Sequence alignment for CL0234

PF01864

Y343_PYRHO/2-170KMNQL..LEAFWYILPAYFANS----------------------------------------------------------
Y832_METTH/5-171IINIIDVLYVIYFMLPAYMANI----------------------------------------------------------
Y1600_METJA/2-177FYRLL..FASLWYILPAYVANA----------------------------------------------------------
Y1740_ARCFU/1-179MLDLI..LKTIWLLLPCYTPNN----------------------------------------------------------

PF01148

O67497_AQUAE/11-189LRRKLFHFLSILLLIIPVKFFPFWLNVFLFLSAILLNLLIIFRVSPFYNIFEVFIKLFEREKNLET..............
Y1137_METJA/4-185IYRQTIHLVFGVLIAFSVLIFKKQ........LIIPLIVSIVIGICLYFLCKRYYIPIVSDLLNLC..............
O27426_METTH/7-183FFRQLIHATGIVFVILAGYLDTTS........MIILSLAAAICGEIIFQLDRRFYLPFFSVILRGC..............
O58680_PYRHO/7-198LKRKALHMTGLSVPLIYLALGKSAAI......TFVLIFLIIFLALEPFRLGEGLRIKVKEKLGIPEEVTEKIEREIDGIA
O28960_ARCFU/30-209VSRKFLHIMVGNIAFILPFFESR.........FVMAFLAAFPFVVLTFLMSPHSPVKLSSRTSVAG..............
P74653_SYNY3/44-231VTRKIVHIGAGQVVLIAWWLSIPGWV......GAIAGVFAAGIAVLSYRLPILPSLESVGRHSYGT..............
DGK1_SCHPO/16-216IPRKALHTSIGFFALLLQGCGYHAA.......QIIPVIEIGFIPAFTGDVIRFNWPAFSRLYNRVI..........GPLM
DGK1_YEAST/74-288IPRKVFHSSIGFITLYLYTQGINYK.......NVLWPLIYAFIILFILDLIRLNWPFFNMLYCRTV..........GALM
Y860_RICPR/10-204KKRKIFHISAIIFPMFYLFVPRI.........AIALLLFIITSITLYLDVIRHNNAKIRKFVTRFF.......SKIIRLK
Q9PEH9_XYLFA/3-282RTRVIAALVMAPVAMCSILFLPT.........AWLASLTAIIFLWGLWEWMKLSQVEDTLVRTVLL..............
CDSA_PSEAE/3-266KQRIITALVLLPIALGGFFLLEG.........AFFALFIGAVVSLGAWEWARLAGYEQQFGRVAYA..............
Q9CJL3_PASMU/3-287KERVLSAIMLIAIVFIALFFFSP.........FYFALAVGVVVILAVWEWTQFAHFKWSFWRLGLT..............
CDSA_HAEIN/3-287KQRVLSAIVLIAAVLCALFLFTP.........FYFALALGAVAILGIWEWTQFARLKQPLIRFFVT..............
Q9KPV7_VIBCH/2-280KQRIITALILAPLVILGILYLPF.........AWFMLALAVVTLLGFWEWTQFVNQPSRMLAMIPA..............
Q9K1G7_NEIMB/3-264KQRVITAMWLLPLMLGMLFYAPQ.........WLWAAFCGLIALIALWEYARMGGLCKIKTNHYLA..............
CDSA_RICPR/18-228YLRIISGIALVSLFVIAILCLK..........TLFYILMILVGLGMLSEWY.............................
Q98MC0_RHILO/5-258QLRVISAVVLAVIALGLTWLGG..........LPFRLLCAAMSAMIFYEWTRMSRPAAANGLSFLP..............
CDSA_BRUAB/5-257QTRIITAIVLGTITLWLTWVGG..........VGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG..............
Q9A708_CAUCR/16-269RTRVVSATVLVPTVVAAVWLGG..........YWFMALSLVCVGLLAREWGRISAPKAPNAVGAVV..............
Q9RU83_DEIRA/12-280STRVLTSVIGFLIVSALVWIGW..........WAMLPALIAVSFFGLSEYFRMLDRNDLDVRRLSL..............
O86769_STRCO/129-388GAAIGVGVGLGVVIIASLFVVK..........AVFVGVIAVAVVVGLWELTKRLEERKGIKAPLVP..............
CDSA_MYCLE/38-311PAAIAVGLSIGGVLVATLVFAP..........RIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPL..............
Q9KA68_BACHD/2-264KQRVVTAIIFGLVFLTFVVVGG..........LPFTMFIIVVATIAMSELLKMKKIAPFSPMGAFS..............
CDSA_BACSU/5-268KQRILTGVLAAIVFLFLVIVGK..........LPFTILIYAMGSVALFELLRMKKLKLVSLPGLIG..............
CDSA_STAAM/2-260KVRTLTAIIALIVFLPILLKGG..........LVLMIFANILALIALKELLNMNMIKFVSVPGLIS..............
Q99XY2_STRP1/2-264KERVVWGGVAVAIFLPFLIIGN..........LPFQLFVGVLAMIGVSELLKMKRLEVFSFEGVFA..............
Q97SR3_STRPN/6-267QKRTLFAGIALAIFLPILMIGG..........LLLQIAIGIIAMLAMHELLKMRGLETMTMEGLLT..............
Q9CDT2_LACLA/2-267MQRIITGVVAGGIFLALLLLGG..........AYFQILVALLVIIAMQELFRMYKLQVFSFEGILA..............
CDSA_HELPY/9-254KSRYITGFVLIIVADLILYADNL.........LLFWAVLGGIYAVGFSEALRLFQVKASFSLYLIL..............
CDSA_THEMA/5-265KTRVITASVVAPFVVLCFVSY...........ESLIGLVSAILILAGYELITLEMKERDARFFYVI..............
YNBB_ECOLI/36-296TLRIRTWWGIVICFSMVISGPR..........WMTLTFFALISFLALKEYCTLISVHFPR....................
Q9KQR2_VIBCH/42-308KLRIRSWWWMVAIVFVVLQLPL..........NYTLFFVGFLSFMALKEFLSIVPTRMTDRRVIFW..............
Q9I0U8_PSEAE/42-308NARINAWWAMVLVIGFAFWLGQ..........AAVILLFYGVSFYALREFITLTPTRRSDYPALVA..............
Q9CJK3_PASMU/41-307NARINAWWVMILIIFAAAFIGF..........YAVIALFFIISFMALREFLSLIYIRRGDHLALAA..............
CDSA_AQUAE/16-253MSREFYGVLIGVTTLLVIFLPK..........SLFLLVILFLCFAISREVSVALGENEVFYFSPLV..............
CDSA_SYNY3/3-286TQRIISAVIGIALAFSLLILGG..........WYFSAAIALVIYLGLREYFQMVRAKGIAPAAKTT..............
Q9M001_ARATH/110-397KKRVTFGLGIGLSVGGIVLAGG..........WVFTVAVAAAVLLSAREYFELVRSKGIAQGMTPP..............
CDSA_CHLPN/18-301FQRVVVHSLVLTFLVLLLYSSLFPLTS.....FALGFITATCGAVGTYEYSSMAKAKMHYPLSTFS..............
CDSA_CHLMU/15-298CQRLVVHSLLLVFLVILLCTSLYPSSA.....FIVGLLSSTCAAIGTYEMSSMVRMKFPFSFTRYS..............
CDS1_SOLTU/50-381LIRAYSSVWMIGGFAFIIYMGH..........LYIWAMVVVIQIFMAKELFNLLRRAHEDRHLPGF..............
Q9SZ17_ARATH/64-395WIRTCSSLWMLGGVVFIIYMGH..........LYIWAMVVVIQIFMAKELFFLRRRAHEERRLPGF..............
CDS1_YEAST/63-393FIRTVWTFVMISGFFITLASGH..........AWCIVLILGCQIATFKECIAVTSASGREKNLPLT..............
CDSH_SCHPO/53-384ITRTIWTFLLLGIFFTALAMGH..........FWVVLLVTIVQIGVYKEVIAIASVPSREKDLPWT..............
CDS2_HUMAN/70-400WVRGILTLAMIAFFFIIIYLGP..........MVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWF..............
CDSA_DROME/84-410VIRGIFTWIMICGFALIIYGGP..........LALMITTLLVQVKCFQEIISIGYQVYRIHGLPWF..............
CDSA_CAEEL/86-417VVRGLFSIIMISTFTFIVTRGA..........TWLMFLVFLIQFKCFQEIISIGLAVYRLYDFPWF..............
Q9NIH5_PLAFA/262-592KVRSQWTFILILLYFIILAAGH..........FYCSILVLILVTTLYKEIISLKSIENKDKKLPEI..............
O83611_TREPA/5-282IKRLLIFFFGVPTILMLVYAAPHAHF......LAFHLVIFGSVMGAVWEMHAMVSRRMCTYPLVLL..............

PF01864

Y343_PYRHO/2-170--------------------------------------------------------------------------------
Y832_METTH/5-171--------------------------------------------------------------------------------
Y1600_METJA/2-177--------------------------------------------------------------------------------
Y1740_ARCFU/1-179--------------------------------------------------------------------------------

PF01148

O67497_AQUAE/11-189......PGIQSLWAILGVFISYL.........................................................
Y1137_METJA/4-185.KREKEDGKGAIYFAIGMLISLI.........................................................
O27426_METTH/7-183..RRDDTERGFIYYFIGMTLTYS.........................................................
O58680_PYRHO/7-198REREKRGIGAHIYFTIAALLVIY.........................................................
O28960_ARCFU/30-209......HGLGLVYYSIAWTVLAY.........................................................
P74653_SYNY3/44-231...........LFYALSIGLLVG.........................................................
DGK1_SCHPO/16-216RESEKNAWNGVIFYMIGVWIVLK.........................................................
DGK1_YEAST/74-288RKKEIHTYNGVLWYILGLIFSFN.........................................................
Y860_RICPR/10-204ENNGTFALSGISFMMLGFFLTSI.........................................................
Q9PEH9_XYLFA/3-282.........TLNLLLMVLLVWVSAHTLVLFQIATLIGIAWWILALLWLRFLGFCADPNQRTAKIVKLTAGTLAVIPAWSA
CDSA_PSEAE/3-266.............ATVAVLMVALYHLPQLAGAVLLLALVWWTLATVLVLTYPESVGYWGGR..WRRLGMGLLILLPAWQG
Q9CJL3_PASMU/3-287..GLSAAFLFLWIYGESDYLNAGRVFENTLSLLLFSSVLWWFVALGLVISYPKGATYWGKNK.LLQFAFAFLTLVPFFAG
CDSA_HAEIN/3-287..TFLGVFIFLWLYTEGNYLDAGRVFEQHLQLLLINAVSWWGLALLLVISYPKSAKFWSKNP.LLQLLFAFSTLIPFVAG
Q9KPV7_VIBCH/2-280.....LLVGGISVALIDFQFPAISNMNTAHFIVLGIGSLWWLVSSGLAITYPRSRPLWEHSS.TVRHLFGLFTLLPFFWS
Q9K1G7_NEIMB/3-264.............ATLVFGVVAYAGGWMLPNLVWYVVLAFWLAVMPLWLRFKWRLNGG.....WQVYAVGWLLVMPFWFA
CDSA_RICPR/18-228...............................................................NMTYPSINYLLIGLIII
Q98MC0_RHILO/5-258...............EALVVVFIGALIAGLAASWLLLLVVVLIAVTAIAALVRKAGQWEVS..GLAYASVSGLSLALLRD
CDSA_BRUAB/5-257...........WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAA.......GLFYAGFSALSLSLLRG
Q9A708_CAUCR/16-269..........GVFCGIAVVAAFLQQFLVAWAVVLVGSFLAGLIA...................RGAVERRADAAYGVVYI
Q9RU83_DEIRA/12-280....GVFGTALIVASLPMFSEYAPWPGGSWREVVLTIAVGTLLVLEVIRPG............ERPLERVVYSLFGLLYI
O86769_STRCO/129-388......LAIGGAAMVVAGYARGAEGAWVAMALTALAVLVWRMTEPP.................EGYLKDVTAGLFAAFYV
CDSA_MYCLE/38-311.......LIGGQFTVWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPV.SNYLRDASATVFLAAWV
Q9KA68_BACHD/2-264........LLPMWMLLLPNDWFKVVIPDFTKVEIFIFFILFLLLLTVLTKN............TFTFDEAGFVILSSAYI
CDSA_BACSU/5-268........LLLLWMFLLPSQYSFFEADGISKMEIALFAVLLLLTYTVLVKN............TFTFDEVGFITLAAIYI
CDSA_STAAM/2-260..........AVGLIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKN............RFSFMDAAFCLMSVAYV
Q99XY2_STRP1/2-264........MLAAFVLAVPMDHYLTFLPIDANVAFYSLMVFFILAGTVLNSR............AYSFDDAAFPIATSFYV
Q97SR3_STRPN/6-267........LFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSK.............SYTIEDAVFPLAMSFYV
Q9CDT2_LACLA/2-267........TLAALSLALPVGKHWLGLNADGGVMLFTLFLFMMLTGMVLSNG............KYSFVDVGFPFLSAFYV
CDSA_HELPY/9-254...........VLSWVAAYFNGRPIECALISAMVMASVI........................AYQKAHHSEAILPFLYP
CDSA_THEMA/5-265..........LLALYPVLYGLVFEEPTQPLSILFITGVVFSLITDKDP...............SQVFKTVAAFSIALIYV
YNBB_ECOLI/36-296............WLYWGIPLNYLLIGFNCFELFLLFIPLAGFLILATGQVLVGDPSGFLHTV.SAIFWGWIMTVFALSHA
Q9KQR2_VIBCH/42-308.............AYLSIPFQYYWLSIGWYGMFIIFIPVYVFLYLPMVMVLIGDTKGFIRSA.GIIHWAMMLTVFCISHM
Q9I0U8_PSEAE/42-308............AFYFVLPMQYLLIYIDWYSMFSIFIPVYVFLLLPILASLGGDTKHFLERA.SKVQWGLMLAVFCISFV
Q9CJK3_PASMU/41-307............CFYVILPVQYYFVAIDWFSMFTIFIPVYAFLFLPILSALLGDASHFLDRS.TKVQWAIMISVFCISHI
CDSA_AQUAE/16-253.........................LLTYYFADPLVFPLIGLLSLYFAYK.............RWELNSFFKSTFLLFYP
CDSA_SYNY3/3-286........MVLSLMLLLSATVTPHLTDAFFPLTGALICFYLLFQPK.................MATIADISTSLLGLFYG
Q9M001_ARATH/110-397.PRYLSRVCSIICALMPILTLYFGHIDISITSAAFVVAMALLLQRG.................NPRFSQLSSTMFGLFYC
CDSA_CHLPN/18-301......AIGSFLFLALSFLSIRWGHSLPGFFDALPWTLLIVWVVWSIFRVRKST.........IGALQLSGVTLFSILYV
CDSA_CHLMU/15-298......SIGSAIFVALTCLTARCKMLLPEHVDLIPWFFLFFWTVHLVFKSRHYK.........LGPIGSTGLALFCMLYV
CDS1_SOLTU/50-381......RLLNWHFFFTAMLFVYGRMLSQRLVNTVTLDKFLYKLVGR.................FVKYHMVTCYFFYIAGF
Q9SZ17_ARATH/64-395......WLLNWHFFFTAMLFVYGRIIQQQLVNTVSSDRFIYKLVSG.................LIKYQMVICYFLYIAGL
CDS1_YEAST/63-393......KTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVT.....................NHKFICYCLYLMGF
CDSH_SCHPO/53-384......RFINWYFLMTTLYYAYGESIYAYFHHLFIMDSFMLPLVL.....................HHRFISFMLYIIGF
CDS2_HUMAN/70-400......RTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSK.....................YHRFISFTLYLIGF
CDSA_DROME/84-410......RSLSWYFLLTSNYFFYGENLVDYFGVVINRVEYLKFLVT.....................YHRFLSFALYIIGF
CDSA_CAEEL/86-417......RALSWYFLLTSNYFFFGESLIDYWGIVLKKDNFLHFLVA.....................YHRLVSFALYCIGF
Q9NIH5_PLAFA/262-592......FYIRWYWFFLTIMTLGIPWVIPKLKHQIPLYKFLLT........................YHSINMFILAFVGF
O83611_TREPA/5-282........IPFSLVLPLLGYAALWQPARGAESVLFIGALGTLLMSVFFTELVYSFSASF....ENALERMASALLLVLYP

PF01864

Y343_PYRHO/2-170---------------------------------------------------SPVVLGGGTPIDFGKKWRDGRR-------
Y832_METTH/5-171---------------------------------------------------SGLVFGGGKPLDMGITLADGRR-------
Y1600_METJA/2-177---------------------------------------------------SACIFGGGTPVDLGKNFIDGRR-------
Y1740_ARCFU/1-179---------------------------------------------------FAVLVGGGTPIDFGKTFVDGKR-------

PF01148

O67497_AQUAE/11-189.........................................LFGENAVVGIVVLALGDGFSGLVGYYF--GRR.....KL
Y1137_METJA/4-185.......................................LIDDIKAVFFGILVFAVGDSLATIIGIRG--KLK.......
O27426_METTH/7-183......................................LFGFNMAVANAAIIILTLGDSLSTIIGRRF--GKH.....PI
O58680_PYRHO/7-198........................................LFPREVAIGSISVATLGDAMAAIIGKSY--GRH.......
O28960_ARCFU/30-209......................................AFFDRPDVIAVGIMAMSYGDGLASLIGGRY--GKR....KFR
P74653_SYNY3/44-231....................................GFFSLGLPIFAAIGILVMAWGDGLAALVGQRW--GRH....RYQ
DGK1_SCHPO/16-216........................................VFPEEIAVMSVLLLSWCDTTASTVGRKW--GKY.....TP
DGK1_YEAST/74-288........................................FFSKDVTLISLFLLSWSDTAAATIGRKY--GHL.....TP
Y860_RICPR/10-204........................................LFPKNLVICSWLILIISDCLAALVGIKI--GSS.......
Q9PEH9_XYLFA/3-282LVLL.......................HSGDKPGSTFPESLHAHLWLLTAQIMVWAADSGAYFAGRLF--GKH...KLAP
CDSA_PSEAE/3-266LVLL.................................KQWPLANGLIIAVMVLVWGADIGAYFSGKAF--GKR...KLAP
Q9CJL3_PASMU/3-287VLRL...........................RLAHYVTDPYHGLILLLYVFILVWSADSGAYFAGRQF--GKN...KLAP
CDSA_HAEIN/3-287VLRL...........................RLEHYTHDPYHGLFLLLYVFILVWAADSGAYFSGRAF--GKR...KLAP
Q9KPV7_VIBCH/2-280VLFL...........................RADTYLSDPLYGAKLVLFVCFLVWAADSGAYFVGKSL--GKH...KMAP
Q9K1G7_NEIMB/3-264LVSL.................................RPHPDDALPLLAVMGLVWVADICAYFSGKAF--GKH...KIAP
CDSA_RICPR/18-228PIPI...........................SLLIFLSMEESNRLVIMLYFCILWSVDTFAMIGGKTF--KGI...KLAP
Q98MC0_RHILO/5-258GDHS......................................GLVAILFLFAVVWATDIFAYFVGRAV--GGP...KLAP
CDSA_BRUAB/5-257DEPF......................................GFTTIVFLFAVVWSTDITAYFNGRAL--GGP...KLAP
Q9A708_CAUCR/16-269APAV...........................IAMVWVRSLDDGLWWTLLLFVVTWFADIFAYVTGSIL--KGP...KLWP
Q9RU83_DEIRA/12-280PWLL........................GYFMLLRYSPDGQQGLLYFALPLLATFAADIGGFFAGHFF--GRR...KLAP
O86769_STRCO/129-388PFLA...........................TFVAMMLAADDGAWRVLVFLILTVVSDTGAYAVGWRF--GRK...KLAP
CDSA_MYCLE/38-311PLFA...........................SFAALLVYPKDGAGRVFCLMIAVVASDVGGYTVGVLF--GKH...PLVP
Q9KA68_BACHD/2-264GYGF..........................HFLLLSREIPEIGLPLVFFVLFVIWATDSGAYFAGRAF--GKH...KLWP
CDSA_BACSU/5-268GMCF..........................HYFIEIRNLDQYGLTYIFYACVVIWSTDSGAYFVGKSL--GKR...KLWP
CDSA_STAAM/2-260GIGF.............................MFFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMM--GKH...KLWP
Q99XY2_STRP1/2-264GIGF.............................QHLINARLSGIDKVFLALFIVWATDIGAYLIGRQF--GRR...KLLP
Q97SR3_STRPN/6-267GFGF.............................NALLDARVAGLDKALLALCIVWATDSGAYLVGMNY--GKR...KLAP
Q9CDT2_LACLA/2-267GIGF.............................QNLLTARQTSVYIVFLALFIVWATDIGAYAFGRSL--KDRFPQKLLP
CDSA_HELPY/9-254GVGF............................FALFGVYKDFGAVAIIWLLVVVVASDVGAFFGGKLL--GKT....PFT
CDSA_THEMA/5-265TFFL............................SFFLPIYRDFGAANALLVLTSTWVFDSFAYFTGLKF--GRT...RISP
YNBB_ECOLI/36-296AWLL.............................MLPTTNIQGGALLVLFLLALTESNDIAQYLWGKSC--GRR...KVVP
Q9KQR2_VIBCH/42-308AYLL............................VLPSLNPDAGSLGMLLFLLVMTQFNDVAQYVWGKSF--GKH...KIVP
Q9I0U8_PSEAE/42-308PALL............................TLDIPGFEGRNLLLIAYLVIVVQLSDVMQYICGKLF--GKR...KIAP
Q9CJK3_PASMU/41-307PAIL............................TLDIVGFENKNLLLMIFLILVVQSSDVLQYVWGKLF--GKH...KIAP
CDSA_AQUAE/16-253ALFL.............................VYLIKIKEISTYYLLIFIFGIWINDVFAYYIGKNF--GKT...PLFP
CDSA_SYNY3/3-286GYLPSYWVRLRLGDGAVNPMGLHLPLNGFWPESWAHPENFPTGLLVTILAFACIWAADIGAYIMGKWL--GRT....RLS
Q9M001_ARATH/110-397GYLPCFWVKLRCG...LTAPVLNTGIGRSWPTILGGQAHWTVGLVAILISFCGIIASDTFAFLGGKAF--GRT....PLI
CDSA_CHLPN/18-301GIPI....................RLFLHVLYSFIHTQEPYLGIWWASFLIATTKGADIFGYFFGKAF--GNK...KIAP
CDSA_CHLMU/15-298SVPI....................RLFLHILYGFVHTDTPFIGIWWAIFLIATTKSSDIFGYFFGKAF--GKK...RIAP
CDS1_SOLTU/50-381MWFILTLKKKMYKYQFSQYAWTHMILIVVFTQSAFTVANIFEGIFWFLLPASLIVINDIAAYFFGFFF--GRT....PLI
Q9SZ17_ARATH/64-395IWFILTLKNKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPAALIAMNDVAAYFFGFYF--GKT....PLI
CDS1_YEAST/63-393VLFVCSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLCGITF--GKT....KLI
CDSH_SCHPO/53-384VLFVASLKKGNYKFQFSQFCWTHMTLLLVVGQSHFMINNLFEGLFWFFVPVCYVVCNDVFAYLCGKMF--GKH....PLI
CDS2_HUMAN/70-400CMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFF--GRT....PLI
CDSA_DROME/84-410VWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFF--GRT....PLI
CDSA_CAEEL/86-417VSFVLSLRKGYYMRQFSLFAWTHLTLLLIVSQSFFIIQNIFQGLIWFLAPVAMIICCDIMSYMFGFFW--GKT....PLI
Q9NIH5_PLAFA/262-592VWFILSLRKFSLKYQFSQIGIILLSSLFIVTQSLMHIANIYSGMIWFIVPVSSVVINDIFAYVFGILF--GKT....RLI
O83611_TREPA/5-282GIFS...........................LFFSLITRWRHAEIALVIFFLMVFTCDSCAWFCGTLW--GVN..NRGII

PF01864

Y343_PYRHO/2-170ILGDGKTWRGFFGGLIVGTIIGIVQYFLLP.......EYY----------------------------------------
Y832_METTH/5-171LIGDGVTWRGTAAGTFVGLVVGIIQGLL...........S----------------------------------------
Y1600_METJA/2-177LIGNGVTYRGCIFGILCGTLVGLIQGILVDFNIFNSLDFY----------------------------------------
Y1740_ARCFU/1-179ILGDGKTWRGFVGGVAGGVLTANLQYAIEKLSG.LAIYSS----------------------------------------

PF01148

O67497_AQUAE/11-189FYNPKKSLEGTLAFFTASFLGLLLF.......................................................
Y1137_METJA/4-185IKYFGKTVEGFLAFFISASLILYPFYG.....................................................
O27426_METTH/7-183PLKHDKSIEGSAAFLAAGFLGSLFF.......................................................
O58680_PYRHO/7-198RFKNGKSVEGSLAYFITGLLI...........................................................
O28960_ARCFU/30-209ILGDEKSLEGSVAMFLGCVASFSVVSLYYHG.................................................
P74653_SYNY3/44-231VFGFRKSWEGTLTMVLASFLVTVVFLS.....................................................
DGK1_SCHPO/16-216KIAKNKSLAGSLGAFVCGVFCCYVYWGLFRTGPDSLAA..........................................
DGK1_YEAST/74-288KVARNKSLAGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPE.................................
Y860_RICPR/10-204.LSNGKSIAGSFTFFVSALFISILVYFY....................................................
Q9PEH9_XYLFA/3-282QISPNKTVEGLLGGILTGLAVATGFGLLNGVTM...............................................
CDSA_PSEAE/3-266RVSPGKSWEGVYGGLAASLAITLAVGLYRGWSL...............................................
Q9CJL3_PASMU/3-287KVSPGKSWEGVIGGLVTAGILASIFIHFTQESLLSG............................................
CDSA_HAEIN/3-287KVSPGKSWEGVIGGLITALVLAFIFIHFSNNTLVGD............................................
Q9KPV7_VIBCH/2-280AVSPNKTIEGLVGGIVTAMLVGYWVAECFGIQF...............................................
Q9K1G7_NEIMB/3-264AISPGKSWEGAIGGAVCVAVYMTAVRSAGWLAFD..............................................
CDSA_RICPR/18-228KISPKKTWTGLITGTVSAGLVSVLVSLIPNYHIEHYYF..........................................
Q98MC0_RHILO/5-258SISPGKTRSGALGGAFGGVVAGVMLAAGAGA.................................................
CDSA_BRUAB/5-257RFSPNKTWSGAIGGAAAAVAGGLLVASLVAA.................................................
Q9A708_CAUCR/16-269RISPNKTWAGFVGGLAAATIGAVVVASLAKLD................................................
Q9RU83_DEIRA/12-280EVSPGKTVEGAIGGLAFGFVVVLVVSQLAGI.................................................
O86769_STRCO/129-388RISPGKTREGLLGAIAFAMVAGALCMQFLIDD................................................
CDSA_MYCLE/38-311RISPNKSWEGFAGSLVCGTTATILTATFLAG.................................................
Q9KA68_BACHD/2-264HISPNKTIEGSIGGIILAVIIGSLFYWIMPLF................................................
CDSA_BACSU/5-268EISPNKTVEGFAGGIVIALVLATIFQLVAQLP................................................
CDSA_STAAM/2-260VISPNKTIEGFIGGLFCSLIVPLAMLYFVDFN................................................
Q99XY2_STRP1/2-264TVSPNKTIEGSLGGIACAVLVSFIFMVIDRSVYAP.............................................
Q97SR3_STRPN/6-267RVSPNKTLEGALGGILGAILVTIILMIVDSTVALP.............................................
Q9CDT2_LACLA/2-267SVSPNKTVVGSVGGIVSAVVVALVMYFLFTKELPQ.............................................
CDSA_HELPY/9-254PTSPNKTLEGALIGVVLASVLGSFVGMGKLS.................................................
CDSA_THEMA/5-265RYSPRKSLEGVIGGFLGVVIYTFLYRLVVNDLLSVNV...........................................
YNBB_ECOLI/36-296KVSPGKTLEGLMGGVITIMIASLIIGPLLTP.................................................
Q9KQR2_VIBCH/42-308KVSPNKTWQGFIGGTLTVVTVSYFAAPYLTP.................................................
Q9I0U8_PSEAE/42-308NLSPSKTVEGFVGGIALATAIGASLWWITP..................................................
Q9CJK3_PASMU/41-307TLSPSKTVEGFAGGILSASILGGLLYWLTP..................................................
CDSA_AQUAE/16-253KISPKKTVEGFLGGVLFGSLFFALTLP.....................................................
CDSA_SYNY3/3-286DISPKKTVEGSLWGVGGSLLVGVLGAWYLQWP................................................
Q9M001_ARATH/110-397SISPKKTWEGAFAGLVGCISITILLSKSLSWP................................................
CDSA_CHLPN/18-301QISPNKTVVGFVAGCLGATLISFIFFLQIPTRFASYF...........................................
CDSA_CHLMU/15-298VISPNKTVVGFVAGCIASILVSLIFYSHLPKSFANQI...........................................
CDS1_SOLTU/50-381KLSPKKTWEGFIGASITTIISAFLLANMFGRFQWLTCPRKDLSTGWL......DCDPGPLFKPEYFTLPEWF....PAWF
Q9SZ17_ARATH/64-395KLSPKKTWEGFIGASVATIISAFIFANVLGQFQWLTCPRKDFSTGWL......HCDPGPLFRPEYYPFPSWI....TPFS
CDS1_YEAST/63-393EISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTNFFSN...LTCELNPVFLPQVYRLPPIF....FDKV
CDSH_SCHPO/53-384QVSPKKTVEGFLGGWICTVVIGSLISYVLMHFKYFICPTRDLSTSAFSG...LNCTPNSVFLPHTYTIPAVFV...DTFR
CDS2_HUMAN/70-400KLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFT...VDCEPSDLFRLQEYNIPGVI....QSVI
CDSA_DROME/84-410KLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMT...MSCVPSYLFTPQEYSL........KLFG
CDSA_CAEEL/86-417KLSPKKTWEGFIGGAFSTVVFGILLSLALYNRPFFVCPVQHYQTDSS......NCTIPLAFQLQDYPVPRPFSFVYKILR
Q9NIH5_PLAFA/262-592QLSPKKTVEGYVGSSIITIVWGILITYFLQRYKFFICPQKYITFQPFVSWNYIDCDINPIFQQKVYEVPKQI....SQIL
O83611_TREPA/5-282PASPKKSIAGFIGGFAGSVGAGCFGSLVFGSRVT..............................................

PF01864

Y343_PYRHO/2-170--------GSLGIAIELAFLLSLGTLVGDLIGSFIKRRLNM-PRGYPAVGLDQWGFLIAALCFA..YP..VKTIPTGEVL
Y832_METTH/5-171--------GSIIIGVITGLLLGFGALMGDAAGSFIKRRLKI-DRGRPAPILDQLDFVFGALILV..SP..IVVLPIDYII
Y1600_METJA/2-177--------GTVLDHVILAFFLSVGAIVGDAVGSFIKRRLNI-ERGKPAPLLDQLDFVIGALAFG..YI..VAPIPYEMII
Y1740_ARCFU/1-179--------LPFNEFFTLTFLLAFGAMFGDLCGSFIKRRFGY-ERGSRFLIVDQLMFLLVALLIASLYPPFWKLFTAEIIA

PF01148

O67497_AQUAE/11-189........TDFCEAFVISLICAVLESLPL.......................KLD---------------------DNFY
Y1137_METJA/4-185...............TYGIFVALISAFIEFVSKKI.................RID---------------------DNLY
O27426_METTH/7-183........VEPIHALTGAITGMLVEAYT........................PVE---------------------DNIV
O58680_PYRHO/7-198........LTPLVGLKMALLASLVGMIVEFYGL...................PPD---------------------DNFS
O28960_ARCFU/30-209........SAGPLLLPLAAFATVVEAVTP.......................KGL---------------------DNLS
P74653_SYNY3/44-231........YTFGFTVIVLVVAGTVAIASAGLESFSR................WGI---------------------DNLT
DGK1_SCHPO/16-216........QSRIPFPWLCLINGFIGAFAEAMDVW..................GLD---------------------DNLV
DGK1_YEAST/74-288........TSRLSLNMLSLLGGVVAALSEGIDLF..................NWD---------------------DNFT
Y860_RICPR/10-204........LGYNTSFVIIIISCIGATAVEFYSKYL.................RIN---------------------DNLS
Q9PEH9_XYLFA/3-282........TQFPSLLLVSFVAILASVIGDLFESLLKRHAGIKDSGSMIPGHGGVL---------------------DRID
CDSA_PSEAE/3-266........GALLLALLGAALVVFVSIVGDLTESMFKRQSGIKDSSNLLPGHGGVL---------------------DRID
Q9CJL3_PASMU/3-287........ISIPAFIALSVATVAVSILGDLTESMFKRQSGIKDSSQLIPGHGGIL---------------------DRID
CDSA_HAEIN/3-287........RNITGFIILSVATVAISVLGDLTESMFKRESGVKDSSQLIPGHGGVL---------------------DRID
Q9KPV7_VIBCH/2-280........SSMPVMLLIILLTVVISVLGDLVESMFKRVSGIKDSSNIIPGHGGIL---------------------DRID
Q9K1G7_NEIMB/3-264........TGWFDTVLIGLVLTVVSVCGDLLESWLKRAAGIKDSSKLLPGHGGVF---------------------DRTD
CDSA_RICPR/18-228........SNKIYLFIISCILALIAQSSDLFISYFKRKFNIKDSGHIIPGHGGVL---------------------DRFD
Q98MC0_RHILO/5-258........GNLALLGLVALALSIVAQAGDLFESWVKRRHGRKDSGVLIPGHGGVM---------------------DRVD
CDSA_BRUAB/5-257........PGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVL---------------------DRVD
Q9A708_CAUCR/16-269........LIWQAAALIGLLGGLATMAGDLWESMLKRRFGVKDSGDLIPGHGGLL---------------------DRVD
Q9RU83_DEIRA/12-280........WTPLQAFLYSVLVASASQLGDLSESLIKRALRTKDSGNSLPGHGGFL---------------------DRLD
O86769_STRCO/129-388........GAWWQGLLLGLVVAVSATLGDLGESMIKRDLGIKDMGTLLPGHGGIM---------------------DRLD
CDSA_MYCLE/38-311........KTPWVGALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLM---------------------DRLD
Q9KA68_BACHD/2-264........SSYGVALAVIVVASVFGQLGDLVESALKRHYAVKDSGTVLPGHGGIL---------------------DRFD
CDSA_BACSU/5-268........IPYIYLLLITLFLSVFGQLGDLVESALKRHYDVKDSGNILPGHGGIL---------------------DRFD
CDSA_STAAM/2-260........MNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL---------------------DRFD
Q99XY2_STRP1/2-264........HHFLTMLVLVALFSIFAQFGDLVESALKRHFGVKDSGKLIPGHGGIL---------------------DRFD
Q97SR3_STRPN/6-267........YGIYKMSVFAIFFSIAGQFGDLLESSIKRHFGVKDSGKFIPGHGGVL---------------------DRFD
Q9CDT2_LACLA/2-267........IGFVKLVIFTIIFSVVGQIGDLVESSIKRHFGVKDSGKILPGHGGIL---------------------DRFD
CDSA_HELPY/9-254........GGFFMALFFSFLIALVAVFGDLYESYLKRKVGIKDSGKILPGHGGVL---------------------DRLD
CDSA_THEMA/5-265........ISFRTFLPFAATVAIMDTFGDIFESALKRHYGVKDSGKTLPGHGGML---------------------DRID
YNBB_ECOLI/36-296........LNTLQALLAGLLIGISGFCGDVVMSAIKRDIGVKDSGKLLPGHGGLL---------------------DRID
Q9KQR2_VIBCH/42-308........LTAAQGLVGGVIIALSGFIGDLVISSVKRDLRIKDTSQFIPGHGGIL---------------------DRVD
Q9I0U8_PSEAE/42-308........FNLWQAALIALLINLLGFFGGLVMSAIKRDRGVKDWGHMIEGHGGML---------------------DRLD
Q9CJK3_PASMU/41-307........FSPLQAFLMSLLICLMGFLGGLVMSAIKRSMGVKDWGNMISGHGGML---------------------DRMD
CDSA_AQUAE/16-253........YGILNSFLLGTFVLTVGVAGDYFKSFIKRQVGIKDFSNVFGEHGGFT---------------------DRFD
CDSA_SYNY3/3-286........YWEITGALLGLLIGIVSLLGDLTESMMKRDAGVKDSGQLIPGHGGIL---------------------DRTD
Q9M001_ARATH/110-397........QSLVSTIAFGVLNFFGSVFGDLTESMIKRDAGVKDSGSLIPGHGGIL---------------------DRVD
CDSA_CHLPN/18-301........PMPAILIPLGLALGITGFFGDIIESIFKRDAHLKNSNK.LKAVGGML---------------------DTLD
CDSA_CHLMU/15-298........AMPWILVALGIILGISGFFGDIIESTFKRDAQIKNSSD.LESIGGML---------------------DVLD
CDS1_SOLTU/50-381LSREIAVLPVQWHALLLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGMT---------------------DRMD
Q9SZ17_ARATH/64-395PWKGISTLPVQWHAFSLGLFASIMAPFGGFFASGFKRAFKIKDFGDSIPGHGGFT---------------------DRMD
CDS1_YEAST/63-393QINSITVKPIYFHALNLATFASLFAPFGGFFASGLKRTFKVKDFGHSIPGHGGIT---------------------DRVD
CDSH_SCHPO/53-384LPETITLAPIYFHLAIFATFSSLIAPFGGFFASGLKRAFKIKDFGASIPGHGGLT---------------------DRMD
CDS2_HUMAN/70-400GWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIM---------------------DRFD
CDSA_DROME/84-410IGKTLNLYPFIWHSISLSLFSSIIGPFGGFFASGFKRAFKIKDFGDMIPGHGGIM---------------------DRFD
CDSA_CAEEL/86-417KEPIIQLCPFVFHSIALSLFASILGPFGGFFASGFKRAFKIKDFGDVIPGHGGLM---------------------DRFD
Q9NIH5_PLAFA/262-592SIKNIYYSKMIFHGLMLSLFAAFLAPFGGFFASGFKRALKIKDFGKSIPGHGGVT---------------------DRFD
O83611_TREPA/5-282........LSLGMLMGVGALVGLTAIVGDLVESVMKRSAQVKDSGFFTPGRGGIM---------------------DNLD

PF01864

Y343_PYRHO/2-170FLLVITPLIHWGANIFAYKMGWKKVPW
Y832_METTH/5-171LIMLITLVLHLSANIIAYLLGMKDVWY
Y1600_METJA/2-177IICLFTVFVHLLGNIIAYKLGIKDVWW
Y1740_ARCFU/1-179LAVIITPALHMGINYIAYRLNLKEVPW

PF01148

O67497_AQUAE/11-189IPVLASFLGE.....V-----------
Y1137_METJA/4-185LPFIVAFIINHQINIC-----------
O27426_METTH/7-183IPLVVGAILL.....I-----------
O58680_PYRHO/7-198NQLAIAITLY.....L-----------
O28960_ARCFU/30-209VSILTAILYF.....W-----------
P74653_SYNY3/44-231VPLGSALIAWAGSYLW-----------
DGK1_SCHPO/16-216IPVVSACLLY.....L-----------
DGK1_YEAST/74-288IPVLSSLFMNAVIKTF-----------
Y860_RICPR/10-204IPLSYCLSTTIFPYIL-----------
Q9PEH9_XYLFA/3-282STLAALPVFALGKDIF-----------
CDSA_PSEAE/3-266SLTAAIPVFAALLWAA-----------
Q9CJL3_PASMU/3-287SLTAAVPFFAYFYFFV-----------
CDSA_HAEIN/3-287SLTAAVPFFSYFYFFV-----------
Q9KPV7_VIBCH/2-280SLTAAFPVFALLYFLF-----------
Q9K1G7_NEIMB/3-264SLIAVISVYAAMMSVL-----------
CDSA_RICPR/18-228SIILTAPVFFCINIYL-----------
Q98MC0_RHILO/5-258GLVAAALALYVIGWIS-----------
CDSA_BRUAB/5-257GLVAAAALLYLFGAIF-----------
Q9A708_CAUCR/16-269GLMFAAIVIAAVRLVD-----------
Q9RU83_DEIRA/12-280SLMFAVPATYFFLNIS-----------
O86769_STRCO/129-388SLLPTAPVVWLLLVIF-----------
CDSA_MYCLE/38-311GVLPSAVVAWTMLTLL-----------
Q9KA68_BACHD/2-264SLIYVMPILH.LLHLL-----------
CDSA_BACSU/5-268SFLFVMPFLYFLLALF-----------
CDSA_STAAM/2-260SFMFVLPLLNILLIQS-----------
Q99XY2_STRP1/2-264SMIFVFPIMH.LFGLF-----------
Q97SR3_STRPN/6-267SMLLVFPIMH.LFGLF-----------
Q9CDT2_LACLA/2-267NLIFVFPIMH.LLGLF-----------
CDSA_HELPY/9-254SMLFGALGLHALLYFL-----------
CDSA_THEMA/5-265GLLFVAPVSYIVFKIL-----------
YNBB_ECOLI/36-296SLIFTAPVFFYFIRYC-----------
Q9KQR2_VIBCH/42-308SLMFTAPLFFHYLYYL-----------
Q9I0U8_PSEAE/42-308SVCFAAPIFFHVVRYW-----------
Q9CJK3_PASMU/41-307SLCFAAPIFFHVVRYY-----------
CDSA_AQUAE/16-253ALVFSAPVFYLIMCAG-----------
CDSA_SYNY3/3-286SYVFTAPLVYYFVVLL-----------
Q9M001_ARATH/110-397SYIFTGALAYSFVRLH-----------
CDSA_CHLPN/18-301SLLLSTPIAYLFLLIT-----------
CDSA_CHLMU/15-298SLLLSTPIVYAILLIT-----------
CDS1_SOLTU/50-381CQMVMAVFAYIYHQSF-----------
Q9SZ17_ARATH/64-395CQMVMAVFAYIYIQSF-----------
CDS1_YEAST/63-393CQFIMGSFANLYYETF-----------
CDSH_SCHPO/53-384CQFLNGVFVYMYFQSF-----------
CDS2_HUMAN/70-400CQYLMATFVNVYIASF-----------
CDSA_DROME/84-410CQFLMATFVNVYISSF-----------
CDSA_CAEEL/86-417CQLLMGTFVMVYIHSF-----------
Q9NIH5_PLAFA/262-592CQIFIGMFTYIYMKTF-----------
O83611_TREPA/5-282SLAPSLGTFYIACECF-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window