Sequence alignment for CL0233

PF01592

NIFU_BACSU/10-129LYRQVIMDHYKNPRNKGVLNDSI.........VVDMNNPTCGDRIRLTMKLDG..DIVEDAKFEGEGCSISMASA.SMMT
NIFU_NOSS1/3-134DYTDKVLELFYDPKNQGVIEENGEPGV..KVATGEVGSIACGDALRLHIKVEVESDKIVDSRFQTFGCTSAIASS.SALT
NIFU_KLEPN/3-128NYSEKVKDHFFNPRNARVVDNANA........VGDVGSLSCGDALRLMLRVDPQSEIIEEAGFQTFGCGSAIASS.SALT
O09257_CYAP8/3-133EYTDKVMEFFYNPRNQGTITEKQE.GQ..AITTGEVGSIACGDSPKIHLKIDEATQIILDARFQTFGCASAIASS.SALT
NIFU_AZOBR/3-130NYTDKVKEHFFNPKNAGALDEADD........VGEVGSITCGDALKLMMKVNPDQPGHRDANFQTFGCGSAIASLRSALT
ISU1_ARATH/28-155TYHENVIDHYDNPRNVGSFDKNDP.....NVGTGLVGAPACGDVMKLQIKVDEKTGQIVDARFKTFGCGSAIASS.SVAT
O34393_ARCFU/1-124MYSDKVFDHFQNPRNVGKIEDAD........GVGTVGNPVCGDLMTIYIKVK..DNRIEDIKFQTFGCAAAIATS.SMAT
O31270_AZOVI/2-128AYSDKVIDHYENPRNVGKLDAQDP.....DVGTGMVGAPACGDVMRLQIKVNEQ.GIIEDAKFKTYGCGSAIASS.SLAT
ISU1_YEAST/34-161LYHPKVIEHYTHPRNVGSLDKKLP.....NVGTGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASS.SYMT
NIFU_AZOCH/3-128DYSEKVKEHFYNPKNAGAVEGANA........IGDVGSLSCGDRLRLTLKVDPETDVILDAGFQTFGCGSAIASS.SALT
O53156_MYCTU/8-132IYQDVILDHYKHPQHRGLREPFGA........QVYHVNPICGDEVTLRVALSEDGTRVTDVSYDGQGCSISQAAT.SVLT
NIFU_BUCAP/2-128AYSKKVMDHYENPRNVGSFSNSDS.....NVGSGLVGAPACGDVMKLQIKVNEQ.GIIEDACFKTYGCGSAIASS.SLVT
NIFU_RHOSH/3-126DETGKALDLFFNPRNAGPLEAADA........VGTAGSLEVGDAIRLMLRIEAG..RVAEARFLAFGGAHAIACG.SALT
NIFU_AQUAE/4-129EYNEKVLDHFLNPRNVGVLEDAN........GVGQCGNPACGDAMLFTIKVNPENDVIEDVRFKTFGCGSAIAVS.SMLT
O45948_CAEEL/26-152QYHEKVIDHYENPRNVGSLDKNDP.....SVGTGIVGAPACGDVMKLQIRVDDN.GKIIEAKFKTFGCGSAIASS.SLAT
O25009_HELPY/14-153AYSKEVQRRMDNPTHLGVITEEQAKAKNAKLIVADYGAEACGDAVRLYWLVDESTDRIVDAKFKSFGCGTAIASS.DMMV

PF02657

Y1419_SYNY3/25-148IVERFQRHTDPKKRYEQLLWYGKKLEPMMEEGKIAANK.VQGCVSQVYI.TADLEDGKV..MYQGDSDAQLVKGLVALLI
SUFE_ECOLI/10-135LLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNS.IQGCQSQVWIVMRQNAQGII..ELQGDSDAAIVKGLIAVVF
Y1293_HAEIN/1-126MIEQLKQAKNWEDRYRLIIQAGKNLPRPSDNELAQMQP.ITGCEAQMWFQIMPKNDRTF..QFSGFSEARIMNGLLWILF
Q9Z9B0_CHLPN/20-141IEELFPEPFQKDHLYLKLMENSSSRDAFDKKRMLKENL.VVGCQSDLYL.YEVYQDGIL..FFFTYTKALMSSGIASLFT
O84327_CHLTR/20-141VALLFPENFVKDTFYKQLLQIGRTAKPFPKEFLTKENL.VLGCQSDLYL.HGEFKNNAA..FFFTYTEALISSGVAVLFS
YGDK_ECOLI/20-145LRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKE.IAGCENRVWLGYTVAENGKM..HFFGDSEGRIVRGLLAVLL
Y3312_MYCBO/14-140VVSDFAEVQ.GQDKLRLLLEFANELPALPSHLAESAMEPVPECQSPLFLHVDASDPNRVRLHFSAPAEAPTTRGFASILA

PF01592

NIFU_BACSU/10-129QAIKGKDIETA...LSMSKIFSDMMQ.......GKEYDDSIDLGDIEALQGVSKFPARIKCA
NIFU_NOSS1/3-134EMIKGLTLDEA.LKVSNKDIADYLGG......LPEAKMHCSVMGQEALEAAIYNYRGIPLAA
NIFU_KLEPN/3-128ELIIGHTLAEA.GQITNQQIADYLDG......LPPEKMHCSVMGQEALRAAIANFRGESLEE
O09257_CYAP8/3-133ELLVGKTLDEA.LSLTNREIAEFLGG......LPEEKMHCSVMGQEALEAAIFNYRGIPLDH
NIFU_AZOBR/3-130EMIIGKTVDEALGQVTNRDIAEYLGG......LPPEKMDCSVMGAEALPAAIANFKGEGLVD
ISU1_ARATH/28-155EWVKGKAMEDV.LTIKNTEIAKHLS.......LPPVKLHCSMLAEDAIKAAVKDYKEKRVKT
O34393_ARCFU/1-124EMAKGKTIEEA.LKITRDAVAEALGG......LPKQKMHCSNLAADALRRAIVDYFRKNGKI
O31270_AZOVI/2-128EWMKGRTLEEA.ETIKNTQIAEELA.......LPPVKIHCSVLAEDAIKAAVRDYKHKKGLV
ISU1_YEAST/34-161ELVQGMTLDDA.AKIKNTEIAKELS.......LPPVKLHCSMLAEDAIKAAIKDYKSKRNTP
NIFU_AZOCH/3-128EMVKGADLDDA.LKISNRDIAHFLGR......LPREKMHCSVMGRERLQAAVANYRGEELRT
O53156_MYCTU/8-132EQVIGQRVPRA...LNIVDAFTEMVSS.....RGTVPGDEDVLGDGVAFAGVAKYPARVKCA
NIFU_BUCAP/2-128EWIKGKSITEA.EAIKNTSIVEELE.......LPPVKIHCSILAEDAIKAAISDYKSKKNKN
NIFU_RHOSH/3-126VLVTGLDLAAA.RAVTPEEIEAAVGG......LPAPRRPAAARAWSALQIALAAYEGRTFVA
NIFU_AQUAE/4-129EMVKGKPIQYA.LNLTYKDIFEELGG......LPPQKIHCTNLGLETLHVAIKDYLMKQGRV
O45948_CAEEL/26-152EWINGKTIDYA.SKIKNDEIAKELC.......LPPVKLHCSMLAQDAIQAALKDYQKKQTKK
O25009_HELPY/14-153ELCLNKRVQDA.VKITNLDVERGLRDDPDTPAVPGQKMHCSVMAYDVIKKAAGMYLGKNAED

PF02657

Y1419_SYNY3/25-148QGLNGLTPTEI-VELTPD.FIEATG-------LQVSLTPSRANGFYNIFKMM-----QTKAI
SUFE_ECOLI/10-135ILYDQMTPQDI-VNFDVRPWFEKMA-------LTQHLTPSRSQGLEAMIRAI-----RAKAA
Y1293_HAEIN/1-126NQINGKTADEL-NTFDITVFFSELG-------ISQRLSEMRLNGLNQIGQQL-----KNLCI
Q9Z9B0_CHLPN/20-141EVYSGETPSTI-LTCKPI.FFQRLT-------P..YLSFGRLNGGESLYMRM-----KQIAV
O84327_CHLTR/20-141DIYSGETPETI-LTCKPL.FFEKLS-------R..HLSMGRSRGGESLFLNM-----QRIAV
YGDK_ECOLI/20-145TAVEGKTAAEL-QAQSPLALFDELG-------LRAQLSASRSQGLNALSEAI-----IAATK
Y3312_MYCBO/14-140AGLDEQPAADI-LAVPED.FYTELG-------LAALISPLRLRGMSAMLARI-----KRRLR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window