Sequence alignment for CL0235

PF03357

Q22916_CAEEL/21-195---------------ESIQKLRETE--DILEKKQEFLEKKIDDVRKQN....AVKYGT.....KN...........KRMA
VP201_ARATH/16-194---------------RAILSLKTQR--RKLGQYQQKLEKVIEAEKQAA....RDLIRE.....KR...........KDRA
VPS2C_ARATH/16-186---------------ESKREMTQAT--RGIEKEIGSLQSEEKKLVLEI....KRTAKS.....GN...........EGAT
CHMP6_HUMAN/18-178---------------KAILQLKQQR--DKLRQYQKRIAQQLERERALA....RQLLRD.....GR...........KERA
CHMP3_HUMAN/18-188---------------EWSLKIRKEM--RVVDRQIRDIQREEEKVKRSV....KDAAKK.....GQ...........KDVC
VPS20_YEAST/15-187---------------RAILEVKRSK--DEIHKFTRRTDNLILVEKSQL....KDLIRKNPENYKS...........NMKV
VPS60_YEAST/19-204---------------ESNQSMNQAQ--QSLSNRISQLDTQIAQLNFQLQNIQKNLQRS.....NNKQ......PSLRKQA
CHM4A_HUMAN/21-199---------------EAIQKLKETE--KILIKKQEFLEQKIQQ.ELQT....AKKYGT.....KN...........KRAA
CHM4C_MOUSE/24-193---------------EALARLRETE--EMLAKKQEYLENRIQR.ELAL....AKKHGS.....QN...........KRAA
CHMP5_HUMAN/12-197---------------APPPSLTDCI--GTVDSRAESIDKKISRLDAEL....VKYKDQ.....IKKMREGPAKNMVKQKA
Q8T0Q4_DROME/20-194---------------EAIQKLRETE--NMLIKKQEFLEAKIED.ELNI....ARKNAS.....KN...........KRVA
Q95SH2_DROME/8-178---------------KHLFNLKFAV--KELERNSKKCEKEEKLEKAKA....KKAIQK.....GN...........MDVA
Q18886_CAEEL/21-195---------------ESIQKLRETE--EMLEKKQEFLEKKVID.EKQN....AVKYGT.....KN...........KRMA
CHM4B_HUMAN/24-199---------------EAIQRLRDTE--EMLSKKQEFLEKKIEQ.ELTA....AKKHGT.....KN...........KRAA
Q21959_CAEEL/38-211---------------EAIGNLRDAE--ELLIKKQEYFELRIEQ.EVES....AKKYMK.....TN...........KKMA
SNF7_YEAST/21-207---------------KAIVRLREHI--NLLSKKQSHLRTQITNQENEA....RIFLTK.....GN...........KVMA
SNF7_SCHPO/19-193---------------DTIVRFQEML--ALYDKKEEVLERQIAE.QTEI....ARKNAT.....TN...........KRLA
VP322_ARATH/17-189---------------QTLDKLNETL--EMLEKKEKVLLKKAGAEVEKA....KEYSRA.....KN...........KRAA
YQ56_SCHPO/12-203---------------QPTASLTDAI--DSLDKRSDSVEVKIAKLDAQL....SVFQQK.....IANTRPGPGQTALKQRA
Q9CAF3_ARATH/12-210---------------EPPPSIQDAS--DRINKRGDSVEDKIKKLDVEL....CKYKEQ.....LKKTRPGPAQEAVKARA
Q9FTZ4_ORYSJ/12-208---------------DPPPSIQDAT--ERINKRGESVDDKIKKLDEEL....GRYKEQ.....IRKTRPGPSQDAIKARA
O16458_CAEEL/11-197---------------VPPPDLNNAI--SNVESRSDSIDKKIQKLDQDL....MKLRDQ.....MSKMREGPSKNLIKQKA
CHMP5_DROME/12-197---------------EPGPSLNDCI--AGVDARATNIEEKISNLEAEL....RKYREQ.....MSKMREGPAKNSVKQKA
Q22718_CAEEL/216-386---------------ASVVDIRKAM--NKLDREIQQLEQKVKKYDEQC....RACLRT.....GD...........KGRA
Q9W236_DROME/22-187---------------KAVLQLKQQR--DRLKQYQKRIETQLENDRLLA....RKCLQQ.....GR...........KDRA
Q9BL60_CAEEL/22-185---------------NAILALKTQR--DKMKQMIKRKENCLEKERQLA....KQLIKD.....GR...........KDRA
CHM2B_HUMAN/16-186---------------EQNRELRGTQ--RAIIRDRAALEKQEKQLELEI....KKMAKI.....GN...........KEAC
Q9VRJ5_DROME/18-188---------------ENDRSLRKAT--RDIERERRKMEEEERKLELEI....RRNAAA.....GN...........NDAC
VPS2A_ARATH/18-188---------------ENKRMLDKSI--REIERERQGLQTQEKKLINEI....KKTAKQ.....GQ...........MGAV
Q9U2F6_CAEEL/17-187---------------QNQRALNKAI--RELDRERARMEAQEKKVIADI....KNMAKK.....NQ...........MDSV
Q9VBI3_DROME/17-187---------------KNQRALNKAM--RDLDRERMKMEQQEKKIIADI....KKMAKE.....GQ...........MDAV
CHM2A_HUMAN/17-187---------------QNQRALNRAM--RELDRERQKLETQEKKIIADI....KKMAKQ.....GQ...........MDAV
VPS24_YEAST/19-190---------------RIRSVLRKNG--RNIEKSLRELTVLQNKTQQLI....KKSAKK.....ND...........VRTV
Q9VN02_DROME/18-188---------------EWTHKIRKEG--NQLDRQIRSIQREEEKVKRSL....KQAAQK.....ND...........RDTC

PF04012

Q9A5T5_CAUCR/2-230SIWSKLSALFRGAAHDGAQTVVDANALRILDQEIRDADSAQGKARDEL----AKLVARRRALETEVAQLTDQSRKYESSA
O67361_AQUAE/3-233GLLKRLLRVVRAEAHSVVEKLEDPI..KITEEGLRELRKQLKEAMEAL----AQVKASQIRFEREARNEKERAKALVKKA
Y617_SYNY3/2-238GLFDRLGRVVRANLNDLVSKAEDPE..KVLEQAVIDMQEDLVQLRQAV----ARTIAEEKRTEQRLNQDTQEAKKWEDRA
Q9KDL6_BACHD/1-220MVFDRMKNLVLASIHEGLDKLEDPE..MMLNQYIRNVQSEMGRAEKAI----EEQKKLHVSLERDLEEAKRLMKRREEQA
Q9KRG4_VIBCH/2-219GIFSRFADIVNSNISALLDKAEDPE..KMIRLIIQEMEDTLVEVRTNS----AKAMADKKELARKVESIEQQLEDWQNKA
PSPA_DEIRA/2-219SIFDRLSRLLRANVNDMISKAEDPA..KIIDQALRDMRSAYADARNEV----AGAMAQAAKLEREAGTNSKLAAEYEKKA
P74717_SYNY3/2-218ELFNRVGRVLKSQLTHWQQQQEAPE..DLLERLLGEMELELIELRRAL----AQTIATFKSTERQRDAQQLIAQRWYEKA
LIAH_BACSU/1-221MVLKRIRDMFVASVHEGLDKMENPK..VMLNQYVRDMESDIAKAKQTI----VKQHTIAYQFKKKYEEAAEVAGKRKNQA
35KD_MYCTU/3-244NPFVKAWKYLMALFSSKIDEHADPK..VQIQQAIEEAQRTHQALTQQA----AQVIGNQRQLEMRLNRQLADIEKLQVNV
Q9HXR1_PSEAE/2-230TVWSKLLSALRGGANEVGEAIVDSQALRILDQEIRDADVELRKSREAL----ASIMARHRLAQERVEKGAAQVAEYEQYA
YJFJ_ECOLI/2-232GILKSLFTLGKSFISQAEESIEETQGVRMLEQHIRDAKAELDKAGKSR----VDLLARVKLSHDKLKDLRERKASLEARA

PF03357

Q22916_CAEEL/21-195LQCLSRK-------------------------------------KAFEKQLIHIDGVLATLEHQRETLENASTNAEVLTV
VP201_ARATH/16-194LLALRKK-------------------------------------RTQEELLKQVDQWVINVEQQLTDIELTSKQKAVFES
VPS2C_ARATH/16-186KILARQL-------------------------------------IRLRQQIANLQGSRAQMRGIATHTQAMHAHTSVAAG
CHMP6_HUMAN/18-178KLLLKKK-------------------------------------RYQEQLLDRTENQISSLEAMVQSIEFTQIEMKVMEG
CHMP3_HUMAN/18-188IVLAKEM-------------------------------------IRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGS
VPS20_YEAST/15-187RFLLKRI-------------------------------------HYQEHLLQQASDQLINLENMVSTLEFKMVEKQFING
VPS60_YEAST/19-204LKILNKR-------------------------------------KQLENMKDSLDSQSWSMTQAQLTNDNLQNTMITINA
CHM4A_HUMAN/21-199LQALRRK-------------------------------------KRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRT
CHM4C_MOUSE/24-193LQALKRK-------------------------------------KRFEKQLTQVDGTLSTIEFQREALENSHTNTEVLRN
CHMP5_HUMAN/12-197LRVLKQK-------------------------------------RMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDA
Q8T0Q4_DROME/20-194LQALKKK-------------------------------------KRLEKQLQQIDGTLSTIEMQREALESANTNTAVLTT
Q95SH2_DROME/8-178RIHAENA-------------------------------------IRQKNQAVNYLRMSARVDAVASRVQSALTTRKVTGS
Q18886_CAEEL/21-195LQCLNRK-------------------------------------RNFEKQLAHIDGVLSTIGYQREALENASTNAEVLNV
CHM4B_HUMAN/24-199LQALKRK-------------------------------------KRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKN
Q21959_CAEEL/38-211LAALRKK-------------------------------------KHYEQELSRIDGVLTKLEAQRTALENVGMHNEVIDV
SNF7_YEAST/21-207KNALKKK-------------------------------------KTIEQLLSKVEGTMESMEQQLFSIESANLNLETMRA
SNF7_SCHPO/19-193LTALKRK-------------------------------------KMHENELVKIEGSRNNIEQQLFSIQNANLNFETLQA
VP322_ARATH/17-189IQCLKRK-------------------------------------RLYEGQVEQLGNFQLRIHDQMIMLEGAKATTETVDA
YQ56_SCHPO/12-203MNVLRQK-------------------------------------KIYESQLQQLQQQSFNMEQAAMTTESLKNTMATVQT
Q9CAF3_ARATH/12-210MRVLKQK-------------------------------------KMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTMTA
Q9FTZ4_ORYSJ/12-208IRLLKHK-------------------------------------RMYEEQRNMLYNQTYNLDQVAFAADGLKDAQQTMNA
O16458_CAEEL/11-197LRVLKQK-------------------------------------RMYENQKGQLDQQAFNMDQSNFAIQGMKDNQVTVAA
CHMP5_DROME/12-197LRVLKQK-------------------------------------KAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAA
Q22718_CAEEL/216-386QNFLRQR-------------------------------------KRAEKDIADKDVQYQKLLTMLHQISSAKNNKDVLQA
Q9W236_DROME/22-187KLLLRKK-------------------------------------KYQESLLTNADKQLENLEKLAADIEFAQVEMKVLDG
Q9BL60_CAEEL/22-185LLLLKKK-------------------------------------RYQEKIIDQTLNHLSKIEQMVNDLEFAEVQQRVTDG
CHM2B_HUMAN/16-186KVLAKQL-------------------------------------VHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGA
Q9VRJ5_DROME/18-188RILAKQL-------------------------------------VEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEA
VPS2A_ARATH/18-188KVMAKDL-------------------------------------IRTRHQIEKFYKLKSQLQGVSLRIQTLKSTQAMGEA
Q9U2F6_CAEEL/17-187KVMAKDL-------------------------------------VRTRRYIKKFIVMKANIQAVSLKVQTLKSQDAMASA
Q9VBI3_DROME/17-187KIMAKDL-------------------------------------VRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQA
CHM2A_HUMAN/17-187RIMAKDL-------------------------------------VRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQA
VPS24_YEAST/19-190RLYAKEL-------------------------------------YQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQ
Q9VN02_DROME/18-188VILAKEI-------------------------------------VNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGS

PF04012

Q9A5T5_CAUCR/2-230RAAMNKG..............DQALALEVAQRIADLEKDAGQKSTQMTELRAAEEKLRTVIAQTDTKVEALRREIEIVKV
O67361_AQUAE/3-233ESLLLQAQEGKIS.....PEEAEKLAAELIQKAELHEKNARRLEEEAKRQREMAVKLQAKIDELKVQIAKYEAELKTLKA
Y617_SYNY3/2-238KLALTNG..............EENLAREALARKKSLTDTAAAYQTQLAQQRTMSENLRRNLAALEAKISEAKTKKNMLQA
Q9KDL6_BACHD/1-220KAALSAG..............EEELAKKALYSKKNAAEQVARYEALMQKSHDHVLELRLQLEDLEKKYEQLRDKKRELLL
Q9KRG4_VIBCH/2-219TLALTKQ..............REDLARAALIEKQKLQHVLKGLHTEQMLVEETIEKLTGEIGKLETKITETRAKQQALAI
PSPA_DEIRA/2-219EEALRGG..............SEDLAREALRRAQNHKDLAKGFDEQRTVQQSTVDQLKTQLRALEAKIDEMESKKTLLAA
P74717_SYNY3/2-218QAALDRG..............NEQLAREALGQRQSYQSHTEALGKSLGEQRALVEQVRGQLQKLERKYLELKSQKNLYLA
LIAH_BACSU/1-221QLAFDAG..............EEELAKKALTEMKYLEGKAAEHKASYEQANSQLADLKEQLAALETKLQDVKDKKQALIA
35KD_MYCTU/3-244RQALTLADQATAAGDAAKATEYNNAAEAFAAQLVTAEQSVEDLKTLHDQALSAAAQAKKAVERNAMVLQQKIAERTKLLS
Q9HXR1_PSEAE/2-230IKALEAG..............NEELAREVAEKIATLENQLEGERAQVAEFAASVAQLRKSVSQAEGNIRQLKQQVDTVKA
YJFJ_ECOLI/2-232LEALSKNV.............NPSLINEVAEEIARLENLITAEEQVLSNLEVSRDGVEKAVTATAQRIAQFEQQMEVVKA

PF03357

Q22916_CAEEL/21-195MKLASDALKAV..HNNMDSDQ---VRDMMDNIDEQREVAKEIADAISNP.GFN..---------.NAIDEADLLRELVDL
VP201_ARATH/16-194LKQGNSAIKAI..QSELDLDD---VQKLMDDTADAKAYQDELNAILGEKL.....---------.SAEDEEDILAEFDNL
VPS2C_ARATH/16-186MQGATKAMAAM..SKNMDPAK---QAKVMREFQKQSAQMDMTTEMMSDSIDDAL.---------DNDEAEDETEDLTNQV
CHMP6_HUMAN/18-178LQFGNECLNKM..HQVMSIEE---VERILDETQEAVEYQRQIDELLAGSF.....---------.TQEDEDAILEELSAI
CHMP3_HUMAN/18-188LQKSTEVMKAM..QSLVKIPE---IQATMRELSKEMMKAGIIEEMLEDTFESMD.---------DQEEMEEEAEMEIDRI
VPS20_YEAST/15-187LKNGNEILKKL..NKEFS..N---VDELMDDVQDQIAYQNEINETLSRSL...V.---------GTSNYEDDLDKELDAL
VPS60_YEAST/19-204LKQTNNAMKAQ..YGKINIDK---LQDMQDEMLDLIEQGDELQEVLAMNNNSGE.---------LDDISDAELDAELDAL
CHM4A_HUMAN/21-199MELAAQSMKKA..YQDMDIDK---VDELMTDITEQQEVAQQISDAISRPMGFG..---------.DDVDEDELLEELEEL
CHM4C_MOUSE/24-193MGFAAKAMKAV..HDNMDLNK---IDDLMQDITEQQDIAQEISEAFSQRVQFA..---------.DGFDEAELLAELEEL
CHMP5_HUMAN/12-197MKLGVKEMKKA..YKQVKIDQ---IEDLQDQLEDMMEDANEIQEALSRSYGT...---------.PELDEDDLEAELDAL
Q8T0Q4_DROME/20-194MKNAADALKRA..HQNMDVDK---VHDMMDDIAEQQDVAREISDAISNPVAFG..---------.ADLDDEDLERELDEL
Q95SH2_DROME/8-178MAGVVKAMDAA..MKGMNLEK---ISSLMEKFESQFEDLDVQSSVMEGTMSDTV.---------TTSVPQGDVDNLLQQV
Q18886_CAEEL/21-195MGTASKALKAA..HNNMDIDQ---VHDLMEDIAEQQEVANEIAEAISNPVGFS..---------.TAVDDDDLMRELEAL
CHM4B_HUMAN/24-199MGYAAKAMKAA..HDNMDIDK---VDELMQDIADQQELAEEISTAISKPVGFG..---------.EEFDEDELMAELEEL
Q21959_CAEEL/38-211LGKTTETLKKE..HAKMDIDK---VHDLMDEIADGLAMSEELNEAISAPIG....---------.DVADEDELMQELQEL
SNF7_YEAST/21-207MQEGAKAMKTI..HSGLDIDK---VDETMDEIREQVELGDEISDAISRPLITG..---------ANEVDEDELDEELDML
SNF7_SCHPO/19-193MRQGAEAMKSI..QRGMDADK---VDQIMDKIRDQQTISEEISTMISTPVGLN..---------.AEIDEDELANELDEL
VP322_ARATH/17-189LRSGASAMKAM..QKATNIDD---VDKTMDEINEQTENMKQIQEALATPMGAA..---------.ADFDEDELAAELDEL
YQ56_SCHPO/12-203MQETARQLKSQ..SKNVSIEK---IEKLQDEIQDYMDAAGELNEVLGQNMTD...---------.INVDEEELDAELEAL
Q9CAF3_ARATH/12-210LKSANKELKGM..MKTVKIQD---IDNLQDEMMDLMDVSSEIQESLGRSYNIP..---------.DGLDEDDLMGELDAL
Q9FTZ4_ORYSJ/12-208MKAANKELKGM..MKTVKIED---IDNMQDEMTDLMDVSNEIQESLGRSYNIP..---------.DDVDEEELMGELDAL
O16458_CAEEL/11-197MKDGLKTMQKE..YKKMNIDQ---IEDLQDQMEDMLDMNNEIQEAMSRQYDT...---------.PDIDEADLEAELAML
CHMP5_DROME/12-197MKDGVKQMKTE..YKKINIDQ---IEDIQDDMADMFEQADEVQEALGRTYGM...---------.PEVDDDDLQAELDAL
Q22718_CAEEL/216-386YKSGTAAFKATLARQGLSPDK---IHETMDDVVNSMDEYKEIEEAISSPFVNA..---------.NGFNDADLEQELEDL
Q9W236_DROME/22-187LKAGNAALKKV..HEMLDIDE---VERIMDETREGIEKQQEIDAILTDVL.....---------.TTQDEEDVLAELDAL
Q9BL60_CAEEL/22-185LRQGNEALKKM..NQLFDIDE---IDRIMEETKEAAEYQEEISNMLSGQL.....---------.SNTDVSDVEKELEDL
CHM2B_HUMAN/16-186MSTTAKTMQAV..NKKMDPQK---TLQTMQNFQKENMKMEMTEEMINDTLDDIF.---------DGSDDEEESQDIVNQV
Q9VRJ5_DROME/18-188MGTTAKTMGEM..NKVMRPEA---IGETVRQFQAANMKMEMTDEMINDTLDDML.---------NESGDEEESNAVVNKV
VPS2A_ARATH/18-188MKGVTKAMGQM..NRQMNLPS---LQKIMQEFERQNEKMEMVSEVMGDAIDDAL.---------EGDEEEEETEDLVSQV
Q9U2F6_CAEEL/17-187MKGVTKAMQSM..NRQLNLPQ---IQKIMMEFEKQSEIMDMKEEVMGDAIDDAL.---------GDAGDEEETDQIVNQV
Q9VBI3_DROME/17-187MKGVTKAMQNM..NRQLNLPQ---IQKILQDFEKQSEMMDMKEEMINDAIDDAM.---------EDEGDEEETDAVVSQV
CHM2A_HUMAN/17-187MKGVTKAMGTM..NRQLKLPQ---IQKIMMEFERQAEIMDMKEEMMNDAIDDAM.---------GDEEDEEESDAVVSQV
VPS24_YEAST/19-190MADSAGLMREV..NSLVRLPQ---LRNTMIELEKELMKSGIISEMVDDTMESVGD---------VGEEMDEAVDEEVNKI
Q9VN02_DROME/18-188LQKSTEVLQAM..QSLVRYPE---LAGIMRDMSKEMMKAGIIEEMLDETMDSLE.---------ESEELEEEASKEVDKV

PF04012

Q9A5T5_CAUCR/2-230NESVQKAQAAV--ISRSGSASGV.VGSAADSLKRIKERQAVREEQFRLHSESE...........DRKTGAD.LDAKLAAA
O67361_AQUAE/3-233RLATARAVKKV--NKQIAKVD...PSDTIAMLERMKEKVEEEETLAQAYEELAK..........QEVA....LDVESEAE
Y617_SYNY3/2-238RAKAAKANAEL--QQTLGGLG...TSSATSAFERMENKVLDMEATSQAAGELAGFGIENQFAQLEASSGVEDELAALKAS
Q9KDL6_BACHD/1-220RSQSIKAFEQM--KKARATFS...TEGSERQFQRMEEKIEDMELRESAREGRRG..........FSVD....YDEQVEQE
Q9KRG4_VIBCH/2-219RSQAASHRRDV--QRHLHAGR...TEEAMAKFEQFSRKVDELEAEADLYAQSG...........QARS....LEQEFAEL
PSPA_DEIRA/2-219RQKTAQAGETL--DRVSGFSK...AGGAMDAFNEMEQKVAGMEDRNKAMGELR...........NDQ...D.FDAQLKDL
P74717_SYNY3/2-218RLKSAIAAQKI--EEIAGNLD...NASASSLFERIETKILELEAERELLNPPP...........SPL......DKKFEQW
LIAH_BACSU/1-221RANAAKAKEHM--NTTFDKID...SESAYREFLRIENRIEEMEIRANYSKSAEAG.........TELT....RKEFADDV
35KD_MYCTU/3-244QLEQAKMQEQV--SASLRSMSELAAPGNTPSLDEVRDKIERRYANAIGSAELAES.........SVQG....RMLEVEQA
Q9HXR1_PSEAE/2-230TESVQKAQMAV--AQRYGNSKSK.LQTAVDSLERIKQRQAERAATMDAAAELA...........SAAAPDDALDAKLRAA
YJFJ_ECOLI/2-232TEAMQRAQQAV--TTSTVGASSS.VSTAAESLKRLQTRQAERQARLDAAAQLE...........KVADGRD.LDEKLAEA

PF03357

Q22916_CAEEL/21-195EQEALDKDLLD............ARAPPVTLPDTPNIAL-
VP201_ARATH/16-194ESQLIVDEMPEVPT......KESEESEKLDLPDVPTKTP-
VPS2C_ARATH/16-186LDEIGIDI...................ASQLSSAPKGKI-
CHMP6_HUMAN/18-178TQE........................QIELPEVPSEPL-
CHMP3_HUMAN/18-188LFEITAGA...................LGKAPSKVTDAL-
VPS20_YEAST/15-187ESELNPEKM.................NNAKVANMPSTEG-
VPS60_YEAST/19-204AQE..DFTLPTS...........ENSLGNDMPSYLLGAN-
CHM4A_HUMAN/21-199EQEELAQELLNVG........DKEEEPSVKLPSVPSTHL-
CHM4C_MOUSE/24-193EQEELNKKM.................TSLELPNVPSSSL-
CHMP5_HUMAN/12-197GDELLADEDSS............YLDEAASAPAIPEGVP-
Q8T0Q4_DROME/20-194EQENFDKEIIG............IPEPTPTLPEAPTEDL-
Q95SH2_DROME/8-178ADEAGLEL...................NMELPSGVQSQS-
Q18886_CAEEL/21-195EQEELDKELLD............ARAPPVTLPDTPNIAL-
CHM4B_HUMAN/24-199EQEELDKNLLEI...........SGPETVPLPNVPSIAL-
Q21959_CAEEL/38-211QDNVADLSTTTK...........LPDVPATLPEAPSGEL-
SNF7_YEAST/21-207AQENANQETSKIVNNN..VNAAPISENKVSLPSVPSNKI-
SNF7_SCHPO/19-193QQMELDSKMLG............AEKPPVHTPAVPAVPS-
VP322_ARATH/17-189ESEELESQLL...............QPATTAPPLPSVPV-
YQ56_SCHPO/12-203QQE.....SSWLGDQST.AEKPSYLMPSNELPNFVDEEV-
Q9CAF3_ARATH/12-210EADMGNETEADGMPSYLQPDTETDYDSELNLPAAPTGHN-
Q9FTZ4_ORYSJ/12-208EADMEFESSAVPSYLQ..PDKESDFDAELNLPAAPTAPA-
O16458_CAEEL/11-197GDELDIGESDTN...........YLDEALAAPTVPSDKP-
CHMP5_DROME/12-197GDEIALDDDTS............YLDDVVKAPEAPSREP-
Q22718_CAEEL/216-386ISDNKKNE...................SVHLPEAPTNRF-
Q9W236_DROME/22-187EAEEEQQK...................GAQLPDVPTEDL-
Q9BL60_CAEEL/22-185LAAEWG.....................TVQLPEAPSHEL-
CHM2B_HUMAN/16-186LDEIGIEI...................SGKMAKAPSAAR-
Q9VRJ5_DROME/18-188LDEIGIEI...................SGKMSSIPATGS-
VPS2A_ARATH/18-188LDEIGIDI...................NQELVNAPSGAV-
Q9U2F6_CAEEL/17-187LDELGIQM...................GEEMAGLPSAAG-
Q9VBI3_DROME/17-187LDELGLQL...................GEQLGDLPSASG-
CHM2A_HUMAN/17-187LDELGLSL...................TDELSNLPSTGG-
VPS24_YEAST/19-190VEQYTNEK...................FKNVDQVPTVEL-
Q9VN02_DROME/18-188LWEITDGK...................LGEAPLPPEATP-

PF04012

Q9A5T5_CAUCR/2-230GILPGA.SGA-----------------EDVLARLMAPKNE
O67361_AQUAE/3-233KKLKEVES..-----------------KQKLEELKKRLGL
Y617_SYNY3/2-238MAGGAL.PGT-----------------SAATPQLEAAPVD
Q9KDL6_BACHD/1-220FLNMKK....-----------------SLVDTKNASEQAQ
Q9KRG4_VIBCH/2-219QAQDEI....-----------------EKELNKLKA.QMK
PSPA_DEIRA/2-219GRDKDV....-----------------DDALAALKA.KVQ
P74717_SYNY3/2-218EEQQAV....-----------------EATLAAMKARRSL
LIAH_BACSU/1-221EAEIEK....-----------------MRTLSLQKSDQTK
35KD_MYCTU/3-244GIQMAGHSRL-----------------EQIRASMRGEALP
Q9HXR1_PSEAE/2-230GIKASG.NSV-----------------DGVLARLKE.KGK
YJFJ_ECOLI/2-232GIGGSNKSSA-----------------QDVLARLQRQQGE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window