Sequence alignment for CL0234

PF01864

Y832_METTH/5-171IINIIDVLYV-----------------IYFMLPAYMANISG---------------------------------------
Y1600_METJA/2-177FYRLL..FAS-----------------LWYILPAYVANASA---------------------------------------
Y1740_ARCFU/1-179MLDLI..LKT-----------------IWLLLPCYTPNNFA---------------------------------------

PF01148

Q9PEH9_XYLFA/3-282RTRVIAALVMAPVAMCSILFLP....TAWLASLTAIIFLWGLWEWMKLSQVEDTLVRTVLL........TLNLLLMVLLV
CDSA_PSEAE/3-266KQRIITALVLLPIALGGFFLLE....GAFFALFIGAVVSLGAWEWARLAGYEQQFGRVAYA............ATVAVLM
Q9CJL3_PASMU/3-287KERVLSAIMLIAIVFIALFFFS....PFYFALAVGVVVILAVWEWTQFAHFKWSFWRLGLTGL.SAAFLFLWIYGESDYL
CDSA_HAEIN/3-287KQRVLSAIVLIAAVLCALFLFT....PFYFALALGAVAILGIWEWTQFARLKQPLIRFFVTTF.LGVFIFLWLYTEGNYL
Q9KPV7_VIBCH/2-280KQRIITALILAPLVILGILYLP....FAWFMLALAVVTLLGFWEWTQFVNQPSRMLAMIPA....LLVGGISVALIDFQF
Q9K1G7_NEIMB/3-264KQRVITAMWLLPLMLGMLFYAP....QWLWAAFCGLIALIALWEYARMGGLCKIKTNHYLA............ATLVFGV
Q98MC0_RHILO/5-258QLRVISAVVLAVIALGLTWLGG.....LPFRLLCAAMSAMIFYEWTRMSRPAAANGLSFLP..............EALVV
Q9A708_CAUCR/16-269RTRVVSATVLVPTVVAAVWLGG.....YWFMALSLVCVGLLAREWGRISAPKAPNAVGAVV.........GVFCGIAVVA
Q9RU83_DEIRA/12-280STRVLTSVIGFLIVSALVWIGW.....WAMLPALIAVSFFGLSEYFRMLDRNDLDVRRLSLG...VFGTALIVASLPMFS
O86769_STRCO/129-388GAAIGVGVGLGVVIIASLFVVK.....AVFVGVIAVAVVVGLWELTKRLEERKGIKAPLVP.....LAIGGAAMVVAGYA
CDSA_MYCLE/38-311PAAIAVGLSIGGVLVATLVFAP.....RIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPL......LIGGQFTVWLTWP
Q9KA68_BACHD/2-264KQRVVTAIIFGLVFLTFVVVGG.....LPFTMFIIVVATIAMSELLKMKKIAPFSPMGAFS.......LLPMWMLLLPND
CDSA_BACSU/5-268KQRILTGVLAAIVFLFLVIVGK.....LPFTILIYAMGSVALFELLRMKKLKLVSLPGLIG.......LLLLWMFLLPSQ
Q99XY2_STRP1/2-264KERVVWGGVAVAIFLPFLIIGN.....LPFQLFVGVLAMIGVSELLKMKRLEVFSFEGVFA.......MLAAFVLAVPMD
Q9CDT2_LACLA/2-267MQRIITGVVAGGIFLALLLLGG.....AYFQILVALLVIIAMQELFRMYKLQVFSFEGILA.......TLAALSLALPVG
CDSA_HELPY/9-254KSRYITGFVLIIVADLILYADN....LLLFWAVLGGIYAVGFSEALRLFQVKASFSLYLIL..........VLSWVAAYF
CDSA_THEMA/5-265KTRVITASVVAPFVVLCFVSY......ESLIGLVSAILILAGYELITLEMKERDARFFYVI.........LLALYPVLYG
YNBB_ECOLI/36-296TLRIRTWWGIVICFSMVISGPR.....WMTLTFFALISFLALKEYCTLISVHFPR.................WLYWGIPL
Q9KQR2_VIBCH/42-308KLRIRSWWWMVAIVFVVLQLPL.....NYTLFFVGFLSFMALKEFLSIVPTRMTDRRVIFW............AYLSIPF
Q9I0U8_PSEAE/42-308NARINAWWAMVLVIGFAFWLGQ.....AAVILLFYGVSFYALREFITLTPTRRSDYPALVA...........AFYFVLPM
Q9CJK3_PASMU/41-307NARINAWWVMILIIFAAAFIGF.....YAVIALFFIISFMALREFLSLIYIRRGDHLALAA...........CFYVILPV
CDSA_SYNY3/3-286TQRIISAVIGIALAFSLLILGG.....WYFSAAIALVIYLGLREYFQMVRAKGIAPAAKTT.......MVLSLMLLLSAT
Q9M001_ARATH/110-397KKRVTFGLGIGLSVGGIVLAGG.....WVFTVAVAAAVLLSAREYFELVRSKGIAQGMTPPPRYLSRVCSIICALMPILT
CDS1_SOLTU/50-381LIRAYSSVWMIGGFAFIIYMGH.....LYIWAMVVVIQIFMAKELFNLLRRAHEDRHLPGF.....RLLNWHFFFTAMLF
CDS1_YEAST/63-393FIRTVWTFVMISGFFITLASGH.....AWCIVLILGCQIATFKECIAVTSASGREKNLPLT.....KTLNWYLLFTTIYY
CDSH_SCHPO/53-384ITRTIWTFLLLGIFFTALAMGH.....FWVVLLVTIVQIGVYKEVIAIASVPSREKDLPWT.....RFINWYFLMTTLYY
CDS2_HUMAN/70-400WVRGILTLAMIAFFFIIIYLGP.....MVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWF.....RTLSWYFLLCVNYF
CDSA_DROME/84-410VIRGIFTWIMICGFALIIYGGP.....LALMITTLLVQVKCFQEIISIGYQVYRIHGLPWF.....RSLSWYFLLTSNYF
CDSA_CAEEL/86-417VVRGLFSIIMISTFTFIVTRGA.....TWLMFLVFLIQFKCFQEIISIGLAVYRLYDFPWF.....RALSWYFLLTSNYF
O83611_TREPA/5-282IKRLLIFFFGVPTILMLVYAAPHA.HFLAFHLVIFGSVMGAVWEMHAMVSRRMCTYPLVLL.......IPFSLVLPLLGY
CDSA_CHLTR/16-297.QRLVVHSILLTFLVILLCTSLYPSSAFIVGLLSSACAALGTYEMGAMVRIKFPFSFTRYS.....ALGSAIFIALTCLT
Q1PE48_ARATH/97-428WIRTCSSLWMLGGVVFIIYMGH.....LYIWAMVVVIQIFMAKELFFLRRRAHEERRLPGF.....WLLNWHFFFTAMLF
Q2G1Z6_STAA8/2-257KVRTLTAIIALIVFLPILLKGG.....LVLMIFANILALIALKELLNMNMIKFVSVPGLIS.........AVGLIIIMLP
CDSA_BRUA2/6-257.TRIITAIVLGTITLWLTWVGG.....VGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG.........WAWLIVTGIL
Q8DRB2_STRR6/7-264.KRTLFAGIALAIFLPILMIGG.....LLLQIAIGIVAMLAMHELLKIRGLATMTMEGLLT.......LFATFALTIPLE
Q8ILZ6_PLAF7/262-592KVRSQWTFILILLYFIILAAGH.....FYCSILVLILVTTLYKEIISLKSIENKDKKLPEI.....FYIRWYWFFLTIMT

PF01864

Y832_METTH/5-171-------------------------------------------------------LVFGGGKPL----------------
Y1600_METJA/2-177-------------------------------------------------------CIFGGGTPV----------------
Y1740_ARCFU/1-179-------------------------------------------------------VLVGGGTPI----------------

PF01148

Q9PEH9_XYLFA/3-282WVSAHTLVLFQIATLIGIAWWILALLWLRFLGFCADPNQRTAKIVKLTAGTLAVIPAWSALVLLHS..............
CDSA_PSEAE/3-266VALYHLPQLAGAVLLLALVWWTLATVLVLTYPE..SVGYWGGRWRRLGMGLLILLPAWQGLVLL................
Q9CJL3_PASMU/3-287NAGRVFENTLSLLLFSSVLWWFVALGLVISYPKG.ATYWGKNKLLQFAFAFLTLVPFFAGVLRL................
CDSA_HAEIN/3-287DAGRVFEQHLQLLLINAVSWWGLALLLVISYPKS.AKFWSKNPLLQLLFAFSTLIPFVAGVLRL................
Q9KPV7_VIBCH/2-280PAISNMNTAHFIVLGIGSLWWLVSSGLAITYPRS.RPLWEHSSTVRHLFGLFTLLPFFWSVLFL................
Q9K1G7_NEIMB/3-264VAYAGGWMLPNLVWYVVLAFWLAVMPLWLRFK.....WRLNGGWQVYAVGWLLVMPFWFALVSL................
Q98MC0_RHILO/5-258VFIGALIAGLAASWLLLLVVVLIAVTAIAALVR..KAGQWEVSGLAYASVSGLSLALLRDGDHS................
Q9A708_CAUCR/16-269AFLQQFLVAWAVVLVGSFLAGLIA...................RGAVERRADAAYGVVYIAPAV................
Q9RU83_DEIRA/12-280EYAPWPGGSWREVVLTIAVGTLLVLEVI............RPGERPLERVVYSLFGLLYIPWLLGY..............
O86769_STRCO/129-388RGAEGAWVAMALTALAVLVWRMTEPP.................EGYLKDVTAGLFAAFYVPFLA................
CDSA_MYCLE/38-311YRTVGALAGFGATVVVCMIWRLVMHDNSKQHESR.EALAGPPVSNYLRDASATVFLAAWVPLFA................
Q9KA68_BACHD/2-264WFKVVIPDFTKVEIFIFFILFLLLLTVL............TKNTFTFDEAGFVILSSAYIGYGFH...............
CDSA_BACSU/5-268YSFFEADGISKMEIALFAVLLLLTYTVL............VKNTFTFDEVGFITLAAIYIGMCFH...............
Q99XY2_STRP1/2-264HYLTFLPIDANVAFYSLMVFFILAGTVL............NSRAYSFDDAAFPIATSFYVGIGF................
Q9CDT2_LACLA/2-267KHWLGLNADGGVMLFTLFLFMMLTGMVL............SNGKYSFVDVGFPFLSAFYVGIGF................
CDSA_HELPY/9-254NGRPIECALISAMVMASVI........................AYQKAHHSEAILPFLYPGVGF................
CDSA_THEMA/5-265LVFEEPTQPLSILFITGVVFSLITDKD...............PSQVFKTVAAFSIALIYVTFFL................
YNBB_ECOLI/36-296NYLLIGFNCFELFLLFIPLAGFLILATGQVLVGD.PSGFLHTVSAIFWGWIMTVFALSHAAWLL................
Q9KQR2_VIBCH/42-308QYYWLSIGWYGMFIIFIPVYVFLYLPMVMVLIGD.TKGFIRSAGIIHWAMMLTVFCISHMAYLL................
Q9I0U8_PSEAE/42-308QYLLIYIDWYSMFSIFIPVYVFLLLPILASLGGD.TKHFLERASKVQWGLMLAVFCISFVPALL................
Q9CJK3_PASMU/41-307QYYFVAIDWFSMFTIFIPVYAFLFLPILSALLGD.ASHFLDRSTKVQWAIMISVFCISHIPAIL................
CDSA_SYNY3/3-286VTPHLTDAFFPLTGALICFYLLFQPK.................MATIADISTSLLGLFYGGYLPSYWVRLRLGDGAVNPM
Q9M001_ARATH/110-397LYFGHIDISITSAAFVVAMALLLQRG.................NPRFSQLSSTMFGLFYCGYLPCFWVKLRCGLTA...P
CDS1_SOLTU/50-381VYGRMLSQRLVNTVTLDKFLYKLVGR.................FVKYHMVTCYFFYIAGFMWFILTLKKKMYKYQFSQYA
CDS1_YEAST/63-393LDGKSLFKFFQATFYEYPVLNFIVT.....................NHKFICYCLYLMGFVLFVCSLRKGFLKFQFGSLC
CDSH_SCHPO/53-384AYGESIYAYFHHLFIMDSFMLPLVL.....................HHRFISFMLYIIGFVLFVASLKKGNYKFQFSQFC
CDS2_HUMAN/70-400FYGETVTDYFFTLVQREEPLRILSK.....................YHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFG
CDSA_DROME/84-410FYGENLVDYFGVVINRVEYLKFLVT.....................YHRFLSFALYIIGFVWFVLSLVKKYYIKQFSLFA
CDSA_CAEEL/86-417FFGESLIDYWGIVLKKDNFLHFLVA.....................YHRLVSFALYCIGFVSFVLSLRKGYYMRQFSLFA
O83611_TREPA/5-282AALWQPARGAESVLFIGALGTLLMSVFFTELV....YSFSASFENALERMASALLLVLYPGIFS................
CDSA_CHLTR/16-297ARCKMCFPEHIDLLPWFFLFFWTIRLVFKS.........RHYKLGPIGSTGLALFCMLYVSVPIRLFL............
Q1PE48_ARATH/97-428VYGRIIQQQLVNTVSSDRFIYKLVSG.................LIKYQMVICYFLYIAGLIWFILTLKNKMYKYQFGQYA
Q2G1Z6_STAA8/2-257QHAGPWVQVIQLKSLIAMSFIVLSYTVL............SKNRFSFMDAAFCLMSVAYVGIGF................
CDSA_BRUA2/6-257LIL.DRGALLTIGFLVAGCAILLVTQ.................WKSGRGWPAAGLFYAGFSALS................
Q8DRB2_STRR6/7-264NYLTFLPVDGNVVAYSVLISIMLGTTVF.............SKSYTIEDAVFPLAMSFYVGFGF................
Q8ILZ6_PLAF7/262-592LGIPWVIPKLKHQIPLYKFLLT........................YHSINMFILAFVGFVWFILSLRKFSLKYQFSQIG

PF01864

Y832_METTH/5-171-------------------------------------DMGITLAD---GRR-------LIGDGVTWRGTAAGTFVGLVVG
Y1600_METJA/2-177-------------------------------------DLGKNFID---GRR-------LIGNGVTYRGCIFGILCGTLVG
Y1740_ARCFU/1-179-------------------------------------DFGKTFVD---GKR-------ILGDGKTWRGFVGGVAGGVLTA

PF01148

Q9PEH9_XYLFA/3-282.........GDKPGSTFPESLHAHLWLLTAQIMVWAADSGAYFAGRLFGKH...KLAPQISPNKTVEGLLGGILTGLAVA
CDSA_PSEAE/3-266.................KQWPLANGLIIAVMVLVWGADIGAYFSGKAFGKR...KLAPRVSPGKSWEGVYGGLAASLAIT
Q9CJL3_PASMU/3-287...........RLAHYVTDPYHGLILLLYVFILVWSADSGAYFAGRQFGKN...KLAPKVSPGKSWEGVIGGLVTAGILA
CDSA_HAEIN/3-287...........RLEHYTHDPYHGLFLLLYVFILVWAADSGAYFSGRAFGKR...KLAPKVSPGKSWEGVIGGLITALVLA
Q9KPV7_VIBCH/2-280...........RADTYLSDPLYGAKLVLFVCFLVWAADSGAYFVGKSLGKH...KMAPAVSPNKTIEGLVGGIVTAMLVG
Q9K1G7_NEIMB/3-264.................RPHPDDALPLLAVMGLVWVADICAYFSGKAFGKH...KIAPAISPGKSWEGAIGGAVCVAVYM
Q98MC0_RHILO/5-258......................GLVAILFLFAVVWATDIFAYFVGRAVGGP...KLAPSISPGKTRSGALGGAFGGVVAG
Q9A708_CAUCR/16-269...........IAMVWVRSLDDGLWWTLLLFVVTWFADIFAYVTGSILKGP...KLWPRISPNKTWAGFVGGLAAATIGA
Q9RU83_DEIRA/12-280..........FMLLRYSPDGQQGLLYFALPLLATFAADIGGFFAGHFFGRR...KLAPEVSPGKTVEGAIGGLAFGFVVV
O86769_STRCO/129-388...........TFVAMMLAADDGAWRVLVFLILTVVSDTGAYAVGWRFGRK...KLAPRISPGKTREGLLGAIAFAMVAG
CDSA_MYCLE/38-311...........SFAALLVYPKDGAGRVFCLMIAVVASDVGGYTVGVLFGKH...PLVPRISPNKSWEGFAGSLVCGTTAT
Q9KA68_BACHD/2-264...........FLLLSREIPEIGLPLVFFVLFVIWATDSGAYFAGRAFGKH...KLWPHISPNKTIEGSIGGIILAVIIG
CDSA_BACSU/5-268...........YFIEIRNLDQYGLTYIFYACVVIWSTDSGAYFVGKSLGKR...KLWPEISPNKTVEGFAGGIVIALVLA
Q99XY2_STRP1/2-264.............QHLINARLSGIDKVFLALFIVWATDIGAYLIGRQFGRR...KLLPTVSPNKTIEGSLGGIACAVLVS
Q9CDT2_LACLA/2-267.............QNLLTARQTSVYIVFLALFIVWATDIGAYAFGRSLKDRFPQKLLPSVSPNKTVVGSVGGIVSAVVVA
CDSA_HELPY/9-254............FALFGVYKDFGAVAIIWLLVVVVASDVGAFFGGKLLGKT....PFTPTSPNKTLEGALIGVVLASVLG
CDSA_THEMA/5-265............SFFLPIYRDFGAANALLVLTSTWVFDSFAYFTGLKFGRT...RISPRYSPRKSLEGVIGGFLGVVIYT
YNBB_ECOLI/36-296.............MLPTTNIQGGALLVLFLLALTESNDIAQYLWGKSCGRR...KVVPKVSPGKTLEGLMGGVITIMIAS
Q9KQR2_VIBCH/42-308............VLPSLNPDAGSLGMLLFLLVMTQFNDVAQYVWGKSFGKH...KIVPKVSPNKTWQGFIGGTLTVVTVS
Q9I0U8_PSEAE/42-308............TLDIPGFEGRNLLLIAYLVIVVQLSDVMQYICGKLFGKR...KIAPNLSPSKTVEGFVGGIALATAIG
Q9CJK3_PASMU/41-307............TLDIVGFENKNLLLMIFLILVVQSSDVLQYVWGKLFGKH...KIAPTLSPSKTVEGFAGGILSASILG
CDSA_SYNY3/3-286GLHLPLNGFWPESWAHPENFPTGLLVTILAFACIWAADIGAYIMGKWLGRT....RLSDISPKKTVEGSLWGVGGSLLVG
Q9M001_ARATH/110-397VLNTGIGRSWPTILGGQAHWTVGLVAILISFCGIIASDTFAFLGGKAFGRT....PLISISPKKTWEGAFAGLVGCISIT
CDS1_SOLTU/50-381WTHMILIVVFTQSAFTVANIFEGIFWFLLPASLIVINDIAAYFFGFFFGRT....PLIKLSPKKTWEGFIGASITTIISA
CDS1_YEAST/63-393VTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLCGITFGKT....KLIEISPKKTLEGFLGAWFFTALAS
CDSH_SCHPO/53-384WTHMTLLLVVGQSHFMINNLFEGLFWFFVPVCYVVCNDVFAYLCGKMFGKH....PLIQVSPKKTVEGFLGGWICTVVIG
CDS2_HUMAN/70-400WTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRT....PLIKLSPKKTWEGFIGGFFATVVFG
CDSA_DROME/84-410WTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRT....PLIKLSPKKTWEGFIGGGFATVLFG
CDSA_CAEEL/86-417WTHLTLLLIVSQSFFIIQNIFQGLIWFLAPVAMIICCDIMSYMFGFFWGKT....PLIKLSPKKTWEGFIGGAFSTVVFG
O83611_TREPA/5-282...........LFFSLITRWRHAEIALVIFFLMVFTCDSCAWFCGTLWGVNN..RGIIPASPKKSIAGFIGGFAGSVGAG
CDSA_CHLTR/16-297........HILYGFVHTDTPFVGIWWAIFLIATTKSSDIFGYFFGKAFGKK...RIAPVISPNKTVVGFIAGCCGSILVS
Q1PE48_ARATH/97-428WTHMILIVVFTQSSFTVANIFEGIFWFLLPAALIAMNDVAAYFFGFYFGKT....PLIKLSPKKTWEGFIGASVATIISA
Q2G1Z6_STAA8/2-257.............MFFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKH...KLWPVISPNKTIEGFIGGLFCSLIVP
CDSA_BRUA2/6-257............LSLLRGDEPFGFTTIVFLFAVVWSTDITAYFNGRALGGP...KLAPRFSPNKTWSGAIGGAAAAVAGG
Q8DRB2_STRR6/7-264.............NALLDARVAGLDKALLALCIVWATDSGAYLVGMNYGKR...KLAPRVSPNKTLEGALGGILGAILVT
Q8ILZ6_PLAF7/262-592IILLSSLFIVTQSLMHIANIYSGMIWFIVPVSSVVINDIFAYVFGILFGKT....RLIQLSPKKTVEGYVGSSIITIVWG

PF01864

Y832_METTH/5-171IIQGLL...........S--------------------------------------------GSIIIGVITGLLLGFGAL
Y1600_METJA/2-177LIQGILVDFNIFNSLDFY--------------------------------------------GTVLDHVILAFFLSVGAI
Y1740_ARCFU/1-179NLQYAIEKLSG.LAIYSS--------------------------------------------LPFNEFFTLTFLLAFGAM

PF01148

Q9PEH9_XYLFA/3-282TGFGLLNGVTM...................................................TQFPSLLLVSFVAILASV
CDSA_PSEAE/3-266LAVGLYRGWSL...................................................GALLLALLGAALVVFVSI
Q9CJL3_PASMU/3-287SIFIHFTQESLL................................................SGISIPAFIALSVATVAVSI
CDSA_HAEIN/3-287FIFIHFSNNTLV................................................GDRNITGFIILSVATVAISV
Q9KPV7_VIBCH/2-280YWVAECFGIQF...................................................SSMPVMLLIILLTVVISV
Q9K1G7_NEIMB/3-264TAVRSAGWLAF..................................................DTGWFDTVLIGLVLTVVSV
Q98MC0_RHILO/5-258VMLAAGAGA.....................................................GNLALLGLVALALSIVAQ
Q9A708_CAUCR/16-269VVVASLAKLD....................................................LIWQAAALIGLLGGLATM
Q9RU83_DEIRA/12-280LVVSQLAGI.....................................................WTPLQAFLYSVLVASASQ
O86769_STRCO/129-388ALCMQFLIDD....................................................GAWWQGLLLGLVVAVSAT
CDSA_MYCLE/38-311ILTATFLAG.....................................................KTPWVGALLSFVLVLTCT
Q9KA68_BACHD/2-264SLFYWIMPLF....................................................SSYGVALAVIVVASVFGQ
CDSA_BACSU/5-268TIFQLVAQLP....................................................IPYIYLLLITLFLSVFGQ
Q99XY2_STRP1/2-264FIFMVIDRSVYA.................................................PHHFLTMLVLVALFSIFAQ
Q9CDT2_LACLA/2-267LVMYFLFTKELP.................................................QIGFVKLVIFTIIFSVVGQ
CDSA_HELPY/9-254SFVGMGKLS.....................................................GGFFMALFFSFLIALVAV
CDSA_THEMA/5-265FLYRLVVNDLLSV...............................................NVISFRTFLPFAATVAIMDT
YNBB_ECOLI/36-296LIIGPLLTP.....................................................LNTLQALLAGLLIGISGF
Q9KQR2_VIBCH/42-308YFAAPYLTP.....................................................LTAAQGLVGGVIIALSGF
Q9I0U8_PSEAE/42-308ASLWWITP......................................................FNLWQAALIALLINLLGF
Q9CJK3_PASMU/41-307GLLYWLTP......................................................FSPLQAFLMSLLICLMGF
CDSA_SYNY3/3-286VLGAWYLQWP....................................................YWEITGALLGLLIGIVSL
Q9M001_ARATH/110-397ILLSKSLSWP....................................................QSLVSTIAFGVLNFFGSV
CDS1_SOLTU/50-381FLLANMFGRFQWLTCPRKDLSTGWLDCDPGPLF......KPEYFTLPEWFPAWFLSREIAVLPVQWHALLLGLFASIIAP
CDS1_YEAST/63-393IILTRILSPYTYLTCPVEDLHTNFFSNLTCELNPV...FLPQVYRLPPIFFDKVQINSITVKPIYFHALNLATFASLFAP
CDSH_SCHPO/53-384SLISYVLMHFKYFICPTRDLSTSAFSGLNCTPNSV..FLPHTYTIPAVFVDTFRLPETITLAPIYFHLAIFATFSSLIAP
CDS2_HUMAN/70-400LLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDL...FRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGP
CDSA_DROME/84-410ILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPS.......YLFTPQEYSLKLFGIGKTLNLYPFIWHSISLSLFSSIIGP
CDSA_CAEEL/86-417ILLSLALYNRPFFVCPVQHYQTDSSNCTIPLAFQL..QDYPVPRPFSFVYKILRKEPIIQLCPFVFHSIALSLFASILGP
O83611_TREPA/5-282CFGSLVFGSRV..................................................TLSLGMLMGVGALVGLTAI
CDSA_CHLTR/16-297LLFYSHLPKAFAD...............................................QIAVPWILIALGTVLGVSGF
Q1PE48_ARATH/97-428FIFANVLGQFQWLTCPRKDLSTGWLHCDPGPLF......RPEYYPFPSWITPFSPWKGISTLPVQWHAFSLGLFASIMAP
Q2G1Z6_STAA8/2-257LAMLYFVDFN....................................................MNVWILLGVTLILSLFGQ
CDSA_BRUA2/6-257LLVASLVAA.....................................................PGGWGVPVLALLLSIVSQ
Q8DRB2_STRR6/7-264IIFMIVDSTVAL.................................................PYGIYKMSVFAIFFSIAGQ
Q8ILZ6_PLAF7/262-592ILITYFLQRYKFFICPQKYITFQPFVSWNYIDCDINPIFQQKVYEVPKQISQILSIKNIYYSKMIFHGLMLSLFAAFLAP

PF01864

Y832_METTH/5-171MGDAAGSFIKRRLKI-DRGRPAP----ILDQLDFVFGALILV..SP..IVVLPIDYIILIMLITLVLHLSANIIAYLLGM
Y1600_METJA/2-177VGDAVGSFIKRRLNI-ERGKPAP----LLDQLDFVIGALAFG..YI..VAPIPYEMIIIICLFTVFVHLLGNIIAYKLGI
Y1740_ARCFU/1-179FGDLCGSFIKRRFGY-ERGSRFL----IVDQLMFLLVALLIASLYPPFWKLFTAEIIALAVIITPALHMGINYIAYRLNL

PF01148

Q9PEH9_XYLFA/3-282IGDLFESLLKRHAGIKDSGSMIPGHGGVLDRIDSTLAALPVF-------------ALGKDIF------------------
CDSA_PSEAE/3-266VGDLTESMFKRQSGIKDSSNLLPGHGGVLDRIDSLTAAIPVF-------------AALLWAA------------------
Q9CJL3_PASMU/3-287LGDLTESMFKRQSGIKDSSQLIPGHGGILDRIDSLTAAVPFF-------------AYFYFFV------------------
CDSA_HAEIN/3-287LGDLTESMFKRESGVKDSSQLIPGHGGVLDRIDSLTAAVPFF-------------SYFYFFV------------------
Q9KPV7_VIBCH/2-280LGDLVESMFKRVSGIKDSSNIIPGHGGILDRIDSLTAAFPVF-------------ALLYFLF------------------
Q9K1G7_NEIMB/3-264CGDLLESWLKRAAGIKDSSKLLPGHGGVFDRTDSLIAVISVY-------------AAMMSVL------------------
Q98MC0_RHILO/5-258AGDLFESWVKRRHGRKDSGVLIPGHGGVMDRVDGLVAAALAL-------------YVIGWIS------------------
Q9A708_CAUCR/16-269AGDLWESMLKRRFGVKDSGDLIPGHGGLLDRVDGLMFAAIVI-------------AAVRLVD------------------
Q9RU83_DEIRA/12-280LGDLSESLIKRALRTKDSGNSLPGHGGFLDRLDSLMFAVPAT-------------YFFLNIS------------------
O86769_STRCO/129-388LGDLGESMIKRDLGIKDMGTLLPGHGGIMDRLDSLLPTAPVV-------------WLLLVIF------------------
CDSA_MYCLE/38-311LGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPSAVVA-------------WTMLTLL------------------
Q9KA68_BACHD/2-264LGDLVESALKRHYAVKDSGTVLPGHGGILDRFDSLIYVMPIL-------------H.LLHLL------------------
CDSA_BACSU/5-268LGDLVESALKRHYDVKDSGNILPGHGGILDRFDSFLFVMPFL-------------YFLLALF------------------
Q99XY2_STRP1/2-264FGDLVESALKRHFGVKDSGKLIPGHGGILDRFDSMIFVFPIM-------------H.LFGLF------------------
Q9CDT2_LACLA/2-267IGDLVESSIKRHFGVKDSGKILPGHGGILDRFDNLIFVFPIM-------------H.LLGLF------------------
CDSA_HELPY/9-254FGDLYESYLKRKVGIKDSGKILPGHGGVLDRLDSMLFGALGL-------------HALLYFL------------------
CDSA_THEMA/5-265FGDIFESALKRHYGVKDSGKTLPGHGGMLDRIDGLLFVAPVS-------------YIVFKIL------------------
YNBB_ECOLI/36-296CGDVVMSAIKRDIGVKDSGKLLPGHGGLLDRIDSLIFTAPVF-------------FYFIRYC------------------
Q9KQR2_VIBCH/42-308IGDLVISSVKRDLRIKDTSQFIPGHGGILDRVDSLMFTAPLF-------------FHYLYYL------------------
Q9I0U8_PSEAE/42-308FGGLVMSAIKRDRGVKDWGHMIEGHGGMLDRLDSVCFAAPIF-------------FHVVRYW------------------
Q9CJK3_PASMU/41-307LGGLVMSAIKRSMGVKDWGNMISGHGGMLDRMDSLCFAAPIF-------------FHVVRYY------------------
CDSA_SYNY3/3-286LGDLTESMMKRDAGVKDSGQLIPGHGGILDRTDSYVFTAPLV-------------YYFVVLL------------------
Q9M001_ARATH/110-397FGDLTESMIKRDAGVKDSGSLIPGHGGILDRVDSYIFTGALA-------------YSFVRLH------------------
CDS1_SOLTU/50-381FGGFFASGFKRAFKIKDFGDSIPGHGGMTDRMDCQMVMAVFA-------------YIYHQSF------------------
CDS1_YEAST/63-393FGGFFASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFA-------------NLYYETF------------------
CDSH_SCHPO/53-384FGGFFASGLKRAFKIKDFGASIPGHGGLTDRMDCQFLNGVFV-------------YMYFQSF------------------
CDS2_HUMAN/70-400FGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFV-------------NVYIASF------------------
CDSA_DROME/84-410FGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFV-------------NVYISSF------------------
CDSA_CAEEL/86-417FGGFFASGFKRAFKIKDFGDVIPGHGGLMDRFDCQLLMGTFV-------------MVYIHSF------------------
O83611_TREPA/5-282VGDLVESVMKRSAQVKDSGFFTPGRGGIMDNLDSLAPSLGTF-------------YIACECF------------------
CDSA_CHLTR/16-297FGDIIESTFKRDAQIKNSSD.LESIGGMLDVLDSLLLSTPIV-------------YAILLI.------------------
Q1PE48_ARATH/97-428FGGFFASGFKRAFKIKDFGDSIPGHGGFTDRMDCQMVMAVFA-------------YIYIQSF------------------
Q2G1Z6_STAA8/2-257LGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLL-------------NILL...------------------
CDSA_BRUA2/6-257IGDLAESWVKRQFGAKDSGRLLPGHGGVLDRVDGLVAAAALL-------------YLFGAIF------------------
Q8DRB2_STRR6/7-264FGDLLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIM-------------HLF....------------------
Q8ILZ6_PLAF7/262-592FGGFFASGFKRALKIKDFGKSIPGHGGVTDRFDCQIFIGMFT-------------YIYMKTF------------------

PF01864

Y832_METTH/5-171KDVWY
Y1600_METJA/2-177KDVWW
Y1740_ARCFU/1-179KEVPW

PF01148

Q9PEH9_XYLFA/3-282-----
CDSA_PSEAE/3-266-----
Q9CJL3_PASMU/3-287-----
CDSA_HAEIN/3-287-----
Q9KPV7_VIBCH/2-280-----
Q9K1G7_NEIMB/3-264-----
Q98MC0_RHILO/5-258-----
Q9A708_CAUCR/16-269-----
Q9RU83_DEIRA/12-280-----
O86769_STRCO/129-388-----
CDSA_MYCLE/38-311-----
Q9KA68_BACHD/2-264-----
CDSA_BACSU/5-268-----
Q99XY2_STRP1/2-264-----
Q9CDT2_LACLA/2-267-----
CDSA_HELPY/9-254-----
CDSA_THEMA/5-265-----
YNBB_ECOLI/36-296-----
Q9KQR2_VIBCH/42-308-----
Q9I0U8_PSEAE/42-308-----
Q9CJK3_PASMU/41-307-----
CDSA_SYNY3/3-286-----
Q9M001_ARATH/110-397-----
CDS1_SOLTU/50-381-----
CDS1_YEAST/63-393-----
CDSH_SCHPO/53-384-----
CDS2_HUMAN/70-400-----
CDSA_DROME/84-410-----
CDSA_CAEEL/86-417-----
O83611_TREPA/5-282-----
CDSA_CHLTR/16-297-----
Q1PE48_ARATH/97-428-----
Q2G1Z6_STAA8/2-257-----
CDSA_BRUA2/6-257-----
Q8DRB2_STRR6/7-264-----
Q8ILZ6_PLAF7/262-592-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window