------EQYEKKKIEF.......E......TPN.........
A7F8K5_SCLS1/296-359--------------------------------------------QEFQRKVLER.......K..VP..AGD.........
Q68ST7_PLEDJ/266-326--------------------------------------------AEFQSKAREF.......ATPALQ.............
Q4W9M4_ASPFU/167-231--------------------------------------------KALFKLKARE.......Y..ATS.ARE.........
A6RDQ7_AJECN/243-309--------------------------------------------DAF.RLKAQE..........YSISEPH.........
Q9FLR7_ARATH/228-298--------------------------------------------TMYKKASMIK.......AKVLD..............
A4VAL0_DANRE/80-142--------------------------------------------SRFQQYVEAA.......Q.SLKQ.HES.........
Q0IH68_XENLA/568-627--------------------------------------------QEYLKVAKTL.......F.....TDEA.........
A7TMB6_VANPO/272-338--------------------------------------------ERYKELHYNQ.......A..ATK.LSK....HCTYA
A2FQQ3_TRIVA/174-236--------------------------------------------KKLEERISSL.......S..ASM.SKT.........
Q7JR34_DROME/850-956--------------------------------------------KKHHRYRLNR.......E..IEL.DKT.........
Q7PQ32_ANOGA/514-613--------------------------------------------...HRYRLNRGELVKNTQ..VEL.DRF.........
Q9FHR4_ARATH/262-328--------------------------------------------EMWKRKMEED..........LIP.DAE.........
Q9M1F6_ARATH/134-200--------------------------------------------EMWEQRIKEE.......SIPVCN.............
Q6L461_SOLDE/416-489--------------------------------------------DIMKQRIKEA.......S..IPV.TE..........
Q0V1Z8_PHANO/170-230--------------------------------------------EMYEVYKRDP..........INK.............
Q0J5A0_ORYSJ/102-168--------------------------------------------ERWCAALCEA..........MFA.GAR.........
A3CJQ1_ORYSJ/265-336--------------------------------------------DSLERAFAEA..........GTS.DME.........
O81849_ARATH/271-348--------------------------------------------TTFKSFEEAN..........VCSKNNG.........
A0C9J1_PARTE/294-352--------------------------------------------DRLEKIAFNQ.......Y..LLQ.NPN.........
Q7T3F2_DANRE/81-146--------------------------------------------ELYQRLRFER.......G..VQL.DPS.........
A0BX70_PARTE/182-243--------------------------------------------TKYIKCHQNL.......E..IAM.NPN.........
R144A_XENTR/91-156--------------------------------------------QKYKKLQFEK.......E..ILL.DPC.........
A0C0J8_PARTE/198-258--------------------------------------------QLYKEILVKR.......M..LDN.DSN.........
ITT1_SCHPO/246-308--------------------------------------------NRYKELEEKR.......R..YEN.DSN.........
Q0V3F8_PHANO/246-350--------------------------------------------ERFVKIKRKK.......K..IES.DPT.........
A1DLQ9_NEOFI/293-390--------------------------------------------QRYVFLKRKK.......K..LES.DKS.........
Q2HB83_CHAGB/279-383--------------------------------------------KRYVTLKYKI.......E..LES.DKN.........
Q5ANG1_CANAL/285-353--------------------------------------------DRYYNLFKKS.......Q..YEW.IGN....LLPNR
Q6CB97_YARLI/222-284--------------------------------------------ERYQKLVHKR.......R..LEK.DPN.........
Q20871_CAEEL/253-315--------------------------------------------AKYEAHMLEK.......A..IRE.MDD.........
Q5BZ98_SCHJA/46-106--------------------------------------------NKYEYLVLKR.......G..LDI.MPD.........
A2XX17_ORYSI/305-363--------------------------------------------ERWERLTLQK.......T..LDS.MSD.........
Q5XH24_XENLA/283-344--------------------------------------------SRYDRLLLQS.......S..LDL.MAD.........
A4RSK7_OSTLU/306-365--------------------------------------------EKYEATLLAR.......T..LDS.MAD.........
Q9NA71_CAEEL/882-946--------------------------------------------RRLTDRAKQL..........LIQTNED.........
A8XYZ1_CAEBR/896-960--------------------------------------------LRILVHKTKD.......A..ILAADPE.........
Q0V5B8_PHANO/216-277--------------------------------------------VRYSKLHTKA..........IYEKIPN.........
Q0V4X6_PHANO/367-428--------------------------------------------QRFDDMMARN.......A..IGE.DPN.........
Q0UBQ8_PHANO/147-210--------------------------------------------NRFDELSMRS.......F..LSA.DAQ.........
A7EIK6_SCLS1/19-81--------------------------------------------ERYCELALRN.......Y..SRS..QA...K.....
Q2HFI8_CHAGB/572-633--------------------------------------------NRYDTLVTRA.......A..LTK.DPA.........
A1DL30_NEOFI/229-293--------------------------------------------QAYDAKRTWQ.......I..LEE..DA...E.....
A7F9A0_SCLS1/213-274--------------------------------------------RKGRRTFIMS..........LQH.LPN.........
Q2GN84_CHAGB/396-458--------------------------------------------ERYQTLSFRS.......A..ISS.SPN.........
Q5C0S0_SCHJA/113-178--------------------------------------------ARYEEFLLQQ..........VMSREPE.........
Q6CSC0_KLULA/197-269--------------------------------------------KKHICLSFET.......F..INKHSKN.........
E7LX16_YEASV/242-314--------------------------------------------SKLMDSSIKS.......F..VQKHNRN.........
Q754G6_ASHGO/233-305--------------------------------------------ELLLLSSIKI.......F..IQKHKHR.........
Q6M9E9_NEUCS/104-166--------------------------------------------AKYEDFLTKN.......M..LES.QEG.........
Q54LZ6_DICDI/472-536--------------------------------------------AKYEDFLLKT.......T..LEE.DPN.........
Q55AE0_DICDI/674-736--------------------------------------------TKYEEFTFST.......F..LMK.SPN.........
Q55CB4_DICDI/344-399--------------------------------------------NRYQDYLKQQ...............RG.........
Q8K5C2_RAT/25-89--------------------------------------------NRYQQYGAEE.......C..VLQMGGV.........
A0CE10_PARTE/1763-1827--------------------------------------------SKLLDQSFKR.......Y..KDQHADE.........
A7RQ71_NEMVE/35-115--------------------------------------------RKYEKFKTD...........IEQ.NPN.........
A0JMU3_XENLA/751-813--------------------------------------------NLFHKKLTER.......T..LMK.DPK.........
Q1RL47_CIOIN/677-741--------------------------------------------QLFQKKLRDQ.......T..LMK.MPN.........
Q230W2_TETTS/356-417--------------------------------------------SKYLRFKSIS.......Q..LKL.ENS.........
Q247S4_TETTS/293-353--------------------------------------------QSYLDFKFDE..........FRV.ENN.........
Q54MZ0_DICDI/178-246--------------------------------------------EKYDKILVNV.......H..LNK.DKN.........
Q22BP1_TETTS/607-681--------------------------------------------KTLINQAISD.......I..LNT..HN...S.....
A0BMN6_PARTE/106-169--------------------------------------------NIYFSAQLDE.......L..VIKHQNK.........
Q23WM6_TETTS/1249-1309--------------------------------------------QKLTNLSLNK.......Y..VSENGSS.........
A0CJN6_PARTE/1122-1184--------------------------------------------ETLINLALNK.......F..VQENNQS.........
A0D443_PARTE/1097-1157--------------------------------------------EKLVELSINK.......Y..VNDMRGV.........
A0CYA7_PARTE/895-955--------------------------------------------EKLIKLSINK.......Y..LQDHAAQ.........
Q54QC7_DICDI/511-574--------------------------------------------IKYQDYSFEK.......T..IEINPDL.........
Q229A2_TETTS/252-314--------------------------------------------EAYELKSLTA.......F..FSQDQAL.........
Q229A4_TETTS/326-388--------------------------------------------QRYEKFSLQN.......Y..IDSNADE.........
A0CDV3_PARTE/213-277--------------------------------------------DEFLNYTLNK.......F..VDDHAAD.........
A0DMF5_PARTE/110-178--------------------------------------------FEFQQYTFKQ.......Y..VES.HGDEVIHNLIIK
A0E469_PARTE/256-316--------------------------------------------QEFQILSLRA.......Y..FSS.KKE.........
A7EFK2_SCLS1/395-455--------------------------------------------D.LLEASFHS.......Y..IRR.HPE...D.....
Q2HC35_CHAGB/712-789--------------------------------------------STFEAILAAS.......FAAHIRCHPT..L......
A0BMN6_PARTE/178-236--------------------------------------------KENNEREFKK..........LVE.NMN.........
A6RDQ7_AJECN/317-367--------------------------------------------ATLEEAEYHG..........................
Q0WQ77_ARATH/358-417--------------------------------------------ERYPDDITLH.......R..LAR.YKR.........
Q0UKC8_PHANO/154-206--------------------------------------------EKFQKLATEN.......G..................
Q9SJT6_ARATH/329-385--------------------------------------------DPLYDVKLKS..........LAN.KKK.........
Q1PDR2_ARATH/324-383--------------------------------------------RLVNDMMLKV.......L..AND.QM..........
A3GHG7_PICST/408-467--------------------------------------------EYQMDLLFNK.......M..LKE.SNE.........
Q6FKI3_CANGA/381-437--------------------------------------------EYLADKMLDL.......A..IEEKGSN.........
Q0V4X6_PHANO/440-511--------------------------------------------ERDQKAQEAA.......S..LKAIGRM.........
A0BMU3_PARTE/314-372--------------------------------------------DKYYELTLKQ.......L..V...............
A2DI48_TRIVA/264-325--------------------------------------------VTNEDLMERR.......L..L...NSE.........
AKIB1_DANRE/500-559--------------------------------------------EAYEDAANCL.......W..LLSNSKP.........
Q7RS61_PLAYO/361-426--------------------------------------------QKWNQLQTKG.......DQNIQWINAN.........
O01963_CAEEL/257-324--------------------------------------------KKWIKKCQDD.......SETMNWINAN.........
RBRA_DICDI/277-345--------------------------------------------DKWLQKASDE.......SENVTWMLAN.........
A7RN86_NEMVE/692-750--------------------------------------------EKLLINERKE.......L..INSVM...........
Q2GN84_CHAGB/548-614--------------------------------------------KKLEEEASTR.......T..VGSTTKP.........
Q22LZ5_TETTS/193-259--------------------------------------------NLYKRFLIKD.......A..FGQ.SET.........
Q23AW5_TETTS/198-264--------------------------------------------KVIFKFILKD..........ILQKNKL.........
Q22R93_TETTS/290-354--------------------------------------------EQAKNILFND.......Y..LQI.SQK.........
Q4SJ42_TETNG/89-205--------------------------------------------EKYEEFMLRR.......W..LIT.EPD.........
Q229P0_TETTS/195-261--------------------------------------------KDYCKFLEDD.......A..LKI.ADY.........
A2DRX6_TRIVA/411-470--------------------------------------------RLFQTEAMND.......V..IKSGLPN.........
Q585X6_TRYB2/200-265--------------------------------------------KRAQQRFLTE.......Y..LSN.HPS.........
A7RN86_NEMVE/613-678--------------------------------------------PKFLKRKLNR.......A..LEM.TSS.........
Q84RJ8_ARATH/352-411--------------------------------------------LKSDAAILES.......F..VKT..QG.........
RN217_XENLA/69-136--------------------------------------------K.YKYFLELS.......R..MD....S...S.....
A0BTN9_PARTE/136-197--------------------------------------------KVYQQSYLLR.......L..SKDYRIT.........
A7SFQ2_NEMVE/95-157--------------------------------------------QNFQKMRAIK.......E..IQI.SKS.........
A0DMT6_PARTE/176-237--------------------------------------------EDYLKIVCRK.......F..IET.NKA.........
A0CBB0_PARTE/168-229--------------------------------------------HEFENLLCRR.......F..VDC.SRY.........
C4YFR1_CANAW/228-310--------------------------------------------NPLLHSAARY.......L..VNS.KPK.........
A4I5P6_LEIIN/216-281--------------------------------------------KQIHRKYLTS.......F..VET.CPT.........
A2E3Y3_TRIVA/264-326--------------------------------------------ESYTNFLIES.......Q..ISE.NPN.........
Q23TC9_TETTS/394-456--------------------------------------------KKYKIFLRNT.......L..INK.DPL.........
Q4Z6J6_PLABA/3-77--------------------------------------------KQYKQLLLNV.......Y..IKK.SSN.........
Y5521_DICDI/685-746--------------------------------------------LKYQKFSMIA.......S..LKT.EP..........
Q23PV0_TETTS/462-522--------------------------------------------EKYMRFKKIM.......V..LNQ.DPN.........
Q23GA0_TETTS/1925-1986--------------------------------------------DKFKALRKIV..........FKRMNPN.........
A0C6V8_PARTE/186-247--------------------------------------------QKYLKFKNNI.......S..VAT.STD.........
Q5KBD0_CRYNJ/212-281--------------------------------------------DRYYNLLNAA.......F..VSD.SPN.........
A0BUC0_PARTE/81-137--------------------------------------------DKYAKLRTLQ.......Y..GES.DPT.........
A0BCF4_PARTE/173-233--------------------------------------------LKYQRFLLIK.......Q..YEHVVNG.........
A0C2Z0_PARTE/208-267--------------------------------------------EKYKRFYNRQ.......V..ISQ.NKN.........
A0E9B7_PARTE/246-307--------------------------------------------QKYDKFKKQK.......L..LDR.DET.........
A0BZF1_PARTE/238-298--------------------------------------------RKYLNFKYKN.......E..IQK.DPN.........
A0BW72_PARTE/251-311--------------------------------------------QQYLVFKRKY.......E..IEN.DPT.........
A0CX68_PARTE/223-282--------------------------------------------QKLRRFRKIK.......Q..LQQ.DPD.........
Q22XZ2_TETTS/376-436--------------------------------------------QKYLKFKELK.......I..INS.DPT.........
A4S4Y2_OSTLU/136-200--------------------------------------------TKFDTFLRRS.......F..LEN.NAK.........
Q7Q687_ANOGA/212-274--------------------------------------------DKYQQFTFAD.......Y..VKS.HPE.........
Q4S7W6_TETNG/199-261--------------------------------------------DKYRRYLFRD.......Y..IES.HFQ.........
A7RK36_NEMVE/187-249--------------------------------------------EKFINFLFND.......Q..IKT.FSK.........
A2DI48_TRIVA/190-255--------------------------------------------DNLVNYLTDL.......Q..ISI.SSD.........
CUL9_HUMAN/2140-2203--------------------------------------------SKYEKALLRG.......Y..VES.CSN.........
RBRA_DICDI/208-273--------------------------------------------ERFNNFILKS.......Y..VDD.NPQ.........
A5DH03_PICGU/210-282--------------------------------------------TPFLNLVARS.......Y..VDTNKQT.........
Q23FV5_TETTS/184-246--------------------------------------------QDYKRNLGRV.......Y..CSE.SKT.........
Q6C062_YARLI/216-283--------------------------------------------AKYQSTLCTR.......Y..VRA.HND.........
AKIB1_MOUSE/403-479--------------------------------------------KRYLQFDIKA.......F..VEN.NPA.........
Q54IL3_DICDI/455-551--------------------------------------------EKYQIFSTKK.......F..IQQ.NKQ.........
Q54XG4_DICDI/282-343--------------------------------------------PKYLERLAQT.......Y..VDQ.NPN.........
Q2LZK2_DROPS/219-280--------------------------------------------GRYQQLITNT.......F..VEC.NAL.........
Q2GQL4_CHAGB/211-278--------------------------------------------ERYHELLHRT.......Y..VED.KET.........
Q5B6Z1_EMENI/341-412--------------------------------------------DRYQTLLTRT.......Y..VDD.KEN.........
ARI16_ARATH/148-214--------------------------------------------EMYENYILES.......F..MECHKAT.........
Q653S8_ORYSJ/202-267--------------------------------------------ERFGWFALRS.......Y..VEE.SAG.........
ARI11_ARATH/208-271--------------------------------------------DKYYRYFLRS.......Y..VED.GKK.........
O01965_CAEEL/194-255--------------------------------------------ATYRKLIVAS.......Y..VET.NRL.........
A7SI45_NEMVE/209-270--------------------------------------------SQYHHLIANS.......F..VVS.NRL.........
Q8T2Q2_DICDI/210-273--------------------------------------------SRYWYFICKD.......F..VGN.NKN.........
Q54I29_DICDI/1407-1472--------------------------------------------QRYIQMYVKS.......F..VEF.NPK.........

PF09416

G8XZA4_PICSO/58-206----------------------------------------------------------------HACAYCG---LHSPNS
Q582F1_TRYB2/29-174----------------------------------------------------------------.SCSYCS---EESPTC
J4G139_FIBRA/92-241----------------------------------------------------------------HACSYCG---IHSPAS
C1EH82_MICSR/1-159----------------------------------------------------------------HACAYCG---IRDPAC
C5GIH5_AJEDR/88-239----------------------------------------------------------------HSCAYCG---IHNPSS
D8LYD6_BLAHO/22-163----------------------------------------------------------------.QCDYCK---NRTGSS
A0A0D2VQ61_CAPO3/152-303----------------------------------------------------------------HACKYCG---IHSPAS
M5E6X4_MALS4/48-199----------------------------------------------------------------HACAYCG---IDDVNC
Q5KKH8_CRYNJ/82-233----------------------------------------------------------------HACSYCG---IHNPQC
Q6C803_YARLI/59-205----------------------------------------------------------------HACVYCG---ESSPAS
R4XJ71_TAPDE/75-226----------------------------------------------------------------HACNYCG---IHNPSC
E4XAF3_OIKDI/106-256----------------------------------------------------------------HACAYCG---IHDPMY
A8I9D7_CHLRE/1-148----------------------------------------------------------------...SYCG---IHNPSC
F4QCN3_DICFS/186-340----------------------------------------------------------------HACRYCG---LHDPLT
F0Y1L0_AURAN/48-196----------------------------------------------------------------.ACKYCG---IRDPSA
K0KIK8_WICCF/99-247----------------------------------------------------------------HACAYCG---IHNSSS
C4LXY5_ENTHI/10-148----------------------------------------------------------------.RCWYCG---LADKKK
F9WSH3_TRYVY/11-155----------------------------------------------------------------.SCAYCA---ESNFET
Q5A507_CANAL/91-239----------------------------------------------------------------HACAYCG---IHNPNS
A0A068XMF0_HYMMI/107-256----------------------------------------------------------------HACAYCG---ISDPAC
F2U375_SALR5/211-362----------------------------------------------------------------HACKYCG---IHDPKC
C4XY18_CLAL4/89-230----------------------------------------------------------------EACSYCS---TSDPAS
U1MDU3_ASCSU/84-235----------------------------------------------------------------HACRYCG---IHDPSA
A8Q0S3_MALGO/97-248----------------------------------------------------------------HACAYCG---LADVDC
T1KCT3_TETUR/113-264----------------------------------------------------------------HACKYCG---IHDPSC
W1Q6Y2_OGAPD/17-164----------------------------------------------------------------.ACAYCG---ISEPDS
H3E5K6_PRIPA/118-269----------------------------------------------------------------HACSYCG---VHETAS
I1GEP9_AMPQE/99-250----------------------------------------------------------------HACKYCG---IHDPAA
D0NH56_PHYIT/117-268----------------------------------------------------------------HACAYCG---LHDPAS
B6K5B6_SCHJY/44-195----------------------------------------------------------------ESCAYCG---LSNPSA
B3RSL3_TRIAD/118-268----------------------------------------------------------------HACSYCG---IHDPAA
G0V783_NAUCC/70-218----------------------------------------------------------------HACAYCG---VDSPTC
I1BQX9_RHIO9/91-242----------------------------------------------------------------HACKYCG---IHSPAS
A2E7Q0_TRIVA/6-146----------------------------------------------------------------.KCQYCG---CEAEGS
D8M826_BLAHO/68-219----------------------------------------------------------------.ACCYCR---NDDVTA
D7FN00_ECTSI/154-303----------------------------------------------------------------.ACRFCG---IHDPAC
C4R568_PICPG/55-202----------------------------------------------------------------HACKYCG---VSNPRC
Q011I9_OSTTA/78-231----------------------------------------------------------------HACAYCG---ISNASC
F4P9D9_BATDJ/132-283----------------------------------------------------------------HACSYCG---IHNVST
C5KF29_PERM5/152-303----------------------------------------------------------------HSCQYCY---LSSPEC
A0C1B9_PARTE/33-175----------------------------------------------------------------...SYCL---QSDVNA
S9W8D5_SCHCR/53-203----------------------------------------------------------------.CCAYCN---VSNPNS
L0P928_PNEJ8/96-246----------------------------------------------------------------.ACSYCG---IHTPSS
J9JMR3_ACYPI/116-266----------------------------------------------------------------.ACKYCG---IHDPGC
A5DR11_PICGU/37-185----------------------------------------------------------------HACAYCG---IHATNC
W5BLX3_WHEAT/154-307----------------------------------------------------------------HACRYCG---IHNPAC
A0A068YKJ8_ECHMU/100-249----------------------------------------------------------------HACAYCG---ISDPAS
F0VCC0_NEOCL/202-358----------------------------------------------------------------HACSYCG---ASSPEC
RENT1_DICDI/182-336----------------------------------------------------------------HACAYCA---THELST
K4DP20_TRYCR/40-185----------------------------------------------------------------.GCAYCG---EADPHS
D3B244_POLPA/160-313----------------------------------------------------------------HACRYCG---LHDPST
E1ZMJ4_CHLVA/100-248----------------------------------------------------------------...DYCG---IHNPAC
Q24GG1_TETTS/54-209----------------------------------------------------------------HACEYCG---VHNKNS
U6GER8_EIMAC/206-358----------------------------------------------------------------.CCSYCG---VSGAEV
U7Q7L3_SPOS1/104-255----------------------------------------------------------------HACVYCG---IHSPAS
E5SQS0_TRISP/76-222----------------------------------------------------------------HACRYCG---YHEPSS
RENT1_CAEEL/93-243----------------------------------------------------------------HACRYCG---ISDPLC
F4S1U3_MELLP/115-271----------------------------------------------------------------HACAYCG---IHSPSS
A2DPW5_TRIVA/47-199----------------------------------------------------------------.CCSYCL---CDIPEC
A9UPD7_MONBE/16-167----------------------------------------------------------------HACSYCG---IHDPAS

PF12861

Q4WAI0_ASPFU/1-85-------------------------------------------MKVTIKEWNAVATWRWDMPE.................
APC11_HUMAN/1-84-------------------------------------------MKVKIKCWNGVATWLW.VAN.................
APC11_YEAST/1-102-------------------------------------------MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDED
Q5ACJ8_CANAL/1-91-------------------------------------------MKVEIVEWKSYCTWHWDLASSD............GYV
APC11_SCHPO/1-85-------------------------------------------MKVKILRYHAIANWTWDTPK.................

PF12678

A6R079_AJECN/57-115--------------------------------------------------------------------------------
A0BUN1_PARTE/27-82--------------------------------------------------------------------------------
A2DPC7_TRIVA/29-85--------------------------------------------------------------------------------
B5Y4F3_PHATC/21-77--------------------------------------------------------------------------------
B8CBK3_THAPS/24-79--------------------------------------------------------------------------------
A7SJC0_NEMVE/26-82--------------------------------------------------------------------------------
B3S6B3_TRIAD/21-78--------------------------------------------------------------------------------
B3MLX9_DROAN/21-77--------------------------------------------------------------------------------
Q7Q443_ANOGA/21-76--------------------------------------------------------------------------------
C3YBG7_BRAFL/21-77--------------------------------------------------------------------------------
APC11_DICDI/22-77--------------------------------------------------------------------------------
APC11_ARATH/21-77--------------------------------------------------------------------------------
A8IW77_CHLRE/22-77--------------------------------------------------------------------------------
A8N0N8_COPC7/31-87--------------------------------------------------------------------------------
B6JY13_SCHJY/22-78--------------------------------------------------------------------------------
A0C6P3_PARTE/21-74--------------------------------------------------------------------------------
A5DCW0_PICGU/26-83--------------------------------------------------------------------------------
A5DTG2_LODEL/40-97--------------------------------------------------------------------------------
C5MI91_CANTT/32-89--------------------------------------------------------------------------------
Q6BXZ1_DEBHA/33-90--------------------------------------------------------------------------------
Q6C1E3_YARLI/22-78--------------------------------------------------------------------------------
C5DND5_LACTC/32-88--------------------------------------------------------------------------------
C5DPN9_ZYGRC/34-90--------------------------------------------------------------------------------
Q6FQP6_CANGA/35-91--------------------------------------------------------------------------------
Q0V540_PHANO/22-78--------------------------------------------------------------------------------
A4IBZ0_LEIIN/21-77--------------------------------------------------------------------------------
Q4DH47_TRYCC/21-77--------------------------------------------------------------------------------
A8PY40_BRUMA/315-372--------------------------------------------------------------------------------
A8QC12_BRUMA/57-114--------------------------------------------------------------------------------
A8XSV6_CAEBR/69-127--------------------------------------------------------------------------------
B6AI27_CRYMR/22-79--------------------------------------------------------------------------------
B6KLE6_TOXGO/56-116--------------------------------------------------------------------------------
Q4X393_PLACH/24-78--------------------------------------------------------------------------------
C5KEJ9_PERM5/224-277--------------------------------------------------------------------------------
A9CRX2_ENTBH/29-81--------------------------------------------------------------------------------
C4M0Z6_ENTHI/21-74--------------------------------------------------------------------------------
A8B646_GIAIC/21-74--------------------------------------------------------------------------------
A8B6R7_GIAIC/27-81--------------------------------------------------------------------------------
A8N6L4_COPC7/319-377--------------------------------------------------------------------------------
A9CRI2_ENTBH/185-228--------------------------------------------------------------------------------
Q9SVW0_ARATH/142-199--------------------------------------------------------------------------------
A9UVJ0_MONBE/31-79--------------------------------------------------------------------------------
A2EBP4_TRIVA/50-105--------------------------------------------------------------------------------
Q4QAH0_LEIMA/47-104--------------------------------------------------------------------------------
A2F6A1_TRIVA/51-105--------------------------------------------------------------------------------
UBC4_MIMIV/72-128--------------------------------------------------------------------------------
Q4QEV4_LEIMA/42-93--------------------------------------------------------------------------------
A0CXI2_PARTE/25-80--------------------------------------------------------------------------------
A2G8G7_TRIVA/37-94--------------------------------------------------------------------------------
B0WC49_CULQU/26-82--------------------------------------------------------------------------------
B4GAP5_DROPE/43-103--------------------------------------------------------------------------------
P91404_CAEEL/48-102--------------------------------------------------------------------------------
B3S5N1_TRIAD/38-93--------------------------------------------------------------------------------
A8IY22_CHLRE/50-109--------------------------------------------------------------------------------
C1FDA6_MICSR/26-84--------------------------------------------------------------------------------
B4GB82_DROPE/34-92--------------------------------------------------------------------------------
B4MAF8_DROVI/37-97--------------------------------------------------------------------------------
A0E3I0_PARTE/27-82--------------------------------------------------------------------------------
A5DXH4_LODEL/35-93--------------------------------------------------------------------------------
C5MAB2_CANTT/45-103--------------------------------------------------------------------------------
C4Y7N4_CLAL4/47-105--------------------------------------------------------------------------------
Q6CP68_KLULA/42-100--------------------------------------------------------------------------------
Q6CE99_YARLI/49-106--------------------------------------------------------------------------------
A7AP36_BABBO/28-89--------------------------------------------------------------------------------
Q4N1R0_THEPA/28-91--------------------------------------------------------------------------------
B4N5A6_DROWI/56-113--------------------------------------------------------------------------------
A4HBJ7_LEIBR/36-93--------------------------------------------------------------------------------
B4JD08_DROGR/91-149--------------------------------------------------------------------------------
B3MSM2_DROAN/135-193--------------------------------------------------------------------------------
B4J4L7_DROGR/43-101--------------------------------------------------------------------------------
B4KMP2_DROMO/79-137--------------------------------------------------------------------------------

PF13920

B6K124_SCHJY/78-128-------------------------------------------------------------------------------D
HEL2_SCHPO/77-127-------------------------------------------------------------------------------D
Q0CN45_ASPTN/467-517-------------------------------------------------------------------------------D
A8Q0G3_MALGO/102-152-------------------------------------------------------------------------------E
A0A0D1BX09_USTMA/106-156-------------------------------------------------------------------------------E
C5DTT6_ZYGRC/62-112-------------------------------------------------------------------------------E
A5E539_LODEL/84-134-------------------------------------------------------------------------------E
A3LV07_PICST/58-108-------------------------------------------------------------------------------E
Q6BL77_DEBHA/44-94-------------------------------------------------------------------------------E
C4QYV6_PICPG/48-98-------------------------------------------------------------------------------K
Q6CMY9_KLULA/85-135-------------------------------------------------------------------------------S
D0N6K8_PHYIT/120-171-------------------------------------------------------------------------------E
C5LYS2_PERM5/156-207-------------------------------------------------------------------------------I
B4LJJ4_DROVI/48-98-------------------------------------------------------------------------------D
Q7QJY2_ANOGA/21-71-------------------------------------------------------------------------------T
Q54UX1_DICDI/728-773-------------------------------------------------------------------------------N
A7S739_NEMVE/703-752-------------------------------------------------------------------------------E
Q22W29_TETTS/178-228-------------------------------------------------------------------------------K
Q4QHY1_LEIMA/418-463-------------------------------------------------------------------------------K
D2VIL5_NAEGR/915-962-------------------------------------------------------------------------------E
Q1RL83_CIOIN/726-771-------------------------------------------------------------------------------D
RNF26_HUMAN/376-428-------------------------------------------------------------------------------E
D2HCL2_AILME/270-315-------------------------------------------------------------------------------N
C3XYZ2_BRAFL/80-125-------------------------------------------------------------------------------A
B7PQN0_IXOSC/155-200-------------------------------------------------------------------------------P
C3Y345_BRAFL/524-577-------------------------------------------------------------------------------E
B8C513_THAPS/1796-1843-------------------------------------------------------------------------------D
A7RWB7_NEMVE/452-503-------------------------------------------------------------------------------D
B0WTA2_CULQU/338-387-------------------------------------------------------------------------------S
Q5KMN2_CRYNJ/400-449-------------------------------------------------------------------------------E
D0MRP4_PHYIT/742-789-------------------------------------------------------------------------------E
B5DIZ4_DROPS/288-334-------------------------------------------------------------------------------D
B0WPA5_CULQU/285-331-------------------------------------------------------------------------------D
Q4D380_TRYCC/244-288-------------------------------------------------------------------------------E
Q75HV4_ORYSJ/33-82-------------------------------------------------------------------------------M
MGRN1_HUMAN/274-323-------------------------------------------------------------------------------N
B4JL40_DROGR/312-361-------------------------------------------------------------------------------H
D3B0G5_POLPA/399-448-------------------------------------------------------------------------------D
Q55DC5_DICDI/356-405-------------------------------------------------------------------------------I
Q8I660_PLAF7/235-284-------------------------------------------------------------------------------S
Q4D0Q6_TRYCC/310-360-------------------------------------------------------------------------------E
Q4QHA0_LEIMA/308-357-------------------------------------------------------------------------------E
Q57UZ4_TRYB2/281-331-------------------------------------------------------------------------------D
D0MQ76_PHYIT/288-337-------------------------------------------------------------------------------E
Q4E000_TRYCC/296-345-------------------------------------------------------------------------------E
B6AAH4_CRYMR/246-295-------------------------------------------------------------------------------Q
A4H9Q8_LEIBR/102-149-------------------------------------------------------------------------------D
Q4CVI6_TRYCC/107-152-------------------------------------------------------------------------------E
B7PKQ1_IXOSC/144-193-------------------------------------------------------------------------------R
B3S6I8_TRIAD/181-230-------------------------------------------------------------------------------K
A7S4Z9_NEMVE/255-304-------------------------------------------------------------------------------K
C5KK04_PERM5/366-413-------------------------------------------------------------------------------D
B7QP11_IXOSC/231-276-------------------------------------------------------------------------------V
D2VUY6_NAEGR/325-374-------------------------------------------------------------------------------V
A0BTS1_PARTE/375-420-------------------------------------------------------------------------------G
A0DZP3_PARTE/363-408-------------------------------------------------------------------------------E
A0DSA8_PARTE/389-434-------------------------------------------------------------------------------H
B4MWC3_DROWI/221-271-------------------------------------------------------------------------------N
B3MJU2_DROAN/218-268-------------------------------------------------------------------------------N
B4KIZ8_DROMO/234-285-------------------------------------------------------------------------------H
B4LV95_DROVI/234-285-------------------------------------------------------------------------------S
B4JAJ2_DROGR/234-285-------------------------------------------------------------------------------N
B4G746_DROPE/150-202-------------------------------------------------------------------------------S
A8B237_GIAIC/880-926-------------------------------------------------------------------------------Y
Q4CMQ0_TRYCC/661-713-------------------------------------------------------------------------------T
A9SHG7_PHYPA/405-450-------------------------------------------------------------------------------E
Q8LBF1_ARATH/416-461-------------------------------------------------------------------------------E
Q0J1V3_ORYSJ/63-108-------------------------------------------------------------------------------E
C5XC80_SORBI/53-98-------------------------------------------------------------------------------E
Q4N6R0_THEPA/101-150-------------------------------------------------------------------------------R
C5L3T8_PERM5/394-443-------------------------------------------------------------------------------E
C5LA51_PERM5/115-168-------------------------------------------------------------------------------E
C5LTS1_PERM5/447-500-------------------------------------------------------------------------------T
C5LZC2_PERM5/112-165-------------------------------------------------------------------------------A
B2YG41_MHVB/210-258-------------------------------------------------------------------------------V
A9SEP3_PHYPA/195-240-------------------------------------------------------------------------------E
B9HU58_POPTR/288-333-------------------------------------------------------------------------------E
B9RB10_RICCO/250-295-------------------------------------------------------------------------------R
B9I3B5_POPTR/306-351-------------------------------------------------------------------------------K
B3H4E5_ARATH/232-277-------------------------------------------------------------------------------Q
Q4TU35_ARATH/289-334-------------------------------------------------------------------------------T
C5XTA8_SORBI/271-318-------------------------------------------------------------------------------R
C5XTB1_SORBI/370-415-------------------------------------------------------------------------------T
C5YFF0_SORBI/286-331-------------------------------------------------------------------------------S
C5YFF1_SORBI/318-363-------------------------------------------------------------------------------K
Q7FAF5_ORYSJ/265-310-------------------------------------------------------------------------------T
C5Y3U3_SORBI/280-325-------------------------------------------------------------------------------G
C5XTT6_SORBI/292-337-------------------------------------------------------------------------------G
C5WQ61_SORBI/286-331-------------------------------------------------------------------------------D
Q9FEA0_ARATH/275-320-------------------------------------------------------------------------------T
B9I0I4_POPTR/289-334-------------------------------------------------------------------------------S
A5C0L0_VITVI/251-297-------------------------------------------------------------------------------E
C5X3K2_SORBI/182-227-------------------------------------------------------------------------------P
B9H509_POPTR/217-262-------------------------------------------------------------------------------K
A9P9H0_POPTR/220-265-------------------------------------------------------------------------------M
B9R8C8_RICCO/222-267-------------------------------------------------------------------------------K
B9N2T7_POPTR/294-339-------------------------------------------------------------------------------G
Q9FJQ8_ARATH/249-294-------------------------------------------------------------------------------I
A8MRQ8_ARATH/191-237-------------------------------------------------------------------------------I
A8MQI2_ARATH/158-204-------------------------------------------------------------------------------M
A4HK37_LEIBR/127-171-------------------------------------------------------------------------------L
A2EXP7_TRIVA/612-657-------------------------------------------------------------------------------P
A0CAX1_PARTE/245-290-------------------------------------------------------------------------------Q
A0DHU7_PARTE/55-100-------------------------------------------------------------------------------D
A0BNR4_PARTE/562-612-------------------------------------------------------------------------------D
A0E6W4_PARTE/182-227-------------------------------------------------------------------------------R
C3ZJG2_BRAFL/282-331-------------------------------------------------------------------------------D
C3YU07_BRAFL/338-391-------------------------------------------------------------------------------E
A2DIY9_TRIVA/524-575-------------------------------------------------------------------------------I
UNK_DROME/552-597-------------------------------------------------------------------------------N
A7RKQ0_NEMVE/615-660-------------------------------------------------------------------------------Q
A8BNV2_GIAIC/200-247-------------------------------------------------------------------------------K
Q4E0L2_TRYCC/240-288-------------------------------------------------------------------------------E
Q4QGT3_LEIMA/221-269-------------------------------------------------------------------------------E
B6Q7N1_PENMQ/895-945-------------------------------------------------------------------------------D
Q2H0W0_CHAGB/930-980-------------------------------------------------------------------------------D
C5MAE9_CANTT/731-781-------------------------------------------------------------------------------R
A5D9Z2_PICGU/645-695-------------------------------------------------------------------------------I
A7TKT9_VANPO/628-678-------------------------------------------------------------------------------F
C5DQ71_ZYGRC/577-627-------------------------------------------------------------------------------S
C5DI16_LACTC/585-635-------------------------------------------------------------------------------R
C4R866_PICPG/593-643-------------------------------------------------------------------------------S
Q6C5F9_YARLI/626-676-------------------------------------------------------------------------------E
Q5KKN3_CRYNJ/726-779-------------------------------------------------------------------------------T
B0DG87_LACBS/800-853-------------------------------------------------------------------------------L
A7AMT1_BABBO/791-836-------------------------------------------------------------------------------A
B5U8M8_CAEEL/44-94-------------------------------------------------------------------------------A
A8X2U5_CAEBR/166-216-------------------------------------------------------------------------------T
A8B9Y3_GIAIC/545-592-------------------------------------------------------------------------------C
D2VDZ5_NAEGR/336-381-------------------------------------------------------------------------------E
A0BLM2_PARTE/279-326-------------------------------------------------------------------------------D
A0BRE5_PARTE/279-326-------------------------------------------------------------------------------N
A0C478_PARTE/250-299-------------------------------------------------------------------------------E
A0C829_PARTE/291-336-------------------------------------------------------------------------------K
A0CDQ4_PARTE/258-305-------------------------------------------------------------------------------D
IAP1_OSHVF/311-356-------------------------------------------------------------------------------N
A8BPS6_GIAIC/687-738-------------------------------------------------------------------------------I
RNGB_DICDI/893-938-------------------------------------------------------------------------------D
Q17FP0_AEDAE/482-527-------------------------------------------------------------------------------R
Q1RPV0_CIOIN/514-559-------------------------------------------------------------------------------R
B3WFX6_CAEEL/508-553-------------------------------------------------------------------------------P
A7SP45_NEMVE/135-180-------------------------------------------------------------------------------S
C3ZBL5_BRAFL/431-476-------------------------------------------------------------------------------K
D3B001_POLPA/201-250-------------------------------------------------------------------------------K
Q94491_DICDI/216-265-------------------------------------------------------------------------------R
Q380J4_ANOGA/501-546-------------------------------------------------------------------------------E
Q17NT7_AEDAE/450-495-------------------------------------------------------------------------------E
MYLIB_DANRE/377-422-------------------------------------------------------------------------------E
A7RXW6_NEMVE/6-51-------------------------------------------------------------------------------N
A7S3Y5_NEMVE/373-418-------------------------------------------------------------------------------D
C3XU73_BRAFL/384-429-------------------------------------------------------------------------------E
B4J320_DROGR/398-443-------------------------------------------------------------------------------E
A9V149_MONBE/508-556-------------------------------------------------------------------------------E
B4J9C7_DROGR/363-408-------------------------------------------------------------------------------E
A8HMX4_CHLRE/2800-2846-------------------------------------------------------------------------------S
A9SH61_PHYPA/4592-4636-------------------------------------------------------------------------------A
C3ZK23_BRAFL/256-309-------------------------------------------------------------------------------K
A9UQI9_MONBE/498-545-------------------------------------------------------------------------------E
CWC24_YARLI/202-250-------------------------------------------------------------------------------I
B7XK28_ENTBH/436-487-------------------------------------------------------------------------------E
A0D2U8_PARTE/380-428-------------------------------------------------------------------------------L
A8BQV1_GIAIC/497-546-------------------------------------------------------------------------------S
B5DJC0_DROPS/53-105-------------------------------------------------------------------------------S
B7QLC6_IXOSC/166-211-------------------------------------------------------------------------------N
C3Y1X2_BRAFL/433-483-------------------------------------------------------------------------------N
D3YTR3_MOUSE/556-606-------------------------------------------------------------------------------L
Q29CJ9_DROPS/593-643-------------------------------------------------------------------------------I
A0CCL0_PARTE/398-443-------------------------------------------------------------------------------H
A0CBN4_PARTE/432-477-------------------------------------------------------------------------------H
XB34_ORYSJ/458-507-------------------------------------------------------------------------------P
B9NBW1_POPTR/389-438-------------------------------------------------------------------------------G
B9T1B4_RICCO/183-232-------------------------------------------------------------------------------G
A9SAM3_PHYPA/418-467-------------------------------------------------------------------------------K
A9TAZ5_PHYPA/309-358-------------------------------------------------------------------------------K
XB34_ARATH/321-370-------------------------------------------------------------------------------E
C1DZP8_MICSR/274-329-------------------------------------------------------------------------------G
A2ENP8_TRIVA/471-523-------------------------------------------------------------------------------H
Q9M2V1_ARATH/104-149-------------------------------------------------------------------------------G
A4ID13_LEIIN/261-307-------------------------------------------------------------------------------L
A4HPQ0_LEIBR/260-306-------------------------------------------------------------------------------H
Q4D0Z8_TRYCC/234-280-------------------------------------------------------------------------------T
A8J0L3_CHLRE/225-274-------------------------------------------------------------------------------D
VF193_IIV3/153-201-------------------------------------------------------------------------------S
D0NQR6_PHYIT/1091-1144-------------------------------------------------------------------------------E
A0D1G8_PARTE/217-265-------------------------------------------------------------------------------Q
A2G3U3_TRIVA/649-698-------------------------------------------------------------------------------R
A2DM68_TRIVA/649-698-------------------------------------------------------------------------------R
A2FIP7_TRIVA/650-699-------------------------------------------------------------------------------K
A2DDV4_TRIVA/648-697-------------------------------------------------------------------------------K
A4H3A8_LEIBR/832-887-------------------------------------------------------------------------------S
C5KGH9_PERM5/282-328-------------------------------------------------------------------------------S
A9V6F0_MONBE/813-860-------------------------------------------------------------------------------S
A2EXP7_TRIVA/662-710-------------------------------------------------------------------------------D
C1N685_MICPC/735-790-------------------------------------------------------------------------------N
C1EI00_MICSR/584-639-------------------------------------------------------------------------------D
A4RRY6_OSTLU/291-343-------------------------------------------------------------------------------Q
Q0E527_SFAVA/200-245-------------------------------------------------------------------------------S
A6QSL9_AJECN/126-171-------------------------------------------------------------------------------H
B6QDX9_PENMQ/218-270-------------------------------------------------------------------------------T
B8M471_TALSN/214-267-------------------------------------------------------------------------------N
B8MPN3_TALSN/190-245-------------------------------------------------------------------------------N
A2FRF3_TRIVA/182-233-------------------------------------------------------------------------------S
C5LB69_PERM5/20-68-------------------------------------------------------------------------------T
Q4YUC0_PLABA/117-170-------------------------------------------------------------------------------N
Q54X17_DICDI/400-449-------------------------------------------------------------------------------E
Q9SAF3_ARATH/158-206-------------------------------------------------------------------------------R
A8XJR9_CAEBR/19-68-------------------------------------------------------------------------------D
C4LX45_ENTHI/71-121-------------------------------------------------------------------------------N
D2VUH3_NAEGR/128-177-------------------------------------------------------------------------------Q
A9TTF3_PHYPA/975-1020-------------------------------------------------------------------------------Q
D0NXH2_PHYIT/501-550-------------------------------------------------------------------------------Q
A0CRM9_PARTE/211-262-------------------------------------------------------------------------------E
D0NG82_PHYIT/249-298-------------------------------------------------------------------------------E
Q4H356_CIOIN/487-538-------------------------------------------------------------------------------K
B7QCM6_IXOSC/35-84-------------------------------------------------------------------------------E
B7PU01_IXOSC/401-451-------------------------------------------------------------------------------A
C3YRC2_BRAFL/452-502-------------------------------------------------------------------------------G
C3Y6P7_BRAFL/523-572-------------------------------------------------------------------------------R
C3Y611_BRAFL/502-551-------------------------------------------------------------------------------N
A9TMM2_PHYPA/802-851-------------------------------------------------------------------------------E
C5X980_SORBI/738-787-------------------------------------------------------------------------------K
Q6NQ80_ARATH/672-721-------------------------------------------------------------------------------M
B7PF95_IXOSC/251-296-------------------------------------------------------------------------------T
C3YRB7_BRAFL/450-503-------------------------------------------------------------------------------H
Q4H355_CIOIN/499-554-------------------------------------------------------------------------------T
Q175J8_AEDAE/472-517-------------------------------------------------------------------------------D
B4QH01_DROSI/447-492-------------------------------------------------------------------------------D
B4MQL3_DROWI/441-485-------------------------------------------------------------------------------D
A1YPR8_PIG/445-490-------------------------------------------------------------------------------E
Q8UVF8_CHICK/442-487-------------------------------------------------------------------------------E
C3Z5V2_BRAFL/340-389-------------------------------------------------------------------------------E
C3Z5N3_BRAFL/303-352-------------------------------------------------------------------------------E
C3Z5V3_BRAFL/321-370-------------------------------------------------------------------------------E
A7T0Y6_NEMVE/281-326-------------------------------------------------------------------------------E
C3ZDH2_BRAFL/375-420-------------------------------------------------------------------------------E
C3ZDH3_BRAFL/810-855-------------------------------------------------------------------------------E
RF298_ARATH/756-806-------------------------------------------------------------------------------R
A9SWJ7_PHYPA/400-450-------------------------------------------------------------------------------R
Q6H4E3_ORYSJ/154-204-------------------------------------------------------------------------------R
Q8L7B1_ARATH/680-730-------------------------------------------------------------------------------Y
B2YG55_MHVB/91-136-------------------------------------------------------------------------------F
D3BMT8_POLPA/752-797-------------------------------------------------------------------------------K
D3B0G3_POLPA/301-346-------------------------------------------------------------------------------Q
Q55EJ5_DICDI/318-363-------------------------------------------------------------------------------S
A8BYS6_GIAIC/363-409-------------------------------------------------------------------------------D
D2VG38_NAEGR/121-166-------------------------------------------------------------------------------R
332L_IIV6/181-226-------------------------------------------------------------------------------E
O44624_CAEEL/348-395-------------------------------------------------------------------------------L
A8B3E8_GIAIC/490-537-------------------------------------------------------------------------------R
MDM4_HUMAN/433-484-------------------------------------------------------------------------------L
MDM4_DANRE/439-490-------------------------------------------------------------------------------L
B7QMD7_IXOSC/391-442-------------------------------------------------------------------------------V
B3RT05_TRIAD/399-452-------------------------------------------------------------------------------V
D0N7P7_PHYIT/641-692-------------------------------------------------------------------------------D
B7S448_PHATC/563-614-------------------------------------------------------------------------------L
A0E576_PARTE/650-695-------------------------------------------------------------------------------E
Q54IT7_DICDI/506-551-------------------------------------------------------------------------------D
CBLA_DICDI/614-659-------------------------------------------------------------------------------S
D3B844_POLPA/641-686-------------------------------------------------------------------------------D
Q16EA4_AEDAE/37-82-------------------------------------------------------------------------------S
B7PKW4_IXOSC/293-338-------------------------------------------------------------------------------E
A7RV74_NEMVE/252-297-------------------------------------------------------------------------------L
Q55CM4_DICDI/373-418-------------------------------------------------------------------------------E
B9MVX8_POPTR/330-380-------------------------------------------------------------------------------D
C5Z7Y7_SORBI/126-176-------------------------------------------------------------------------------S
C7J222_ORYSJ/654-703-------------------------------------------------------------------------------G
C5Z1C5_SORBI/284-333-------------------------------------------------------------------------------G
A9SP35_PHYPA/429-478-------------------------------------------------------------------------------D
A4VEG7_TETTS/185-235-------------------------------------------------------------------------------D
A4ID13_LEIIN/107-152-------------------------------------------------------------------------------D
B4FE85_MAIZE/315-365-------------------------------------------------------------------------------D
B9GW13_POPTR/335-385-------------------------------------------------------------------------------E
A9S6Y2_PHYPA/371-421-------------------------------------------------------------------------------D
A9RL93_PHYPA/342-392-------------------------------------------------------------------------------E
Q9SYH3_ARATH/327-377-------------------------------------------------------------------------------D
A9RJ34_PHYPA/301-346-------------------------------------------------------------------------------T
C5X430_SORBI/292-337-------------------------------------------------------------------------------V
A9PFT8_POPTR/187-232-------------------------------------------------------------------------------I
C4LUB1_ENTHI/101-146-------------------------------------------------------------------------------M
A0DEI4_PARTE/163-210-------------------------------------------------------------------------------A
A8B9D3_GIAIC/912-958-------------------------------------------------------------------------------V
Q9U2C5_CAEEL/716-760-------------------------------------------------------------------------------L
B3RP37_TRIAD/597-642-------------------------------------------------------------------------------L
A8HY85_CHLRE/42-92-------------------------------------------------------------------------------S
Q08E63_BOVIN/672-717-------------------------------------------------------------------------------Q
A2CF42_DANRE/670-715-------------------------------------------------------------------------------F
Q17KA2_AEDAE/659-704-------------------------------------------------------------------------------Q
A7RYU6_NEMVE/694-739-------------------------------------------------------------------------------L
A7SA58_NEMVE/291-336-------------------------------------------------------------------------------Q
C3YDJ4_BRAFL/246-293-------------------------------------------------------------------------------E
MUL1A_DANRE/288-335-------------------------------------------------------------------------------V
Q580X7_TRYB2/183-230-------------------------------------------------------------------------------N
A9UW71_MONBE/179-233-------------------------------------------------------------------------------R
A8BTP5_GIAIC/508-554-------------------------------------------------------------------------------H
A8BF50_GIAIC/144-193-------------------------------------------------------------------------------P
D2W5Y2_NAEGR/234-279-------------------------------------------------------------------------------E
Q4E4Q1_TRYCC/67-117-------------------------------------------------------------------------------G
Q4D0Q3_TRYCC/308-360-------------------------------------------------------------------------------D
Q57UZ1_TRYB2/282-334-------------------------------------------------------------------------------S
Y096_OSHVF/5-50-------------------------------------------------------------------------------D
A8B916_GIAIC/483-532-------------------------------------------------------------------------------D
A8BFH4_GIAIC/417-464-------------------------------------------------------------------------------D
RKP_ARATH/1213-1261-------------------------------------------------------------------------------E
Q7X8J6_ORYSJ/195-243-------------------------------------------------------------------------------E
A7RTP5_NEMVE/1091-1139-------------------------------------------------------------------------------V
B4GF46_DROPE/1249-1297-------------------------------------------------------------------------------E
Q172Z5_AEDAE/1211-1259-------------------------------------------------------------------------------E
D3BFC7_POLPA/945-993-------------------------------------------------------------------------------S
A0DDH1_PARTE/752-797-------------------------------------------------------------------------------K
B8LWU9_TALSN/1261-1306-------------------------------------------------------------------------------E
C5FIR2_ARTOC/1441-1486-------------------------------------------------------------------------------E
B6HHQ4_PENCW/1154-1199-------------------------------------------------------------------------------E
A0CXZ6_PARTE/629-674-------------------------------------------------------------------------------E
095L_IIV6/35-79-------------------------------------------------------------------------------D
A0DTE6_PARTE/310-359-------------------------------------------------------------------------------T
A0BIJ5_PARTE/438-487-------------------------------------------------------------------------------S
A0DQT5_PARTE/433-482-------------------------------------------------------------------------------S
A0E0W7_PARTE/350-399-------------------------------------------------------------------------------S
A0BRT5_PARTE/364-413-------------------------------------------------------------------------------S
A0DKE3_PARTE/353-402-------------------------------------------------------------------------------S
A0BXR0_PARTE/306-355-------------------------------------------------------------------------------S
A0DCL7_PARTE/237-286-------------------------------------------------------------------------------K
A0E266_PARTE/386-435-------------------------------------------------------------------------------T
B9QR14_TOXGO/877-926-------------------------------------------------------------------------------E
B6AHR5_CRYMR/424-473-------------------------------------------------------------------------------F
A0D9J6_PARTE/386-435-------------------------------------------------------------------------------Q
A0D3H9_PARTE/407-456-------------------------------------------------------------------------------S
A0DW47_PARTE/493-542-------------------------------------------------------------------------------T
A0E9B5_PARTE/508-557-------------------------------------------------------------------------------N
A0EDX3_PARTE/355-404-------------------------------------------------------------------------------S
A0E7T4_PARTE/360-409-------------------------------------------------------------------------------S
A0DGX9_PARTE/326-371-------------------------------------------------------------------------------E
Q5CQ63_CRYPI/542-598-------------------------------------------------------------------------------S
B6AAB1_CRYMR/645-701-------------------------------------------------------------------------------G
Q6BZX0_YARLI/1057-1110-------------------------------------------------------------------------------E
C3ZJP1_BRAFL/454-499-------------------------------------------------------------------------------S
A0EEM4_PARTE/123-169-------------------------------------------------------------------------------D
A0BUL0_PARTE/143-189-------------------------------------------------------------------------------D
A0CHG4_PARTE/238-286-------------------------------------------------------------------------------E
A0BWF0_PARTE/276-324-------------------------------------------------------------------------------E
A9SFN3_PHYPA/878-930-------------------------------------------------------------------------------I
Q54YP5_DICDI/37-90-------------------------------------------------------------------------------I
Q4QBN7_LEIMA/2434-2479-------------------------------------------------------------------------------E
Q4DEV7_TRYCC/938-983-------------------------------------------------------------------------------L
B4LG30_DROVI/964-1009-------------------------------------------------------------------------------S
Q7PZI6_ANOGA/923-968-------------------------------------------------------------------------------P
B4LG30_DROVI/1011-1056-------------------------------------------------------------------------------K
B0WW31_CULQU/928-973-------------------------------------------------------------------------------K
B4KE70_DROMO/921-966-------------------------------------------------------------------------------N
B0WPU4_CULQU/806-851-------------------------------------------------------------------------------I
A2F0R0_TRIVA/448-496-------------------------------------------------------------------------------K
C1EAH1_MICSR/417-462-------------------------------------------------------------------------------S
C1MHQ3_MICPC/448-493-------------------------------------------------------------------------------D
Q01FP0_OSTTA/472-517-------------------------------------------------------------------------------P
A4H5U9_LEIBR/173-218-------------------------------------------------------------------------------D
A2FJR6_TRIVA/40-88-------------------------------------------------------------------------------G
A2FAQ1_TRIVA/178-227-------------------------------------------------------------------------------N
A0DUV3_PARTE/152-197-------------------------------------------------------------------------------I
A0CS68_PARTE/196-241-------------------------------------------------------------------------------I
A1A5F8_XENTR/500-547-------------------------------------------------------------------------------.
A8B9E6_GIAIC/351-396-------------------------------------------------------------------------------.
A8NJ75_BRUMA/266-311-------------------------------------------------------------------------------.
A8PYM5_BRUMA/661-708-------------------------------------------------------------------------------.
B4HTJ4_DROSE/110-163-------------------------------------------------------------------------------.
B4QQ20_DROSI/287-331-------------------------------------------------------------------------------.
B9GIH6_POPTR/319-366-------------------------------------------------------------------------------.
B9H044_POPTR/672-720-------------------------------------------------------------------------------.
B9HFX4_POPTR/1219-1265-------------------------------------------------------------------------------D
C5LN27_PERM5/401-452-------------------------------------------------------------------------------.
D7M718_ARALL/391-438-------------------------------------------------------------------------------.
E1GAB8_LOALO/85-132-------------------------------------------------------------------------------.
E7KLV8_YEASL/60-109-------------------------------------------------------------------------------E
E7KSP0_YEASL/566-612-------------------------------------------------------------------------------.
F1QJY3_DANRE/300-346-------------------------------------------------------------------------------.
F1QZ44_DANRE/466-513-------------------------------------------------------------------------------.
F4IHN6_ARATH/784-831-------------------------------------------------------------------------------.
F4IIX4_ARATH/596-642-------------------------------------------------------------------------------.
F6Q0X6_CIOIN/671-715-------------------------------------------------------------------------------E
F6V562_XENTR/362-410-------------------------------------------------------------------------------.
F6VVP4_CIOIN/828-872-------------------------------------------------------------------------------E
F6ZD85_XENTR/502-549-------------------------------------------------------------------------------.
G1R8W5_NOMLE/299-345-------------------------------------------------------------------------------.
H0V2W5_CAVPO/438-486-------------------------------------------------------------------------------.
H0WDM0_CAVPO/460-509-------------------------------------------------------------------------------.
H3CQS4_TETNG/356-405-------------------------------------------------------------------------------.
H3DCV6_TETNG/295-341-------------------------------------------------------------------------------.
H3DPY2_TETNG/377-425-------------------------------------------------------------------------------.
H9GCR3_ANOCA/96-148-------------------------------------------------------------------------------.
I1JLP1_SOYBN/334-381-------------------------------------------------------------------------------.
I1QW19_ORYGL/297-343-------------------------------------------------------------------------------.
J3LIJ7_ORYBR/654-701-------------------------------------------------------------------------------.
J9JVK3_ACYPI/243-291-------------------------------------------------------------------------------.
Q22CV7_TETTS/439-483-------------------------------------------------------------------------------.
Q22NG2_TETTS/498-543-------------------------------------------------------------------------------.
Q24BZ9_TETTS/694-741-------------------------------------------------------------------------------.
Q294I0_DROPS/710-759-------------------------------------------------------------------------------.
Q388Z7_TRYB2/96-140-------------------------------------------------------------------------------E
U5GK99_POPTR/778-825-------------------------------------------------------------------------------.
V4Z7N5_TOXGO/501-545-------------------------------------------------------------------------------.

PF14447

D0LT74_HALO1/123-168--------------------------------------------------------------------------------
D2AUX4_STRRD/137-182--------------------------------------------------------------------------------
X1X6Y9_ACYPI/104-147--------------------------------------------------------------------------------
F4PCT5_BATDJ/136-183--------------------------------------------------------------------------------
G0MI82_CAEBE/9-57--------------------------------------------------------------------------------
H2JRE4_STRHJ/119-164--------------------------------------------------------------------------------
U5WAD0_9ACTN/116-161--------------------------------------------------------------------------------
B1W1U9_STRGG/120-165--------------------------------------------------------------------------------
E2BD82_HARSA/293-332--------------------------------------------------------------------------------
Q9RCV7_STRCO/117-162--------------------------------------------------------------------------------
X6M942_RETFI/131-181--------------------------------------------------------------------------------
D2PZ71_KRIFD/129-174--------------------------------------------------------------------------------
H9GEW4_ANOCA/185-238--------------------------------------------------------------------------------
Q1CZ12_MYXXD/107-152--------------------------------------------------------------------------------

PF03854

Z_LYCVA/28-77-------------------------------------------------------------------------------G
Z_TACVF/36-85-------------------------------------------------------------------------------G
Z_LASSJ/27-76-------------------------------------------------------------------------------G

PF14445

A7I4Q2_METB6/12-67--------------------------------------------------------------------------DPHSFA
Q2FKZ9_METHJ/22-77--------------------------------------------------------------------------DPESFS
L0HAQ6_METFS/42-97--------------------------------------------------------------------------DPRTFS

PF14569

B9IMB3_POPTR/27-104-------------------------------------------------------------------------KPLKNLD
B9N4G3_POPTR/29-106-------------------------------------------------------------------------RSLERVS
Q06FC6_PHYPA/29-106-------------------------------------------------------------------------RPENQVN
C5Z153_SORBI/31-108-------------------------------------------------------------------------KPAKSAS
B9SUE6_RICCO/13-88-------------------------------------------------------------------------KNAKQNA
J3LUK4_ORYBR/29-106-------------------------------------------------------------------------KPLKHTN
W5A591_WHEAT/10-81-------------------------------------------------------------------------......A
M0SYV1_MUSAM/33-104-------------------------------------------------------------------------...SRAN
M4EY24_BRARP/19-90-------------------------------------------------------------------------.....FS
D8QPL4_SELML/26-103-------------------------------------------------------------------------KPLNSVN
D8QXH9_SELML/28-105-------------------------------------------------------------------------KPLKHLN
M0S2A0_MUSAM/9-84-------------------------------------------------------------------------KPVKHSG
A9T9M4_PHYPA/2-79-------------------------------------------------------------------------RPLSNVN
M0TNJ9_MUSAM/32-107-------------------------------------------------------------------------...HDSN
D7LYB5_ARALL/10-86-------------------------------------------------------------------------KPMKNVV
D8R892_SELML/26-103-------------------------------------------------------------------------KPLSHCK
K4BTR6_SOLLC/29-106-------------------------------------------------------------------------KSMQQQS
W1PN60_AMBTC/29-106-------------------------------------------------------------------------RPLQQLS
D7LL56_ARALL/30-109-------------------------------------------------------------------------KPLKDLN
U5DBY3_AMBTC/12-84-------------------------------------------------------------------------.....SR
I1KTE1_SOYBN/29-106-------------------------------------------------------------------------KSVRELS
CESAA_ARATH/23-100-------------------------------------------------------------------------KPLKDLN
F6HB61_VITVI/10-87-------------------------------------------------------------------------KSLKGLG
I1KRK2_SOYBN/23-97-------------------------------------------------------------------------.PTRQSA
I1N137_SOYBN/29-106-------------------------------------------------------------------------KPLKNLN
T1MB14_TRIUA/28-100-------------------------------------------------------------------------.....IL
K4A562_SETIT/14-87-------------------------------------------------------------------------....HRA
M1BV52_SOLTU/29-106-------------------------------------------------------------------------KPLKPLN
B9GRE7_POPTR/26-98-------------------------------------------------------------------------.....AT
M4D4E1_BRARP/29-106-------------------------------------------------------------------------KPLKNMD
A9RUW7_PHYPA/28-105-------------------------------------------------------------------------KPLSQVN

PF14570

E3KCH5_PUCGT/25-72--------------------------------------------------------------------------------
C5Z2Q3_SORBI/153-202--------------------------------------------------------------------------------
A9SS17_PHYPA/149-197--------------------------------------------------------------------------------
A9TJ93_PHYPA/149-197--------------------------------------------------------------------------------
B9GZJ8_POPTR/106-155--------------------------------------------------------------------------------
A9TJ92_PHYPA/149-197--------------------------------------------------------------------------------
D8R581_SELML/140-188--------------------------------------------------------------------------------
A9S910_PHYPA/152-201--------------------------------------------------------------------------------
C7J5V0_ORYSJ/139-187--------------------------------------------------------------------------------
C5WQN8_SORBI/138-187--------------------------------------------------------------------------------
B4LR99_DROVI/14-61--------------------------------------------------------------------------------
D8QRL0_SELML/7-59--------------------------------------------------------------------------------
E3M500_CAERE/13-60--------------------------------------------------------------------------------
A0A0D1E4H5_USTMA/92-139--------------------------------------------------------------------------------
B6K5B3_SCHJY/18-65--------------------------------------------------------------------------------
D7TQA4_VITVI/2-51--------------------------------------------------------------------------------
D8SZU2_SELML/134-182--------------------------------------------------------------------------------
B7FS97_PHATC/4-51--------------------------------------------------------------------------------
D8SMF9_SELML/143-191--------------------------------------------------------------------------------
F2UBF0_SALR5/11-58--------------------------------------------------------------------------------
D7FLE0_ECTSI/18-65--------------------------------------------------------------------------------
E1Z5F3_CHLVA/7-59--------------------------------------------------------------------------------
B6KGI1_TOXGO/287-334--------------------------------------------------------------------------------
B6AF72_CRYMR/35-82--------------------------------------------------------------------------------
A9RPN5_PHYPA/537-583--------------------------------------------------------------------------------
A7AQF3_BABBO/19-66--------------------------------------------------------------------------------
C0NRW9_AJECG/18-66--------------------------------------------------------------------------------
D2V231_NAEGR/12-58--------------------------------------------------------------------------------
B9R8Z9_RICCO/281-327--------------------------------------------------------------------------------
Q8I569_PLAF7/125-172--------------------------------------------------------------------------------
A2I1U4_TRIVA/15-62--------------------------------------------------------------------------------
A9SN46_PHYPA/683-731--------------------------------------------------------------------------------
C1FIH5_MICSR/14-66--------------------------------------------------------------------------------
E4XX29_OIKDI/13-59--------------------------------------------------------------------------------
D8LWI9_BLAHO/18-64--------------------------------------------------------------------------------
D7KS60_ARALL/216-262--------------------------------------------------------------------------------
D3B1B1_POLPA/10-57--------------------------------------------------------------------------------
D8UJD3_VOLCA/6-53--------------------------------------------------------------------------------
D8LZN3_BLAHO/13-59--------------------------------------------------------------------------------
D8LYA2_BLAHO/6-52--------------------------------------------------------------------------------
B9RZ22_RICCO/108-151--------------------------------------------------------------------------------
C1NA27_MICPC/1777-1826--------------------------------------------------------------------------------
C1ECQ0_MICSR/1869-1919--------------------------------------------------------------------------------
B9IEK3_POPTR/279-325--------------------------------------------------------------------------------
C5Y9X2_SORBI/268-314--------------------------------------------------------------------------------
F6HT44_VITVI/117-166--------------------------------------------------------------------------------
G2QHA3_THIHA/15-59--------------------------------------------------------------------------------
G8YIU3_PICSO/17-66--------------------------------------------------------------------------------
M1BEF9_SOLTU/138-186--------------------------------------------------------------------------------
Q2QYY3_ORYSJ/12-64--------------------------------------------------------------------------------
Q5KM21_CRYNJ/64-110--------------------------------------------------------------------------------
CSLD1_ORYSJ/113-162--------------------------------------------------------------------------------

PF05290

IE0_NPVLD/108-250LRAMRAMSRFEHNVFVFLPYCKRLRALVELFRHDYCCQSTVAGCARALDETIADAQRHLLVVRSMSERAAVMLVFSDWVR
Q287C0_NPVAS/99-239IEHLKSQPKFQYNMFIFLPYIRQLRIINDLFANDYCCTAIVKFNANALAALCEEGDKYLHVIKLMKERMHLINVFTNP.K
I3XMH6_NPVMB/93-233IGHLNNQPKFQYNMYIFLPYVRQLRQINTLFLNDYCCSKIVKSNGAALDTLIAHCDKYLHVIASMNERMQLINVFTEP.K
Q0N487_9ABAC/128-269LLFVVQQEMYVHNVYIFLPYLRQLKQMLSNFVNDYCCSSVVQKCIQSVDSLMQRSTKYLEAIKFISDRLLVMNVFDDSIK
Q8QL66_9ABAC/93-233IGHLNNQPKFQYNMYIFLPYVRQLRQINTLFINDYCCSKIVKSNSAALDLLIAHCDKYLHVIASMNERMQLINVFTEP.K
Q0ILB1_NPVLS/143-285MENLYQIELYKLNYFVFIPYLKQLLAILNLFVNDACCKKYTRIAKDILEVSLKRSQEQLDCVQRITKTVQVMNVFLET.P
O10614_9ABAC/1-141MNFSDDEVNYVKPKVYFFTLLKYLNKILKLFQYDKCCAKLTKQLQAQLNTLLTQSADSCKHIHAINRQSQVLTVFLEN.P
Q462F6_9ABAC/132-272LQHVYRMPKFEYSTYVFMPYLKQIRKIIILFVNDFCCKKLVENYLITLDLMITNSLKLLETIEMINKRIDVMNVFLDR.R
Q8V5X4_9ABAC/135-275MNFSDDEVNYVKQKFIFLPYLKYLNKILKLFQYDKCCAKLTKQLQAQLNTLLTQSADSCKHIHAINRQSQVLTVFLEN.P
Q77KA3_9ABAC/135-275MNFSDDEVNYVKQKFIFLPYLKYLNKILKLFQYDKCCAKLTKQLQAQLNTLLTQSADSCKHIHAINRQSQVLTVFLEN.P
Q4KT70_9ABAC/161-301LQHVNRMSKFEYSMYVFMPYLKQIRKTIILFVNDFCCKKLVENYLLTLDAMIADSLKLLETIQMINKRVDVMNVFLDR.P
Q9IBQ9_9ABAC/99-239LEHLKSQPKFQYNMYIFMPYVKQIMVINDMFKNDFCCTAIVKTNSNALRELCERGEKYMHVIKLMNERMQIINVFTNP.K
A1YJD2_NPVSF/92-232IQNLNTQPKFQYNMYIFIPYIKQIRVINNMFVNDFCCSAIVKSNSVTLNDLYDRSEKYLHIIKLMNERMQLINVFTDP.K

PF13639

A0BF07_PARTE/123-166--------------------------------------------------------------------------------
A0BG06_PARTE/408-453--------------------------------------------------------------------------------
A0BG98_PARTE/975-1016--------------------------------------------------------------------------------
A0BHL9_PARTE/487-532--------------------------------------------------------------------------------
A0BW53_PARTE/242-287--------------------------------------------------------------------------------
A0C065_PARTE/257-302--------------------------------------------------------------------------------
A0C4D0_PARTE/209-254--------------------------------------------------------------------------------
A0CM36_PARTE/389-430--------------------------------------------------------------------------------
A0CP51_PARTE/704-750--------------------------------------------------------------------------------
A0CTC1_PARTE/316-359--------------------------------------------------------------------------------
A0CVE7_PARTE/479-524--------------------------------------------------------------------------------
A0CVK3_PARTE/111-153--------------------------------------------------------------------------------
A0D773_PARTE/151-197--------------------------------------------------------------------------------
A0DDR1_PARTE/271-312--------------------------------------------------------------------------------
A0DUT5_PARTE/364-405--------------------------------------------------------------------------------
A0DZE8_PARTE/222-272--------------------------------------------------------------------------------
A0E6R8_PARTE/294-335--------------------------------------------------------------------------------
A2EWG4_TRIVA/521-562--------------------------------------------------------------------------------
A2F2I1_TRIVA/177-218--------------------------------------------------------------------------------
A2F4T4_TRIVA/6-48--------------------------------------------------------------------------------
A4D9H5_ASPFU/43-87--------------------------------------------------------------------------------
A4H5E8_LEIBR/271-315--------------------------------------------------------------------------------
A4S5N6_OSTLU/207-250--------------------------------------------------------------------------------
A5DL42_PICGU/2-46--------------------------------------------------------------------------------
A5KBD4_PLAVS/682-726--------------------------------------------------------------------------------
A7ASN3_BABBO/245-286--------------------------------------------------------------------------------
A7EV89_SCLS1/213-255--------------------------------------------------------------------------------
A7F7S5_SCLS1/79-114--------------------------------------------------------------------------------
A7SE55_NEMVE/265-306--------------------------------------------------------------------------------
A7SV59_NEMVE/17-58--------------------------------------------------------------------------------
A7TEL4_VANPO/240-287--------------------------------------------------------------------------------
A7TNA9_VANPO/500-546--------------------------------------------------------------------------------
A8B1R0_GIAIC/198-239--------------------------------------------------------------------------------
A8BCR1_GIAIC/396-436--------------------------------------------------------------------------------
A8BH29_GIAIC/526-564--------------------------------------------------------------------------------
A8BH48_GIAIC/167-206--------------------------------------------------------------------------------
A8BR45_GIAIC/756-798--------------------------------------------------------------------------------
A8J2E4_CHLRE/27-70--------------------------------------------------------------------------------
A8NNS3_COPC7/317-363--------------------------------------------------------------------------------
A8NRQ3_COPC7/82-124--------------------------------------------------------------------------------
A8PS53_MALGO/218-260--------------------------------------------------------------------------------
A8PW40_BRUMA/176-220--------------------------------------------------------------------------------
A8WK80_CAEBR/59-103--------------------------------------------------------------------------------
HRDL1_CAEBR/348-388--------------------------------------------------------------------------------
A8X639_CAEBR/2090-2134--------------------------------------------------------------------------------
A8XCH4_CAEBR/391-437--------------------------------------------------------------------------------
A8XFE0_CAEBR/1272-1316--------------------------------------------------------------------------------
A8Y153_CAEBR/199-244--------------------------------------------------------------------------------
A8Y154_CAEBR/1055-1099--------------------------------------------------------------------------------
A8Y4G8_CAEBR/15-58--------------------------------------------------------------------------------
A9RKN3_PHYPA/1033-1075--------------------------------------------------------------------------------
A9S3J6_PHYPA/626-663--------------------------------------------------------------------------------
A9STB2_PHYPA/163-207--------------------------------------------------------------------------------
A9UVL1_MONBE/57-98--------------------------------------------------------------------------------
A9UWA5_MONBE/146-191--------------------------------------------------------------------------------
A9V1C8_MONBE/81-124--------------------------------------------------------------------------------
A9V8U2_MONBE/25-68--------------------------------------------------------------------------------
B0D6B0_LACBS/8-50--------------------------------------------------------------------------------
B0D6D7_LACBS/8-54--------------------------------------------------------------------------------
B0DBT2_LACBS/509-550--------------------------------------------------------------------------------
B0W7P9_CULQU/1910-1963--------------------------------------------------------------------------------
B0WRM7_CULQU/22-63--------------------------------------------------------------------------------
B0X025_CULQU/326-366--------------------------------------------------------------------------------
B2ARF0_PODAN/381-422--------------------------------------------------------------------------------
B2ARP1_PODAN/97-144--------------------------------------------------------------------------------
B2VXK1_PYRTR/232-281--------------------------------------------------------------------------------
B2W0J7_PYRTR/26-77--------------------------------------------------------------------------------
B2WHH7_PYRTR/224-275--------------------------------------------------------------------------------
B3RXT9_TRIAD/16-56--------------------------------------------------------------------------------
B3RZR8_TRIAD/243-283--------------------------------------------------------------------------------
B3S2U3_TRIAD/573-620--------------------------------------------------------------------------------
B4G588_DROPE/157-200--------------------------------------------------------------------------------
B4GK50_DROPE/46-88--------------------------------------------------------------------------------
B4LI97_DROVI/204-249--------------------------------------------------------------------------------
B4LSA1_DROVI/268-313--------------------------------------------------------------------------------
B4MF50_DROVI/89-132--------------------------------------------------------------------------------
B4USZ3_OTOGA/276-327--------------------------------------------------------------------------------
B5YMI0_THAPS/374-418--------------------------------------------------------------------------------
B6H8U3_PENCW/360-405--------------------------------------------------------------------------------
B6JXH2_SCHJY/1111-1151--------------------------------------------------------------------------------
B6K5J5_SCHJY/275-319--------------------------------------------------------------------------------
B6U0S2_MAIZE/37-80--------------------------------------------------------------------------------
B7FVA2_PHATC/266-311--------------------------------------------------------------------------------
B7GBA9_PHATC/105-148--------------------------------------------------------------------------------
B7PWV8_IXOSC/130-171--------------------------------------------------------------------------------
B7Q3P5_IXOSC/283-324--------------------------------------------------------------------------------
B8C1B2_THAPS/134-178--------------------------------------------------------------------------------
B8LCG6_THAPS/254-299--------------------------------------------------------------------------------
B8N2D7_ASPFN/129-176--------------------------------------------------------------------------------
B9GM69_POPTR/210-253--------------------------------------------------------------------------------
B9H8Y6_POPTR/159-207--------------------------------------------------------------------------------
B9HCQ3_POPTR/262-307--------------------------------------------------------------------------------
B9HGN6_POPTR/520-566--------------------------------------------------------------------------------
B9HHT1_POPTR/105-149--------------------------------------------------------------------------------
B9HWB4_POPTR/83-127--------------------------------------------------------------------------------
B9I3L5_POPTR/156-196--------------------------------------------------------------------------------
B9QEB6_TOXGO/881-924--------------------------------------------------------------------------------
B9SHS5_RICCO/117-161--------------------------------------------------------------------------------
B9T2M7_RICCO/86-129--------------------------------------------------------------------------------
C1E1T7_MICSR/516-566--------------------------------------------------------------------------------
C1EDK4_MICSR/193-237--------------------------------------------------------------------------------
C1MTE8_MICPC/954-1004--------------------------------------------------------------------------------
C1MV68_MICPC/95-145--------------------------------------------------------------------------------
C3XY44_BRAFL/375-426--------------------------------------------------------------------------------
C3Z5V4_BRAFL/318-359--------------------------------------------------------------------------------
C4M9D6_ENTHI/170-211--------------------------------------------------------------------------------
C4R4A1_PICPG/846-896--------------------------------------------------------------------------------
C4R4D1_PICPG/565-609--------------------------------------------------------------------------------
C4V6V3_NOSCE/233-278--------------------------------------------------------------------------------
C5DE05_LACTC/81-127--------------------------------------------------------------------------------
C5DQ62_ZYGRC/933-982--------------------------------------------------------------------------------
C5DQP9_ZYGRC/218-263--------------------------------------------------------------------------------
C5FMR2_ARTOC/431-479--------------------------------------------------------------------------------
C5L6A3_PERM5/71-116--------------------------------------------------------------------------------
C5LDG0_PERM5/227-269--------------------------------------------------------------------------------
C5LZ25_PERM5/899-952--------------------------------------------------------------------------------
C5M287_CANTT/514-558--------------------------------------------------------------------------------
C5WTI2_SORBI/179-223--------------------------------------------------------------------------------
C5XUQ0_SORBI/467-510--------------------------------------------------------------------------------
C5Y3B4_SORBI/199-242--------------------------------------------------------------------------------
C5Y4M0_SORBI/235-278--------------------------------------------------------------------------------
C5Y9D9_SORBI/133-172--------------------------------------------------------------------------------
C5YEN4_SORBI/144-188--------------------------------------------------------------------------------
C5YRP9_SORBI/195-241--------------------------------------------------------------------------------
C5YWB0_SORBI/157-202--------------------------------------------------------------------------------
C5Z417_SORBI/100-144--------------------------------------------------------------------------------
C9SGF6_VERA1/34-79--------------------------------------------------------------------------------
D0MUU8_PHYIT/693-736--------------------------------------------------------------------------------
D0N2B9_PHYIT/237-277--------------------------------------------------------------------------------
D0N7W5_PHYIT/251-294--------------------------------------------------------------------------------
D0NAT9_PHYIT/306-357--------------------------------------------------------------------------------
D0NFZ0_PHYIT/39-82--------------------------------------------------------------------------------
D0NFZ8_PHYIT/358-399--------------------------------------------------------------------------------
D0NS47_PHYIT/455-498--------------------------------------------------------------------------------
D2UYX3_NAEGR/281-324--------------------------------------------------------------------------------
D2V0Z7_NAEGR/342-386--------------------------------------------------------------------------------
D2V2X6_NAEGR/149-189--------------------------------------------------------------------------------
D2VNH8_NAEGR/318-358--------------------------------------------------------------------------------
D3BBP0_POLPA/337-378--------------------------------------------------------------------------------
D3KI90_GIAIC/92-137--------------------------------------------------------------------------------
O17099_CAEEL/132-179--------------------------------------------------------------------------------
O45195_CAEEL/898-942--------------------------------------------------------------------------------
Q00Y10_OSTTA/828-872--------------------------------------------------------------------------------
Q0UAU3_PHANO/38-88--------------------------------------------------------------------------------
Q0URI7_PHANO/311-361--------------------------------------------------------------------------------
Q0USC7_PHANO/302-346--------------------------------------------------------------------------------
Q16HN5_AEDAE/231-274--------------------------------------------------------------------------------
Q177I6_AEDAE/26-69--------------------------------------------------------------------------------
Q17E25_AEDAE/57-100--------------------------------------------------------------------------------
Q23CZ8_TETTS/474-517--------------------------------------------------------------------------------
Q23WM6_TETTS/1182-1231--------------------------------------------------------------------------------
Q245T2_TETTS/96-139--------------------------------------------------------------------------------
Q24E42_TETTS/276-321--------------------------------------------------------------------------------
Q387H5_TRYB2/690-736--------------------------------------------------------------------------------
Q38EC7_TRYB2/138-181--------------------------------------------------------------------------------
Q38F27_TRYB2/287-330--------------------------------------------------------------------------------
RN183_BOVIN/9-58--------------------------------------------------------------------------------
Q4D1E0_TRYCC/568-612--------------------------------------------------------------------------------
Q4E1P7_TRYCC/345-389--------------------------------------------------------------------------------
A0A0D1CRT3_USTMA/409-453--------------------------------------------------------------------------------
A0A0D1E5Q8_USTMA/533-577--------------------------------------------------------------------------------
Q4QA61_LEIMA/537-581--------------------------------------------------------------------------------
Q4QDS7_LEIMA/298-339--------------------------------------------------------------------------------
Q4YC89_PLABA/106-145--------------------------------------------------------------------------------
Q54N05_DICDI/1106-1146--------------------------------------------------------------------------------
Q554L0_DICDI/6-51--------------------------------------------------------------------------------
Q557D0_DICDI/28-69--------------------------------------------------------------------------------
Q55DX7_DICDI/540-585--------------------------------------------------------------------------------
Q5TWM2_ANOGA/26-67--------------------------------------------------------------------------------
Q6C4M3_YARLI/513-557--------------------------------------------------------------------------------
Q6EU86_ORYSJ/89-133--------------------------------------------------------------------------------
Q6ZGW2_ORYSJ/19-63--------------------------------------------------------------------------------
Q7RTI8_PLAYO/580-623--------------------------------------------------------------------------------
Q7XJ11_ORYSJ/166-210--------------------------------------------------------------------------------
Q8IM37_PLAF7/668-713--------------------------------------------------------------------------------
Q8QKU6_ESV1K/143-192--------------------------------------------------------------------------------
Q8QKY0_ESV1K/85-128--------------------------------------------------------------------------------
Q8QNP1_ESV1K/124-173--------------------------------------------------------------------------------
UHRF1_MOUSE/711-752--------------------------------------------------------------------------------
Q9AV35_ORYSJ/95-144--------------------------------------------------------------------------------
Q9FFG2_ARATH/146-190--------------------------------------------------------------------------------
Q9FWA5_ARATH/333-376--------------------------------------------------------------------------------
ATL62_ARATH/77-121--------------------------------------------------------------------------------
Q9LKA8_ARATH/170-215--------------------------------------------------------------------------------
Q9N3H6_CAEEL/136-180--------------------------------------------------------------------------------
Q9N5Y9_CAEEL/401-444--------------------------------------------------------------------------------
Q9SH17_ARATH/127-171--------------------------------------------------------------------------------
Q9VZK5_DROME/99-144--------------------------------------------------------------------------------

PF17123

M9LQU8_PSEA3/670-698--------------------------------------------------------------------------------
G8YKW2_PICSO/433-461--------------------------------------------------------------------------------
E3RGC4_PYRTT/226-254--------------------------------------------------------------------------------
ZNRF3_HUMAN/292-320--------------------------------------------------------------------------------
A9SWZ3_PHYPA/4-32--------------------------------------------------------------------------------
D7LX71_ARALL/58-87--------------------------------------------------------------------------------
F2PPY3_TRIEC/318-343--------------------------------------------------------------------------------
B6Q6A7_PENMQ/360-389--------------------------------------------------------------------------------
E2BB02_HARSA/584-612--------------------------------------------------------------------------------
DMA1_SCHPO/191-219--------------------------------------------------------------------------------
DMA2_YEAST/432-460--------------------------------------------------------------------------------
I1MHZ7_SOYBN/154-182--------------------------------------------------------------------------------
D2V268_NAEGR/256-284--------------------------------------------------------------------------------
U9SZW1_RHIID/169-197--------------------------------------------------------------------------------
I1K7G8_SOYBN/73-102--------------------------------------------------------------------------------
G3JG23_CORMM/444-472--------------------------------------------------------------------------------
A9U391_PHYPA/31-60--------------------------------------------------------------------------------
M1A7J2_SOLTU/124-154--------------------------------------------------------------------------------
I1G7H3_AMPQE/29-57--------------------------------------------------------------------------------
M2MXX2_BAUCO/339-367--------------------------------------------------------------------------------
I7LWD8_TETTS/325-355--------------------------------------------------------------------------------
K7MP33_SOYBN/116-145--------------------------------------------------------------------------------
B9T4Z4_RICCO/180-208--------------------------------------------------------------------------------
K4ARP9_SOLLC/76-105--------------------------------------------------------------------------------
D8RN03_SELML/2-31--------------------------------------------------------------------------------
S2JCC5_MUCC1/165-193--------------------------------------------------------------------------------
T1J8S5_STRMM/73-101--------------------------------------------------------------------------------
D8R216_SELML/14-42--------------------------------------------------------------------------------
ATL74_ARATH/104-133--------------------------------------------------------------------------------
K1QTN7_CRAGI/43-71--------------------------------------------------------------------------------
H3H3V3_PHYRM/57-85--------------------------------------------------------------------------------
A8PX85_MALGO/344-372--------------------------------------------------------------------------------
M1BIA4_SOLTU/61-90--------------------------------------------------------------------------------
F6HT83_VITVI/58-87--------------------------------------------------------------------------------
M0T2R4_MUSAM/97-126--------------------------------------------------------------------------------
A0BDA6_PARTE/306-334--------------------------------------------------------------------------------
A1C708_ASPCL/313-341--------------------------------------------------------------------------------
G0VA53_NAUCC/344-372--------------------------------------------------------------------------------
N1J4Q3_BLUG1/324-352--------------------------------------------------------------------------------
I1MC10_SOYBN/70-99--------------------------------------------------------------------------------
M1D122_SOLTU/38-66--------------------------------------------------------------------------------
S7XNY3_SPRLO/155-183--------------------------------------------------------------------------------
G3MWN3_BOVIN/81-109--------------------------------------------------------------------------------
K3WXW1_PYTUL/219-247--------------------------------------------------------------------------------
M2NEX5_BAUCO/246-274--------------------------------------------------------------------------------
K7VH86_MAIZE/99-128--------------------------------------------------------------------------------
I1Q2T7_ORYGL/103-132--------------------------------------------------------------------------------
U6GNP0_EIMAC/552-580--------------------------------------------------------------------------------
Q8H5Z8_ORYSJ/207-235--------------------------------------------------------------------------------
M0ZSV0_SOLTU/178-206--------------------------------------------------------------------------------
M1E0I6_SOLTU/54-83--------------------------------------------------------------------------------
H9JRQ4_BOMMO/28-56--------------------------------------------------------------------------------
B0X690_CULQU/183-211--------------------------------------------------------------------------------
E5A6G0_LEPMJ/335-363--------------------------------------------------------------------------------
K4BU20_SOLLC/130-159--------------------------------------------------------------------------------
W5E190_WHEAT/113-142--------------------------------------------------------------------------------
M1CMY5_SOLTU/78-107--------------------------------------------------------------------------------
K7KU89_SOYBN/131-160--------------------------------------------------------------------------------
Q0UH23_PHANO/24-53--------------------------------------------------------------------------------
K1S2Y4_CRAGI/99-128--------------------------------------------------------------------------------
R4FMR7_RHOPR/87-115--------------------------------------------------------------------------------
ASR1_ASHGO/17-44--------------------------------------------------------------------------------
C8V1R9_EMENI/315-343--------------------------------------------------------------------------------
U7DVX6_POPTR/102-131--------------------------------------------------------------------------------
W1PRS8_AMBTC/47-75--------------------------------------------------------------------------------
T1F5S0_HELRO/45-74--------------------------------------------------------------------------------
S8B4E1_PENO1/304-332--------------------------------------------------------------------------------
Q59S20_CANAL/320-348--------------------------------------------------------------------------------
M1CT87_SOLTU/94-122--------------------------------------------------------------------------------
G6DJ91_DANPL/203-231--------------------------------------------------------------------------------
M4EN48_BRARP/131-161--------------------------------------------------------------------------------
K4AD29_SETIT/121-150--------------------------------------------------------------------------------
M0U0F9_MUSAM/137-166--------------------------------------------------------------------------------
I1H9P2_BRADI/112-141--------------------------------------------------------------------------------
G8ZPV5_TORDC/435-463--------------------------------------------------------------------------------
B9INM0_POPTR/100-129--------------------------------------------------------------------------------
A0BQ98_PARTE/104-133--------------------------------------------------------------------------------
Q6C175_YARLI/549-577--------------------------------------------------------------------------------
F0Y7A0_AURAN/186-212--------------------------------------------------------------------------------
M0W555_HORVD/117-146--------------------------------------------------------------------------------
M0ZSV5_SOLTU/55-83--------------------------------------------------------------------------------
B9HAE0_POPTR/152-180--------------------------------------------------------------------------------
Q0U9D9_PHANO/29-57--------------------------------------------------------------------------------
A0C9T4_PARTE/336-364--------------------------------------------------------------------------------
W4ZTE6_WHEAT/2-31--------------------------------------------------------------------------------
C5Y318_SORBI/116-145--------------------------------------------------------------------------------
D7G5M0_ECTSI/400-428--------------------------------------------------------------------------------
B9SM80_RICCO/199-227--------------------------------------------------------------------------------
U5CUY3_AMBTC/93-122--------------------------------------------------------------------------------
B9GEV4_POPTR/92-121--------------------------------------------------------------------------------
F2TXI0_SALR5/67-95--------------------------------------------------------------------------------
W5H303_WHEAT/7-36--------------------------------------------------------------------------------
K3YWG9_SETIT/58-86--------------------------------------------------------------------------------
F4NRC4_BATDJ/322-350--------------------------------------------------------------------------------
D8U3N4_VOLCA/359-385--------------------------------------------------------------------------------
M1CU46_SOLTU/5-35--------------------------------------------------------------------------------
M1CAK4_SOLTU/68-97--------------------------------------------------------------------------------
S2J9U7_MUCC1/259-287--------------------------------------------------------------------------------
I1CBQ0_RHIO9/176-204--------------------------------------------------------------------------------
V5FKW5_BYSSN/342-370--------------------------------------------------------------------------------
Q22BU9_TETTS/1146-1174--------------------------------------------------------------------------------
A7RGT9_NEMVE/559-587--------------------------------------------------------------------------------
I1NRQ7_ORYGL/116-145--------------------------------------------------------------------------------
C5KRX0_PERM5/8-36--------------------------------------------------------------------------------
K0P2Q1_9BACT/376-408--------------------------------------------------------------------------------
I1G069_AMPQE/315-343--------------------------------------------------------------------------------
F4NZG0_BATDJ/253-281--------------------------------------------------------------------------------
Y733_ENCCU/259-287--------------------------------------------------------------------------------
A9SET1_PHYPA/4-33--------------------------------------------------------------------------------
B9T8K2_RICCO/187-215--------------------------------------------------------------------------------
M0ZHN0_SOLTU/250-278--------------------------------------------------------------------------------
H6BRW0_EXODN/257-285--------------------------------------------------------------------------------
H3GHB5_PHYRM/6-32--------------------------------------------------------------------------------
A0E1F5_PARTE/371-399--------------------------------------------------------------------------------
W4ZBD1_STRPU/83-111--------------------------------------------------------------------------------
I4YHB9_WALSC/299-327--------------------------------------------------------------------------------
B9H0B9_POPTR/82-110--------------------------------------------------------------------------------
C4V879_NOSCE/161-189--------------------------------------------------------------------------------
M0VCP6_HORVD/2-31--------------------------------------------------------------------------------
B9H6Z2_POPTR/142-171--------------------------------------------------------------------------------
A9UV01_MONBE/4-32--------------------------------------------------------------------------------
ATL66_ARATH/106-135--------------------------------------------------------------------------------
M4FHC0_BRARP/121-151--------------------------------------------------------------------------------
D7FKZ7_ECTSI/326-354--------------------------------------------------------------------------------
T1FPU1_HELRO/105-132--------------------------------------------------------------------------------
A9SYM4_PHYPA/33-61--------------------------------------------------------------------------------
T1ELA1_HELRO/6-34--------------------------------------------------------------------------------
B7PZI8_IXOSC/89-117--------------------------------------------------------------------------------
J3M0W4_ORYBR/156-185--------------------------------------------------------------------------------
H3EYT8_PRIPA/153-181--------------------------------------------------------------------------------
M0YZY6_HORVD/5-34--------------------------------------------------------------------------------
F4P6A5_BATDJ/350-378--------------------------------------------------------------------------------
M0ZSX3_SOLTU/43-71--------------------------------------------------------------------------------
C5LJQ7_PERM5/159-187--------------------------------------------------------------------------------
H6BNB4_EXODN/362-390--------------------------------------------------------------------------------
I1GQM0_BRADI/116-145--------------------------------------------------------------------------------
H3EI77_PRIPA/42-70--------------------------------------------------------------------------------
Q9FFT1_ARATH/173-201--------------------------------------------------------------------------------
C1FH55_MICSR/4-33--------------------------------------------------------------------------------
D7KCM8_ARALL/83-111--------------------------------------------------------------------------------
M4DQ70_BRARP/48-78--------------------------------------------------------------------------------
H3EYU2_PRIPA/64-91--------------------------------------------------------------------------------
B0DRM3_LACBS/317-345--------------------------------------------------------------------------------
C4R4T4_PICPG/284-312--------------------------------------------------------------------------------
A0A088A4K6_APIME/53-81--------------------------------------------------------------------------------
K7LV20_SOYBN/161-190--------------------------------------------------------------------------------
M0SPK6_MUSAM/147-176--------------------------------------------------------------------------------

PF11793

Q29B73_DROPS/306-375-------------------------------------------------------------------------------Q
Q7PSZ3_ANOGA/292-361-------------------------------------------------------------------------------G
B9DHA4_ARATH/221-298-------------------------------------------------------------------------------Q
Q3MUH5_CHICK/301-369-------------------------------------------------------------------------------F
A2EV24_TRIVA/268-336-------------------------------------------------------------------------------T
Q8T913_DROME/307-376-------------------------------------------------------------------------------E
A7SDU3_NEMVE/301-369-------------------------------------------------------------------------------F
FANCL_MOUSE/303-371-------------------------------------------------------------------------------F
Q17FW9_AEDAE/295-364-------------------------------------------------------------------------------D
F7DPP4_XENTR/296-363-------------------------------------------------------------------------------.

PF17120

YDSB_SCHPO/783-844-----------------------------------------------------------------------------VTS
Q5A887_CANAL/1361-1417-----------------------------------------------------------------------------RQL
WDR59_YEAST/1092-1147-----------------------------------------------------------------------------KFL
WDR59_SCHPO/1259-1318-----------------------------------------------------------------------------LVP
Q750L2_ASHGO/1067-1122-----------------------------------------------------------------------------SAI
C4QVL2_PICPG/1135-1192-----------------------------------------------------------------------------SLR
D5G7T3_TUBMM/1215-1272-----------------------------------------------------------------------------RQI
Q6CGJ6_YARLI/1169-1225-----------------------------------------------------------------------------PNN
Q0UK84_PHANO/1304-1360-----------------------------------------------------------------------------PEP

PF12906

SUD1_ARATH/68-114--------------------------------------------------------------------------------
Q18997_CAEEL/25-71--------------------------------------------------------------------------------
MIR1_HHV8P/9-53--------------------------------------------------------------------------------
LAP_MYXVL/23-68--------------------------------------------------------------------------------
Q9VQI2_DROME/392-442--------------------------------------------------------------------------------
MARH7_HUMAN/552-607--------------------------------------------------------------------------------
MARH8_MOUSE/76-122--------------------------------------------------------------------------------
DOA10_SCHPO/8-54--------------------------------------------------------------------------------
MARH2_MOUSE/64-109--------------------------------------------------------------------------------
Q9XWI0_CAEEL/194-247--------------------------------------------------------------------------------
Q9W3Y8_DROME/91-137--------------------------------------------------------------------------------
Q93227_CAEEL/13-67--------------------------------------------------------------------------------
DOA10_YEAST/39-93--------------------------------------------------------------------------------
O64633_ARATH/74-119--------------------------------------------------------------------------------
Q9SQT6_ARATH/218-264--------------------------------------------------------------------------------
Q21530_CAEEL/16-66--------------------------------------------------------------------------------
Q9W3I6_DROME/34-88--------------------------------------------------------------------------------
Q9VB61_DROME/23-78--------------------------------------------------------------------------------
Q39623_CHLRE/12-58--------------------------------------------------------------------------------
D7M801_ARALL/247-294--------------------------------------------------------------------------------
F4HXK4_ARATH/20-65--------------------------------------------------------------------------------

PF08746

A2DRZ2_TRIVA/175-215--------------------------------------------------------------------------------
A7RM35_NEMVE/182-221--------------------------------------------------------------------------------
A7TJ64_VANPO/273-317--------------------------------------------------------------------------------
A8NFT1_COPC7/192-235--------------------------------------------------------------------------------
A8Q9P4_MALGO/157-197--------------------------------------------------------------------------------
A9TA79_PHYPA/196-239--------------------------------------------------------------------------------
B0CS87_LACBS/198-238--------------------------------------------------------------------------------
B0WPT4_CULQU/189-227--------------------------------------------------------------------------------
B0X5P6_CULQU/189-227--------------------------------------------------------------------------------
B2ASI6_PODAN/330-372--------------------------------------------------------------------------------
B3S2D3_TRIAD/163-203--------------------------------------------------------------------------------
B4GJ15_DROPE/181-219--------------------------------------------------------------------------------
B4HXW1_DROSE/184-222--------------------------------------------------------------------------------
B4LRG0_DROVI/184-222--------------------------------------------------------------------------------
B4MZ26_DROWI/184-222--------------------------------------------------------------------------------
B8NLA5_ASPFN/240-282--------------------------------------------------------------------------------
B9S6N4_RICCO/202-245--------------------------------------------------------------------------------
C4R0J5_PICPG/188-226--------------------------------------------------------------------------------
C4Y0S7_CLAL4/188-228--------------------------------------------------------------------------------
C5DCF6_LACTC/239-278--------------------------------------------------------------------------------
C5FGQ6_ARTOC/230-272--------------------------------------------------------------------------------
C6H5E2_AJECH/232-274--------------------------------------------------------------------------------
C7Z4L2_NECH7/227-269--------------------------------------------------------------------------------
C9SAU4_VERA1/243-283--------------------------------------------------------------------------------
D5G6C2_TUBMM/218-260--------------------------------------------------------------------------------
D7KGS3_ARALL/199-241--------------------------------------------------------------------------------
D7T1H8_VITVI/201-244--------------------------------------------------------------------------------
E0VUH9_PEDHC/177-217--------------------------------------------------------------------------------
E2ADT0_CAMFO/175-215--------------------------------------------------------------------------------
E3KXJ8_PUCGT/208-248--------------------------------------------------------------------------------
E3QA06_COLGM/234-276--------------------------------------------------------------------------------
E3RD04_PYRTT/237-281--------------------------------------------------------------------------------
E5A835_LEPMJ/260-304--------------------------------------------------------------------------------
E7KRF6_YEASL/106-159--------------------------------------------------------------------------------
A0A0D2WUY3_CAPO3/191-233--------------------------------------------------------------------------------
E9DEJ9_COCPS/231-273--------------------------------------------------------------------------------
E9ENE5_METRA/234-276--------------------------------------------------------------------------------
E9QJ95_DANRE/182-224--------------------------------------------------------------------------------
F0X8L7_GROCL/292-339--------------------------------------------------------------------------------
F4RKD7_MELLP/196-236--------------------------------------------------------------------------------
F7CBY5_XENTR/185-225--------------------------------------------------------------------------------
F9X440_ZYMTI/235-278--------------------------------------------------------------------------------
G0RLM8_HYPJQ/225-267--------------------------------------------------------------------------------
G0S8A9_CHATD/237-279--------------------------------------------------------------------------------
G0SXD4_RHOG2/246-284--------------------------------------------------------------------------------
G0V5G7_NAUCC/285-341--------------------------------------------------------------------------------
G0W7Y8_NAUDC/281-337--------------------------------------------------------------------------------
G1N4R2_MELGA/191-231--------------------------------------------------------------------------------
G2RDX4_THITE/264-306--------------------------------------------------------------------------------
G2Y935_BOTF4/224-266--------------------------------------------------------------------------------
G3JDU4_CORMM/230-272--------------------------------------------------------------------------------
G3TL09_LOXAF/195-235--------------------------------------------------------------------------------
G4MZL2_MAGO7/234-276--------------------------------------------------------------------------------
G4UI54_NEUT9/253-296--------------------------------------------------------------------------------
G8C139_TETPH/290-341--------------------------------------------------------------------------------
G8YT41_PICSO/212-254--------------------------------------------------------------------------------
G8ZVJ6_TORDC/249-291--------------------------------------------------------------------------------
H0ZGS9_TAEGU/185-225--------------------------------------------------------------------------------
H2ATC7_KAZAF/250-298--------------------------------------------------------------------------------
H2UQ13_TAKRU/181-223--------------------------------------------------------------------------------
H2Z292_CIOSA/51-92--------------------------------------------------------------------------------
H6C926_EXODN/231-273--------------------------------------------------------------------------------
H9G7S4_ANOCA/180-220--------------------------------------------------------------------------------
I1HF27_BRADI/97-140--------------------------------------------------------------------------------
A0A016PZI7_GIBZA/227-269--------------------------------------------------------------------------------
I2H1A9_TETBL/266-313--------------------------------------------------------------------------------
I6NCS4_ERECY/251-302--------------------------------------------------------------------------------
J3P4X2_GAGT3/365-407--------------------------------------------------------------------------------
J4G7D8_FIBRA/180-220--------------------------------------------------------------------------------
J7S9R2_KAZNA/316-366--------------------------------------------------------------------------------
J9JWF5_ACYPI/161-201--------------------------------------------------------------------------------
K0K9Q2_WICCF/200-243--------------------------------------------------------------------------------
K1PRA0_CRAGI/211-250--------------------------------------------------------------------------------
K1XLK9_MARBU/225-268--------------------------------------------------------------------------------
K3YCH6_SETIT/181-223--------------------------------------------------------------------------------
K4ASI7_SOLLC/199-242--------------------------------------------------------------------------------
K7IS45_NASVI/176-216--------------------------------------------------------------------------------
K7N1S4_SOYBN/203-246--------------------------------------------------------------------------------
L0PCM3_PNEJ8/182-224--------------------------------------------------------------------------------
L8FQD9_PSED2/223-265--------------------------------------------------------------------------------
M2M890_BAUCO/233-276--------------------------------------------------------------------------------
M2ZXM0_PSEFD/230-273--------------------------------------------------------------------------------
M3AWI4_SPHMS/273-316--------------------------------------------------------------------------------
M3ZX46_XIPMA/185-227--------------------------------------------------------------------------------
M7SB58_EUTLA/232-274--------------------------------------------------------------------------------
N1JBI4_BLUG1/208-250--------------------------------------------------------------------------------
N1PJ33_DOTSN/222-264--------------------------------------------------------------------------------
Q0V1K7_PHANO/240-284--------------------------------------------------------------------------------
Q16PA4_AEDAE/195-233--------------------------------------------------------------------------------
Q5KC98_CRYNJ/208-250--------------------------------------------------------------------------------
Q6BH78_DEBHA/201-243--------------------------------------------------------------------------------
Q6FPU2_CANGA/325-366--------------------------------------------------------------------------------
Q759D3_ASHGO/220-269--------------------------------------------------------------------------------
Q84VP9_ARATH/198-240--------------------------------------------------------------------------------
R0ICN5_SETT2/247-291--------------------------------------------------------------------------------
R4XEW3_TAPDE/194-234--------------------------------------------------------------------------------
R7Z157_CONA1/233-275--------------------------------------------------------------------------------
R8BUZ2_TOGMI/229-271--------------------------------------------------------------------------------
S2KEM5_MUCC1/188-230--------------------------------------------------------------------------------
S3DCP8_GLAL2/235-277--------------------------------------------------------------------------------
S7Z8E9_PENO1/233-275--------------------------------------------------------------------------------
S8AAF4_DACHA/241-282--------------------------------------------------------------------------------
S8ETB8_FOMPI/193-233--------------------------------------------------------------------------------
T0LMX3_COLGC/228-270--------------------------------------------------------------------------------
T1HB85_RHOPR/177-218--------------------------------------------------------------------------------
T5AC96_OPHSC/228-270--------------------------------------------------------------------------------
U1GD89_ENDPU/227-269--------------------------------------------------------------------------------
U4LU38_PYROM/236-278--------------------------------------------------------------------------------
U9UNJ2_RHIID/187-229--------------------------------------------------------------------------------
V2XVD5_MONRO/138-178--------------------------------------------------------------------------------
W1NTZ6_AMBTC/198-241--------------------------------------------------------------------------------
W4W1Q3_ATTCE/175-215--------------------------------------------------------------------------------
W5K8T9_ASTMX/185-227--------------------------------------------------------------------------------
W5M8R4_LEPOC/185-227--------------------------------------------------------------------------------

PF05883

Q91ES1_GVCPM/3-133--------------------------------------------------------------------------------
Q8B9J7_NPVR1/1-134--------------------------------------------------------------------------------

PF17034

M7NP39_PNEMU/806-922---------------------------CNFCNKSITHKPITSKHHTNIQ....NSNIPSTG.....NIQKSTLCPACSKP
B6JVZ6_SCHJY/505-623---------------------------CNYCKKSF...SFSAAEK........QAAVLSKGGRKFVDTSKRSACPRCHQQ
YAG1_SCHPO/778-905---------------------------CNFCRKPIF..PFSNRNECNNLPTPIQRGVSKAGPAKHLGKS....CPHCGQP

PF15227

F7CME7_ORNAN/11-52---C-----P--V--C----------------------------------------------------------------
RFPL3_HUMAN/40-81---C-----P--V--C----------------------------------------------------------------
F7F323_ORNAN/11-48---C-----P--I--C----------------------------------------------------------------
G7PI48_MACFA/23-64---C-----P--I--C----------------------------------------------------------------
G3VAS7_SARHA/17-57---C-----P--I--C----------------------------------------------------------------
G3UB63_LOXAF/16-60---C-----P--V--C----------------------------------------------------------------
F6Q3T5_HORSE/11-52---C-----R--H--C----------------------------------------------------------------
H0XJT9_OTOGA/23-64---C-----P--I--C----------------------------------------------------------------
H9KWF0_CALJA/16-56---C-----P--I--C----------------------------------------------------------------
D6RAS2_HUMAN/16-56---C-----P--I--C----------------------------------------------------------------
H3CZE1_TETNG/15-54---C-----P--I--C----------------------------------------------------------------

PF13445

Q5XIP3_RAT/129-168---C-----P--I--C----------------------------------------------------------------
H2U4S0_TAKRU/12-54---C-----P--I--C----------------------------------------------------------------
K2SS04_MACPH/92-138---C-----L--I--C----------------------------------------------------------------
G1MUP8_MELGA/12-50---C-----P--V--C----------------------------------------------------------------
R4XGI6_TAPDE/192-231---C-----P--I--T----------------------------------------------------------------
W4YI58_STRPU/16-53---C-----P--V--C----------------------------------------------------------------
G0MPF4_CAEBE/491-535---C-----K--I--C----------------------------------------------------------------
F6VLT2_XENTR/28-71---C-----K--V--C----------------------------------------------------------------
A8XHU9_CAEBR/11-55---C-----Q--I--C----------------------------------------------------------------
F6V6N2_XENTR/12-53---C-----S--I--C----------------------------------------------------------------
M2RK82_CERS8/4-45---C-----V--I--C----------------------------------------------------------------
A9SQJ9_PHYPA/12-64---C-----P--V--C----------------------------------------------------------------
G1NRB9_MELGA/10-55---C-----P--I--C----------------------------------------------------------------
G1R3M4_NOMLE/37-73---C-----A--V--C----------------------------------------------------------------
E9PJJ9_HUMAN/16-58---C-----P--I--C----------------------------------------------------------------
G5E5F1_BOVIN/21-57---C-----K--I--C----------------------------------------------------------------
K0SPM9_THAOC/145-191---C-----G--I--C----------------------------------------------------------------
W4Y956_STRPU/19-57---C-----T--I--C----------------------------------------------------------------
A0E1J7_PARTE/103-142---C-----P--I--S----------------------------------------------------------------
RNFT1_DANRE/359-394---C-----P--I--C----------------------------------------------------------------
A0BTR3_PARTE/55-96---C-----P--I--C----------------------------------------------------------------
A7S4D3_NEMVE/10-49---C-----P--I--C----------------------------------------------------------------
T1L2A6_TETUR/85-129---C-----S--V--C----------------------------------------------------------------
A8E7M3_DANRE/17-57---C-----P--I--C----------------------------------------------------------------
C4QVD1_PICPG/131-170---C-----P--I--C----------------------------------------------------------------
A0DRL5_PARTE/27-64---C-----S--I--C----------------------------------------------------------------
W5D6D5_WHEAT/162-200---C-----P--I--C----------------------------------------------------------------
F0ZWT0_DICPU/6-44---C-----S--I--C----------------------------------------------------------------
D8SZY1_SELML/288-327---C-----A--I--C----------------------------------------------------------------
A3LTM3_PICST/59-107---C-----P--I--C----------------------------------------------------------------
G3TCL0_LOXAF/21-63---C-----P--I--C----------------------------------------------------------------
Q22GY2_TETTS/78-114---C-----P--I--S----------------------------------------------------------------
W5KEH2_ASTMX/36-69---C-----R--V--C----------------------------------------------------------------
Q0UD97_PHANO/225-273---C-----P--I--C----------------------------------------------------------------
C3YS34_BRAFL/17-57---C-----T--I--C----------------------------------------------------------------
G0N804_CAEBE/271-314---C-----K--I--C----------------------------------------------------------------
I3ISM8_DANRE/14-51---C-----S--V--C----------------------------------------------------------------
F8PR62_SERL3/741-783---C-----P--I--C----------------------------------------------------------------
M4CHX3_BRARP/59-112---C-----P--I--C----------------------------------------------------------------
K1QS25_CRAGI/33-70---C-----P--V--C----------------------------------------------------------------
V8NH63_OPHHA/76-119---C-----L--I--C----------------------------------------------------------------
W5M316_LEPOC/54-99---C-----P--I--C----------------------------------------------------------------
H0W4R9_CAVPO/45-83---C-----P--L--C----------------------------------------------------------------
F7F374_ORNAN/11-50---C-----P--I--C----------------------------------------------------------------
G1KD08_ANOCA/15-54---C-----P--I--C----------------------------------------------------------------
X6LNY8_RETFI/31-66---C-----P--V--C----------------------------------------------------------------
C3XQ13_BRAFL/418-455---C-----G--I--C----------------------------------------------------------------
A0DYA3_PARTE/317-357---C-----P--V--S----------------------------------------------------------------
H2MPK1_ORYLA/10-49---C-----S--I--C----------------------------------------------------------------
E3NLR0_CAERE/132-173---C-----E--V--C----------------------------------------------------------------
C4LWT0_ENTHI/22-62---P-----N--I--P----------------------------------------------------------------
H2LHW9_ORYLA/18-55---C-----P--L--C----------------------------------------------------------------
A0A098DZP0_GIBZA/106-145---C-----A--I--C----------------------------------------------------------------
W5LPC4_ASTMX/14-58---C-----P--V--C----------------------------------------------------------------
A7RRQ3_NEMVE/16-56---C-----P--I--C----------------------------------------------------------------
M4B7N8_HYAAE/32-88---C-----E--L--C----------------------------------------------------------------
I1GDC1_AMPQE/18-59---C-----S--I--C----------------------------------------------------------------
K5Y1G6_AGABU/3-55---C-----C--I--C----------------------------------------------------------------
W4Y4S3_STRPU/40-78---C-----P--F--T----------------------------------------------------------------
RAD18_CANGA/27-62---C-----H--I--C----------------------------------------------------------------
E3N4M3_CAERE/13-40---I-----P--K--V----------------------------------------------------------------
C3YHG3_BRAFL/20-58---C-----S--I--C----------------------------------------------------------------
H2U6M1_TAKRU/11-48---C-----P--V--C----------------------------------------------------------------
A0CKT1_PARTE/19-57---C-----N--I--C----------------------------------------------------------------
W4YH05_STRPU/19-59---C-----A--I--C----------------------------------------------------------------
M0XDV5_HORVD/329-370---C-----P--V--L----------------------------------------------------------------
F7HQP6_MACMU/23-63---C-----I--I--C----------------------------------------------------------------
C3Y3Q8_BRAFL/823-861---C-----Q--I--C----------------------------------------------------------------
K5X9X6_AGABU/24-64---C-----P--I--C----------------------------------------------------------------
H0UZE1_CAVPO/16-59---C-----S--I--C----------------------------------------------------------------
M0W5B0_HORVD/368-422---C-----S--I--C----------------------------------------------------------------
M3K141_CANMX/59-112---C-----A--I--C----------------------------------------------------------------
G3WXC1_SARHA/5-44---C-----S--I--C----------------------------------------------------------------
Q6Z8T9_ORYSJ/100-139---C-----R--V--C----------------------------------------------------------------
C3Z9P0_BRAFL/17-57---C-----Q--I--C----------------------------------------------------------------
W5LW03_LEPOC/12-50---C-----P--V--C----------------------------------------------------------------
B6IGT1_CAEBR/2-57---C-----P--V--C----------------------------------------------------------------
I3MBB3_SPETR/15-53---C-----P--I--C----------------------------------------------------------------
Q54DE4_DICDI/7-42---C-----W--V--C----------------------------------------------------------------
D4ANH0_ARTBC/208-243---C-----Q--V--C----------------------------------------------------------------
A8NFK9_COPC7/331-371---C-----L--V--S----------------------------------------------------------------
H2QS69_PANTR/29-79---C-----S--I--C----------------------------------------------------------------
E3NBL3_CAERE/246-287---C-----I--V--C----------------------------------------------------------------
W5PWF8_SHEEP/29-67---C-----S--V--C----------------------------------------------------------------
M3B3C8_SPHMS/376-416---C-----P--V--S----------------------------------------------------------------
C4R3V1_PICPG/327-367---C-----P--V--S----------------------------------------------------------------
V2WR56_MONRO/5-46---C-----S--I--C----------------------------------------------------------------
B5DJC3_DROPS/23-63---C-----G--M--C----------------------------------------------------------------
Q6MAM3_PARUW/97-138---C-----P--I--T----------------------------------------------------------------
A9S273_PHYPA/329-370---C-----P--V--S----------------------------------------------------------------
I1EPR1_AMPQE/90-125---C-----P--I--C----------------------------------------------------------------
I3JRP9_ORENI/20-62---C-----P--I--C----------------------------------------------------------------
H2ATW4_KAZAF/33-73---C-----N--I--C----------------------------------------------------------------
F1A268_DICPU/60-100---C-----S--I--C----------------------------------------------------------------
K1QL17_CRAGI/138-178---C-----E--V--C----------------------------------------------------------------
U5HBL1_USTV1/83-123---C-----H--I--C----------------------------------------------------------------
I1EV64_AMPQE/40-77---C-----T--I--C----------------------------------------------------------------
A9UXJ6_MONBE/34-75---C-----P--I--C----------------------------------------------------------------
G0PB00_CAEBE/92-135---C-----K--I--C----------------------------------------------------------------
K1QJ51_CRAGI/16-59---C-----S--I--C----------------------------------------------------------------
W5JZW7_ASTMX/23-63---C-----S--I--C----------------------------------------------------------------
E9GED8_DAPPU/17-57---C-----G--V--C----------------------------------------------------------------
F6YGB6_CALJA/15-57---C-----P--I--C----------------------------------------------------------------
E9J606_SOLIN/133-171---C-----P--I--C----------------------------------------------------------------
C3ZI51_BRAFL/16-58---C-----Q--I--C----------------------------------------------------------------
F7VRY5_SORMK/730-765---C-----P--I--C----------------------------------------------------------------
F6QH43_CIOIN/18-55---C-----S--I--C----------------------------------------------------------------
H2S3V3_TAKRU/15-52---C-----D--V--C----------------------------------------------------------------
Q1JPC8_BOVIN/282-324---C-----P--V--C----------------------------------------------------------------
E9GEC4_DAPPU/13-57---C-----G--V--C----------------------------------------------------------------
M4DVG3_BRARP/196-236---C-----P--I--C----------------------------------------------------------------
I3NEE4_SPETR/16-54---C-----P--I--C----------------------------------------------------------------
M2TAV9_COCH5/15-57---C-----S--I--C----------------------------------------------------------------
T1EZ91_HELRO/15-55---C-----P--I--C----------------------------------------------------------------
D8QLY5_SCHCM/10-49---C-----D--I--G----------------------------------------------------------------
K3YIC8_SETIT/10-46---C-----P--I--T----------------------------------------------------------------
A0D4J1_PARTE/9-51---C-----P--E--C----------------------------------------------------------------
H9G3X6_ANOCA/17-55---C-----S--I--C----------------------------------------------------------------
E9I564_DAPPU/12-52---C-----S--I--C----------------------------------------------------------------
A5KA05_PLAVS/1738-1779---C-----P--I--S----------------------------------------------------------------
D7TX82_VITVI/6-49---C-----L--V--C----------------------------------------------------------------
G0MZV1_CAEBE/18-64---C-----E--I--C----------------------------------------------------------------
C3XUI1_BRAFL/14-51---C-----E--I--C----------------------------------------------------------------
A2EJL6_TRIVA/6-41---C-----K--I--C----------------------------------------------------------------
A8N8Q9_COPC7/5-46---C-----G--I--C----------------------------------------------------------------
C5LDU0_PERM5/132-173---C-----P--I--C----------------------------------------------------------------
H3BB17_LATCH/14-53---C-----A--I--C----------------------------------------------------------------
C3Y770_BRAFL/22-63---C-----T--I--C----------------------------------------------------------------
F6ZES7_MONDO/11-50---C-----P--I--C----------------------------------------------------------------
Q557I6_DICDI/500-535---C-----P--I--C----------------------------------------------------------------
E3LHN6_CAERE/165-206---C-----Q--I--C----------------------------------------------------------------
C3XSU0_BRAFL/19-70---C-----G--I--C----------------------------------------------------------------
G3ILU9_CRIGR/12-48---C-----S--I--C----------------------------------------------------------------
W4XDD6_STRPU/19-64---C-----S--L--C----------------------------------------------------------------
I1EDY3_AMPQE/9-46---C-----S--V--C----------------------------------------------------------------
G1SZ36_RABIT/16-54---C-----P--V--C----------------------------------------------------------------
H3AS96_LATCH/17-57---C-----P--I--C----------------------------------------------------------------
C3YJ40_BRAFL/346-387---C-----P--I--L----------------------------------------------------------------
A8BYH8_GIAIC/88-128---C-----A--I--C----------------------------------------------------------------
E3QH28_COLGM/19-58---C-----P--V--C----------------------------------------------------------------
C3YCK8_BRAFL/18-55---C-----A--I--C----------------------------------------------------------------
E3MD67_CAERE/243-288---C-----S--I--C----------------------------------------------------------------
A2BFT4_DANRE/12-52---C-----P--L--C----------------------------------------------------------------
H9GCA4_ANOCA/6-45---C-----S--I--C----------------------------------------------------------------
K2R6E5_MACPH/29-67---C-----P--I--C----------------------------------------------------------------
F6Q9Y4_XENTR/12-53---C-----S--I--C----------------------------------------------------------------
H0XIJ0_OTOGA/11-50---C-----S--I--C----------------------------------------------------------------
K1R237_CRAGI/11-55---C-----P--I--C----------------------------------------------------------------
A5DNE9_PICGU/483-538---C-----P--V--S----------------------------------------------------------------
Q6IZ49_XENTR/24-60---C-----P--I--C----------------------------------------------------------------
T1FTH2_HELRO/43-88---C-----M--I--C----------------------------------------------------------------
E4XZU1_OIKDI/249-293---C-----P--I--L----------------------------------------------------------------
F6WZL0_MONDO/16-53---C-----P--I--C----------------------------------------------------------------
P91482_CAEEL/116-162---C-----G--I--C----------------------------------------------------------------
C4LU11_ENTHI/142-180---C-----P--L--T----------------------------------------------------------------
M4D5N6_BRARP/323-365---C-----P--V--S----------------------------------------------------------------
B6AIC5_CRYMR/509-552---C-----T--I--S----------------------------------------------------------------
A0A0D2WQV5_CAPO3/360-400---C-----P--V--S----------------------------------------------------------------
F6XK31_XENTR/26-73---C-----P--I--C----------------------------------------------------------------
A7RLP8_NEMVE/17-55---C-----G--I--C----------------------------------------------------------------
I1F402_AMPQE/15-53---C-----S--V--C----------------------------------------------------------------
K1QMJ9_CRAGI/17-61---C-----S--I--C----------------------------------------------------------------
K1QI57_CRAGI/14-58---C-----P--V--C----------------------------------------------------------------
A9S1L1_PHYPA/191-243---C-----P--I--C----------------------------------------------------------------
H2PL69_PONAB/11-50---C-----P--V--C----------------------------------------------------------------
C4LXJ9_ENTHI/319-354---C-----L--I--C----------------------------------------------------------------
W4ZVJ4_WHEAT/365-400---C-----S--I--C----------------------------------------------------------------
H9GBR8_ANOCA/18-57---C-----P--V--C----------------------------------------------------------------
RN186_MOUSE/39-82---C-----L--V--C----------------------------------------------------------------
HRD1_CAEEL/292-330---C-----I--I--C----------------------------------------------------------------
K1R2N9_CRAGI/11-51---C-----A--I--C----------------------------------------------------------------
B9I9W3_POPTR/164-204---C-----P--V--C----------------------------------------------------------------
E5S3N4_TRISP/53-97---C-----P--A--C----------------------------------------------------------------
E1G217_LOALO/57-95---C-----S--V--C----------------------------------------------------------------
A7SX53_NEMVE/329-370---C-----P--I--S----------------------------------------------------------------
K7JHE6_NASVI/79-123---C-----P--I--C----------------------------------------------------------------
E3LLW6_CAERE/25-77---C-----P--I--C----------------------------------------------------------------
F9XL86_ZYMTI/147-183---C-----T--I--C----------------------------------------------------------------
A0C1N2_PARTE/16-53---C-----K--I--C----------------------------------------------------------------
Q9U1S9_CAEEL/183-225---C-----E--I--C----------------------------------------------------------------
V5FT15_BYSSN/39-80---C-----P--I--C----------------------------------------------------------------
W4ZK58_STRPU/11-51---C-----S--I--C----------------------------------------------------------------
C3ZQ23_BRAFL/132-166---Q-----D--P--.----------------------------------------------------------------
U3JIN8_FICAL/156-198---C-----P--I--T----------------------------------------------------------------
W4XDW4_STRPU/70-107---C-----P--I--C----------------------------------------------------------------
G0SHW4_CHATD/317-357---C-----P--V--S----------------------------------------------------------------
A7RQ72_NEMVE/158-198---C-----P--I--T----------------------------------------------------------------
F1N8I5_CHICK/24-63---C-----P--V--C----------------------------------------------------------------
G0MUK6_CAEBE/202-243---C-----E--I--C----------------------------------------------------------------
F6SDB1_XENTR/184-221---C-----P--L--C----------------------------------------------------------------
B0DBN6_LACBS/365-406---C-----R--I--S----------------------------------------------------------------
K1PUY4_CRAGI/18-64---C-----P--I--Y----------------------------------------------------------------
A7S4Y4_NEMVE/22-62---C-----P--V--C----------------------------------------------------------------
T1FYV1_HELRO/274-309---C-----A--V--C----------------------------------------------------------------
A9UPI2_MONBE/165-203---C-----F--I--C----------------------------------------------------------------
A7SP16_NEMVE/14-51---C-----P--I--C----------------------------------------------------------------
G0MZ61_CAEBE/163-204---C-----E--I--C----------------------------------------------------------------
H2LUA9_ORYLA/26-61---C-----P--L--C----------------------------------------------------------------
K1QE01_CRAGI/16-61---C-----T--I--C----------------------------------------------------------------
A5DY58_LODEL/80-127---C-----P--I--C----------------------------------------------------------------
K0TA34_THAOC/42-81---C-----H--I--C----------------------------------------------------------------
A0A0E1S0L2_COCIM/323-358---C-----T--L--C----------------------------------------------------------------
K1QCU6_CRAGI/16-59---C-----S--M--C----------------------------------------------------------------
K1QJZ4_CRAGI/7-53---C-----A--I--C----------------------------------------------------------------
C3ZKR2_BRAFL/41-82---C-----P--I--C----------------------------------------------------------------
C4R4E3_PICPG/212-251---C-----P--I--S----------------------------------------------------------------
H0ZD31_TAEGU/7-53---C-----P--I--C----------------------------------------------------------------
A8XTA5_CAEBR/3-47---C-----K--I--C----------------------------------------------------------------
S8ADC7_DACHA/248-289---C-----P--I--T----------------------------------------------------------------
A0A0D2VU52_CAPO3/162-201---C-----P--I--T----------------------------------------------------------------
D8RT29_SELML/3-46---C-----P--V--C----------------------------------------------------------------
B9SAM1_RICCO/138-173---C-----N--I--C----------------------------------------------------------------
S8DX13_FOMPI/61-100---C-----P--I--C----------------------------------------------------------------
W4Y1J6_STRPU/11-49---C-----P--V--C----------------------------------------------------------------
G1P3G4_MYOLU/10-49---C-----P--V--C----------------------------------------------------------------
E3NLH7_CAERE/261-302---C-----K--I--C----------------------------------------------------------------
B4H0Q4_DROPE/25-67---C-----P--I--C----------------------------------------------------------------
F1N9Y8_CHICK/61-99---C-----S--I--C----------------------------------------------------------------
A7S8N9_NEMVE/27-71---C-----T--I--C----------------------------------------------------------------
G0N3Q9_CAEBE/6-48---C-----K--V--C----------------------------------------------------------------
K4BZ63_SOLLC/46-84---C-----S--I--C----------------------------------------------------------------
G4V7T9_SCHMA/36-76---C-----G--I--C----------------------------------------------------------------
S8EPB2_FOMPI/10-46---C-----D--V--C----------------------------------------------------------------
H2T1K1_TAKRU/12-53---C-----S--I--C----------------------------------------------------------------
A8XEF1_CAEBR/134-180---C-----M--I--C----------------------------------------------------------------
T1IPK5_STRMM/160-206---C-----P--V--C----------------------------------------------------------------
D8TYN7_VOLCA/202-229---R-----P--L--V----------------------------------------------------------------
G3N6A5_GASAC/15-55---C-----A--V--C----------------------------------------------------------------
C4LW51_ENTHI/88-126---C-----P--I--C----------------------------------------------------------------
J0CWR5_AURDE/10-52---C-----D--V--C----------------------------------------------------------------
H3CPP0_TETNG/18-57---C-----P--V--C----------------------------------------------------------------
G3WKM1_SARHA/16-52---C-----P--I--C----------------------------------------------------------------
E3N6R1_CAERE/139-180---C-----P--V--C----------------------------------------------------------------
F4PZ55_DICFS/507-542---C-----P--I--G----------------------------------------------------------------
I1EWH7_AMPQE/22-59---C-----S--V--C----------------------------------------------------------------
K7J0H9_NASVI/98-137---C-----P--I--C----------------------------------------------------------------
W5N297_LEPOC/11-49---C-----P--I--C----------------------------------------------------------------
I7LUI0_TETTS/226-264---C-----S--I--C----------------------------------------------------------------
C3ZGA7_BRAFL/18-55---C-----S--V--C----------------------------------------------------------------
G4NE79_MAGO7/671-707---C-----N--V--C----------------------------------------------------------------
Q231T2_TETTS/85-124---C-----S--I--C----------------------------------------------------------------
W5Q3S2_SHEEP/14-51---C-----P--I--C----------------------------------------------------------------
E3MMY9_CAERE/25-66---C-----E--I--C----------------------------------------------------------------
C3YPJ4_BRAFL/16-59---C-----S--V--C----------------------------------------------------------------
D6WLM7_TRICA/66-101---C-----P--M--C----------------------------------------------------------------
R7YHI3_CONA1/116-155---C-----P--I--C----------------------------------------------------------------
H0WKK6_OTOGA/16-54---C-----P--I--C----------------------------------------------------------------
I3JLY3_ORENI/20-56---C-----S--I--C----------------------------------------------------------------
W4WQC2_ATTCE/10-49---C-----A--I--C----------------------------------------------------------------
D2VJL1_NAEGR/382-417---C-----T--I--C----------------------------------------------------------------
I1FJM3_AMPQE/18-57---C-----G--I--C----------------------------------------------------------------
F6PP99_XENTR/15-56---C-----S--I--C----------------------------------------------------------------
F6TDF7_CIOIN/62-106---C-----P--K--C----------------------------------------------------------------
Q23DE8_TETTS/254-293---C-----P--I--C----------------------------------------------------------------
Q28DP5_XENTR/12-52---C-----S--I--C----------------------------------------------------------------
D8Q1Q7_SCHCM/3-43---C-----G--I--C----------------------------------------------------------------
E9GBM9_DAPPU/330-375---C-----P--I--L----------------------------------------------------------------
V2XQW9_MONRO/257-296---C-----P--L--T----------------------------------------------------------------
K1R3B6_CRAGI/30-89---C-----H--I--C----------------------------------------------------------------
G3RSL6_GORGO/51-99---C-----S--I--C----------------------------------------------------------------
W5KSC8_ASTMX/16-54---C-----P--V--C----------------------------------------------------------------
H3G1R5_PRIPA/39-77---C-----P--I--C----------------------------------------------------------------
D7LV06_ARALL/360-401---C-----Y--I--S----------------------------------------------------------------
G8BIU0_CANPC/49-93---C-----P--I--C----------------------------------------------------------------
A9VBL7_MONBE/312-352---C-----P--V--A----------------------------------------------------------------
H6C4C8_EXODN/771-813---C-----P--I--C----------------------------------------------------------------
G5AM83_HETGA/27-75---C-----P--A--C----------------------------------------------------------------
J4I996_FIBRA/727-777---C-----P--I--C----------------------------------------------------------------
W4YUR8_STRPU/14-53---C-----P--V--C----------------------------------------------------------------
D2W6L8_NAEGR/140-179---C-----N--I--C----------------------------------------------------------------
A8XYR8_CAEBR/161-204---C-----E--V--C----------------------------------------------------------------
M0YDD9_HORVD/149-184---C-----P--V--C----------------------------------------------------------------
G0MPF4_CAEBE/168-212---C-----Q--V--C----------------------------------------------------------------
E3LXX4_CAERE/25-65---C-----P--I--C----------------------------------------------------------------
H2W0A6_CAEJA/15-59---C-----L--I--C----------------------------------------------------------------
A2EQ53_TRIVA/191-228---C-----L--I--C----------------------------------------------------------------
I1G585_AMPQE/166-206---C-----P--I--T----------------------------------------------------------------
R0K4D0_ANAPL/8-54---C-----P--I--C----------------------------------------------------------------
A7S4W1_NEMVE/16-56---C-----L--L--C----------------------------------------------------------------
G0P807_CAEBE/23-75---C-----I--I--C----------------------------------------------------------------
M2LBA6_BAUCO/23-60---C-----Q--I--C----------------------------------------------------------------
W5NEU2_LEPOC/17-55---C-----P--V--C----------------------------------------------------------------
E7FES6_DANRE/13-53---C-----P--I--C----------------------------------------------------------------
A0D5N3_PARTE/19-54---C-----S--I--C----------------------------------------------------------------
H9GD26_ANOCA/16-61---C-----S--I--C----------------------------------------------------------------
M7UTJ4_BOTF1/255-289---C-----P--S--C----------------------------------------------------------------
G0NML6_CAEBE/27-70---C-----Q--I--C----------------------------------------------------------------
T1GWB5_MEGSC/39-81---C-----P--I--C----------------------------------------------------------------
E3MGC8_CAERE/19-62---C-----P--V--C----------------------------------------------------------------
H2UNP4_TAKRU/10-53---C-----P--I--C----------------------------------------------------------------
T1EKY6_HELRO/6-42---C-----P--I--C----------------------------------------------------------------
A7RP04_NEMVE/17-76---C-----G--V--C----------------------------------------------------------------
G0P1H8_CAEBE/97-141---C-----S--V--C----------------------------------------------------------------
C3XPM5_BRAFL/21-58---C-----S--I--C----------------------------------------------------------------
G0N3S4_CAEBE/130-172---C-----P--I--C----------------------------------------------------------------
M0SG32_MUSAM/228-264---C-----P--I--S----------------------------------------------------------------
H2LQL7_ORYLA/15-56---C-----P--I--C----------------------------------------------------------------
W5KNR6_ASTMX/267-307---C-----G--M--C----------------------------------------------------------------
A7SFU8_NEMVE/7-45---C-----P--V--C----------------------------------------------------------------
W4YX39_STRPU/17-57---C-----P--L--C----------------------------------------------------------------
W5M1Y5_LEPOC/13-53---C-----P--V--C----------------------------------------------------------------
A8XYQ1_CAEBR/115-156---C-----R--I--C----------------------------------------------------------------
K1QTR1_CRAGI/16-60---C-----P--I--C----------------------------------------------------------------
F6WIL5_MONDO/16-54---C-----P--I--C----------------------------------------------------------------
M4BF24_HYAAE/296-336---C-----P--I--C----------------------------------------------------------------
F7E0S6_ORNAN/13-51---C-----S--V--C----------------------------------------------------------------
L8WWQ4_THACA/165-203---C-----P--V--C----------------------------------------------------------------
H3F0Q7_PRIPA/60-101---C-----D--I--C----------------------------------------------------------------
E9GE44_DAPPU/15-55---C-----N--I--C----------------------------------------------------------------
E7QD38_YEASZ/230-271---C-----P--V--L----------------------------------------------------------------
H3AW60_LATCH/15-53---C-----P--I--C----------------------------------------------------------------
I1EYH9_AMPQE/14-55---C-----E--V--C----------------------------------------------------------------
E3LM12_CAERE/290-332---C-----Q--I--C----------------------------------------------------------------
A0C9I8_PARTE/106-147---C-----P--I--C----------------------------------------------------------------
A3KQE0_DANRE/11-50---C-----P--L--C----------------------------------------------------------------
K3WTC4_PYTUL/8-61---C-----E--L--C----------------------------------------------------------------
H9GRA4_ANOCA/20-72---C-----Q--I--C----------------------------------------------------------------
H2KYH9_CAEEL/6-48---C-----K--I--C----------------------------------------------------------------
E3MIX2_CAERE/1146-1188---C-----E--I--C----------------------------------------------------------------
H3ARK8_LATCH/31-69---C-----A--V--C----------------------------------------------------------------
K1Q9B6_CRAGI/675-717---C-----P--I--C----------------------------------------------------------------
H3B2S6_LATCH/22-61---C-----P--I--C----------------------------------------------------------------
E3NIP7_CAERE/74-116---C-----M--V--C----------------------------------------------------------------
W4Z1I9_STRPU/14-54---C-----S--I--C----------------------------------------------------------------
K1QBI4_CRAGI/866-912---C-----P--I--C----------------------------------------------------------------
F7CI92_XENTR/12-50---C-----P--L--C----------------------------------------------------------------
G0N3R0_CAEBE/6-48---C-----K--V--C----------------------------------------------------------------
G0NCQ3_CAEBE/156-195---C-----E--I--C----------------------------------------------------------------
W4YIM6_STRPU/29-67---C-----P--I--C----------------------------------------------------------------
B4I484_DROSE/276-313---C-----P--V--C----------------------------------------------------------------
B9S2U6_RICCO/6-48---C-----P--V--C----------------------------------------------------------------
H2MTV3_ORYLA/15-55---C-----P--V--C----------------------------------------------------------------
A0A068YFW4_ECHMU/435-478---C-----P--V--I----------------------------------------------------------------
C3ZGA6_BRAFL/18-55---C-----G--I--C----------------------------------------------------------------
I4YBZ0_WALSC/93-137---C-----S--I--C----------------------------------------------------------------
Q20369_CAEEL/199-240---C-----E--I--C----------------------------------------------------------------
A8XYQ0_CAEBR/165-206---C-----E--I--C----------------------------------------------------------------
A8XMM8_CAEBR/395-438---C-----E--I--C----------------------------------------------------------------
Q9N3T6_CAEEL/10-57---C-----P--V--C----------------------------------------------------------------
V8NXX1_OPHHA/10-54---C-----P--V--C----------------------------------------------------------------
V4ZAP5_TOXGO/3834-3876---C-----A--V--S----------------------------------------------------------------
N1PNP8_DOTSN/39-76---C-----T--I--C----------------------------------------------------------------
B7FZ09_PHATC/103-139---C-----H--I--C----------------------------------------------------------------
W5KC55_ASTMX/19-53---C-----S--I--C----------------------------------------------------------------
A0A068XST2_HYMMI/437-482---C-----P--V--E----------------------------------------------------------------
B2W2B2_PYRTR/29-69---C-----P--I--C----------------------------------------------------------------
A7RTP3_NEMVE/20-60---C-----P--V--C----------------------------------------------------------------
K1RLX1_CRAGI/17-58---C-----S--I--C----------------------------------------------------------------
W5MRG0_LEPOC/14-51---C-----S--V--C----------------------------------------------------------------
S8EG65_FOMPI/5-40---C-----S--I--C----------------------------------------------------------------
C3YMN9_BRAFL/10-49---C-----K--V--C----------------------------------------------------------------
W4XQL8_STRPU/208-263---C-----K--V--C----------------------------------------------------------------
G1PFP9_MYOLU/14-54---C-----P--L--C----------------------------------------------------------------
I3KEQ7_ORENI/15-56---C-----P--V--C----------------------------------------------------------------
K1QII5_CRAGI/9-51---C-----P--I--C----------------------------------------------------------------
W4XQY2_STRPU/19-63---C-----A--I--C----------------------------------------------------------------
S8E3I6_FOMPI/513-562---C-----P--V--C----------------------------------------------------------------
G0M6U5_CAEBE/114-166---C-----P--I--C----------------------------------------------------------------
D8TM91_VOLCA/21-62---C-----W--I--C----------------------------------------------------------------
U3KNP9_RABIT/59-97---C-----P--I--C----------------------------------------------------------------
T1JAV6_STRMM/20-64---C-----I--I--C----------------------------------------------------------------
F1R269_DANRE/16-62---C-----P--V--C----------------------------------------------------------------
G3WFD2_SARHA/31-73---C-----G--V--C----------------------------------------------------------------
E4X9B8_OIKDI/311-349---C-----P--V--C----------------------------------------------------------------
C3XSK7_BRAFL/16-53---C-----G--V--C----------------------------------------------------------------
C3Y7X3_BRAFL/19-56---C-----S--I--C----------------------------------------------------------------
K1R6M8_CRAGI/21-65---C-----P--I--C----------------------------------------------------------------
H0ZKG4_TAEGU/8-45---C-----P--V--C----------------------------------------------------------------
W5MD82_LEPOC/37-85---C-----A--V--C----------------------------------------------------------------
T1EIS8_HELRO/13-55---C-----L--I--C----------------------------------------------------------------
W4ZGM2_STRPU/900-940---C-----P--V--C----------------------------------------------------------------
I1EKI7_AMPQE/15-52---C-----S--V--C----------------------------------------------------------------
F6UD02_CIOIN/10-57---C-----P--I--C----------------------------------------------------------------
G0MWU0_CAEBE/260-305---C-----N--I--C----------------------------------------------------------------
A7S113_NEMVE/16-55---C-----S--L--C----------------------------------------------------------------
A7RK42_NEMVE/22-60---C-----P--I--C----------------------------------------------------------------
C3XZN4_BRAFL/10-62---C-----P--V--C----------------------------------------------------------------
D2VJJ0_NAEGR/335-378---C-----P--V--T----------------------------------------------------------------
G0PB02_CAEBE/137-180---C-----R--I--C----------------------------------------------------------------
K1VT53_TRIAC/33-71---C-----P--I--C----------------------------------------------------------------
Q22GU7_TETTS/11-54---C-----S--I--C----------------------------------------------------------------
G0PG13_CAEBE/6-49---C-----S--I--C----------------------------------------------------------------
W4XRM7_STRPU/11-51---C-----P--M--C----------------------------------------------------------------
T1F8U2_HELRO/22-67---C-----S--I--C----------------------------------------------------------------
E3MPV3_CAERE/3-46---C-----K--I--C----------------------------------------------------------------
Q57VJ2_TRYB2/65-103---C-----P--I--C----------------------------------------------------------------
F6YT78_XENTR/13-55---C-----P--V--C----------------------------------------------------------------
A8BHM8_GIAIC/616-652---C-----P--I--C----------------------------------------------------------------
A0A068XK70_HYMMI/11-46---C-----S--I--C----------------------------------------------------------------
E3LFV0_CAERE/299-341---C-----E--I--C----------------------------------------------------------------
I1FA65_AMPQE/60-100---C-----P--L--C----------------------------------------------------------------
G0MUL2_CAEBE/194-235---C-----E--I--C----------------------------------------------------------------
C3YDS0_BRAFL/16-53---C-----G--I--C----------------------------------------------------------------
C3Y5W8_BRAFL/16-54---C-----Q--I--C----------------------------------------------------------------
S8BCS0_PENO1/36-78---C-----P--I--C----------------------------------------------------------------
A0A068YFT4_ECHMU/14-54---C-----R--I--C----------------------------------------------------------------
H6BZK9_EXODN/769-804---C-----C--V--C----------------------------------------------------------------
D3BEB0_POLPA/176-214---C-----P--I--T----------------------------------------------------------------
E5A7L1_LEPMJ/55-97---C-----A--I--C----------------------------------------------------------------
G4VDE0_SCHMA/77-123---C-----K--I--C----------------------------------------------------------------
F4P0A7_BATDJ/205-245---C-----S--I--C----------------------------------------------------------------
E3MVZ4_CAERE/17-59---C-----N--V--C----------------------------------------------------------------
A0BVF4_PARTE/7-44---C-----S--I--C----------------------------------------------------------------
A0A068X361_HYMMI/45-80---C-----V--I--C----------------------------------------------------------------
A2F584_TRIVA/298-335---C-----I--I--C----------------------------------------------------------------
I3JWD3_ORENI/10-51---C-----S--I--C----------------------------------------------------------------
I1F5F6_AMPQE/18-60---C-----P--V--C----------------------------------------------------------------
A8Y1L9_CAEBR/19-71---C-----Q--V--C----------------------------------------------------------------
C3XXP0_BRAFL/16-53---C-----Q--I--C----------------------------------------------------------------
S3D0X6_GLAL2/203-245---C-----S--I--C----------------------------------------------------------------
Q17PC3_AEDAE/64-101---C-----T--I--C----------------------------------------------------------------
A0DLF5_PARTE/6-50---C-----P--Q--C----------------------------------------------------------------
B6AGJ6_CRYMR/252-290---C-----L--I--C----------------------------------------------------------------
W5JZH8_ASTMX/14-51---C-----P--V--C----------------------------------------------------------------
C3YMQ6_BRAFL/17-56---C-----Q--I--C----------------------------------------------------------------
W5NL94_LEPOC/15-55---C-----S--L--C----------------------------------------------------------------
A7SIN0_NEMVE/18-58---C-----A--L--C----------------------------------------------------------------
R7YV55_CONA1/41-81---C-----C--I--C----------------------------------------------------------------
C3Y2A3_BRAFL/17-57---C-----K--V--C----------------------------------------------------------------
W5LU92_ASTMX/102-146---C-----P--V--C----------------------------------------------------------------
J0WP15_AURDE/169-206---C-----E--I--C----------------------------------------------------------------
G0MUL8_CAEBE/134-181---C-----P--I--C----------------------------------------------------------------
Q6CGJ4_YARLI/332-374---C-----P--V--S----------------------------------------------------------------
C5LVJ3_PERM5/242-279---C-----S--I--C----------------------------------------------------------------
K5UXB5_PHACS/16-52---C-----P--I--C----------------------------------------------------------------
G0N7Z7_CAEBE/250-292---C-----G--I--C----------------------------------------------------------------
X1WBW4_DANRE/13-53---C-----P--V--C----------------------------------------------------------------
G8JNC7_ERECY/182-243---C-----P--I--S----------------------------------------------------------------
E5SBW1_TRISP/33-76---C-----T--V--C----------------------------------------------------------------
W5LZP8_LEPOC/16-56---C-----P--I--C----------------------------------------------------------------
W5NLA7_LEPOC/18-67---C-----P--V--C----------------------------------------------------------------
A7STB0_NEMVE/23-62---C-----P--V--C----------------------------------------------------------------
W4YJ36_STRPU/16-54---C-----Q--I--C----------------------------------------------------------------
G0P866_CAEBE/32-78---C-----S--I--C----------------------------------------------------------------
YGI4_SCHPO/107-147---C-----P--I--C----------------------------------------------------------------
H3C6F8_TETNG/16-52---C-----S--V--C----------------------------------------------------------------
W5KS92_ASTMX/13-53---C-----P--V--C----------------------------------------------------------------
G0N3R6_CAEBE/13-59---C-----K--V--C----------------------------------------------------------------
F4Q6G6_DICFS/57-93---C-----P--V--C----------------------------------------------------------------
C3XV33_BRAFL/55-99---C-----P--V--C----------------------------------------------------------------
A7S7Q5_NEMVE/7-67---C-----P--I--C----------------------------------------------------------------
W4XYF8_STRPU/14-54---C-----P--I--C----------------------------------------------------------------
M4AQ73_XIPMA/20-58---C-----P--I--C----------------------------------------------------------------
H2LNJ3_ORYLA/14-54---C-----P--L--C----------------------------------------------------------------
F8PKA0_SERL3/755-798---C-----P--V--C----------------------------------------------------------------
C4M901_ENTHI/65-100---C-----L--I--C----------------------------------------------------------------
C9SDW7_VERA1/257-303---C-----P--I--C----------------------------------------------------------------
K0TML9_THAOC/142-179---C-----S--I--C----------------------------------------------------------------
F4RNK4_MELLP/95-127---C-----N--I--C----------------------------------------------------------------
R4XL14_TAPDE/318-355---C-----P--V--T----------------------------------------------------------------
G0M7D3_CAEBE/125-166---C-----Q--I--C----------------------------------------------------------------
C3YDU6_BRAFL/10-56---C-----P--V--C----------------------------------------------------------------
N1PGE4_DOTSN/29-64---C-----P--V--C----------------------------------------------------------------
W5N2W9_LEPOC/16-51---C-----P--I--C----------------------------------------------------------------
I1GCQ6_AMPQE/15-59---C-----P--V--C----------------------------------------------------------------
C5FXX8_ARTOC/59-97---C-----G--V--C----------------------------------------------------------------
A0A023BAT6_GRENI/4-46---C-----P--I--C----------------------------------------------------------------
G3VAC4_SARHA/23-65---C-----P--I--C----------------------------------------------------------------
Q9VJB0_DROME/178-215---C-----P--V--C----------------------------------------------------------------
D8TKP2_VOLCA/9-45---C-----P--I--S----------------------------------------------------------------
W5NBG3_LEPOC/16-56---C-----S--I--C----------------------------------------------------------------
D2VQ69_NAEGR/372-411---C-----S--I--C----------------------------------------------------------------
C1DZC6_MICSR/25-65---C-----P--I--C----------------------------------------------------------------
B4IY65_DROGR/1051-1092---C-----P--I--C----------------------------------------------------------------
C3YEX1_BRAFL/16-53---C-----K--V--C----------------------------------------------------------------
C5DQY2_ZYGRC/118-159---C-----P--I--C----------------------------------------------------------------
E9GNY7_DAPPU/15-56---C-----G--I--C----------------------------------------------------------------
F2ULB9_SALR5/405-444---C-----G--I--C----------------------------------------------------------------
G4TAL9_PIRID/10-51---C-----D--V--C----------------------------------------------------------------
I1F754_AMPQE/13-54---C-----A--V--C----------------------------------------------------------------
H2U3Q0_TAKRU/20-60---C-----P--I--C----------------------------------------------------------------
P91131_CAEEL/88-129---C-----E--I--C----------------------------------------------------------------
K0RCJ2_THAOC/101-145---C-----G--I--C----------------------------------------------------------------
H1V5X9_COLHI/439-482---C-----P--I--C----------------------------------------------------------------
M2QRU5_CERS8/496-540---C-----P--I--C----------------------------------------------------------------
G0N810_CAEBE/264-307---C-----K--I--C----------------------------------------------------------------
K1QPR4_CRAGI/15-59---C-----T--I--C----------------------------------------------------------------
H3DU94_PRIPA/23-64---C-----P--V--C----------------------------------------------------------------
F6T524_HORSE/66-107---C-----P--I--C----------------------------------------------------------------
A2EG51_TRIVA/44-82---C-----K--K--C----------------------------------------------------------------
F4PX82_DICFS/315-350---C-----P--I--C----------------------------------------------------------------
X6LMB4_RETFI/210-252---C-----P--I--C----------------------------------------------------------------
A7SY92_NEMVE/3-38---C-----P--V--C----------------------------------------------------------------
Q1RLI9_CIOIN/45-83---C-----Q--I--C----------------------------------------------------------------
F2TYA1_SALR5/90-128---C-----A--I--C----------------------------------------------------------------
S7ZPY1_PENO1/118-155---C-----P--V--C----------------------------------------------------------------
Q0UAN7_PHANO/238-296---C-----P--I--C----------------------------------------------------------------
Q6CVX5_KLULA/30-71---C-----T--I--C----------------------------------------------------------------
K7J0B5_NASVI/71-109---C-----P--V--C----------------------------------------------------------------
G0SZW5_RHOG2/209-242---C-----A--I--C----------------------------------------------------------------
E5SA13_TRISP/76-113---C-----P--L--C----------------------------------------------------------------
F7ED51_ORNAN/35-79---C-----K--I--C----------------------------------------------------------------
H9GCM8_ANOCA/17-55---C-----P--I--C----------------------------------------------------------------
Q9U5C2_CAEEL/6-48---C-----E--I--C----------------------------------------------------------------
J9JWZ8_ACYPI/311-350---C-----P--I--L----------------------------------------------------------------
G1KU39_ANOCA/13-61---C-----P--V--C----------------------------------------------------------------
Q5KI05_CRYNJ/338-379---C-----P--V--S----------------------------------------------------------------
K0RDY0_THAOC/79-121---C-----S--I--C----------------------------------------------------------------
K4DBT6_SOLLC/270-308---C-----V--I--C----------------------------------------------------------------
YT44_CAEEL/154-196---C-----F--I--C----------------------------------------------------------------
A4F321_CAEEL/26-71---C-----S--I--C----------------------------------------------------------------
A8PKF8_BRUMA/28-67---C-----S--I--C----------------------------------------------------------------
X6MFQ8_RETFI/114-158---C-----C--I--C----------------------------------------------------------------
F1QS36_DANRE/13-51---C-----T--I--C----------------------------------------------------------------
V8NQZ9_OPHHA/88-126---C-----S--I--C----------------------------------------------------------------
H3B217_LATCH/15-53---C-----S--I--C----------------------------------------------------------------
I1F696_AMPQE/16-54---C-----P--L--C----------------------------------------------------------------
I1CGZ9_RHIO9/5-48---C-----T--I--C----------------------------------------------------------------
H2WLU7_CAEJA/109-151---C-----E--I--C----------------------------------------------------------------
G0N7Y6_CAEBE/122-163---C-----Q--V--C----------------------------------------------------------------
E3NG77_CAERE/222-264---C-----E--I--C----------------------------------------------------------------
D7LWT3_ARALL/58-101---C-----S--I--C----------------------------------------------------------------
H2MQ22_ORYLA/17-54---C-----P--I--C----------------------------------------------------------------
U3J553_ANAPL/11-46---C-----T--I--C----------------------------------------------------------------
A5PMH5_DANRE/56-100---C-----I--V--C----------------------------------------------------------------
C3YT46_BRAFL/18-55---C-----S--I--C----------------------------------------------------------------
Q293B6_DROPS/31-70---C-----A--F--C----------------------------------------------------------------
W4XMW3_STRPU/18-54---C-----P--I--C----------------------------------------------------------------
N1QDJ8_SPHMS/49-94---C-----P--I--C----------------------------------------------------------------
U3K2J3_FICAL/20-61---C-----P--I--C----------------------------------------------------------------
T1IJA1_STRMM/108-146---S-----E--H--T----------------------------------------------------------------
M0Z6Q8_HORVD/16-62---C-----P--I--C----------------------------------------------------------------
A0A087W136_ECHMU/5-41---C-----P--I--C----------------------------------------------------------------
Q8IID0_PLAF7/225-260---C-----A--I--C----------------------------------------------------------------
W1QF39_OGAPD/28-63---C-----T--I--C----------------------------------------------------------------
H3BGJ6_LATCH/17-64---C-----S--I--C----------------------------------------------------------------
B3RRI7_TRIAD/193-231---C-----P--I--C----------------------------------------------------------------
A0A068YES4_ECHMU/57-106---C-----P--I--D----------------------------------------------------------------
C5L2J7_PERM5/9-53---C-----T--I--C----------------------------------------------------------------
A7ARX2_BABBO/898-940---C-----P--I--S----------------------------------------------------------------
E5A7J3_LEPMJ/25-68---C-----A--I--C----------------------------------------------------------------
L8G0G4_PSED2/232-267---C-----Q--I--C----------------------------------------------------------------
I1FK14_AMPQE/48-88---C-----A--V--C----------------------------------------------------------------
E7F7E4_DANRE/11-49---C-----P--V--C----------------------------------------------------------------
G1P2E7_MYOLU/21-58---C-----A--V--C----------------------------------------------------------------
C3ZG71_BRAFL/39-82---C-----N--I--C----------------------------------------------------------------
K1R320_CRAGI/11-50---C-----S--I--C----------------------------------------------------------------
W4Z0J1_STRPU/19-65---C-----T--I--C----------------------------------------------------------------
H3F9C8_PRIPA/114-157---C-----P--I--L----------------------------------------------------------------
K7IU46_NASVI/67-110---C-----T--I--C----------------------------------------------------------------
G0PAY7_CAEBE/123-163---C-----N--V--C----------------------------------------------------------------
W4Z726_STRPU/15-55---C-----P--I--C----------------------------------------------------------------
A7STH6_NEMVE/14-54---C-----S--I--C----------------------------------------------------------------
W4Y9I9_STRPU/19-59---C-----P--V--C----------------------------------------------------------------
H0EQA8_GLAL7/21-62---C-----P--I--C----------------------------------------------------------------
G0PDI7_CAEBE/62-107---C-----K--I--C----------------------------------------------------------------
C3ZJI4_BRAFL/16-53---C-----G--I--C----------------------------------------------------------------
Q59RB2_CANAL/510-558---C-----P--V--S----------------------------------------------------------------
F7DSK6_XENTR/5-44---C-----S--V--C----------------------------------------------------------------
W4YM48_STRPU/14-56---C-----P--I--C----------------------------------------------------------------
K0RTA4_THAOC/18-58---C-----G--I--C----------------------------------------------------------------
K1RB60_CRAGI/157-200---C-----P--I--C----------------------------------------------------------------
D8UJ60_VOLCA/183-225---C-----P--V--C----------------------------------------------------------------
B6JYH5_SCHJY/321-362---C-----P--V--S----------------------------------------------------------------
F6V897_XENTR/12-53---C-----S--I--C----------------------------------------------------------------
E3MGW9_CAERE/21-63---C-----P--I--C----------------------------------------------------------------
Q8SVE9_ENCCU/7-49---C-----P--I--C----------------------------------------------------------------
C3YJB4_BRAFL/19-58---C-----T--V--C----------------------------------------------------------------
H0XR22_OTOGA/11-50---C-----R--V--C----------------------------------------------------------------
W1NUC9_AMBTC/16-51---C-----P--I--C----------------------------------------------------------------
I3KZ62_ORENI/19-54---C-----T--V--C----------------------------------------------------------------
H3F6B6_PRIPA/94-133---C-----P--I--C----------------------------------------------------------------
I7MEF6_TETTS/24-64---C-----P--I--C----------------------------------------------------------------
A9SDU8_PHYPA/224-262---C-----P--I--C----------------------------------------------------------------
B2AXP0_PODAN/48-85---C-----P--I--C----------------------------------------------------------------
T1EKZ0_HELRO/2-40---C-----V--I--C----------------------------------------------------------------
T1FXD0_HELRO/23-58---C-----S--I--C----------------------------------------------------------------
M4AAW1_XIPMA/23-63---C-----P--V--C----------------------------------------------------------------
F6UI49_MONDO/16-53---C-----T--I--C----------------------------------------------------------------
H9G3J3_ANOCA/17-55---C-----P--V--C----------------------------------------------------------------
B7PDB4_IXOSC/176-217---C-----T--I--C----------------------------------------------------------------
K1R7E6_CRAGI/85-143---C-----L--I--C----------------------------------------------------------------
C4V8Q4_NOSCE/35-71---C-----L--I--C----------------------------------------------------------------
F4RFV8_MELLP/132-191---C-----P--L--C----------------------------------------------------------------
O16616_CAEEL/6-49---C-----E--I--C----------------------------------------------------------------
D3B5I5_POLPA/145-185---C-----P--I--C----------------------------------------------------------------
H3B8D8_LATCH/17-57---C-----P--L--C----------------------------------------------------------------
E0VVI1_PEDHC/29-78---C-----Q--I--C----------------------------------------------------------------
G4NJG4_MAGO7/959-1004---C-----P--I--C----------------------------------------------------------------
Q0UGJ5_PHANO/24-66---C-----S--I--C----------------------------------------------------------------
A7S9R7_NEMVE/68-107---C-----S--V--C----------------------------------------------------------------
C3YDX6_BRAFL/10-57---C-----P--V--C----------------------------------------------------------------
J9KA33_ACYPI/134-169---C-----N--V--C----------------------------------------------------------------
G0N7H0_CAEBE/98-142---C-----T--I--C----------------------------------------------------------------
D7L5T1_ARALL/198-235---C-----S--A--C----------------------------------------------------------------
H2VQ39_CAEJA/121-162---C-----Q--I--C----------------------------------------------------------------
I1GEZ3_AMPQE/33-73---C-----P--I--C----------------------------------------------------------------
B0CTH0_LACBS/4-38---C-----N--I--C----------------------------------------------------------------
H2M0J4_ORYLA/30-69---C-----P--V--C----------------------------------------------------------------
G0N825_CAEBE/249-293---C-----E--V--C----------------------------------------------------------------
C8VRE2_EMENI/104-152---C-----P--V--C----------------------------------------------------------------
E3MSH8_CAERE/60-98---C-----P--L--C----------------------------------------------------------------
A7SVR6_NEMVE/25-65---C-----P--I--C----------------------------------------------------------------
A4IG09_DANRE/8-48---C-----Y--L--C----------------------------------------------------------------
E3MMX8_CAERE/120-161---C-----E--V--C----------------------------------------------------------------
E4XGE3_OIKDI/6-45---C-----P--I--C----------------------------------------------------------------
C3YDN2_BRAFL/17-56---C-----P--I--C----------------------------------------------------------------
F4RAV6_MELLP/41-77---C-----S--I--C----------------------------------------------------------------
C3ZYG5_BRAFL/17-52---C-----P--V--C----------------------------------------------------------------
T1G136_HELRO/50-88---C-----P--I--C----------------------------------------------------------------
V6DHC5_9DELT/188-230---C-----P--I--C----------------------------------------------------------------
H2SKQ3_TAKRU/30-70---C-----A--I--C----------------------------------------------------------------
H2WLV3_CAEJA/141-184---C-----E--I--C----------------------------------------------------------------
H3AYG0_LATCH/8-46---C-----S--I--C----------------------------------------------------------------
W4YM36_STRPU/18-59---C-----A--I--C----------------------------------------------------------------
C5KHW7_PERM5/170-210---C-----A--V--C----------------------------------------------------------------
C1N5X1_MICPC/233-279---C-----A--V--C----------------------------------------------------------------
A0A0C4DRB5_MAGP6/901-954---C-----P--I--C----------------------------------------------------------------
H0YAI5_HUMAN/48-90---C-----P--I--C----------------------------------------------------------------
E3MDV5_CAERE/131-173---C-----G--I--C----------------------------------------------------------------
K5X1A7_PHACS/917-967---C-----P--V--C----------------------------------------------------------------
H0W448_CAVPO/13-51---C-----C--I--C----------------------------------------------------------------
C3Y9M5_BRAFL/16-56---C-----Q--I--C----------------------------------------------------------------
E4WQ42_OIKDI/268-311---C-----S--L--C----------------------------------------------------------------
W4Y0G5_STRPU/15-56---C-----S--I--C----------------------------------------------------------------
A8XQX2_CAEBR/48-96---C-----A--V--C----------------------------------------------------------------

PF13923

L5KXI3_PTEAL/50-90--MC-----P--I--C----------------------------------------------------------------
V8P853_OPHHA/702-741--KC-----T--I--C----------------------------------------------------------------
F4WIJ4_ACREC/356-389--MC-----P--V--C----------------------------------------------------------------
M9LX19_PSEA3/698-736--EC-----Q--L--C----------------------------------------------------------------
H0Y340_HUMAN/40-78--VC-----P--I--C----------------------------------------------------------------
L9KQ74_TUPCH/255-295--YC-----P--V--C----------------------------------------------------------------
RNG1L_ARATH/215-256--QC-----A--V--C----------------------------------------------------------------
RN220_HUMAN/513-552--KC-----L--I--C----------------------------------------------------------------
S9X0A4_SCHCR/176-214--EC-----Q--I--C----------------------------------------------------------------
RAD18_KLULA/31-69--RC-----H--I--C----------------------------------------------------------------

PF00097

PML_HUMAN/57-91---C-----Q--Q--C----------------------------------------------------------------
H2Q4Y2_PANTR/381-419---C-----K--I--C----------------------------------------------------------------
413R_IIV6/148-195---C-----I--I--C----------------------------------------------------------------
A33_PLEWA/163-202---C-----P--L--C----------------------------------------------------------------
RING1_HUMAN/48-87---C-----P--I--C----------------------------------------------------------------
BRE1_CAEEL/785-823---C-----P--S--C----------------------------------------------------------------
D0Z760_DROME/263-301---C-----H--L--C----------------------------------------------------------------
GOLI_DROME/303-343---C-----A--I--C----------------------------------------------------------------
F7DCK3_MACMU/16-56---C-----P--V--C----------------------------------------------------------------
NHL1_CAEEL/43-83---C-----P--I--C----------------------------------------------------------------
F6T905_MACMU/18-56---C-----V--L--C----------------------------------------------------------------
E1JH51_DROME/35-73---C-----R--L--C----------------------------------------------------------------
BRCA1_HUMAN/24-64---C-----P--I--C----------------------------------------------------------------
H2Q2Y1_PANTR/16-54---C-----P--I--C----------------------------------------------------------------
TR30A_MOUSE/15-58---C-----P--I--C----------------------------------------------------------------
RAD18_YEAST/28-65---C-----H--I--C----------------------------------------------------------------
YNN1_CAEEL/8-45---C-----A--V--C----------------------------------------------------------------
RAG1_CHICK/289-327---C-----Q--I--C----------------------------------------------------------------
G2W9C0_YEASK/537-580---C-----Q--L--C----------------------------------------------------------------
H0GK06_SACCK/914-960---C-----S--I--C----------------------------------------------------------------
PEX2_CRIGR/243-282---C-----A--L--C----------------------------------------------------------------
ESAG8_TRYBB/10-45---C-----A--V--C----------------------------------------------------------------
G8HBH2_HHV1/116-156---C-----A--V--C----------------------------------------------------------------
ICP0_BHV1J/13-51---C-----C--I--C----------------------------------------------------------------
ICP0_EHV1B/8-46---C-----P--I--C----------------------------------------------------------------
ICP0_SUHVF/46-84---C-----P--I--C----------------------------------------------------------------
IE61_VZVD/19-57---C-----T--I--C----------------------------------------------------------------
PE38_NPVAC/86-138---C-----S--V--C----------------------------------------------------------------
PE38_NPVOP/39-91---C-----A--V--C----------------------------------------------------------------
A0A023ZC77_YEASX/206-249---C-----P--I--C----------------------------------------------------------------
TRAF2_MOUSE/34-72---C-----S--A--C----------------------------------------------------------------
RAD5_SCHPO/877-922---C-----P--I--C----------------------------------------------------------------
A0A023ZDG1_YEASX/179-223---C-----I--I--C----------------------------------------------------------------
VCG3_NPVAC/8-62---C-----N--I--C----------------------------------------------------------------
VIE2_NPVOP/207-254---C-----H--I--C----------------------------------------------------------------

PF14634

E1C7D9_CHICK/6-48--FC-----N..S--C----------------------------------------------------------------
E1FZW0_LOALO/6-50--HC-----N..V--C----------------------------------------------------------------
E9GEC8_DAPPU/12-57--TC-----G..V--C----------------------------------------------------------------
Q4QGD1_LEIMA/6-46--IC-----V..V--C----------------------------------------------------------------
B0CSV8_LACBS/15-58--AC-----A..K--C----------------------------------------------------------------
C4LXP1_ENTHI/207-247--KC-----K..K--C----------------------------------------------------------------
B6IIE6_CAEBR/17-60--HC-----N..E--C----------------------------------------------------------------
A8XMJ0_CAEBR/116-156--DC-----S..I--C----------------------------------------------------------------
F2U6V3_SALR5/10-49--LC-----N..H--C----------------------------------------------------------------
Q6FWV3_CANGA/12-51--HY-----G..V--C----------------------------------------------------------------
A8XFZ9_CAEBR/5-45--QC-----N..N--C----------------------------------------------------------------
Q9U3L0_CAEEL/5-45--QC-----N..H--C----------------------------------------------------------------
Q8MYP1_CAEEL/5-51--HC-----F..R--C----------------------------------------------------------------
A8XFY8_CAEBR/5-44--HC-----N..H--C----------------------------------------------------------------
Q16ES6_AEDAE/8-51--HC-----N..I--C----------------------------------------------------------------
E4XQK4_OIKDI/224-267--SC-----K..V--C----------------------------------------------------------------
B5DY13_DROPS/25-73--RC-----P..K--C----------------------------------------------------------------
A1CTV8_ASPCL/49-97--RC-----NALK--C----------------------------------------------------------------
B3MST8_DROAN/9-53--HC-----N..K--C----------------------------------------------------------------
E7F2P1_DANRE/6-47--CC-----N..A--C----------------------------------------------------------------
B4GYG5_DROPE/27-77--HC-----N..R--C----------------------------------------------------------------
C7Z911_NECH7/207-256--IC-----NNLQ--C----------------------------------------------------------------
Q55DW8_DICDI/7-51--HC-----N..S--C----------------------------------------------------------------
E3MCJ8_CAERE/17-68--EC-----N..K--C----------------------------------------------------------------
B4NUQ8_DROSI/5-49--HC-----N..K--C----------------------------------------------------------------
A8WJ97_CAEBR/8-50--EC-----I..I--C----------------------------------------------------------------
E3NG56_CAERE/267-315--KC-----N..I--C----------------------------------------------------------------
B3MUY6_DROAN/5-49--HC-----N..K--C----------------------------------------------------------------
C5FK34_ARTOC/10-58--RC-----NNLS--C----------------------------------------------------------------
F1A3H2_DICPU/5-56--EC-----K..I--C----------------------------------------------------------------
B0CWP3_LACBS/5-50--FC-----S..V--C----------------------------------------------------------------
E3MBM8_CAERE/6-48--FC-----L..K--C----------------------------------------------------------------
B6HJ02_PENCW/608-658--NC-----P..R--C----------------------------------------------------------------
RN212_HUMAN/6-47--FC-----N..R--C----------------------------------------------------------------
B4JEQ5_DROGR/5-48--HC-----N..K--C----------------------------------------------------------------
Q6CWK7_KLULA/13-58--NC-----S..Q--C----------------------------------------------------------------
Y4613_DICDI/8-64--EC-----S..I--C----------------------------------------------------------------
C3ZHE7_BRAFL/303-344--KC-----Q..V--C----------------------------------------------------------------
Q5TWF6_ANOGA/8-51--HC-----N..I--C----------------------------------------------------------------
B4G2B4_DROPE/5-49--HC-----N..K--C----------------------------------------------------------------
E9G342_DAPPU/16-63--KC-----NVSA--C----------------------------------------------------------------
Y121_OSHVF/52-106--VC-----V..I--C----------------------------------------------------------------
P90905_CAEEL/5-44--HC-----N..K--C----------------------------------------------------------------
A4RWU3_OSTLU/1786-1830--KC-----E..A--C----------------------------------------------------------------
E0VQH4_PEDHC/5-47--HC-----N..N--C----------------------------------------------------------------
B6ILY2_CAEBR/8-50--FC-----V..K--C----------------------------------------------------------------
D8LDC0_ECTSI/14-64--RC-----N..M--C----------------------------------------------------------------
E3LVG7_CAERE/5-45--VC-----N..K--C----------------------------------------------------------------
E0VJY0_PEDHC/20-59--KC-----Q..K--C----------------------------------------------------------------
E1ZX87_CAMFO/5-46--IC-----N..K--C----------------------------------------------------------------
F0VKM3_NEOCL/116-156--FC-----P..I--C----------------------------------------------------------------
E1ZVC6_CAMFO/5-46--IC-----N..K--C----------------------------------------------------------------
C3ZRQ6_BRAFL/6-49--IC-----NFKK--C----------------------------------------------------------------
C0NRS3_AJECG/10-58--RC-----NSLK--C----------------------------------------------------------------
E3MKE8_CAERE/9-49--RC-----P..T--C----------------------------------------------------------------
B3MWG3_DROAN/9-59--HC-----N..R--C----------------------------------------------------------------
E7A0E3_SPORE/17-84--HC-----S..V--C----------------------------------------------------------------
B4MS95_DROWI/5-47--HC-----N..K--C----------------------------------------------------------------
E3M3L5_CAERE/7-49--DC-----G..I--C----------------------------------------------------------------
B4NE87_DROWI/45-107--HC-----N..N--C----------------------------------------------------------------
F0ZEE6_DICPU/7-49--YC-----N..F--C----------------------------------------------------------------
A8NYK0_COPC7/174-219--EC-----P..V--C----------------------------------------------------------------
B0WY05_CULQU/8-51--HC-----N..H--C----------------------------------------------------------------
C5L4C0_PERM5/179-224--PC-----R..K--C----------------------------------------------------------------
E9CYQ8_COCPS/10-58--RC-----NSLQ--C----------------------------------------------------------------
E9GED0_DAPPU/15-62--NC-----G..V--C----------------------------------------------------------------
A2DG01_TRIVA/10-55--RC-----N..S--C----------------------------------------------------------------
B4K9R1_DROMO/5-50--HC-----N..R--C----------------------------------------------------------------
A8BW81_GIAIC/271-327--SC-----P..K--C----------------------------------------------------------------
E9II61_SOLIN/7-48--IC-----N..K--C----------------------------------------------------------------
D2VGX0_NAEGR/14-66--KC-----L..S--C----------------------------------------------------------------
D8MAK7_BLAHO/6-49--HC-----N..I--C----------------------------------------------------------------
Q8IMM9_DROME/5-49--HC-----N..K--C----------------------------------------------------------------
Q16T22_AEDAE/9-56--VC-----NARD--C----------------------------------------------------------------
A8PV49_BRUMA/15-64--MC-----N..V--C----------------------------------------------------------------
C3YFB0_BRAFL/6-47--HC-----N..L--C----------------------------------------------------------------
E3NG58_CAERE/270-317--TC-----Q..I--C----------------------------------------------------------------
D3B891_POLPA/3-46--HC-----N..S--C----------------------------------------------------------------
D8QBA2_SCHCM/9-50--TC-----T..L--C----------------------------------------------------------------
D6WWZ3_TRICA/13-55--SC-----P..V--C----------------------------------------------------------------
Q4W4Z4_CAEEL/5-47--EC-----S..I--C----------------------------------------------------------------
E3NQU5_CAERE/8-49--LC-----L..K--C----------------------------------------------------------------
E4WWU4_OIKDI/70-127--RC-----S..V--C----------------------------------------------------------------
H3D646_TETNG/10-52--.C-----NFPK--C----------------------------------------------------------------
TIF1B_RAT/66-124--HC-----G..V--C----------------------------------------------------------------
O76908_DROME/20-70--HC-----N..S--C----------------------------------------------------------------
RNF37_MOUSE/483-527--SC-----K..Q--A----------------------------------------------------------------
Q9VV48_DROME/13-53--NC-----P..I--C----------------------------------------------------------------
U1M783_ASCSU/6-47--HC-----N..V--C----------------------------------------------------------------
U1M983_ASCSU/6-49--HC-----N..V--C----------------------------------------------------------------

PF11789

NSE2_SCHPO/166-220DNRC-----P--L--T----------------------------------------------------------------
Q4WN41_ASPFU/329-400SLRC-----P--L--T----------------------------------------------------------------
Q6BTN3_DEBHA/217-271SLKD-----P--L--S----------------------------------------------------------------
Q0CK87_ASPTN/846-915SLKC-----P--L--T----------------------------------------------------------------
A7URE5_ANOGA/120-176NMVD-----P--I--S----------------------------------------------------------------
Q6FJV5_CANGA/174-230ELNC-----P--I--T----------------------------------------------------------------
Q4UH75_THEAN/120-184SDQC-----P--I--S----------------------------------------------------------------
Q4X4I4_PLACH/87-151PTKC-----P--I--S----------------------------------------------------------------
A6R9Q0_AJECN/331-406SLCC-----P--I--T----------------------------------------------------------------
Q17L84_AEDAE/118-173DM.D-----P--I--T----------------------------------------------------------------
NSE2_HUMAN/156-216NFTC-----P--I--T----------------------------------------------------------------
A2QVT0_ASPNC/323-396SLKC-----P--L--T----------------------------------------------------------------
NSE2_YEAST/171-227ELTC-----P--I--T----------------------------------------------------------------
Q7RZA1_NEUCR/281-336DLTC-----K--L--T----------------------------------------------------------------
Q0U6V6_PHANO/293-363SIRC-----P--L--T----------------------------------------------------------------
Q757R5_ASHGO/117-172ELTC-----P--I--T----------------------------------------------------------------
Q2GS77_CHAGB/246-301DLKC-----P--L--S----------------------------------------------------------------
Q5A2Z8_CANAL/182-236SLKD-----P--L--T----------------------------------------------------------------
C8VKT8_EMENI/321-393SLRC-----P--L--T----------------------------------------------------------------
H3DP52_TETNG/148-208NLTC-----P--L--T----------------------------------------------------------------

PF14835

F1SSQ2_PIG/39-103LLRC-----S--R--C----------------------------------------------------------------

PF02891

Q6BIU5_DEBHA/323-372SLKC-----P--L--T----------------------------------------------------------------
Q7QJ47_ANOGA/609-658SLKC-----T--L--T----------------------------------------------------------------
A0A0D1C349_USTMA/363-412SLKC-----P--F--S----------------------------------------------------------------
Q2U9J1_ASPOR/299-348SLKC-----P--L--S----------------------------------------------------------------
Q6FLD3_CANGA/338-387SLQC-----P--I--S----------------------------------------------------------------
Q6CY92_KLULA/302-351SLQC-----P--I--S----------------------------------------------------------------
SIZ1_YEAST/357-406SLQC-----P--I--S----------------------------------------------------------------
SIZ2_YEAST/334-383SLQC-----P--I--S----------------------------------------------------------------
Q6FUK3_CANGA/339-388SLKC-----P--I--S----------------------------------------------------------------
PLI1_SCHPO/301-350SLKC-----P--L--S----------------------------------------------------------------
Q6C4V7_YARLI/350-399KLKC-----P--I--S----------------------------------------------------------------
Q7KNF5_DROME/321-370SLNC-----P--L--G----------------------------------------------------------------
Q5VRS8_ORYSJ/318-367SLKC-----P--I--S----------------------------------------------------------------
Q7JR52_DROME/714-763SLKC-----P--I--T----------------------------------------------------------------
Q54UZ6_DICDI/63-112SSIC-----P--L--T----------------------------------------------------------------
Q6BFZ0_PARTE/785-836SLVC-----Q--Y--S----------------------------------------------------------------
Q555X5_DICDI/473-522TVRC-----P--L--S----------------------------------------------------------------
Q54V57_DICDI/820-869TVRC-----I--L--K----------------------------------------------------------------
SIZ1_ARATH/359-408NLRC-----P--M--S----------------------------------------------------------------
Q4D897_TRYCC/311-360TLRC-----P--L--S----------------------------------------------------------------
Q38DR7_TRYB2/457-506TTKC-----P--I--S----------------------------------------------------------------
Q4E4T0_TRYCC/410-459TSKC-----P--I--L----------------------------------------------------------------
E9AFM2_LEIMA/500-549TTKC-----P--I--S----------------------------------------------------------------
Q586F5_TRYB2/424-473RAVC-----P--I--T----------------------------------------------------------------
Q4CSC6_TRYCC/405-454KINC-----P--I--T----------------------------------------------------------------
Q4Q6T7_LEIMA/259-308KIQC-----P--I--T----------------------------------------------------------------
Q4XYF2_PLACH/379-432SLNC-----P--F--S----------------------------------------------------------------
Q4N5M9_THEPA/234-287DLTC-----P--V--T----------------------------------------------------------------
F6W032_CIOIN/264-312SLRC-----P--L--G----------------------------------------------------------------
F8W4G0_DANRE/271-319SLIC-----P--L--V----------------------------------------------------------------
I3IVZ2_ORENI/628-676SLKC-----P--I--T----------------------------------------------------------------
U9W851_NEUCR/331-379SLKC-----P--L--S----------------------------------------------------------------

PF17122

M3HI18_CANMX/927-962---C-----N--N--C----------------------------------------------------------------
B6JYV2_SCHJY/783-817---C-----D--I--C----------------------------------------------------------------
PEP5L_SCHPO/780-814---C-----D--N--C----------------------------------------------------------------

PF17121

G2Q0I8_THIHA/15-65EDMC-----P--V--C----------------------------------------------------------------
B6QL88_PENMQ/14-64DEVC-----P--I--C----------------------------------------------------------------
E9F746_METRA/26-76DETC-----P--V--C----------------------------------------------------------------
G4UBK5_NEUT9/12-62DEMC-----P--V--C----------------------------------------------------------------
L8FV55_PSED2/16-66DDIC-----P--V--C----------------------------------------------------------------
TFB3_SCHPO/10-60DEKC-----P--L--C----------------------------------------------------------------
N1QL18_SPHMS/21-71DDIC-----P--V--C----------------------------------------------------------------

PF16685

B5DR75_DROPS/43-115-LSC-----V--V--C----------------------------------------------------------------
E2ACB4_CAMFO/91-160-LSC-----T--V--C----------------------------------------------------------------
B4MTK1_DROWI/41-113-VAC-----V--V--C----------------------------------------------------------------
G1QUV9_NOMLE/42-111-LSC-----C--V--C----------------------------------------------------------------
B0WV25_CULQU/55-124-LSC-----A--V--C----------------------------------------------------------------
M4A435_XIPMA/42-111-LAC-----L--V--C----------------------------------------------------------------
H2MDG1_ORYLA/42-111-LSC-----L--V--C----------------------------------------------------------------
D6W8B3_TRICA/39-108-LCC-----V--V--C----------------------------------------------------------------
B4KJL9_DROMO/40-112-LSC-----A--V--C----------------------------------------------------------------
E9HFH7_DAPPU/39-107-LSC-----T--V--C----------------------------------------------------------------
A7USF8_ANOGA/37-106-LSC-----A--V--C----------------------------------------------------------------
A5JPL8_BOMMO/39-108-LSC-----T--V--C----------------------------------------------------------------
B0V0X0_DANRE/42-111-LSC-----L--V--C----------------------------------------------------------------
B7QLX1_IXOSC/39-108-LLC-----S--V--C----------------------------------------------------------------
B4JBU9_DROGR/40-112-LSC-----V--V--C----------------------------------------------------------------
B4G866_DROPE/40-112-LSC-----V--V--C----------------------------------------------------------------
B4N486_DROWI/41-113-LSC-----V--V--C----------------------------------------------------------------

PF04564

UFD2_YEAST/881-953EFLD-----P--L--M----------------------------------------------------------------
PUB3_ARATH/238-310YFRC-----P--L--S----------------------------------------------------------------
Q9U4F8_DROME/915-987EYLD-----P--I--I----------------------------------------------------------------
UBE4A_HUMAN/988-1060EFLD-----P--I--M----------------------------------------------------------------
UBE4_CAEEL/906-977EFKD-----P--I--M----------------------------------------------------------------
WSDU1_MOUSE/402-474EFIC-----P--I--T----------------------------------------------------------------
UFD2_SCHPO/931-1003YFLD-----P--L--M----------------------------------------------------------------
Q9XYW6_DROME/213-285FLCG-----K--I--S----------------------------------------------------------------
O44007_DICDI/1016-1088EFCD-----P--I--L----------------------------------------------------------------
UBE4_ARATH/941-1013EFLD-----P--I--Q----------------------------------------------------------------
UBE4B_HUMAN/1228-1299EFRD-----P--L--M----------------------------------------------------------------
CHIP_HUMAN/227-299YLCG-----K--I--S----------------------------------------------------------------
Q9VA79_DROME/222-300EFLD-----S--I--T----------------------------------------------------------------
RNF37_HUMAN/259-337EFLD-----P--I--T----------------------------------------------------------------
CHIP_ARATH/200-272YLCC-----N--I--T----------------------------------------------------------------
Q9VK44_DROME/1141-1212EFKD-----P--L--M----------------------------------------------------------------

PF15906

E2R5E4_CANFA/120-194GKNC-----TAGA--V----------------------------------------------------------------
NOSIP_DANRE/4-78GKNC-----TAGA--V----------------------------------------------------------------

PF04641

A4S0T5_OSTLU/8-288WFTC-----A--L--T----------------------------------------------------------------
A0DTQ1_PARTE/1-244AQFC-----S--L--T----------------------------------------------------------------
Q2UTA9_ASPOR/1-287WKTC-----P--L--S----------------------------------------------------------------
Q5SMK9_ORYSJ/84-335FTCC-----A--L--S----------------------------------------------------------------
Q29KQ8_DROPS/1-280WLHC-----S--L--T----------------------------------------------------------------
Q17G64_AEDAE/1-281WKHC-----N--L--T----------------------------------------------------------------
A8XXP4_CAEBR/1-289WRNC-----Q--L--T----------------------------------------------------------------
Q5K8P8_CRYNJ/1-310FFLC-----A--L--S----------------------------------------------------------------
RTF2_DICDI/1-266WFLC-----A--L--A----------------------------------------------------------------
Q23KD1_TETTS/1-249ARLC-----T--L--S----------------------------------------------------------------
RTF2_CHICK/1-289WYYC-----T--L--S----------------------------------------------------------------
A7RZE6_NEMVE/1-286WFHC-----A--I--S----------------------------------------------------------------
A0A0D1DPG3_USTMA/1-280WTVC-----S--L--S----------------------------------------------------------------
RTF2_SCHPO/1-239FSQC-----A--I--T----------------------------------------------------------------
F1QSV2_DANRE/1-293WKYC-----A--L--S----------------------------------------------------------------
Q5TPA4_ANOGA/1-281WKHC-----A--L--T----------------------------------------------------------------
Q6NQ98_ARATH/84-337WLNC-----A--L--S----------------------------------------------------------------
RTF2_MOUSE/1-290WNYC-----T--L--S----------------------------------------------------------------

PF07800

M4CJA0_BRARP/50-200NVIC-----S--V--C----------------------------------------------------------------
J3MK74_ORYBR/23-223RISC-----P--I--C----------------------------------------------------------------
I1K2V2_SOYBN/49-211DVTC-----S--V--C----------------------------------------------------------------
A0A096UKJ4_WHEAT/23-231RISC-----P--I--C----------------------------------------------------------------
F6HZY0_VITVI/22-260DVSC-----P--I--C----------------------------------------------------------------
M7Z892_TRIUA/9-237DARC-----P--I--C----------------------------------------------------------------
Q9LRY5_ARATH/22-219EVSC-----P--V--C----------------------------------------------------------------
B9GUG0_POPTR/51-216GATC-----S--I--C----------------------------------------------------------------
M1CGY7_SOLTU/46-208GATC-----S--V--C----------------------------------------------------------------
K4CU07_SOLLC/16-249GASC-----P--I--C----------------------------------------------------------------
I1N2C3_SOYBN/22-255EVSC-----P--I--C----------------------------------------------------------------
I1M9R8_SOYBN/11-171DVAC-----P--I--C----------------------------------------------------------------
M0RX91_MUSAM/44-191EVRC-----P--V--C----------------------------------------------------------------
M4D465_BRARP/25-184DLVC-----P--I--C----------------------------------------------------------------
M0U683_MUSAM/22-183EVLC-----P--I--C----------------------------------------------------------------
F6H968_VITVI/49-215DATC-----S--V--C----------------------------------------------------------------
C5X4F2_SORBI/23-254RISC-----P--I--C----------------------------------------------------------------
A9SF80_PHYPA/49-210EATC-----P--V--C----------------------------------------------------------------
B9SEM7_RICCO/46-230EARC-----P--V--C----------------------------------------------------------------
M1BUR7_SOLTU/46-233DARC-----P--V--C----------------------------------------------------------------
F6HX92_VITVI/41-187ETRC-----P--I--C----------------------------------------------------------------
M0RJN1_MUSAM/50-203GATC-----P--V--C----------------------------------------------------------------
M0SRW7_MUSAM/22-177ETSC-----P--I--C----------------------------------------------------------------
B6SUA2_MAIZE/30-197DVAC-----P--I--C----------------------------------------------------------------
I1KZC0_SOYBN/22-256EVSC-----P--I--C----------------------------------------------------------------
J3KUR8_ORYBR/26-254DALC-----P--I--C----------------------------------------------------------------
M0U6C0_MUSAM/135-295DIVC-----P--I--C----------------------------------------------------------------
M1CSJ9_SOLTU/45-210EAKC-----P--I--C----------------------------------------------------------------
J3MH44_ORYBR/29-188DVTC-----P--I--C----------------------------------------------------------------
M4E8R7_BRARP/36-202EARC-----P--V--C----------------------------------------------------------------
M0THX6_MUSAM/100-260DVTC-----S--I--C----------------------------------------------------------------
I1P4P1_ORYGL/48-211DANC-----S--V--C----------------------------------------------------------------
W1NJC5_AMBTC/57-230DATC-----S--V--C----------------------------------------------------------------
B9SPP5_RICCO/28-184EVVC-----P--I--C----------------------------------------------------------------
F6H3B5_VITVI/28-194DVTC-----P--I--C----------------------------------------------------------------
J3LYB6_ORYBR/145-298SATC-----S--I--C----------------------------------------------------------------
W1P3H0_AMBTC/37-183DVRC-----T--V--C----------------------------------------------------------------
K7KTN8_SOYBN/11-174DVIC-----P--I--C----------------------------------------------------------------
B9SZV8_RICCO/31-193EVRC-----P--I--C----------------------------------------------------------------
I1PLP2_ORYGL/49-202RATC-----S--I--C----------------------------------------------------------------
Q9LUA0_ARATH/39-255EARC-----P--V--C----------------------------------------------------------------
W1P964_AMBTC/48-238DVRC-----P--V--C----------------------------------------------------------------
F6H0M7_VITVI/115-281DATC-----S--V--C----------------------------------------------------------------
B9GF75_POPTR/49-209NVTC-----S--V--C----------------------------------------------------------------
K3ZTK7_SETIT/23-255RISC-----P--I--C----------------------------------------------------------------
M4DF02_BRARP/22-205EVSC-----P--V--C----------------------------------------------------------------
U5D0D1_AMBTC/32-284DASC-----P--I--C----------------------------------------------------------------
F6HH69_VITVI/46-233DARC-----P--V--C----------------------------------------------------------------
I1KSC4_SOYBN/46-217EARC-----P--I--C----------------------------------------------------------------
M4D3C9_BRARP/51-199DAVC-----S--V--C----------------------------------------------------------------
C5Y9B2_SORBI/49-202NATC-----S--I--C----------------------------------------------------------------
K7TN85_MAIZE/24-253DVLC-----P--I--C----------------------------------------------------------------
I1LMI1_SOYBN/43-250EARC-----P--V--C----------------------------------------------------------------
M1CRX8_SOLTU/39-210EARC-----A--I--C----------------------------------------------------------------
I1NPL5_ORYGL/52-207DVRC-----P--V--C----------------------------------------------------------------
B9S551_RICCO/22-258EVSC-----P--I--C----------------------------------------------------------------
I1KA51_SOYBN/47-210DATC-----S--V--C----------------------------------------------------------------
K3YTM6_SETIT/49-212GATC-----P--V--C----------------------------------------------------------------
Q7XP23_ORYSJ/26-252DALC-----P--I--C----------------------------------------------------------------
W1NR99_AMBTC/24-180EVTC-----P--I--C----------------------------------------------------------------
B9GTE6_POPTR/22-235EVSC-----P--I--C----------------------------------------------------------------
I1HXY9_BRADI/26-254DARC-----P--I--C----------------------------------------------------------------
B9RJB2_RICCO/51-216SSTC-----S--V--C----------------------------------------------------------------
B9N5I9_POPTR/46-233EARC-----P--V--C----------------------------------------------------------------
K4DHB9_SOLLC/16-172DVFC-----P--I--C----------------------------------------------------------------
W1P3L7_AMBTC/42-195DATC-----S--V--C----------------------------------------------------------------
M0S465_MUSAM/48-212DATC-----S--V--C----------------------------------------------------------------

PF02148

UBP44_MOUSE/26-88---C.....M--V--C----------------------------------------------------------------
HDAC6_HUMAN/1133-1195---C.....G--D--C----------------------------------------------------------------
HDAC6_MOUSE/1067-1129---C.....K--T--C----------------------------------------------------------------
Q7QEG4_ANOGA/63-151---C.....S--K--C----------------------------------------------------------------
Q7PS30_ANOGA/1015-1078---C.....S--D--C----------------------------------------------------------------
Q4WPT2_ASPFU/433-495---C.....S--V--C----------------------------------------------------------------
Q752M3_ASHGO/46-108---C.....S--E--C----------------------------------------------------------------
Q55AP9_DICDI/92-190---C.....M--V--C----------------------------------------------------------------
Q29G58_DROPS/978-1040---C.....G--E--C----------------------------------------------------------------
UBPA_DICDI/191-266---CD...IE--G--C----------------------------------------------------------------
UBP45_MOUSE/62-139---C.....S--E--C----------------------------------------------------------------
UBP22_MOUSE/63-124---C.....H--V--C----------------------------------------------------------------
A5DHG6_PICGU/209-286---C.....G--A--C----------------------------------------------------------------
UBP16_HUMAN/48-128---C.....Q--D--C----------------------------------------------------------------
Q6BU87_DEBHA/100-163---C.....T--E--C----------------------------------------------------------------
Q2LYY5_DROPS/46-106---C.....F--E--C----------------------------------------------------------------
A5DPT2_PICGU/308-371---C.....A--D--C----------------------------------------------------------------
Q29I81_DROPS/77-163---C.....S--Q--C----------------------------------------------------------------
Q6BK37_DEBHA/91-153---C.....S--I--T----------------------------------------------------------------
Q0UPU5_PHANO/195-257---C.....S--V--C----------------------------------------------------------------
A5DCQ5_PICGU/48-110---C.....S--V--S----------------------------------------------------------------
Q0UZD0_PHANO/143-217---C.....S--E--C----------------------------------------------------------------
A5DJV9_PICGU/79-143---C.....S--D--C----------------------------------------------------------------
A4S4T6_OSTLU/23-87---C.....E--A--C----------------------------------------------------------------
Q581T5_TRYB2/216-278---C.....E--Q--C----------------------------------------------------------------
A7RU34_NEMVE/35-97---CS...IS--L--S----------------------------------------------------------------
UBP14_ARATH/180-255---C.....S--K--C----------------------------------------------------------------
Q5KDF6_CRYNJ/396-460---C.....S--M--C----------------------------------------------------------------
UBP13_MOUSE/209-282---C.....A--R--C----------------------------------------------------------------
Q4E680_TRYCC/180-252---CA...LD--G--C----------------------------------------------------------------
Q6H890_ORYSJ/215-277---C.....S--V--C----------------------------------------------------------------
Q0IG52_AEDAE/51-111---C.....Y--K--C----------------------------------------------------------------
Q1RL25_CIOIN/77-139---C.....N--V--C----------------------------------------------------------------
Q4DNU2_TRYCC/216-278---C.....G--E--C----------------------------------------------------------------
Q17K27_AEDAE/77-139---CS...VS--L--T----------------------------------------------------------------
Q5U4Y7_XENTR/62-139---C.....T--E--C----------------------------------------------------------------
A8BKG1_GIAIC/41-106---CA...AS--R--C----------------------------------------------------------------
A7TLQ2_VANPO/49-111---CS...VT--S--S----------------------------------------------------------------
UBP22_ARATH/56-116---C.....S--Y--C----------------------------------------------------------------
A7SXK5_NEMVE/193-255---C.....F--M--C----------------------------------------------------------------
ETP1_YEAST/301-363---C.....A--T--C----------------------------------------------------------------
Q7PYV7_ANOGA/248-310---C.....M--E--C----------------------------------------------------------------
A0R482_MYCS2/16-85---C.....A--E--C----------------------------------------------------------------
UBP10_SCHPO/77-139---CS...VS--L--T----------------------------------------------------------------
Q5CWL8_CRYPI/185-268---C.....E--T--C----------------------------------------------------------------
A5DUT2_LODEL/188-265---C.....H--E--C----------------------------------------------------------------
Q5KF82_CRYNJ/109-183---C.....S--S--C----------------------------------------------------------------
Q1LM26_RALME/20-89---C.....E--E--C----------------------------------------------------------------
Q0J0M6_ORYSJ/91-194---C.....E--H--C----------------------------------------------------------------
Q54XH4_DICDI/293-355---CS...VS--F--H----------------------------------------------------------------
Q5YNV2_NOCFA/18-88---C.....V--E--C----------------------------------------------------------------
A7S0W3_NEMVE/44-106---C.....H--G--C----------------------------------------------------------------
A7AQH7_BABBO/198-279---C.....D--R--C----------------------------------------------------------------
UBP33_BOVIN/30-97---C.....Q--D--C----------------------------------------------------------------
UBP14_YEAST/192-265---C.....S--S--C----------------------------------------------------------------
Q00RU3_OSTTA/38-100---C.....E--T--C----------------------------------------------------------------
A3LW63_PICST/119-183---C.....T--D--C----------------------------------------------------------------
A6R3J1_AJECN/127-189---CS...VS--L--S----------------------------------------------------------------
Q750D2_ASHGO/186-260---C.....G--D--C----------------------------------------------------------------
A7TTD6_VANPO/191-264---C.....S--S--C----------------------------------------------------------------
A0A0D1E9C8_USTMA/168-244---C.....H--T--C----------------------------------------------------------------
Q29E26_DROPS/206-280---C.....E--K--C----------------------------------------------------------------
Q4UGQ2_THEAN/189-270---C.....E--K--C----------------------------------------------------------------
A7TMH2_VANPO/46-108---C.....A--D--C----------------------------------------------------------------
Q6FIW7_CANGA/46-108---C.....S--T--C----------------------------------------------------------------
Q6CCP5_YARLI/264-326---C.....T--T--C----------------------------------------------------------------
Q17MD0_AEDAE/958-1020---C.....T--G--C----------------------------------------------------------------
UBP20_BOVIN/30-97---C.....Q--S--C----------------------------------------------------------------
Q7PZW5_ANOGA/51-111---C.....Y--K--C----------------------------------------------------------------
A0DKY3_PARTE/163-237---C.....R--R--C----------------------------------------------------------------
A8WUG0_CAEBR/958-1020---C.....S--D--C----------------------------------------------------------------
Q0S9I7_RHOJR/18-87---C.....A--E--C----------------------------------------------------------------
A4VF07_TETTS/119-181---CS...IS--L--A----------------------------------------------------------------
Q38FD4_TRYB2/284-346---C.....N--A--C----------------------------------------------------------------
EPT1_SCHPO/262-324---C.....T--V--C----------------------------------------------------------------
E9AE92_LEIMA/178-250---CS...VE--M--C----------------------------------------------------------------
Q59XT8_CANAL/147-211---C.....H--Q--C----------------------------------------------------------------
Q59ZS6_CANAL/28-90---CS...QT--L--S----------------------------------------------------------------
A4IA95_LEIIN/261-323---C.....E--A--C----------------------------------------------------------------
A2E0J2_TRIVA/180-241---C......--T--C----------------------------------------------------------------
Q6CIL3_KLULA/270-332---C.....L--E--C----------------------------------------------------------------
A0CMR2_PARTE/34-96---CS...VT--L--S----------------------------------------------------------------
Q751A3_ASHGO/268-330---C.....D--V--C----------------------------------------------------------------
Q6CJH1_KLULA/186-259---C.....N--D--C----------------------------------------------------------------
A0A0D1EBZ2_USTMA/186-260---C.....G--K--C----------------------------------------------------------------
A7E4F0_SCLS1/490-552---C.....S--I--C----------------------------------------------------------------
A6WAE2_KINRD/21-93---C.....A--D--C----------------------------------------------------------------
Q17BE1_AEDAE/54-115---C.....A--E--C----------------------------------------------------------------
A2F507_TRIVA/163-237---C.....S--S--C----------------------------------------------------------------
A7EYW2_SCLS1/175-249---C.....S--L--C----------------------------------------------------------------
A4S2V3_OSTLU/208-270---C.....A--T--C----------------------------------------------------------------
Q8IBN0_PLAF7/903-965---C.....K--N--C----------------------------------------------------------------
A5DYC5_LODEL/240-300---C.....T--D--C----------------------------------------------------------------
Q4DD96_TRYCC/275-337---C.....Y--T--C----------------------------------------------------------------
A4H369_LEIBR/325-387---C.....K--V--C----------------------------------------------------------------
A8B354_GIAIC/176-251---C.....A--S--C----------------------------------------------------------------
A5KC57_PLAVS/612-674---C.....R--H--C----------------------------------------------------------------
Q6BIP0_DEBHA/187-264---C.....A--Q--C----------------------------------------------------------------
A6W560_KINRD/15-87---C.....A--D--C----------------------------------------------------------------
Q4UFF9_THEAN/163-225---CS...IT--L--S----------------------------------------------------------------
Q16V37_AEDAE/32-100---C.....T--E--C----------------------------------------------------------------
Q55EJ1_DICDI/941-1003---C.....T--D--C----------------------------------------------------------------
Q4Y3J9_PLACH/9-71---C.....K--N--C----------------------------------------------------------------
Q7Q848_ANOGA/57-120---A.....A--K--C----------------------------------------------------------------
Q9W4C3_DROME/70-164---C.....S--Q--C----------------------------------------------------------------
A0BHH7_PARTE/29-97---CDNAKRQ--Q--C----------------------------------------------------------------
A7REZ3_NEMVE/173-246---C.....A--L--C----------------------------------------------------------------
Q23RF9_TETTS/272-336---C.....H--Q--C----------------------------------------------------------------
Q0SGQ5_RHOJR/26-95---C.....E--G--C----------------------------------------------------------------
A3LWP4_PICST/64-126---CS...VT--L--S----------------------------------------------------------------
A7AU59_BABBO/59-121---CS...IT--L--S----------------------------------------------------------------
Q4YCK5_PLABA/187-270---C.....A--V--C----------------------------------------------------------------
A1SM61_NOCSJ/18-87---C.....M--E--C----------------------------------------------------------------
A8XIA6_CAEBR/53-115---C.....D--E--C----------------------------------------------------------------
Q1DFK0_MYXXD/21-90---C.....E--E--C----------------------------------------------------------------
Q5KKZ9_CRYNJ/100-162---CS...KS--L--S----------------------------------------------------------------
A6W9F1_KINRD/23-92---C.....E--D--C----------------------------------------------------------------
UBP1_ARATH/56-151---C.....G--E--C----------------------------------------------------------------
Q582Q1_TRYB2/178-250---CV...VA--G--C----------------------------------------------------------------
A0C6J0_PARTE/90-152---C.....V--Q--C----------------------------------------------------------------
Q8SSA5_ENCCU/124-196---C.....N--L--C----------------------------------------------------------------
Q1MTK1_DANRE/26-88---C.....V--D--C----------------------------------------------------------------
Q2UMH5_ASPOR/176-250---C.....S--M--C----------------------------------------------------------------
B1AY15_MOUSE/192-253---C.....Q--I--C----------------------------------------------------------------
Q5ALK2_CANAL/329-392---C.....M--E--C----------------------------------------------------------------
P91502_CAEEL/185-266---CE...VE--G--C----------------------------------------------------------------
UBP8_SCHPO/38-99---C.....S--T--C----------------------------------------------------------------
SIR2A_DICDI/34-96---C.....H--A--C----------------------------------------------------------------
A7RQL5_NEMVE/37-99---C.....E--T--C----------------------------------------------------------------
Q8IR38_DROME/1014-1076---C.....S--V--C----------------------------------------------------------------
A7H950_ANADF/23-92---C.....E--E--C----------------------------------------------------------------
Q6CEB0_YARLI/174-247---C.....A--Q--C----------------------------------------------------------------
A4S4P2_OSTLU/20-82---CA...VS--L--S----------------------------------------------------------------
Q55C68_DICDI/441-503---C.....S--T--C----------------------------------------------------------------
A3LTF5_PICST/186-263---C.....A--E--C----------------------------------------------------------------
Q5KEY2_CRYNJ/82-153---C.....H--T--C----------------------------------------------------------------
Q6CNA2_KLULA/57-121---CS...VT--L--S----------------------------------------------------------------
Q6CU80_KLULA/45-107---C.....M--D--C----------------------------------------------------------------
UBP14_SCHPO/174-248---C.....S--K--C----------------------------------------------------------------
UBP16_DANRE/48-129---C.....Q--D--C----------------------------------------------------------------
Q6FRA4_CANGA/200-273---C.....S--S--C----------------------------------------------------------------
Q6C622_YARLI/29-91---CS...VS--L--S----------------------------------------------------------------
D7TC41_VITVI/207-266---C.....F--V--C----------------------------------------------------------------
E5KGE0_ARATH/225-284---C.....S--I--C----------------------------------------------------------------
E7QIK7_YEASZ/46-105---C.....G--T--C----------------------------------------------------------------
F0V7F7_NEOCL/86-147---C.....C--I--C----------------------------------------------------------------
F4IHD8_ARATH/60-118---C.....S--R--C----------------------------------------------------------------
F6SBG8_CIOIN/199-271---C.....C--K--C----------------------------------------------------------------
F6V8N9_CIOIN/219-278---C.....M--V--C----------------------------------------------------------------
F6WLJ5_XENTR/1088-1148---C.....A--Q--C----------------------------------------------------------------
F7AYQ7_CALJA/29-106---C.....S--V--C----------------------------------------------------------------
F7DP39_XENTR/198-270---C.....S--V--C----------------------------------------------------------------
F7DQH6_XENTR/29-90---C.....V--D--C----------------------------------------------------------------
F8W4B7_DANRE/999-1059---C.....E--E--C----------------------------------------------------------------
G1PW17_MYOLU/357-416---C.....F--E--C----------------------------------------------------------------
G4LXM5_SCHMA/205-277---C.....A--K--C----------------------------------------------------------------
G4VF40_SCHMA/27-88---C.....N--N--C----------------------------------------------------------------
H0Y8J5_HUMAN/29-105---C.....S--E--C----------------------------------------------------------------
H2PJ11_PONAB/26-87---C.....L--E--C----------------------------------------------------------------
H3C8M1_TETNG/1048-1107---C.....Q--D--C----------------------------------------------------------------
H3CSL1_TETNG/29-108---C.....S--V--C----------------------------------------------------------------
H3DDM2_TETNG/196-268---C.....Q--K--C----------------------------------------------------------------
H3DNW7_TETNG/48-132---C.....Q--D--C----------------------------------------------------------------
I1PQ93_ORYGL/50-114---C.....S--P--C----------------------------------------------------------------
I1QNV7_ORYGL/121-182---C.....S--I--S----------------------------------------------------------------
Q22MQ4_TETTS/55-117---C.....S--N--C----------------------------------------------------------------

PF14446

D4KCM5_9FIRM/3-56GCPCE-------G--C------G--KPL---------TLQ..--------------------------------------
R5L268_9CLOT/4-54NQKCP-------V--C------G--VAF---------KSG..--------------------------------------
R6CMF0_9FIRM/3-56GAKCS-------V--C------G--EMF---------KDG..--------------------------------------
R6IX88_9FIRM/4-55GQKCP-------A--C------G--RNF---------DHD..--------------------------------------
R6DEQ5_9CLOT/4-58GVSCP-------V--C------G--QEF---------KEG..--------------------------------------
R7F8M1_9FIRM/6-57GQECF-------G--C------H--QKL---------QED..--------------------------------------
D4L8K9_9FIRM/2-55EYKCP-------V--C------D--KQF---------KKG..--------------------------------------
E6UEW2_RUMA7/3-55GSKCI-------C--C------G--KRF---------TDE..--------------------------------------
R6T2N4_9FIRM/3-56GKKCF-------S--C------G--EVF---------KDG..--------------------------------------
R6P286_9CLOT/3-55GVPCP-------I--C------G--KAF---------HEG..--------------------------------------
D4LCL0_RUMC1/2-55NKLCS-------K--C------G--KPF---------RPE..--------------------------------------
R6Y3H6_9FIRM/3-56GIKCP-------V--C------G--VPF---------RSG..--------------------------------------
R6EIU8_9FIRM/2-57EDICP-------I--C------G--QEI---------AKEAV--------------------------------------
R5MJ60_9FIRM/2-55GQHCP-------I--C------G--KEF---------CDG..--------------------------------------
R6Q9T1_9FIRM/3-56NEKCP-------V--C------N--QEF---------KDG..--------------------------------------
R7MRY6_9FIRM/2-55GEKCI-------C--C------N--KEF---------QQG..--------------------------------------
R6UCX1_9CLOT/2-55NQKCP-------G--C------H--KAF---------NKD..--------------------------------------
R6MU41_9FIRM/2-55KYKCP-------V--C------N--KQF---------KEG..--------------------------------------
R6NKW4_9CLOT/2-55GLPCP-------V--C------G--RIM---------TDD..--------------------------------------
R5UYS9_9FIRM/3-56GQSCF-------V--C------Q--KPF---------EPE..--------------------------------------
R7KZN4_9FIRM/3-56GYECK-------S--C------G--KKF---------TDD..--------------------------------------
R6DV58_9FIRM/2-55GKICD-------G--C------R--EPL---------KEG..--------------------------------------
B5IDB3_ACIB4/1537-1587KVKCT-------L--C------R--GTI---------LPG..--------------------------------------
D4JWG4_9FIRM/4-56NEKCA-------A--C------G--MKF---------FDD..--------------------------------------
D2R359_PIRSD/219-268KTACP-------V--C------S--DEL---------SGA..--------------------------------------
R5GQ20_9FIRM/3-56NKLCP-------I--C------R--RPL---------NDK..--------------------------------------
R7NJ19_9FIRM/2-55GFRCP-------V--C------D--KNF---------HAD..--------------------------------------
R6QRD2_9CLOT/2-55GKKCP-------I--C------S--EKF---------KAD..--------------------------------------

PF02591

D7CW01_TRURR/196-228--RCG-------G--C------N--VRL---------PIH----------------------------------------
E8RBW9_DESPD/198-230--VCQ-------G--C------Y--MAL---------PPQ----------------------------------------
D5USN8_TSUPD/203-237--RCG-------A--C------R--LEL---------DRG----------------------------------------
H8KX59_SOLCM/203-235--SCS-------G--C------F--NKI---------PPQ----------------------------------------
H2K064_STRHJ/154-188--TCQ-------G--C------R--QEL---------AIT----------------------------------------
A6GYY0_FLAPJ/207-239--ASA-------G--S------F--FTI---------PPQ----------------------------------------
A0R095_MYCS2/203-237--RCG-------A--C------R--IEI---------DRG----------------------------------------
F4GK73_SPHCD/198-230--VCQ-------G--C------H--MTL---------PVQ----------------------------------------
D9QBM9_CORP2/199-233--SCG-------G--C------F--IIL---------PPA----------------------------------------
D3SLT3_THEAH/194-225--TCS-------Y--C------G--TKL---------PSS----------------------------------------
C7M0A3_ACIFD/194-225--RCS-------A--C------H--MEL---------SGA----------------------------------------
E1WZY1_HALMS/198-230--KCS-------R--C------R--FEA---------SSS----------------------------------------
A1AU73_PELPD/198-230--YCL-------G--C------N--MNL---------PPQ----------------------------------------
H6L2M2_SAPGL/209-241--SCG-------G--C------F--NHI---------PPQ----------------------------------------
B2V9X7_SULSY/199-231--VCT-------G--C------Y--MVI---------PPK----------------------------------------
D6Z574_DESAT/198-230--VCR-------G--C------F--MNI---------PPQ----------------------------------------
F0SP42_RUBBR/198-229--ACN-------N--C------F--LQL---------TPQ----------------------------------------
C7LXG6_DESBD/201-233--VCL-------G--C------H--VVI---------PPQ----------------------------------------
B5HBP1_STRPR/205-239--RCE-------G--C------Q--LEL---------NIT----------------------------------------
A4J7B5_DESRM/199-231--ACS-------G--C------H--LGI---------SFD----------------------------------------
E3IZA7_FRASU/205-239--RCE-------G--C------H--LEL---------SGA----------------------------------------
F2NIX1_DESAR/198-230--VCQ-------A--C------H--MNL---------PPQ----------------------------------------
D7WEF2_9CORY/185-219--TCG-------S--C------F--LQL---------PPA----------------------------------------
Q1MR74_LAWIP/201-233--VCG-------G--C------H--IVV---------PPQ----------------------------------------
C6VSB1_DYAFD/203-235--ACG-------G--C------F--SIV---------PPQ----------------------------------------
Q310X1_DESAG/201-233--ICS-------G--C------H--IAI---------PPQ----------------------------------------
B3QVG4_CHLT3/224-255--ACS-------G--C------N--TRV---------PTN----------------------------------------
O67273_AQUAE/199-231--ACA-------G--C------G--IKI---------PSV----------------------------------------
E4NAI7_KITSK/204-238--RCE-------G--C------R--TEF---------SIT----------------------------------------
Q2LRB2_SYNAS/198-230--VCG-------G--C------H--MNI---------PPQ----------------------------------------
A7ZDY4_CAMC1/198-230--ACY-------G--C------F--MQI---------NDK----------------------------------------
D1BFS0_SANKS/205-239--RCE-------G--C------Q--LDM---------NQT----------------------------------------
D3PKG4_MEIRD/209-241--RCT-------A--C------N--VQL---------PMH----------------------------------------
F8E5M6_FLESM/198-230--TCT-------G--C------Y--MKV---------PPQ----------------------------------------
E1R070_OLSUV/200-232--VPS-------V--C------R--VKL---------QPG----------------------------------------
Q8FNL0_COREF/200-234--SCG-------G--C------A--MVL---------PAG----------------------------------------
E4TJQ2_CALNY/198-230--VCS-------G--C------Y--MKI---------PPQ----------------------------------------
C8W3J9_DESAS/199-229--ICS-------G--C------H--IGL---------SSG----------------------------------------
F7UUL4_EEGSY/204-236--SCG-------V--C------R--MVI---------EGG----------------------------------------
G8QW58_SPHPG/201-233--ICQ-------G--C------H--IVL---------PIQ----------------------------------------
Q1IH82_KORVE/197-229--MCM-------G--C------R--VYL---------RPQ----------------------------------------
F2IHQ3_FLUTR/210-242--SCG-------G--C------F--NKI---------PPQ----------------------------------------
Q39YN1_GEOMG/198-230--NCS-------G--C------N--MNL---------PPQ----------------------------------------
Q3A145_PELCD/203-235--NCT-------G--C------H--MHL---------PPQ----------------------------------------
D6ZCR4_SEGRD/202-236--KCG-------A--C------R--LEL---------TVS----------------------------------------
F0JJ48_DESDE/199-231--VCS-------G--C------N--IMI---------PPQ----------------------------------------
C7R4X6_JONDD/205-239--QCG-------G--C------R--LDL---------NAG----------------------------------------
B8E091_DICTD/203-234--VCE-------G--C------K--IAI---------PKV----------------------------------------
D0LJD1_HALO1/197-229--TCL-------G--C------H--MAL---------PPQ----------------------------------------
B8FBL1_DESAA/198-230--VCK-------A--C------H--MGI---------PPQ----------------------------------------
D2QM72_SPILD/203-235--ACG-------G--C------F--NVV---------PPQ----------------------------------------
A1TB60_MYCVP/203-237--RCG-------A--C------R--IEI---------DQG----------------------------------------
I0AGC4_IGNAJ/198-230--ACS-------G--C------H--NII---------PSQ----------------------------------------
H5XB79_9PSEU/203-237--RCG-------A--C------Q--LEL---------DRA----------------------------------------
Q82B29_STRAW/154-188--RCE-------G--C------H--IEL---------NIT----------------------------------------
F4CPL6_PSEUX/204-238--RCG-------A--C------R--LEL---------DRT----------------------------------------
D9SW71_CLOC7/134-166--RCS-------A--C------K--HKI---------EDN----------------------------------------
F8KR50_HELBC/198-230--ACG-------G--C------F--IRI---------NDR----------------------------------------
F2NRR6_TRES6/199-231--VCD-------G--C------H--MIL---------PAQ----------------------------------------
H6RR27_BLASD/204-238--QCQ-------G--C------R--IEL---------NGR----------------------------------------
I0IQZ1_LEPFC/205-237--ACE-------S--C------R--ITL---------PPR----------------------------------------
E8WWT9_GRATM/197-231--KCT-------A--