Sequence alignment for CL0235

PF03357

CHM2A_HUMAN/17-187QNQRALNRAMR-ELDRERQKLETQE--KKIIADI....KKMAKQ.....GQ...........MDAVRIMAKDLVRTRRYV
Q9U2F6_CAEEL/17-187QNQRALNKAIR-ELDRERARMEAQE--KKVIADI....KNMAKK.....NQ...........MDSVKVMAKDLVRTRRYI
Q9VBI3_DROME/17-187KNQRALNKAMR-DLDRERMKMEQQE--KKIIADI....KKMAKE.....GQ...........MDAVKIMAKDLVRTRRYA
VPS2A_ARATH/18-188ENKRMLDKSIR-EIERERQGLQTQE--KKLINEI....KKTAKQ.....GQ...........MGAVKVMAKDLIRTRHQI
VPS2C_ARATH/16-186ESKREMTQATR-GIEKEIGSLQSEE--KKLVLEI....KRTAKS.....GN...........EGATKILARQLIRLRQQI
CHM2B_HUMAN/16-186EQNRELRGTQR-AIIRDRAALEKQE--KQLELEI....KKMAKI.....GN...........KEACKVLAKQLVHLRKQK
Q9VRJ5_DROME/18-188ENDRSLRKATR-DIERERRKMEEEE--RKLELEI....RRNAAA.....GN...........NDACRILAKQLVEIRKQK
VPS24_YEAST/19-190RIRSVLRKNGR-NIEKSLRELTVLQ--NKTQQLI....KKSAKK.....ND...........VRTVRLYAKELYQINKQY
Q9VN02_DROME/18-188EWTHKIRKEGN-QLDRQIRSIQREE--EKVKRSL....KQAAQK.....ND...........RDTCVILAKEIVNARKAI
CHMP3_HUMAN/18-188EWSLKIRKEMR-VVDRQIRDIQREE--EKVKRSV....KDAAKK.....GQ...........KDVCIVLAKEMIRSRKAV
O16458_CAEEL/11-197VPPPDLNNAIS-NVESRSDSIDKKI--QKLDQDL....MKLRDQ.....MSKMREGPSKNLIKQKALRVLKQKRMYENQK
CHMP5_HUMAN/12-197APPPSLTDCIG-TVDSRAESIDKKI--SRLDAEL....VKYKDQ.....IKKMREGPAKNMVKQKALRVLKQKRMYEQQR
CHMP5_DROME/12-197EPGPSLNDCIA-GVDARATNIEEKI--SNLEAEL....RKYREQ.....MSKMREGPAKNSVKQKALRVLKQKKAYEQQA
Q9FTZ4_ORYSJ/12-208DPPPSIQDATE-RINKRGESVDDKI--KKLDEEL....GRYKEQ.....IRKTRPGPSQDAIKARAIRLLKHKRMYEEQR
Q9LPN5_ARATH/12-209EPPPSIQDASD-RINKRGDSVEDKI--KKLDVEL....CKYKEQ.....LKKTRPGPAQEAVKARAMRVLKQKKMYEGQR
YQ56_SCHPO/12-203QPTASLTDAID-SLDKRSDSVEVKI--AKLDAQL....SVFQQK.....IANTRPGPGQTALKQRAMNVLRQKKIYESQL
VPS60_YEAST/19-204ESNQSMNQAQQ-SLSNRISQLDTQI--AQLNFQLQNIQKNLQRS.....NNKQ......PSLRKQALKILNKRKQLENMK
Q18886_CAEEL/21-195ESIQKLRETEE-MLEKKQEFLEKKV--ID.EKQN....AVKYGT.....KN...........KRMALQCLNRKRNFEKQL
Q22916_CAEEL/21-195ESIQKLRETED-ILEKKQEFLEKKI--DDVRKQN....AVKYGT.....KN...........KRMALQCLSRKKAFEKQL
CHM4A_HUMAN/21-199EAIQKLKETEK-ILIKKQEFLEQKI--QQ.ELQT....AKKYGT.....KN...........KRAALQALRRKKRFEQQL
CHM4C_MOUSE/24-193EALARLRETEE-MLAKKQEYLENRI--QR.ELAL....AKKHGS.....QN...........KRAALQALKRKKRFEKQL
CHM4B_HUMAN/24-199EAIQRLRDTEE-MLSKKQEFLEKKI--EQ.ELTA....AKKHGT.....KN...........KRAALQALKRKKRYEKQL
Q8T0Q4_DROME/20-194EAIQKLRETEN-MLIKKQEFLEAKI--ED.ELNI....ARKNAS.....KN...........KRVALQALKKKKRLEKQL
Q21959_CAEEL/38-211EAIGNLRDAEE-LLIKKQEYFELRI--EQ.EVES....AKKYMK.....TN...........KKMALAALRKKKHYEQEL
SNF7_SCHPO/19-193DTIVRFQEMLA-LYDKKEEVLERQI--AE.QTEI....ARKNAT.....TN...........KRLALTALKRKKMHENEL
VP322_ARATH/17-189QTLDKLNETLE-MLEKKEKVLLKKA--GAEVEKA....KEYSRA.....KN...........KRAAIQCLKRKRLYEGQV
SNF7_YEAST/21-207KAIVRLREHIN-LLSKKQSHLRTQI--TNQENEA....RIFLTK.....GN...........KVMAKNALKKKKTIEQLL
Q22718_CAEEL/216-386ASVVDIRKAMN-KLDREIQQLEQKV--KKYDEQC....RACLRT.....GD...........KGRAQNFLRQRKRAEKDI
VPS20_YEAST/15-187RAILEVKRSKD-EIHKFTRRTDNLI--LVEKSQL....KDLIRKNPENYKS...........NMKVRFLLKRIHYQEHLL
VP201_ARATH/16-194RAILSLKTQRR-KLGQYQQKLEKVI--EAEKQAA....RDLIRE.....KR...........KDRALLALRKKRTQEELL
CHMP6_HUMAN/18-178KAILQLKQQRD-KLRQYQKRIAQQL--ERERALA....RQLLRD.....GR...........KERAKLLLKKKRYQEQLL
Q9BL60_CAEEL/22-185NAILALKTQRD-KMKQMIKRKENCL--EKERQLA....KQLIKD.....GR...........KDRALLLLKKKRYQEKII
Q9W236_DROME/22-187KAVLQLKQQRD-RLKQYQKRIETQL--ENDRLLA....RKCLQQ.....GR...........KDRAKLLLRKKKYQESLL

PF04012

Q9A5T5_CAUCR/2-230SIWSKLSALFRGAAHDGAQTVVDANALRILDQEIRDADSAQGKA------------------RDELAKLVARRRALETEV
O67361_AQUAE/3-233GLLKRLLRVVRAEAHSVVEKLEDPI..KITEEGLRELRKQLKEA------------------MEALAQVKASQIRFEREA
Y617_SYNY3/2-238GLFDRLGRVVRANLNDLVSKAEDPE..KVLEQAVIDMQEDLVQL------------------RQAVARTIAEEKRTEQRL
Q9KDL6_BACHD/1-220MVFDRMKNLVLASIHEGLDKLEDPE..MMLNQYIRNVQSEMGRA------------------EKAIEEQKKLHVSLERDL
Q9KRG4_VIBCH/2-219GIFSRFADIVNSNISALLDKAEDPE..KMIRLIIQEMEDTLVEV------------------RTNSAKAMADKKELARKV
PSPA_DEIRA/2-219SIFDRLSRLLRANVNDMISKAEDPA..KIIDQALRDMRSAYADA------------------RNEVAGAMAQAAKLEREA
P74717_SYNY3/2-218ELFNRVGRVLKSQLTHWQQQQEAPE..DLLERLLGEMELELIEL------------------RRALAQTIATFKSTERQR
LIAH_BACSU/1-221MVLKRIRDMFVASVHEGLDKMENPK..VMLNQYVRDMESDIAKA------------------KQTIVKQHTIAYQFKKKY
Q9HXR1_PSEAE/2-230TVWSKLLSALRGGANEVGEAIVDSQALRILDQEIRDADVELRKS------------------REALASIMARHRLAQERV
YJFJ_ECOLI/2-232GILKSLFTLGKSFISQAEESIEETQGVRMLEQHIRDAKAELDKA------------------GKSRVDLLARVKLSHDKL
35KD_MYCTU/3-242NPFVKAWKYLMALFSSKIDEHADPK..VQIQQAIEEAQRTHQAL------------------TQQAAQVIGNQRQLEMRL

PF03357

CHM2A_HUMAN/17-187RKFVLMRANIQAVSL--------------------KIQTLKSNNSMAQAMKGVTKAMGTM..NRQLKLPQIQKIMMEFER
Q9U2F6_CAEEL/17-187KKFIVMKANIQAVSL--------------------KVQTLKSQDAMASAMKGVTKAMQSM..NRQLNLPQIQKIMMEFEK
Q9VBI3_DROME/17-187KKFMLMKANIQAVSL--------------------KIQTLKSQNTMAQAMKGVTKAMQNM..NRQLNLPQIQKILQDFEK
VPS2A_ARATH/18-188EKFYKLKSQLQGVSL--------------------RIQTLKSTQAMGEAMKGVTKAMGQM..NRQMNLPSLQKIMQEFER
VPS2C_ARATH/16-186ANLQGSRAQMRGIAT--------------------HTQAMHAHTSVAAGMQGATKAMAAM..SKNMDPAKQAKVMREFQK
CHM2B_HUMAN/16-186TRTFAVSSKVTSMST--------------------QTKVMNSQMKMAGAMSTTAKTMQAV..NKKMDPQKTLQTMQNFQK
Q9VRJ5_DROME/18-188SRTYAAAGKIQSIGY--------------------QNKNMGANIALSEAMGTTAKTMGEM..NKVMRPEAIGETVRQFQA
VPS24_YEAST/19-190DRMYTSRAQLDSVRM--------------------KIDEAIRMNTLSNQMADSAGLMREV..NSLVRLPQLRNTMIELEK
Q9VN02_DROME/18-188NRIYTSKAHLNSIQM--------------------QMKNQLSTLRVAGSLQKSTEVLQAM..QSLVRYPELAGIMRDMSK
CHMP3_HUMAN/18-188SKLYASKAHMNSVLM--------------------GMKNQLAVLRVAGSLQKSTEVMKAM..QSLVKIPEIQATMRELSK
O16458_CAEEL/11-197GQLDQQAFNMDQSNF--------------------AIQGMKDNQVTVAAMKDGLKTMQKE..YKKMNIDQIEDLQDQMED
CHMP5_HUMAN/12-197DNLAQQSFNMEQANY--------------------TIQSLKDTKTTVDAMKLGVKEMKKA..YKQVKIDQIEDLQDQLED
CHMP5_DROME/12-197ESLRNQSFNMEQANY--------------------AAQSLKDTQATVAAMKDGVKQMKTE..YKKINIDQIEDIQDDMAD
Q9FTZ4_ORYSJ/12-208NMLYNQTYNLDQVAF--------------------AADGLKDAQQTMNAMKAANKELKGM..MKTVKIEDIDNMQDEMTD
Q9LPN5_ARATH/12-209DMLYNQTFNLDQVSF--------------------AAEGLKDAQQTMTALKSANKELKGM..MKTVKIQDIDNLQDEMMD
YQ56_SCHPO/12-203QQLQQQSFNMEQAAM--------------------TTESLKNTMATVQTMQETARQLKSQ..SKNVSIEKIEKLQDEIQD
VPS60_YEAST/19-204DSLDSQSWSMTQAQL--------------------TNDNLQNTMITINALKQTNNAMKAQ..YGKINIDKLQDMQDEMLD
Q18886_CAEEL/21-195AHIDGVLSTIGYQRE--------------------ALENASTNAEVLNVMGTASKALKAA..HNNMDIDQVHDLMEDIAE
Q22916_CAEEL/21-195IHIDGVLATLEHQRE--------------------TLENASTNAEVLTVMKLASDALKAV..HNNMDSDQVRDMMDNIDE
CHM4A_HUMAN/21-199AQTDGTLSTLEFQRE--------------------AIENATTNAEVLRTMELAAQSMKKA..YQDMDIDKVDELMTDITE
CHM4C_MOUSE/24-193TQVDGTLSTIEFQRE--------------------ALENSHTNTEVLRNMGFAAKAMKAV..HDNMDLNKIDDLMQDITE
CHM4B_HUMAN/24-199AQIDGTLSTIEFQRE--------------------ALENANTNTEVLKNMGYAAKAMKAA..HDNMDIDKVDELMQDIAD
Q8T0Q4_DROME/20-194QQIDGTLSTIEMQRE--------------------ALESANTNTAVLTTMKNAADALKRA..HQNMDVDKVHDMMDDIAE
Q21959_CAEEL/38-211SRIDGVLTKLEAQRT--------------------ALENVGMHNEVIDVLGKTTETLKKE..HAKMDIDKVHDLMDEIAD
SNF7_SCHPO/19-193VKIEGSRNNIEQQLF--------------------SIQNANLNFETLQAMRQGAEAMKSI..QRGMDADKVDQIMDKIRD
VP322_ARATH/17-189EQLGNFQLRIHDQMI--------------------MLEGAKATTETVDALRSGASAMKAM..QKATNIDDVDKTMDEINE
SNF7_YEAST/21-207SKVEGTMESMEQQLF--------------------SIESANLNLETMRAMQEGAKAMKTI..HSGLDIDKVDETMDEIRE
Q22718_CAEEL/216-386ADKDVQYQKLLTMLH--------------------QISSAKNNKDVLQAYKSGTAAFKATLARQGLSPDKIHETMDDVVN
VPS20_YEAST/15-187QQASDQLINLENMVS--------------------TLEFKMVEKQFINGLKNGNEILKKL..NKEFS..NVDELMDDVQD
VP201_ARATH/16-194KQVDQWVINVEQQLT--------------------DIELTSKQKAVFESLKQGNSAIKAI..QSELDLDDVQKLMDDTAD
CHMP6_HUMAN/18-178DRTENQISSLEAMVQ--------------------SIEFTQIEMKVMEGLQFGNECLNKM..HQVMSIEEVERILDETQE
Q9BL60_CAEEL/22-185DQTLNHLSKIEQMVN--------------------DLEFAEVQQRVTDGLRQGNEALKKM..NQLFDIDEIDRIMEETKE
Q9W236_DROME/22-187TNADKQLENLEKLAA--------------------DIEFAQVEMKVLDGLKAGNAALKKV..HEMLDIDEVERIMDETRE

PF04012

Q9A5T5_CAUCR/2-230AQLTDQSRKYESSARAAMNKG..............DQALALEVAQRIADLEKDAGQKSTQMTELRAAEEKLRTVIAQTDT
O67361_AQUAE/3-233RNEKERAKALVKKAESLLLQAQEGK.....ISPEEAEKLAAELIQKAELHEKNARRLEEEAKRQREMAVKLQAKIDELKV
Y617_SYNY3/2-238NQDTQEAKKWEDRAKLALTNG..............EENLAREALARKKSLTDTAAAYQTQLAQQRTMSENLRRNLAALEA
Q9KDL6_BACHD/1-220EEAKRLMKRREEQAKAALSAG..............EEELAKKALYSKKNAAEQVARYEALMQKSHDHVLELRLQLEDLEK
Q9KRG4_VIBCH/2-219ESIEQQLEDWQNKATLALTKQ..............REDLARAALIEKQKLQHVLKGLHTEQMLVEETIEKLTGEIGKLET
PSPA_DEIRA/2-219GTNSKLAAEYEKKAEEALRGG..............SEDLAREALRRAQNHKDLAKGFDEQRTVQQSTVDQLKTQLRALEA
P74717_SYNY3/2-218DAQQLIAQRWYEKAQAALDRG..............NEQLAREALGQRQSYQSHTEALGKSLGEQRALVEQVRGQLQKLER
LIAH_BACSU/1-221EEAAEVAGKRKNQAQLAFDAG..............EEELAKKALTEMKYLEGKAAEHKASYEQANSQLADLKEQLAALET
Q9HXR1_PSEAE/2-230EKGAAQVAEYEQYAIKALEAG..............NEELAREVAEKIATLENQLEGERAQVAEFAASVAQLRKSVSQAEG
YJFJ_ECOLI/2-232KDLRERKASLEARALEALSKN.............VNPSLINEVAEEIARLENLITAEEQVLSNLEVSRDGVEKAVTATAQ
35KD_MYCTU/3-242NRQLADIEKLQVNVRQALTLADQATAAGDAAKATEYNNAAEAFAAQLVTAEQSVEDLKTLHDQALSAAAQAKKAVERNAM

PF03357

CHM2A_HUMAN/17-187QAEIMDMKEEMMNDAIDDAM.GDEED----------EEESDAVVSQVLDELGLSL..........-----------....
Q9U2F6_CAEEL/17-187QSEIMDMKEEVMGDAIDDAL.GDAGD----------EEETDQIVNQVLDELGIQM..........-----------....
Q9VBI3_DROME/17-187QSEMMDMKEEMINDAIDDAM.EDEGD----------EEETDAVVSQVLDELGLQL..........-----------....
VPS2A_ARATH/18-188QNEKMEMVSEVMGDAIDDAL.EGDEE----------EEETEDLVSQVLDEIGIDI..........-----------....
VPS2C_ARATH/16-186QSAQMDMTTEMMSDSIDDAL.DNDEA----------EDETEDLTNQVLDEIGIDI..........-----------....
CHM2B_HUMAN/16-186ENMKMEMTEEMINDTLDDIF.DGSDD----------EEESQDIVNQVLDEIGIEI..........-----------....
Q9VRJ5_DROME/18-188ANMKMEMTDEMINDTLDDML.NESGD----------EEESNAVVNKVLDEIGIEI..........-----------....
VPS24_YEAST/19-190ELMKSGIISEMVDDTMESVGDVGEEM----------DEAVDEEVNKIVEQYTNEK..........-----------....
Q9VN02_DROME/18-188EMMKAGIIEEMLDETMDSLE.ESEEL----------EEEASKEVDKVLWEITDGK..........-----------....
CHMP3_HUMAN/18-188EMMKAGIIEEMLEDTFESMD.DQEEM----------EEEAEMEIDRILFEITAGA..........-----------....
O16458_CAEEL/11-197MLDMNNEIQEAMSRQYDT....PDID----------EADLEAELAMLGDELDIGESDTN......-----------....
CHMP5_HUMAN/12-197MMEDANEIQEALSRSYGT....PELD----------EDDLEAELDALGDELLADEDSS.......-----------....
CHMP5_DROME/12-197MFEQADEVQEALGRTYGM....PEVD----------DDDLQAELDALGDEIALDDDTS.......-----------....
Q9FTZ4_ORYSJ/12-208LMDVSNEIQESLGRSYNIP...DDVD----------EEELMGELDALEADMEFESSAVPSYLQ..-----------PDKE
Q9LPN5_ARATH/12-209LMDVSSEIQESLGRSYNIP...DGLD----------EDDLMGELDALEADMGNETEADGMPSYLQ-----------PDTE
YQ56_SCHPO/12-203YMDAAGELNEVLGQNMTD....INVD----------EEELDAELEALQQE.....SSWLGDQST.-----------AEKP
VPS60_YEAST/19-204LIEQGDELQEVLAMNNNSGE.LDDIS----------DAELDAELDALAQE..DFTLPTS......-----------....
Q18886_CAEEL/21-195QQEVANEIAEAISNPVGFS...TAVD----------DDDLMRELEALEQEELDKELLD.......-----------....
Q22916_CAEEL/21-195QREVAKEIADAISNP.GFN...NAID----------EADLLRELVDLEQEALDKDLLD.......-----------....
CHM4A_HUMAN/21-199QQEVAQQISDAISRPMGFG...DDVD----------EDELLEELEELEQEELAQELLNVG.....-----------...D
CHM4C_MOUSE/24-193QQDIAQEISEAFSQRVQFA...DGFD----------EAELLAELEELEQEELNKKM.........-----------....
CHM4B_HUMAN/24-199QQELAEEISTAISKPVGFG...EEFD----------EDELMAELEELEQEELDKNLLEI......-----------....
Q8T0Q4_DROME/20-194QQDVAREISDAISNPVAFG...ADLD----------DEDLERELDELEQENFDKEIIG.......-----------....
Q21959_CAEEL/38-211GLAMSEELNEAISAPIG.....DVAD----------EDELMQELQELQDNVADLSTTTK......-----------....
SNF7_SCHPO/19-193QQTISEEISTMISTPVGLN...AEID----------EDELANELDELQQMELDSKMLG.......-----------....
VP322_ARATH/17-189QTENMKQIQEALATPMGAA...ADFD----------EDELAAELDELESEELESQLL........-----------....
SNF7_YEAST/21-207QVELGDEISDAISRPLITG..ANEVD----------EDELDEELDMLAQENANQETSKIVNNN..-----------VNAA
Q22718_CAEEL/216-386SMDEYKEIEEAISSPFVNA...NGFN----------DADLEQELEDLISDNKKNE..........-----------....
VPS20_YEAST/15-187QIAYQNEINETLSRSL...V.GTSNY----------EDDLDKELDALESELNPEKM.........-----------....
VP201_ARATH/16-194AKAYQDELNAILGEKL......SAED----------EEDILAEFDNLESQLIVDEMPEVPT....-----------..KE
CHMP6_HUMAN/18-178AVEYQRQIDELLAGSF......TQED----------EDAILEELSAITQE...............-----------....
Q9BL60_CAEEL/22-185AAEYQEEISNMLSGQL......SNTD----------VSDVEKELEDLLAAEWG............-----------....
Q9W236_DROME/22-187GIEKQQEIDAILTDVL......TTQD----------EEDVLAELDALEAEEEQQK..........-----------....

PF04012

Q9A5T5_CAUCR/2-230KVEALRREIEIVKVNESVQKAQAAVISRSGSASG.VVGSAADSLKRIKERQAVREEQFRLHSESE...........DRKT
O67361_AQUAE/3-233QIAKYEAELKTLKARLATARAVKKVNKQIAKVD...PSDTIAMLERMKEKVEEEETLAQAYEELAK..........QEVA
Y617_SYNY3/2-238KISEAKTKKNMLQARAKAAKANAELQQTLGGLG...TSSATSAFERMENKVLDMEATSQAAGELAGFGIENQFAQLEASS
Q9KDL6_BACHD/1-220KYEQLRDKKRELLLRSQSIKAFEQMKKARATFS...TEGSERQFQRMEEKIEDMELRESAREGRRG..........FSVD
Q9KRG4_VIBCH/2-219KITETRAKQQALAIRSQAASHRRDVQRHLHAGR...TEEAMAKFEQFSRKVDELEAEADLYAQSG...........QARS
PSPA_DEIRA/2-219KIDEMESKKTLLAARQKTAQAGETLDRVSGFSK...AGGAMDAFNEMEQKVAGMEDRNKAMGELR...........NDQ.
P74717_SYNY3/2-218KYLELKSQKNLYLARLKSAIAAQKIEEIAGNLD...NASASSLFERIETKILELEAERELLNPPP...........SPL.
LIAH_BACSU/1-221KLQDVKDKKQALIARANAAKAKEHMNTTFDKID...SESAYREFLRIENRIEEMEIRANYSKSAEA.........GTELT
Q9HXR1_PSEAE/2-230NIRQLKQQVDTVKATESVQKAQMAVAQRYGNSKS.KLQTAVDSLERIKQRQAERAATMDAAAELA...........SAAA
YJFJ_ECOLI/2-232RIAQFEQQMEVVKATEAMQRAQQAVTTSTVGASS.SVSTAAESLKRLQTRQAERQARLDAAAQLE...........KVAD
35KD_MYCTU/3-242VLQQKIAERTKLLSQLEQAKMQEQVSASLRSMSELAAPGNTPSLDEVRDKIERRYANAIGSAELAE.........SSVQG

PF03357

CHM2A_HUMAN/17-187.....TDELSNLPSTGG------------------
Q9U2F6_CAEEL/17-187.....GEEMAGLPSAAG------------------
Q9VBI3_DROME/17-187.....GEQLGDLPSASG------------------
VPS2A_ARATH/18-188.....NQELVNAPSGAV------------------
VPS2C_ARATH/16-186.....ASQLSSAPKGKI------------------
CHM2B_HUMAN/16-186.....SGKMAKAPSAAR------------------
Q9VRJ5_DROME/18-188.....SGKMSSIPATGS------------------
VPS24_YEAST/19-190.....FKNVDQVPTVEL------------------
Q9VN02_DROME/18-188.....LGEAPLPPEATP------------------
CHMP3_HUMAN/18-188.....LGKAPSKVTDAL------------------
O16458_CAEEL/11-197.YLDEALAAPTVPSDKP------------------
CHMP5_HUMAN/12-197.YLDEAASAPAIPEGVP------------------
CHMP5_DROME/12-197.YLDDVVKAPEAPSREP------------------
Q9FTZ4_ORYSJ/12-208SDFDAELNLPAAPTAPA------------------
Q9LPN5_ARATH/12-209TDYDSELNLPAAPTGH.------------------
YQ56_SCHPO/12-203SYLMPSNELPNFVDEEV------------------
VPS60_YEAST/19-204.ENSLGNDMPSYLLGAN------------------
Q18886_CAEEL/21-195.ARAPPVTLPDTPNIAL------------------
Q22916_CAEEL/21-195.ARAPPVTLPDTPNIAL------------------
CHM4A_HUMAN/21-199KEEEPSVKLPSVPSTHL------------------
CHM4C_MOUSE/24-193....TSLELPNVPSSSL------------------
CHM4B_HUMAN/24-199.SGPETVPLPNVPSIAL------------------
Q8T0Q4_DROME/20-194.IPEPTPTLPEAPTEDL------------------
Q21959_CAEEL/38-211.LPDVPATLPEAPSGEL------------------
SNF7_SCHPO/19-193.AEKPPVHTPAVPAVPS------------------
VP322_ARATH/17-189...QPATTAPPLPSVPV------------------
SNF7_YEAST/21-207PISENKVSLPSVPSNKI------------------
Q22718_CAEEL/216-386.....SVHLPEAPTNRF------------------
VPS20_YEAST/15-187....NNAKVANMPSTEG------------------
VP201_ARATH/16-194SEESEKLDLPDVPTKTP------------------
CHMP6_HUMAN/18-178.....QIELPEVPSEPL------------------
Q9BL60_CAEEL/22-185.....TVQLPEAPSHEL------------------
Q9W236_DROME/22-187.....GAQLPDVPTEDL------------------

PF04012

Q9A5T5_CAUCR/2-230G.ADLDAKLAAAGILPGA.SGAEDVLARLMAPKNE
O67361_AQUAE/3-233....LDVESEAEKKLKEVES..KQKLEELKKRLGL
Y617_SYNY3/2-238GVEDELAALKASMAGGAL.PGTSAATPQLEAAPVD
Q9KDL6_BACHD/1-220....YDEQVEQEFLNMKK....SLVDTKNASEQAQ
Q9KRG4_VIBCH/2-219....LEQEFAELQAQDEI....EKELNKLKA.QMK
PSPA_DEIRA/2-219...DFDAQLKDLGRDKDV....DDALAALKA.KVQ
P74717_SYNY3/2-218.....DKKFEQWEEQQAV....EATLAAMKARRSL
LIAH_BACSU/1-221....RKEFADDVEAEIEK....MRTLSLQKSDQTK
Q9HXR1_PSEAE/2-230PDDALDAKLRAAGIKASG.NSVDGVLARLKE.KGK
YJFJ_ECOLI/2-232G.RDLDEKLAEAGIGGSNKSSAQDVLARLQRQQGE
35KD_MYCTU/3-242....RMLEVEQAGIQMAGHSRLEQIRASMRGEA..

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window