Sequence alignment for CL0237

PF08668

Q312E7_DESAG/87-282-------------------------------IPPLPSVFHT--------------------LQSQL.EDPAASPDD--IA
Q30XT4_DESAG/21-218-------------------------------LPVDHGLMRD--------------------LFAGTGDDSRLSLSE--VG
Q47EK7_DECAR/16-210-------------------------------LPALPTVVAE--------------------LLASF.GNEDVDIAL--LA
Q726T5_DESVH/188-383-------------------------------LPSLPTVYVE--------------------LRQRL.ADPDCSVRE--AA
Q2S9N5_HAHCH/19-212-------------------------------IPPQPQILVD--------------------IQMEQ.VMPDPDISR--IA
Q30WC1_DESAG/87-282-------------------------------LPSLPAVVAE--------------------LRDVL.SSPNSSAAD--VA
Q479K8_DECAR/17-212-------------------------------IPSPPEILLR--------------------LMRTV.EDEQATMGD--LA
Q73KD9_TREDE/241-434-------------------------------IPQFPENIMQ--------------------IQRAI.NDPESKMQK--IA
Q31F11_THICR/31-224-------------------------------LPRFPNALMK--------------------LEQMLSSNKDVHLDE--VA
Q72CV0_DESVH/23-218-------------------------------LATLPETFHR--------------------LTEVL.HDPMSTAAD--AA
Q2SKE1_HAHCH/26-214-------------------------------IPMLPEVAQK--------------------VIAIT.TNPDSGASE--LV
Q3JE99_NITOC/16-212-------------------------------LPSPSGVALE--------------------IMRLT.QREETSIQD--LA
Q30WG2_DESAG/22-218-------------------------------L.TFPPVMVK--------------------LLQAL.AQPEPDFSV--IA
Q2S8R9_HAHCH/193-393-------------------------------MPPLPETAQR--------------------IIKLR.VDPEAGISE--LA
Q2SA21_HAHCH/160-347-------------------------------LPSLPDMAMR--------------------IRHVT.EQPNFHLND--IA
Q3A583_PELCD/28-222-------------------------------LPTPPNVVFR--------------------LLEVV.RNDEHSFLE--IG
Q312Z8_DESAG/87-282-------------------------------LASFPDIYFR--------------------IRKVL.DSPNSSADD--IS
Q72F84_DESVH/140-337-------------------------------LPSLPETLRE--------------------VLAEL.NAPNPSLRR--LG
Q39QJ3_GEOMG/20-214-------------------------------LPTIPAVATQ--------------------VLSLL.DQPDVEIDQ--VA
Q5E6F6_VIBF1/39-240-------------------------------LPPIPDVVLK--------------------IQKLC.TLEGTMIKD--VS
A6TLC8_ALKMQ/18-213-------------------------------IPTLPHMINK--------------------IMELT.DDPESTVQD--IE
Q72DM6_DESVH/18-215-------------------------------LPFDPGLLRE--------------------VLKLTSDDSRAPANR--LA
Q311L6_DESAG/19-208-------------------------------LPTLPTALEE--------------------VSRLV.EDPNSSTEQ--IA
Q9WZV8_THEMA/16-211-------------------------------LPSPNVVVQR--------------------IIAVC.SKPDASSTE--VA
Q3J8D7_NITOC/32-219-------------------------------LPTLPEVALK--------------------IREVV.DDPNTSAAD--VA
Q7P1W8_CHRVO/14-205-------------------------------LPMVPKVVQE--------------------LVASF.HRSDVNIND--IT
Q7UJI6_RHOBA/74-269-------------------------------LPALPHSAIS--------------------LLQLS.QKESAGPND--FA
Q5DZR1_VIBF1/13-204-------------------------------LPKIPKVIRE--------------------MMELV.NDPDVELQD--LS
Q3A5R3_PELCD/31-223-------------------------------LPAMTDIVND--------------------FLLTI.EDPDWSAKS--VA
Y073_TREPA/254-447-------------------------------IPQLPSKLLE--------------------IQRAI.ENPDVQLSD--IV
Q2W316_MAGSA/143-340-------------------------------LPSLPDLFFK--------------------LDAEL.RSPQCSTKS--VA
Q30YJ4_DESAG/188-383-------------------------------LGSLPPVFHR--------------------LVDVV.NDPRSSATD--MA
Q315F2_DESAG/150-345-------------------------------LLSFPDIYFR--------------------IVKVL.ESPSSSSRK--LA
Q39ZN9_GEOMG/20-214-------------------------------LPTVPTVIVS--------------------IVQKL.HDPEVDIQE--IL
Q47F47_DECAR/17-209-------------------------------MPAFPRVVTE--------------------IIATL.DDDGATLGA--LV
Q2RWK0_RHORT/140-335-------------------------------LPSPPDLYLR--------------------LTAAM.ADPAVNTST--IA
Q9I6M3_PSEAE/161-349-------------------------------APLLADVRAA--------------------SDRCL.SAEEHPLRV--LE
Q893W4_CLOTE/30-227-------------------------------MPLIPDRINK--------------------ILKLV.EDPDSTVAD--VE
Q6AL41_DESPS/16-211-------------------------------LPTLPVVASQ--------------------ILTLT.AAEDVTLTS--IA
Q39X38_GEOMG/18-206-------------------------------LPTLPGVVSR--------------------LQALA.ENRKSSIEE--MA
Q74AQ6_GEOSL/25-219-------------------------------LPTVPDIVLR--------------------IAGKL.NDPDVAIDE--VA
Q47BZ2_DECAR/19-212-------------------------------IPPCPAVLIE--------------------LDAEL.KKDMPDQRE--IA
Q74A15_GEOSL/20-215-------------------------------VYSLPYFYER--------------------LNEAI.NHPRSSIDD--VA
Q729J3_DESVH/10-205-------------------------------IPALPQLFME--------------------LQNAL.GQPHVSYER--IA
Q7MK26_VIBVY/15-206-------------------------------LPRIQSLLQE--------------------LLEMV.NQEEVNFGA--LA
G8MPC2_9BURK/14-206-------------------------------LPTIPQVVLE--------------------LVEMT.RDDNVELTD--VI
Q4KGR2_PSEF5/23-203-------------------------------LPTLPEVALQ--------------------IRQAA.EDPEISVST--LS
Q88AT3_PSESM/164-350-------------------------------.PLFVDVATA--------------------VKLSQ.TANGIDVAL--LE
Q88RB8_PSEPK/160-345-------------------------------.PLLADVQVA--------------------INRAL.NPQGLNLRV--LE
Q8EXT4_LEPIN/15-212-------------------------------LPRISSVVTK--------------------VMQMV.QKQDVAIPD--LA
Q8F5F6_LEPIN/263-457-------------------------------LPPLPNTLTR--------------------IISLC.NNPDSDLGI--IA
Q8F7S8_LEPIN/248-443-------------------------------LPTFPKSIQD--------------------IQTMI.SKPNSSINQ--IA
Q8PAV4_XANCP/2-187-------------------------------.......ALR--------------------IIELA.QDPDVDMTT--TA

PF01966

O17828_CAEEL/89-184-------------------------------G-----------------------------------YSHRFSALI--DA
D4FZG3_BACNB/50-149-------------------------------Y-----------------------------------IIHPIQVAG--IL
DGTP_SHIBO/66-184-------------------------------R-----------------------------------LTHSMEVQQ--VG
Q9Y9C8_AERPE/32-133-------------------------------V-----------------------------------AEHLFASAV--IA
N1P9P6_YEASC/58-164-------------------------------I-----------------------------------SDHMYRMGL--TT
O67745_AQUAE/51-169-------------------------------R-----------------------------------FEHSLGVYH--IT
Q9Z9D3_CHLPN/480-625-------------------------------T-----------------------------------YQHSVLVGS--LA
Y205_CLOB8/33-134-------------------------------N-----------------------------------LKHFLDVAR--IA
Q9RU30_DEIRA/189-293-------------------------------G-----------------------------------LGHSAAVAD--AS
YS48_CAEEL/92-193-------------------------------R-----------------------------------FVHSLGTFS--LA
Q9RWF0_DEIRA/280-403-------------------------------T-----------------------------------GGHTARVVG--LA
Q9X1N3_THEMA/52-163-------------------------------R-----------------------------------FAHSLGTMH--VA
Q9X1H8_THEMA/254-377-------------------------------T-----------------------------------RGHSEKVAE--LA
D4G2U1_BACNB/61-181-------------------------------R-----------------------------------FNHSLGVYE--IV
SPOT_AQUAE/49-145-------------------------------Y-----------------------------------IIHPLNVAL--KL
O24769_BACME/28-137-------------------------------V-----------------------------------SQHSFSVIA--IS
F7UTY5_SYNYG/586-734-------------------------------T-----------------------------------FQHTLFVAC--LA
E8VG54_BACST/160-279-------------------------------L-----------------------------------AYHVVSMLN--LA
Q9YBD1_AERPE/68-180-------------------------------I-----------------------------------FDRLLESGV--TP
RNY_MYCMY/238-331-------------------------------V-----------------------------------LAHSIEVAK--LS
J9DNF1_9THEM/20-135-------------------------------R-----------------------------------INHVRSVVE--FS
RELA_STREQ/50-149-------------------------------Y-----------------------------------IVHPIQVAG--IL
Q9X1J6_THEMA/238-380-------------------------------T-----------------------------------YYHSVIVAN--LA
A0A008B076_STAAU/57-156-------------------------------Y-----------------------------------IMHPIQVAG--IL
SPOT_MYCPN/62-167-------------------------------F-----------------------------------FIHPLRTAL--RL
B7J1D0_BORBZ/62-161-------------------------------Y-----------------------------------IIHPIMVSL--FL
D4FWU4_BACNB/336-429-------------------------------V-----------------------------------LKHSMEVAF--LA
A0A038F966_MYCTX/105-202-------------------------------Y-----------------------------------ITHPLAVAN--IL
M1UP73_BACIU/501-643-------------------------------T-----------------------------------YHHSVMVAN--LS
Y778_METJA/18-130-------------------------------V-----------------------------------VEHCLAVSE--YA
A0A017JHE0_ECOLX/30-142-------------------------------V-----------------------------------SEHSLQVAM--VA
RNY_DEIRA/388-481-------------------------------V-----------------------------------LKHSVQVAH--LT
Q9RV39_DEIRA/227-347-------------------------------V-----------------------------------FEH..GVEA--LH
O29268_ARCFU/5-101-------------------------------D-----------------------------------EGHVERVIK--LA
F5M2J7_RHOSH/51-140-------------------------------V-----------------------------------AEHSLLVEE--IL
Y461_MYCGE/55-184-------------------------------R-----------------------------------YAHSLGVYE--LI
GLND_RHILV/488-604-------------------------------V-----------------------------------DEHLIRTVD--IL
SPOT_HAEIN/18-117-------------------------------Y-----------------------------------ITHPVAVAS--II
Y1020_METJA/58-173-------------------------------V-----------------------------------ANNAIKMLK--IL
F7UME6_SYNYG/335-476-------------------------------G-----------------------------------EIRQRGVLK--IA
Q9X0Q2_THEMA/445-567-------------------------------T-----------------------------------KGHSEEAAY--YA
CAS10_METJA/1-92-------------------------------M-----------------------------------GN.......--.C
A0A026MC82_ECOLX/26-132-------------------------------D-----------------------------------VCHFRRVWA--TA
Q9X225_THEMA/394-516-------------------------------T-----------------------------------SGHSLRVAD--YS
I0LL24_CORGK/383-503-------------------------------I-----------------------------------DEHSLNTVA--GC
B9X448_BORBG/324-419-------------------------------V-----------------------------------LSHSKETAI--IG
SAMH1_HUMAN/164-319-------------------------------R-----------------------------------FEHSLGVGY--LA
E8VDR1_BACST/18-132-------------------------------R-----------------------------------YIHTVGVMN--TA
O59597_PYRHO/37-137-------------------------------G-----------------------------------FSHTLRVLA--IA
RNY_AQUAE/374-467-------------------------------V-----------------------------------LLHSKEVAY--IA
RNY_THEMA/324-417-------------------------------V-----------------------------------LNHSIEVAL--LA
F7UK95_SYNYG/36-134-------------------------------Y-----------------------------------ISHLLGVTA--LV
B2S3P0_TREPS/581-722-------------------------------T-----------------------------------YNHTMMVAT--LA
RNY_MYCGE/293-385-------------------------------V-----------------------------------LSHSLETAF--LT
F6BQM3_SINMB/494-610-------------------------------V-----------------------------------DEHLLRSVD--VL
A0A017I4K6_ECOLX/228-329-------------------------------T-----------------------------------GIHTLMTLS--MA
O34203_FERIS/166-297-------------------------------L-----------------------------------LEHSLNVAK--LV
Q9WXP4_THEMA/15-134-------------------------------L-----------------------------------GRHSFQVAF--LS
M1GE25_MYCPM/300-392-------------------------------V-----------------------------------LSHCLETGF--LT
F7UP12_SYNYG/21-136-------------------------------R-----------------------------------LDHILGVEQ--TA
MESH1_DROME/33-128-------------------------------Y-----------------------------------VNHVINVST--IL
Q9V1T1_PYRAB/57-183-------------------------------R-----------------------------------FEHSLGTWY--LA
GLND_VIBF1/451-585-------------------------------V-----------------------------------DEHSIRLLK--HI
Q9UY89_PYRAB/33-132-------------------------------V-----------------------------------ADHSFGVAF--IS
Q9WZI8_THEMA/93-197-------------------------------F-----------------------------------ITHPVEVTK--IL
D6EPR5_STRLI/149-246-------------------------------Y-----------------------------------ITHPLAVTT--IL
G4EUQ1_BACIU/26-129-------------------------------D-----------------------------------WHHVSRVAD--LA
B2S403_TREPS/156-278-------------------------------L-----------------------------------ETHALRSTL--YA
C9MIV2_HAEIF/446-580-------------------------------V-----------------------------------DEHTLRVML--KL
O30165_ARCFU/578-749-------------------------------R-----------------------------------YY...YVIK--NF
C7GMY9_YEAS2/77-183-------------------------------I-----------------------------------SDHMYRLSI--IT
O58617_PYRHO/35-142-------------------------------G-----------------------------------YGH...FLS--KI
DGT1B_DEIRA/61-211-------------------------------R-----------------------------------LTHSLEVAQ--IG
Q9RYW9_DEIRA/337-458-------------------------------N-----------------------------------LSHAGQVAE--LS
D6EMA1_STRLI/270-395-------------------------------V-----------------------------------YDHTLIVLE--QA
Q9X0N1_THEMA/184-308-------------------------------T-----------------------------------HEHTLRVGR--IS
SPOT_SPICI/49-148-------------------------------Y-----------------------------------IIHPLWTTF--FL
O26251_METTH/50-159-------------------------------R-----------------------------------FEHSIGAMY--LA
DGTL1_ZYMMO/68-203-------------------------------R-----------------------------------LTHSLEVAQ--IG
O27704_METTH/15-122-------------------------------V-----------------------------------IDHSLAVRK--KA
O28840_ARCFU/39-129-------------------------------V-----------------------------------AEHSFRAAI--IA
YPEC_LACLC/25-141-------------------------------T-----------------------------------DENLKLIFT--DG
Q9RTC7_DEIRA/78-187-------------------------------Y-----------------------------------ITHPVAVAI--IL
Y2027_AQUAE/19-141-------------------------------T-----------------------------------RGHTERGVF--YA
A0A017I0H4_ECOLX/45-144-------------------------------Y-----------------------------------ITHPVAVAC--IL
D5AVY7_RICPP/62-198-------------------------------R-----------------------------------LTHSLEVST--VA
O83882_TREPA/204-327-------------------------------F-----------------------------------AKPAVDTAI--FS
O27154_METTH/3-97-------------------------------V-----------------------------------FY.......--..
Q56418_THETH/27-147-------------------------------A-----------------------------------WDHTLSAVF--HL
RSH3C_ARATH/237-341-------------------------------Y-----------------------------------LQHCVETAM--LL
O57915_PYRHO/21-126-------------------------------L-----------------------------------YEHSLNAKR--IA
O58085_PYRHO/33-132-------------------------------I-----------------------------------ADHSFGVAF--IT
RELA_MYXXA/63-165-------------------------------Y-----------------------------------LVHPLEVAG--IL
Q9RJG7_STRCO/66-190-------------------------------I-----------------------------------FHHSRRVYL--FG
RNY_HELPJ/342-435-------------------------------A-----------------------------------LQHSKEVAL--LA
Q9RVH0_DEIRA/24-142-------------------------------W-----------------------------------VAHSRNVAL--AA
YC0H_SCHPO/38-144-------------------------------I-----------------------------------ADHMYRMGI--LT
Y048_RHOCB/51-140-------------------------------V-----------------------------------AEHSLLVEE--LF
Q9RYB1_DEIRA/218-341-------------------------------T-----------------------------------KGHTDRVTR--LA
D4GBT9_TREPC/186-314-------------------------------T-----------------------------------GLHCERVNH--YC
F7UP82_SYNYG/158-280-------------------------------V-----------------------------------GEASITCSQ--LI
Q9YW52_MSEPV/52-162-------------------------------L-----------------------------------VEHLCKTAN--GL
B2S4Q5_TREPS/320-413-------------------------------V-----------------------------------LYHSKEVAL--LA
A0A038FDD5_MYCTX/72-222-------------------------------R-----------------------------------LTHSLEVAQ--IG
O67911_AQUAE/273-423-------------------------------L-----------------------------------DEHTLKTLE--YL
D4G0S6_BACNB/23-139-------------------------------G-----------------------------------VAHAIACAY--HA
G4EZI1_BACIU/49-154-------------------------------R-----------------------------------YEHSIGVML--LI
D0KRE5_SULS9/50-168-------------------------------R-----------------------------------FSHSLGTFY--LT
O29044_ARCFU/20-133-------------------------------V-----------------------------------RRHCLTVAR--VA
O69970_STRCO/99-196-------------------------------Y-----------------------------------ITHPLAVTL--IL
Y240_MYCGE/140-252-------------------------------R-----------------------------------FQHCLRVGK--LA
Q9RWG4_DEIRA/36-142-------------------------------S-----------------------------------AEHSWHLAL--LA
Q59534_MYCLR/269-391-------------------------------V-----------------------------------YQHSLTVLR--QA
Q9WZJ8_THEMA/110-231-------------------------------G-----------------------------------WSHSQRVAR--LA
O28849_ARCFU/51-157-------------------------------R-----------------------------------FEHSLGVMH--VT
Q9UXZ9_PYRAB/35-137-------------------------------G-----------------------------------FSHTLRVLA--LS
Q9RRB2_DEIRA/9-122-------------------------------R-----------------------------------YEHVLRVAE--LA
B1LB67_THESQ/20-135-------------------------------L-----------------------------------VKHCLAAEA--VM
A0A038FBC4_MYCTX/430-550-------------------------------V-----------------------------------DRHVVETAV--HA
B0R8Y7_HALS3/34-139-------------------------------V-----------------------------------AAHTWGTAA--LC
D5EU34_PRER2/267-390-------------------------------N-----------------------------------FYHTLEVLD--NV
F7UQ39_SYNYG/76-175-------------------------------Y-----------------------------------IAHPVAVAG--LL
J9H327_9THEM/170-294-------------------------------T-----------------------------------HRHTERVGW--LS
O24771_BACME/49-153-------------------------------R-----------------------------------YDHSVGVML--LI
O30203_ARCFU/70-165-------------------------------L-----------------------------------IKHCIATAA--VM
A4QEM7_CORGB/77-174-------------------------------Y-----------------------------------ITHPLAVAT--IA
GLND_STRCO/431-550-------------------------------V-----------------------------------DRHLIETAV--RA
O59446_PYRHO/39-165-------------------------------R-----------------------------------FEHSLGTWY--LA
DGT1A_DEIRA/76-198-------------------------------R-----------------------------------LTHTLEVQQ--VA
B2S3X9_TREPS/13-131-------------------------------R-----------------------------------YEHSRRVAE--FG
Q9VMB3_DROME/209-311-------------------------------I-----------------------------------SGHMYRMSM--LT
O81418_ARATH/34-167-------------------------------F-----------------------------------IIHPVAVAR--IL
GLND_KLEOX/465-599-------------------------------V-----------------------------------DEHTIRVLL--KL
Q9UZX4_PYRAB/16-187-------------------------------M-----------------------------------EDHIREGLK--FI
Q16CX0_ROSDO/51-140-------------------------------V-----------------------------------AEHSLLVET--LF
Q9R6H4_RHIRD/41-147-------------------------------V-----------------------------------AEHTWMMAL--MA
F7USP6_SYNYG/61-155-------------------------------R-----------------------------------LIHSLEVSC--VG
Q9WXP4_THEMA/224-342-------------------------------T-----------------------------------TSHTWRVAV--FS
Q9RRR5_DEIRA/48-141-------------------------------L-----------------------------------QRHMLNVET--AM
MPTB_METJA/58-172-------------------------------L-----------------------------------IEHTISVTK--IA
Q9RYH1_DEIRA/488-612-------------------------------T-----------------------------------GEHIKRVGT--FA
Q56749_WOLSC/57-181-------------------------------T-----------------------------------GFHVKRVAE--YS
O82212_ARATH/108-212-------------------------------I-----------------------------------ADHMYRMGL--MA
J3TU75_MYCGT/49-154-------------------------------F-----------------------------------FIHPLRTAL--SL
Q9RZM5_DEIRA/48-178-------------------------------V-----------------------------------ATHSALVLA--RA
Q9X210_THEMA/387-509-------------------------------T-----------------------------------GNHVRRVQE--LS
M1GES7_MYCPM/55-184-------------------------------R-----------------------------------YSHSLGVYE--LL
F7UPV4_SYNYG/177-315-------------------------------T-----------------------------------GNHIRRTQN--YV
A0A008AQ38_STAAU/159-278-------------------------------L-----------------------------------SYHVLTMLR--IA
Y336_MYCPN/193-304-------------------------------R-----------------------------------MQHCLRVGQ--LA
Q9RH69_BRAJP/95-194-------------------------------Y-----------------------------------FSHPLEVAA--IL
L8F915_MYCSM/72-222-------------------------------R-----------------------------------LTHSLEVAQ--IG
Q9X0M9_THEMA/171-296-------------------------------T-----------------------------------LNHIYNVAF--WA
Y1154_METJA/50-150-------------------------------R-----------------------------------FEHSLGTMF--IA

PF13328

A9U2H3_PHYPA/119-274-------------------------------AFRMAEEAHR................GQVRRNGDMFLSHCVETAL..TL
A1T4E6_MYCVP/17-161-------------------------------ALVYAELKHHN..............QVRKGGGDTPYLAHLLGVAA..LV
CRSH3_ORYSJ/79-231-------------------------------ALKLALPALR...............DGGGDGGGGQSVSRALVVAA..SL
D0J716_COMT2/42-203-------------------------------ARAFAEPLIA................GEVMETGENTLTHADAVAA..IL
D3HT91_LEGLN/40-196-------------------------------ACTLSQLAGQ................EHATETGQSCLQQGLSMAD..LL
A4G620_HERAR/30-203-------------------------------ALAYVKPFYTGKS.........VSAGQDAFESEQDAFEFAQGVAT..VL
C5A8B1_BURGB/16-182-------------------------------VLAYVREHAG................DALQPSGERLADHAAGIVA..IM
B1Y0Q8_LEPCP/41-202-------------------------------ARAFAVPLLS................GHRFDTGEDALEHADGVAQ..IL
C1DRX7_AZOVD/40-203-------------------------------ACEYVREAERRA...........RPDAERPAVGTSTFLVGLEIAE..IL
Q7NIR7_GLOVI/11-155-------------------------------ALILAARAHC...............DQLRKGTDIPYVMHPFHVSL..LL
Q2KUM4_BORA1/36-197-------------------------------AAAWALPRFD................GQSAITGEPLTHHAACVVR..IL
A6VKS4_ACTSZ/37-191-------------------------------AWRYSQTKAQ.................QLFLNSHWYLRDGVEMVE..IL
Q1QX17_CHRSD/40-201-------------------------------ACELARHLAYNA...........EKPHHNWAEPASSFRTGLEMAD..IL
Q3JBJ7_NITOC/22-174-------------------------------ARELLADQID..................DKSQVMSLIVQGDAIVE..LL
Q0VP27_ALCBS/38-202-------------------------------ACERAEQCQLAG...........EAAGRVWPYGKGCLDIGLEMAE..VL
Q5NYK8_AROAE/35-194-------------------------------ALELARGAYE................NHVLGTGESVWTHAMGMAL..IA
C6WYQ5_METML/40-203-------------------------------ACQLATLAYD................AHAELTGEPLLQHATSTAA..IL
A0LAH5_MAGSM/29-180-------------------------------AADLAIYFHE...............GQFRKLDGSRYVLHCIQVATHCFS
A4RTL9_OSTLU/39-191-------------------------------AFDFTAKSHA...................GPGLGPHFDRCVDTAI..TL
A4YUR2_BRASO/10-154-------------------------------ALVYAAELHR...............MQFRKGGNVPYIAHLLSVSS....
A1WR12_VEREI/38-195-------------------------------ARAFAEPLLA................GASLDSGENTLAHADAVAA..IL
Q01DM6_OSTTA/79-231-------------------------------AFDFAAKSHA...................GPGLGPHFDRCVETAV..TL
Q2Y627_NITMU/35-194-------------------------------AQVFCEPLYM................DKSLPNGELLSSHVDGLAA..IL
C1DDC8_LARHH/40-201-------------------------------AFSLAREQYA...............GRKLGHTDEEMFSHAVHAAA..II
D3RPV6_ALLVD/41-199-------------------------------ACEVLARCRG................EPRPDTGETPIRHGLSTAD..IL
A1WXU2_HALHL/39-197-------------------------------AWERARAGYG................ERLRDSGEPYFAHAVYTAT..IL
Q1H1S1_METFK/41-206-------------------------------SVDFAAPCYA................GSLEITTVPVLHHVLGVAS..IL
Q9CJX4_PASMU/37-191-------------------------------AWYYSQKYIP.................QHHDASSCSLHSGVEMVE..IL
D5CLC9_SIDLE/41-202-------------------------------ACEFAAPLYH................GHSEITGTPLLQHALGSAS..IL
Q7VTF3_BORPE/36-199-------------------------------AAAWAWPRFE................AQKALTGEPLASHAAGAVR..IL
Q21WQ7_ALBFT/39-207-------------------------------ARAFAEPLLA................SETLDTGENTLAHADAVAA..IL
C7RQP8_ACCPU/48-214-------------------------------AVDFARGIYG................DGQLGSGEAVWGHALGMAL..IV
C4YVJ8_9RICK/45-189-------------------------------AICYAKEYHA................NQKRQSGEPYYSHPLEVAY..MV
D0MFP1_RHOM4/19-189-------------------------------AIELAARWHDGTYRKSQWRPPLMPSPDPDDLVPVPVMAHLTTVAL..LV
E6U0A6_BACCJ/9-157-------------------------------AVIFATNAHA...............KQYRKTDSTPYITHPYTAAL..FM
Q0KBZ4_CUPNH/23-190-------------------------------ALAYVREHGA................EVALPTGETVLSHAQGMLR..IL
D9SJ75_GALCS/35-194-------------------------------ACAVAEPLYR................GQTELTGTPLMQHALGSAS..IL
Q6AP30_DESPS/31-180-------------------------------AWQFAARVHE................GQEHFSGTPYLLHLQEVGA..TL
D5X0W0_THIK1/25-183-------------------------------ARAYALALID................TVVLETGEPAVEHADGVSA..IL
Q0A9N8_ALKEH/39-195-------------------------------AWRLAEAGCK................SAQRPTGDSYFEHGVAVAT..IL
A5UZY0_ROSS1/13-154-------------------------------ALQFAALAHR...............QQVRKGTDIPYIVHAVHVSV..IL
A1K650_AZOSB/35-194-------------------------------ALDLAADIYE................GHVLGTGESVWTHAMGTAL..IA
C4ZK28_THASP/35-194-------------------------------ALEWIADLYE................GKVLGTGEPTWTHAIGAAL..IA
D4IMI0_9BACT/28-187-------------------------------ALEYADGKLA................GLVRYDGSPLLEHAAAVAS..IV
A2SG51_METPP/47-209-------------------------------ARAFAEPLLA................GERFDTGEDALAHADGVAA..IL
Q8LSZ7_CHLRE/200-352-------------------------------AYGLAARAHQ................NQQRKNGESLLSHCVAVAK..TV
E0ULD0_CYAP2/16-160-------------------------------ALVYAAQLHA...............QQLRKGSQVPYISHLLSVAA..LV
Q2SL26_HAHCH/40-204-------------------------------ACLLAKEIESEA...........VRAGNLWSEGSSSFLTGLEMTQ..IL
A6VUQ3_MARMS/40-204-------------------------------ACELARQAELQC............ARPSYWGAQASTFRAGLEMVE..IL
Q47C74_DECAR/36-202-------------------------------AVEYAWEVYG................DRTLGSGERIWSHALGMAV..II
Q3A521_PELCD/26-176-------------------------------AYVYSAKVHR................GQSRLSGEPYLNHSLEIAN..IL
A1VQB2_POLNA/39-200-------------------------------ARAFAEPLIA................SEVMDTGENILAHADAVVG..IL
A1U2U8_MARAV/44-203-------------------------------AAQIAVQAFR...............EDRLWAPGASSFRTGLEMAQ..VL
A1WAJ9_ACISJ/45-206-------------------------------ARAFAEPLLI................GETLETGENTLVHADAVSA..IL
C4YZG9_9RICK/69-212-------------------------------AIYFAKKYHG................RQKRETGEFYYSHPLEVAY..MV
G2IXS4_PSEUL/40-200-------------------------------AFNSARELYA...............GKRLTQTGEDVFSHAVSAAA..IV
O25466_HELPY/45-202-------------------------------ALNLAAKSHK................GQYRKSGEPYIVHPICVAS..LV
RELA_HAEIN/37-193-------------------------------AWYYARDLMNA..............YPDEMKNATLMLQSGVEMVE..IL
Q13WF6_BURXL/19-186-------------------------------AMAFVREHAG................EVRLSSGEMLADHAAGTAS..IM
Q31Q06_SYNE7/14-158-------------------------------AVSLAAQLHA...............DQVRKGTSIPYLAHLLAVAS..LV
Q5F707_NEIG1/40-201-------------------------------AWSLAQEHYP...............ADAATPYGEPLPDHFLGAAQ..MV
Q5NEV0_FRATT/39-192-------------------------------ALELLKNKSA...............ESVRHPTGISSFLYAIEMAY..VL
Q83BW2_COXBU/24-180-------------------------------ASVLAEKLAS................TYETPAHEVLIEKGLAIAS..LL
Q885Y7_PSESM/37-199-------------------------------ACEFARQAEQND...........KAHKNHWAEGTSSFQTGLEIAE..IL
Q8PBN2_XANCP/11-164-------------------------------AVDYARIAHA...............GQLRKGTQIPYLSHLLGVST..LV
Q8XZ30_RALSO/33-195-------------------------------.....ADHAG................DHQTLTGEPLVSHARGTVA..IL
R7JMQ2_9BACT/28-185-------------------------------ALEYAAEHTA................SQVRHDGSPMLDHAAEVAR..IG

PF07514

A1U8B0_MARAV/20-345EYAVALSGKDLLKQPKRTELISRVKRLFSVTEQVWNKHYLYAIEQFAELVQEVPASEIHHHSESGGLIDHTLEALY--AG
A1TJN5_ACIAC/34-347GWTARQSASELLAPARRQRLLEHIWQRTSLSRAQFDQLYLGPIRRYAEFVQSFPASESHHHAYPGGMLDHGLEIVA--YA
A1TQV2_ACIAC/57-390GWLRVLEAEQLLTTVQASRAIQEIWRKSNQSRETWERDLLPAIHRYAEFVQLMPASEAHHHAHAGGLLSHTIEMLL--AA
A6THL2_KLEP7/23-338GWFAPQSAERLLATPLRQSCLHQLRQLTPLPDTLFDSWILTAINRFAALVQLLPASQSHHHSIPGGLLDHSLEVAC--NA
Q47CV4_DECAR/17-338GFAALSVD.ELLAS..EADLIARIKLCYGTDRECFEREVLTLVRRYAACVHLLPATADNYFSKPGGLLRLGLETAF--FS
Q21QJ1_ALBFT/57-380GIRLATPD.DVLAT..QADLIRLLKRNLGIANDDFERRYLAPLRRAAELINLIPATRDKHHTGAGGLFRFAATMAI--RS
B4EWU3_PROMH/32-353GLPAASPE.DLQST..QDELIAKLRQILGFNQRDFQRLIQPCIDHLAAYVHLLPASEHHHHSGAGGLLRHSLEVAF--WA
H6URM8_PROSM/46-357..PVAPLD.KILAT..QAELIEKVRNSLGFTVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAF--WA
M9X6X6_PASHA/34-346GWLYPKNASQLLNTELRQKYLGLLWQQVSMNRQMFEALYQQPIERYAEMVQLLPASESHHHSHIGGMLDHGLEVIA--FS
Q13VV9_BURXL/28-340.RLRPESAASLLATPRRQKLLEHIWQRTSLSRKQFATLYRAPLERYAELVQRFPASEAHHHAYPGGMLDHGLEIVA--YA
Q889C1_PSESM/24-338GFTKPESADALLSTPRRRQLIENIWQRTSLPRTQFDTLYVQAFKSYAALVQHLPASENHHHAYHGGMLDHGLEIVA--YA
S6BRE4_PSERE/59-379GYPGLVSG.QWFMRNYQHELFDRIIHSVGMPASDLKLYVEPILVNFAELAHMLPASENHHHSGPGGLLRHSLEVAS--LT

PF13487

C4LEW6_TOLAT/829-894--------------------------------------------------------------------------------
C7RLF4_ACCPU/828-893--------------------------------------------------------------------------------
A4XWP5_PSEMY/838-903--------------------------------------------------------------------------------
C6C118_DESAD/445-510--------------------------------------------------------------------------------
Q1LGI2_RALME/831-896--------------------------------------------------------------------------------
A1SW11_PSYIN/823-888--------------------------------------------------------------------------------
B9L9U4_NAUPA/308-373--------------------------------------------------------------------------------
Q88JQ0_PSEPK/644-709--------------------------------------------------------------------------------
E6VRY4_DESAO/573-635--------------------------------------------------------------------------------
A1U2G6_MARAV/797-862--------------------------------------------------------------------------------
B1YGB8_EXIS2/181-244--------------------------------------------------------------------------------
Q88IQ7_PSEPK/258-320--------------------------------------------------------------------------------
B7KEJ3_CYAP7/323-385--------------------------------------------------------------------------------
A4XQI8_PSEMY/237-307--------------------------------------------------------------------------------
B8IYF0_DESDA/583-645--------------------------------------------------------------------------------
Q8EE49_SHEON/255-317--------------------------------------------------------------------------------
Q47Z39_COLP3/249-311--------------------------------------------------------------------------------
C6BWJ1_DESAD/540-602--------------------------------------------------------------------------------
E6VWT1_DESAO/206-269--------------------------------------------------------------------------------
B2JVC1_BURP8/302-364--------------------------------------------------------------------------------
E6VTW0_DESAO/225-288--------------------------------------------------------------------------------
Q10WT1_TRIEI/323-385--------------------------------------------------------------------------------
A4XNT7_PSEMY/287-349--------------------------------------------------------------------------------
Q21JZ3_SACD2/197-260--------------------------------------------------------------------------------
A6TVP0_ALKMQ/242-306--------------------------------------------------------------------------------
Q6MM25_BDEBA/342-407--------------------------------------------------------------------------------
Q2W8H3_MAGSA/209-272--------------------------------------------------------------------------------
Q15VN2_PSEA6/250-311--------------------------------------------------------------------------------
A8ESC2_ARCB4/238-300--------------------------------------------------------------------------------
Q0ATW9_SYNWW/203-268--------------------------------------------------------------------------------
Q2W315_MAGSA/210-273--------------------------------------------------------------------------------
F2G724_ALTMD/249-310--------------------------------------------------------------------------------
Q2RWJ9_RHORT/206-269--------------------------------------------------------------------------------
C4XMD6_DESMR/203-269--------------------------------------------------------------------------------
D7E117_NOSA0/301-367--------------------------------------------------------------------------------
C6BRZ3_DESAD/205-267--------------------------------------------------------------------------------
B0JHT5_MICAN/324-384--------------------------------------------------------------------------------
B7JY25_CYAP8/324-385--------------------------------------------------------------------------------
D4ZCM2_SHEVD/914-979--------------------------------------------------------------------------------
E3FLC4_STIAD/302-361--------------------------------------------------------------------------------
E3FSY9_STIAD/376-441--------------------------------------------------------------------------------
K0HSG2_9BURK/850-915--------------------------------------------------------------------------------
Q0VML8_ALCBS/381-446--------------------------------------------------------------------------------
Q63JR8_BURPS/285-346--------------------------------------------------------------------------------
Q72BS2_DESVH/821-886--------------------------------------------------------------------------------

PF05153

MIOX_DICDI/35-292-------------------------------YENS..EDRVSEAYRNSHTYQTYDYATEKKKQYS.QLDTSIKMGLWEAA
Q9VTU9_DROME/38-292-------------------------------DTTDPLKERVRQTYRQMHLNQTVDFVKGRREHWL..KFNTIKMTVREAL
MIOX_PONAB/31-285-------------------------------YTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFG..GFSYKKMTVMEAV
MIOX2_ARATH/61-317-------------------------------NGESERQQGVEEFYRMQHIHQTYDFVKKMRKEYG..KLNKMEMSIWECC
Q01Z78_SOLUE/31-278-------------------------------DDSA..PAGVREFYRENHAKQTREFAQAMKRKYG..AKTRGRMSIWEAC
Q4PIN4_USTMA/80-332-------------------------------YEDA..LDHVKAFYKTQHEKQTVAFNIAARERFL..HNHHASMTVWEAI
A8XBD0_CAEBR/22-276-------------------------------TAEDPIQVRVRNHYYTQHQNQTVQFVEEMHKKWL..NFDHAKMPILGCL
Q5AKC6_CANAL/89-340-------------------------------YELA..CDRVKQFYEEQHEKQTVAYNIQARINFK..TKTRARMTVWEGL
MIOX5_ARATH/58-314-------------------------------DTNSERQKSVEHFYATQHTNQTLDFVQKMRSEYG..KLDKMVMNIWECC
Q6CNQ4_KLULA/67-318-------------------------------YNQA..KDRVREFYKEQHEKQTMAYNLQARINFK..TKVRARMTVWDAL
Q16XZ8_AEDAE/38-292-------------------------------DDSDPLKERVRRTYKLMHTHQTVDFVKGRHADWL..KFDHFKANIRDAL
Q5KEW8_CRYNJ/65-315-------------------------------YEEA..CDRVKNFYAEQHLKQTYEYNVKIRQEFR..NTVRARMSIWEAM
A1C675_ASPCL/63-315-------------------------------YEDA..CDRVKNFYKEQHTKQTVAYNLKARNDFH..SKTRAEMTVWEAI
Q0DBI8_ORYSJ/52-308-------------------------------EAESERKETVEEFYRVNHINQTYDFVRRMREEYG..RVDKTEMGIWECI
Q2GML9_CHAGB/59-314-------------------------------YADA..CDRVKHFYAEQHAKQTVAHNLAARAHFHSPSRKRPELGIWEAM
A5FF81_FLAJ1/46-295-------------------------------YVDSERVETVKEFYRINHTYQTYDFVCSKEQEFL..QFNRKEMSIWEAV
F6Z3P9_XENTR/31-279-------------------------------......LDRVRKTYTLMHTYQTVQFVKEKHVQWG..SCTHRKMSVMDAL
H9J8E4_BOMMO/127-375-------------------------------......KERVRRTYYLMHSNVTVDLVKQKREKWL..KFNHFKATVKDAL
K5WF63_PHACS/46-296-------------------------------YEEA..CDRVKAFYKEQHEKQTVEFNLKVRASFK..KTVRARMGIWEAM
Q1K733_NEUCR/98-352-------------------------------YTTA..ESRVLNFYTEQHTKQTVSHNLAARAHFNSPDRKRPEMTIWQAI

PF00233

K3XBL4_PYTUL/325-572-------------------------------FHN---------------------------------AAHAADVLH--SL
F6R4G9_ORNAN/251-478-------------------------------FHN---------------------------------FRHCFCVTQ--MM
G0QQ35_ICHMG/67-322-------------------------------FHN---------------------------------FNHGIAVMQ--SC
G3N3Y5_GASAC/183-410-------------------------------FHN---------------------------------LTHAADVTQ--TI
A2F408_TRIVA/808-1039-------------------------------YHN---------------------------------WRHACDVTQ--FV
A0EGL5_PARTE/997-1235-------------------------------FHN---------------------------------YDHGISVMQ--SA
F6Z586_MONDO/224-458-------------------------------YHN---------------------------------AVHAADVTQ--AM
F7BCQ1_XENTR/185-414-------------------------------YHN---------------------------------AVHAADVTQ--AM
A9UR22_MONBE/86-321-------------------------------FHN---------------------------------FAHAVSVMH--TL
A0C8A0_PARTE/631-860-------------------------------FHN---------------------------------YNHGVNVMH--SC
G4VPI6_SCHMA/343-584-------------------------------YHN---------------------------------SMHAADVLQ--TA
G6DFF8_DANPL/405-640-------------------------------YHS---------------------------------WLHAFNVSQ--WA
C1MV36_MICPC/57-286-------------------------------YHC---------------------------------ALHAADVLS--AT
Q23AZ3_TETTS/471-707-------------------------------YHD---------------------------------RLHSFDVTQ--TI
G3SHK9_GORGO/356-600-------------------------------YHN---------------------------------SLHAADVAQ--ST
H2XQX1_CIOIN/516-756-------------------------------YHN---------------------------------WRHGLNVAH--TM
A0BEN8_PARTE/463-688-------------------------------YHN---------------------------------SLHAMDVTN--SA
A2DYU6_TRIVA/820-1055-------------------------------YHN---------------------------------WMHACDVTE--YV
D0MT23_PHYIT/280-525-------------------------------FHN---------------------------------ATHAADVMH--TL
I1CMJ2_RHIO9/36-262-------------------------------YHT---------------------------------FYHAADIVT--IL
K1R0I4_CRAGI/563-798-------------------------------YHN---------------------------------WRHAFNVAQ--TM
A0D8M4_PARTE/180-432-------------------------------YHN---------------------------------FTHAFQLSQ--LL
A7RY89_NEMVE/476-708-------------------------------YHN---------------------------------WRHAFNVAQ--SM
V4ZU93_TOXGO/723-961-------------------------------FHN---------------------------------SIRSAEVLQ--AM
G5BDY7_HETGA/501-733-------------------------------YHN---------------------------------WKHAVTVAH--CM
F6YX00_XENTR/336-571-------------------------------YHN---------------------------------WRHAFNTAQ--CM
E7QL51_YEASZ/264-483-------------------------------FHN---------------------------------FRHAIDVMQ--AT
T1G2P4_HELRO/239-480-------------------------------YHN---------------------------------GYHAADVTQ--SC
H3CTB8_TETNG/485-730-------------------------------YHN---------------------------------WRHGFNVGQ--TM
Q17L35_AEDAE/238-472-------------------------------YHN---------------------------------WWHAFSVAH--FA
G3PQF3_GASAC/493-744-------------------------------YHN---------------------------------SSHAADVLH--AT
Q7Q8G2_ANOGA/621-858-------------------------------YHN---------------------------------WRHAFNVTQ--MM
E9GSA7_DAPPU/245-472-------------------------------YHN---------------------------------NTHAADVTQ--TL
H2Y9W1_CIOSA/248-489-------------------------------YHN---------------------------------SLHAADVVQ--SV
H0X6I7_OTOGA/562-803-------------------------------MV.---------------------------------...GMMLAQ--TM
A7AR41_BABBO/497-730-------------------------------YHN---------------------------------KMHGAMVAQ--KV
D8TZH6_VOLCA/22-283-------------------------------YHN---------------------------------RIHAADVLQ--SL
F2U4B8_SALR5/364-601-------------------------------YHN---------------------------------WKHAFNVGQ--FV
F2TZN0_SALR5/451-687-------------------------------FHN---------------------------------WRHAVMVLH--TT
PDE3_DICDI/212-445-------------------------------FHS---------------------------------FNHAIAVTQ--TI
A0EHP5_PARTE/664-893-------------------------------FHN---------------------------------FEHGFTVAH--AC
R4XC23_TAPDE/151-415-------------------------------YHN---------------------------------FRHAVDVLQ--AV
T1J3H1_STRMM/460-696-------------------------------YHN---------------------------------WLHAFSVAH--FS
A8PF04_BRUMA/39-279-------------------------------YHN---------------------------------QVHAADVTQ--SV
G3XS32_ASPNA/355-613-------------------------------YHN---------------------------------FRHAIDVLQ--SV
F0YJF8_AURAN/57-300-------------------------------YHS---------------------------------RAHGADALL--TT
K0SZ48_THAOC/210-457-------------------------------YHN---------------------------------NIHAADVTQ--TV
F6XN91_ORNAN/135-378-------------------------------YHN---------------------------------WRHGFNVGQ--TM
H3A1Y1_LATCH/622-855-------------------------------YHN---------------------------------WRHAFNVSQ--CM
A0CZ03_PARTE/433-669-------------------------------YHN---------------------------------RVHAQDVAQ--TC
B3RRH3_TRIAD/64-293-------------------------------YHN---------------------------------VIHATDVLQ--TV
D0NX90_PHYIT/873-1108-------------------------------YHS---------------------------------FYHGFDVAL--AS
B7QLS8_IXOSC/587-822-------------------------------YHN---------------------------------WRHAFNVGQ--MM
K1Q9Q8_CRAGI/1379-1613-------------------------------YHN---------------------------------WTHAFAVAH--FC
B3RW84_TRIAD/250-489-------------------------------FHN---------------------------------FRHCFCVTQ--MM
F2UNV2_SALR5/160-397-------------------------------YHN---------------------------------FNHAMDVAQ--FA
B3RXL9_TRIAD/261-492-------------------------------YHN---------------------------------WYHAFNVTH--SM
G3NKI6_GASAC/413-649-------------------------------YHN---------------------------------WRHAFNVCQ--CM
E9FT33_DAPPU/300-536-------------------------------YHN---------------------------------WMHAFSVFH--FT
G3W7P6_SARHA/125-355-------------------------------YHN---------------------------------AVHAADVTQ--AM
U6HPK0_ECHMU/682-932-------------------------------YHN---------------------------------WRHAFNVAQ--TM
A4VDP2_TETTS/828-1069-------------------------------FHN---------------------------------FDHGIMVMH--GC
A0E8K4_PARTE/474-706-------------------------------YHN---------------------------------SMHALDVTN--ST
I7MEB2_TETTS/181-435-------------------------------YHN---------------------------------WTHAFQLSQ--MF
T1J0B6_STRMM/178-405-------------------------------YHN---------------------------------AVHAADVTQ--AM
K7IPZ8_NASVI/211-437-------------------------------YHN---------------------------------NLHAADVAQ--TM
A0BWQ6_PARTE/357-590-------------------------------YHN---------------------------------VIHAFDVTH--TV
C1G9S6_PARBD/375-630-------------------------------YHN---------------------------------FRHAVDVLQ--ST
T1JHX2_STRMM/149-384-------------------------------YHN---------------------------------WRHAFNVAQ--MM
A2FKH2_TRIVA/811-1047-------------------------------YHN---------------------------------WRHAVDVTQ--FV
E5SJ10_TRISP/256-483-------------------------------YHN---------------------------------LVHAADVTQ--TA
A8J0S4_CHLRE/4-240-------------------------------YHS---------------------------------ATHAADVLQ--TL
H3B4D9_LATCH/251-482-------------------------------FHN---------------------------------FRHCFCVTQ--MM
G0QN94_ICHMG/88-327-------------------------------FHN---------------------------------FQHAIAVSQ--AI
F0YF22_AURAN/6-233-------------------------------YHN---------------------------------SRHVTDVTQ--CM
G1N629_MELGA/537-772-------------------------------YHN---------------------------------WRHGFNVAQ--TM
PDE6A_BOVIN/558-803-------------------------------YHN---------------------------------WRHGFNVGQ--TM
I7M0W2_TETTS/670-909-------------------------------FHN---------------------------------FQHAIAVSH--AT
B8BX07_THAPS/28-275-------------------------------YHN---------------------------------SVHAADVAQ--TT
Q4D9B7_TRYCC/425-657-------------------------------YHN---------------------------------SMHAADVAH--IN
L9KNU5_TUPCH/284-521-------------------------------YHN---------------------------------STHSADVLH--AT
B7Q413_IXOSC/244-479-------------------------------YHN---------------------------------WYHAFAVAH--FC
A0A023B5L4_GRENI/875-1106-------------------------------YHN---------------------------------SVHAANVAH--VA
G7YHN2_CLOSI/450-692-------------------------------FHN---------------------------------SIHATDVLH--TM
W4Y0R5_STRPU/42-276-------------------------------YHN---------------------------------SMHAADVCQ--AM
E9GTK1_DAPPU/140-372-------------------------------YHN---------------------------------STHAADVLQ--ST
C3Y3W7_BRAFL/483-718-------------------------------YHN---------------------------------WRHAFNVTQ--TM
G0QM75_ICHMG/438-673-------------------------------YHY---------------------------------KLHAFDVLQ--TL
A9VBQ1_MONBE/959-1201-------------------------------YHN---------------------------------NLHAADVTH--ST
G4VM44_SCHMA/758-999-------------------------------YHN---------------------------------RVHAADVVQ--ST
Q38F42_TRYB2/668-906-------------------------------YHN---------------------------------FYHVVDVCQ--TI
H2YGD4_CIOSA/110-343-------------------------------FHN---------------------------------FRHAFCVTQ--MM
H0WWX2_OTOGA/185-414-------------------------------YHN---------------------------------AVHAADVTQ--AM
A2F4K8_TRIVA/824-1056-------------------------------FHN---------------------------------KLHSLDCIQ--FF
G0QL69_ICHMG/309-544-------------------------------YHN---------------------------------KLHSLDVTQ--TM
G3UQY0_MELGA/561-809-------------------------------YHN---------------------------------WRHGFNVGQ--TM
A2DBZ3_TRIVA/890-1109-------------------------------FHN---------------------------------FEHALDFTQ--FV
G1KNF9_ANOCA/182-411-------------------------------YHN---------------------------------SVHATDVTQ--TV
Q57V52_TRYB2/430-668-------------------------------YHN---------------------------------SMHAADVTQ--VN
H9GNX4_ANOCA/147-379-------------------------------YHN---------------------------------AVHAADVTQ--AM
A7RQM4_NEMVE/269-513-------------------------------FHN---------------------------------CIHAADVTQ--TA
A0CDZ4_PARTE/797-1028-------------------------------FHN---------------------------------FDHGITVMH--SC
F9WY25_MYCGM/19-262-------------------------------YHN---------------------------------WRHAVDVTQ--SV
F4P4T4_BATDJ/201-438-------------------------------YHN---------------------------------FTHAVSVTH--AF
T1G0C4_HELRO/267-508-------------------------------YHN---------------------------------SLHAADVTQ--SA
H3A4S4_LATCH/186-412-------------------------------YHN---------------------------------HIHAADVTQ--TI
I6NCN3_ERECY/237-472-------------------------------FHN---------------------------------FRHAVDVMQ--AT
E7F690_DANRE/664-899-------------------------------YHN---------------------------------WSHALRTAQ--CM
H9JP37_BOMMO/450-678-------------------------------YHN---------------------------------AQHAFTFTH--TM
K4E297_TRYCR/367-596-------------------------------YHN---------------------------------AIHAADVLQ--GT
G6D0G3_DANPL/510-749-------------------------------YHN---------------------------------AEHAFCFTH--TM
G3X2A9_SARHA/458-685-------------------------------YHN---------------------------------WKHAVTVAH--CM
F6UGJ6_HORSE/648-882-------------------------------YHN---------------------------------WMHAFSVSH--FC
E9C7I3_CAPO3/34-276-------------------------------YHN---------------------------------FDHGFDVMQ--TC
D2UZF3_NAEGR/172-403-------------------------------FHN---------------------------------SIHAADVLQ--TF
A2E0E8_TRIVA/899-1134-------------------------------YHN---------------------------------WTHAVDVTQ--FM
G0QTW0_ICHMG/347-581-------------------------------YHN---------------------------------KLHSFDVLQ--TI
T1ID25_RHOPR/266-496-------------------------------YHN---------------------------------WTHGFSVAN--SM
K0TNY7_THAOC/1104-1338-------------------------------YHN---------------------------------SSHAADVVQ--TL
E9H1H3_DAPPU/584-819-------------------------------YHN---------------------------------WRHAFNVAQ--MM
A2FET3_TRIVA/891-1121-------------------------------YHN---------------------------------WNHAVETVQ--LC
A2ENJ2_TRIVA/832-1067-------------------------------YHN---------------------------------WRHAVDVTQ--YV
K1Q862_CRAGI/623-859-------------------------------YHN---------------------------------WRHAFNVCQ--FM
T1KF46_TETUR/201-442-------------------------------YHN---------------------------------STHAADVTQ--SV
I1C756_RHIO9/55-278-------------------------------YHS---------------------------------FYHAADIVV--IL
L5LYV0_MYODS/378-630-------------------------------YHN---------------------------------STHAAHVLR--AT
G0R0C4_ICHMG/193-446-------------------------------YHN---------------------------------KIHCFDVTQ--TI
I1FCX2_AMPQE/486-721-------------------------------YHN---------------------------------WMHAFSVAH--FC
I3MB41_SPETR/221-447-------------------------------YHN---------------------------------QIHAADVTQ--TV
F0VH18_NEOCL/757-991-------------------------------FHC---------------------------------AAHTADMIQ--AM
B6H979_PENCW/364-622-------------------------------YHN---------------------------------FRHAIDVLQ--SV
A8XFQ4_CAEBR/454-686-------------------------------YHN---------------------------------WAHGWSVAH--AM
M4AGW4_XIPMA/350-586-------------------------------YHN---------------------------------WSHALSTAQ--SM
I7MF95_TETTS/428-661-------------------------------YHN---------------------------------KIHAFDVTQ--TM
Q7RNG1_PLAYO/216-445-------------------------------YHN---------------------------------SIHAAMVTK--HC
A2FBN7_TRIVA/832-1064-------------------------------YHN---------------------------------WIHAVDVVQ--YV
U4LEJ5_PYROM/325-578-------------------------------YHN---------------------------------FRHVVDVLQ--AI
Q4E0Y6_TRYCC/668-905-------------------------------YHN---------------------------------FYHVVDVCQ--TV
G7Y3Q5_CLOSI/247-479-------------------------------YHN---------------------------------WDHAFSVAH--SM
A7S9Q1_NEMVE/571-806-------------------------------YHN---------------------------------WRHAFNVAQ--TM
J9JP99_ACYPI/205-438-------------------------------YHN---------------------------------AIHATDVTQ--AM
B5YN05_THAPS/24-269-------------------------------YHN---------------------------------NIHAADVLQ--TL
F0XZ44_AURAN/6-240-------------------------------YHN---------------------------------FTHVTDVTQ--YM
G4VD32_SCHMA/194-450-------------------------------YHN---------------------------------ATHAGDVLQ--AS
U6IBZ4_HYMMI/336-560-------------------------------YHN---------------------------------LIHAADVAQ--TC
G3NZM0_GASAC/269-495-------------------------------YHN---------------------------------LIHAADVTQ--TA
A0C8Q0_PARTE/698-935-------------------------------YHN---------------------------------FDHGVAVMQ--AV
A2E5S0_TRIVA/1039-1262-------------------------------FYN---------------------------------WQRAVASAQ--FV
H3HCQ7_PHYRM/257-492-------------------------------...---------------------------------.EHAADVTQ--TL
G6DIL5_DANPL/640-871-------------------------------YHN---------------------------------FDHGWSVAH--AM
X6MLN0_RETFI/437-724-------------------------------FHN---------------------------------WQHGFFVFH--FV
A2G2M9_TRIVA/856-1091-------------------------------YHN---------------------------------WIHAIDVLQ--YI
B8MH55_TALSN/358-616-------------------------------YHN---------------------------------FRHAVDVLQ--SV
F2U3P6_SALR5/586-820-------------------------------YHN---------------------------------WQHAFSVTQ--CM
H2KQX0_CLOSI/666-901-------------------------------YHN---------------------------------WIHAFSVTH--FV
A2F9J4_TRIVA/865-1099-------------------------------YHN---------------------------------WTHACDVMQ--FV
A8QAS5_BRUMA/427-656-------------------------------YHN---------------------------------WLHGWTVAH--AM
H9JH54_BOMMO/108-347-------------------------------YHN---------------------------------WRHAFNVAQ--MM
E9FX16_DAPPU/491-726-------------------------------YHN---------------------------------WRHALNVAQ--TM
V8PBU9_OPHHA/202-428-------------------------------FHN---------------------------------FRHCFCVTQ--MM
G7YD67_CLOSI/310-534-------------------------------YHN---------------------------------LMHAADVMQ--TC
K7JB77_NASVI/291-525-------------------------------YHN---------------------------------SIHAADVTQ--AM
A0CDV7_PARTE/494-726-------------------------------YHN---------------------------------SMHAIDVAN--ST
A2D762_TRIVA/830-1065-------------------------------YHN---------------------------------WMHCVDVCQ--YL
K7JCC9_NASVI/433-669-------------------------------YHN---------------------------------WMHAFSVAH--FA
A2FZL3_TRIVA/843-1079-------------------------------YHN---------------------------------WIHAIDVLQ--YV
Q5CIN1_CRYHO/124-384-------------------------------FHN---------------------------------FHHAVSISI--TL
A2DV74_TRIVA/897-1132-------------------------------YHN---------------------------------WMHAVDVTQ--FI
G4M0K8_SCHMA/183-425-------------------------------FHN---------------------------------SIHALDVLH--AT
G7YCW0_CLOSI/404-645-------------------------------YHN---------------------------------RVHAADVLQ--ST
G0QNS6_ICHMG/258-503-------------------------------FHS---------------------------------FDHGIQVMH--GC
C5LYC9_PERM5/76-308-------------------------------YHN---------------------------------QAHAAQVTS--HG
Q5CHC0_CRYHO/724-964-------------------------------YHN---------------------------------ELHGTNVCH--LA
G7Y525_CLOSI/169-406-------------------------------YHT---------------------------------AVHAADVMQ--AL
F4P9V8_BATDJ/55-290-------------------------------YHN---------------------------------STHAIDVAH--SL
A0D3N1_PARTE/161-414-------------------------------YHN---------------------------------FTHAFALFQ--LL
G3H1T4_CRIGR/86-313-------------------------------YHN---------------------------------WRHAFNVCQ--LM
W5L340_ASTMX/213-441-------------------------------YHN---------------------------------AVHAADVTQ--AM
B6AJ92_CRYMR/946-1223-------------------------------FHN---------------------------------LYHAVTVAL--VL
I1FF72_AMPQE/584-825-------------------------------YHN---------------------------------SIHAADVMQ--AV
U6HDD1_ECHMU/294-535-------------------------------YHN---------------------------------KIHAADVVQ--SV
F0Y3P3_AURAN/5-236-------------------------------YHG---------------------------------ALHGADVLQ--SA
A2EA57_TRIVA/862-1082-------------------------------FHN---------------------------------FRHSVDCLQ--FV
I3IVG8_ORENI/238-473-------------------------------YHN---------------------------------AVHAADVTQ--AM
A2EY05_TRIVA/672-907-------------------------------YHN---------------------------------WTHAIDVLQ--YV
K3W5J5_PYTUL/499-740-------------------------------YHN---------------------------------SSHAADVVN--SV
I3KLG1_ORENI/165-393-------------------------------YHN---------------------------------FRHCFCVTQ--MM
H9K9C1_APIME/440-676-------------------------------YHN---------------------------------WIHAFSVTH--FA
U6ILW1_HYMMI/656-907-------------------------------YHN---------------------------------WRHAFNVAQ--TM
E5S1Y7_TRISP/469-710-------------------------------YHN---------------------------------SLHAADVTQ--TV
E2B075_CAMFO/438-674-------------------------------YHN---------------------------------WTHAFSVAH--FA
T1JTY5_TETUR/534-761-------------------------------YHN---------------------------------NIHAADVTQ--TV
G0R5R3_ICHMG/354-593-------------------------------FHN---------------------------------FQHALAVSH--AI
C9SP75_VERA1/352-608-------------------------------YHN---------------------------------FRHVVDVLQ--AT
A7S0H3_NEMVE/17-252-------------------------------YHN---------------------------------WRHAFNVAQ--SM
I3J4D3_ORENI/620-856-------------------------------YHN---------------------------------WRHAFNVSQ--CM
B3RPK8_TRIAD/484-719-------------------------------YHN---------------------------------WRHAFNVAQ--LM
A0D0P6_PARTE/709-947-------------------------------FHN---------------------------------YDHGVTVMQ--CS
H2TUF6_TAKRU/91-321-------------------------------FHN---------------------------------FRHCFCVTQ--MM
S2JNF3_MUCC1/101-338-------------------------------YHN---------------------------------FRHAVDVMQ--ST
H9IXR0_BOMMO/575-809-------------------------------YHN---------------------------------FDHGWTVAH--AM
T1K846_TETUR/97-334-------------------------------YHN---------------------------------WRHAFNVAQ--MM
E9BZV2_CAPO3/556-788-------------------------------YHN---------------------------------ATHAADVLQ--IM
W4XSF6_STRPU/406-647-------------------------------YHN---------------------------------QIHAADVVH--ST
C5LW71_PERM5/59-291-------------------------------YHN---------------------------------FKHAYSVMS--AA
F1Q4S3_DANRE/251-478-------------------------------FHN---------------------------------FRHCFCVSQ--MM
A2DG30_TRIVA/778-1007-------------------------------YHN---------------------------------WAHAVDVLQ--FT
U1LY64_ASCSU/200-424-------------------------------YHN---------------------------------IIHAADVTQ--SS
Q22CV4_TETTS/972-1213-------------------------------FHN---------------------------------FDHGVSVMQ--SC
M4AEC3_XIPMA/46-276-------------------------------FHN---------------------------------FQHCFCVTQ--MM
W5MCE7_LEPOC/202-428-------------------------------YHS---------------------------------QIHAADVTQ--TI
E1FRJ3_LOALO/357-588-------------------------------YHN---------------------------------WSHAFAVAH--FT
B4R3X9_DROSI/617-847-------------------------------FHN---------------------------------SLHAADVTQ--ST
D8TP55_VOLCA/67-324-------------------------------YHN---------------------------------KTHAADVLQ--GM
PDE8A_MOUSE/550-801-------------------------------YHN---------------------------------STHAADVLH--AT
F0YCZ9_AURAN/8-254-------------------------------YHN---------------------------------FRHGIDVAQ--TL
A2EIP4_TRIVA/1084-1320-------------------------------YHN---------------------------------WRHAVDVMQ--FV
K1PID2_CRAGI/187-413-------------------------------YHN---------------------------------LVHGADVTQ--TV
T1EIY3_HELRO/187-428-------------------------------YHN---------------------------------HIHATDVTH--AV
U6I2M0_HYMMI/497-738-------------------------------YHN---------------------------------HIHAADVVQ--AV
A2E8N2_TRIVA/822-1057-------------------------------YHN---------------------------------WTHAVDVTQ--FM
G0QLG1_ICHMG/322-557-------------------------------YHN---------------------------------KIHAFDVLM--TI
F4PDL8_BATDJ/236-451-------------------------------FHN---------------------------------FQHCFCVTQ--MM
G3NNN6_GASAC/516-748-------------------------------YHN---------------------------------WKHAVTVAH--CM
G0QX25_ICHMG/75-311-------------------------------YHN---------------------------------KLHAFDVLQ--TL
I7M6Z2_TETTS/95-332-------------------------------FHN---------------------------------FDHGITVAH--GI
K3WGS8_PYTUL/507-737-------------------------------FHN---------------------------------FQHAFQVMH--AT
Q01CI7_OSTTA/263-505-------------------------------YHN---------------------------------GVHAADVTQ--AA
D8TVU3_VOLCA/73-301-------------------------------YHN---------------------------------ATHAADVLQ--TL
E4V020_ARTGP/368-626-------------------------------YHN---------------------------------FRHAVDVLQ--ST
C1E004_MICSR/344-598-------------------------------YHT---------------------------------ATHAADVVQ--AC
T1IWR2_STRMM/725-967-------------------------------YHN---------------------------------STHAADVLQ--AA
E9IWT3_SOLIN/637-872-------------------------------YHN---------------------------------WRHALNVAQ--TM
H0XDY2_OTOGA/233-455-------------------------------FHN---------------------------------FRHCFCVAQ--MM
F9WTZ7_TRYVY/241-479-------------------------------YHN---------------------------------FFHVVDVCQ--TI
Q16J23_AEDAE/167-399-------------------------------YHN---------------------------------SIHATDVTQ--AM
C0NC75_AJECG/367-624-------------------------------YHN---------------------------------FRHAIDVLQ--ST
T1IN43_STRMM/372-598-------------------------------YHN---------------------------------NIHAADVTQ--TV
B3RT43_TRIAD/444-691-------------------------------YHN---------------------------------STHAGDVLH--AS
T1G4C8_HELRO/177-404-------------------------------YHN---------------------------------AVHAADVTQ--TV
I1FSR8_AMPQE/302-535-------------------------------YHN---------------------------------SYHAADVTQ--AL
A4RUJ3_OSTLU/354-596-------------------------------YHN---------------------------------RVHATDVTQ--AA
Q5CXM2_CRYPI/1551-1826-------------------------------YHN---------------------------------IFHALQVVQ--VC
T1G2T5_HELRO/253-496-------------------------------YHN---------------------------------NIHATDVLQ--AS
B8C496_THAPS/64-313-------------------------------YHN---------------------------------NTHAADVLQ--TL
C3Z0J8_BRAFL/157-377-------------------------------YHN---------------------------------QLHAADVTQ--TT
G7Y619_CLOSI/692-940-------------------------------YHN---------------------------------WRHAFTVAQ--TM
H2YVD4_CIOSA/588-824-------------------------------YHN---------------------------------WRHAFNVCQ--SC
E0VPK2_PEDHC/654-888-------------------------------YHN---------------------------------WRHAFNVSQ--VM
I7MHG9_TETTS/819-1072-------------------------------FHN---------------------------------FDHGITVMH--GC
A0DRT9_PARTE/368-610-------------------------------FHN---------------------------------FDHGFTVAH--AC
A9UVX6_MONBE/192-425-------------------------------YHN---------------------------------FQHAMDVAQ--FA
B3RPP8_TRIAD/504-735-------------------------------YHN---------------------------------WYHAFTVAH--TM
T1JG26_STRMM/622-856-------------------------------YHN---------------------------------WRHAFNVAQ--MM
G7Y2X2_CLOSI/386-622-------------------------------YHN---------------------------------WTHAFCVGH--FA
S2JJA8_MUCC1/205-462-------------------------------YHN---------------------------------FAHAVDVLQ--CI
A0BZK9_PARTE/736-969-------------------------------YHN---------------------------------YDHGITVMQ--TA
W4XPS9_STRPU/508-740-------------------------------FHN---------------------------------FCHAFDVCH--CM
T1G9G6_HELRO/40-271-------------------------------FHN---------------------------------FKHSFCVTQ--MI
F6YN13_CIOIN/497-735-------------------------------YHN---------------------------------STHAADVLH--AT
S2JM15_MUCC1/91-344-------------------------------YHN---------------------------------FAHAVDVLQ--CL
T1EEC2_HELRO/179-455-------------------------------YHN---------------------------------NIHAADVLQ--TI
G3W5Y3_SARHA/633-868-------------------------------YHN---------------------------------WRHAFNTAQ--CM
H2N2Q2_ORYLA/19-254-------------------------------YHN---------------------------------WRHAFNTAQ--CM
A2DJF3_TRIVA/756-991-------------------------------YHN---------------------------------WRHAVDVTQ--FV
T1FZK3_HELRO/143-369-------------------------------YHN---------------------------------LVHGADVTQ--TT
F0YND2_AURAN/33-267-------------------------------YHN---------------------------------FSHVTDVTQ--YL
B3S4Q2_TRIAD/437-672-------------------------------YHN---------------------------------WRHAFNVAQ--TM
A7SC93_NEMVE/229-460-------------------------------YHN---------------------------------WTHAFTVAH--FC
Q4Y3R0_PLACH/81-319-------------------------------YHN---------------------------------SLHAAQVAH--FS
D0MQY9_PHYIT/829-1076-------------------------------YHN---------------------------------LQHAFQVTH--AT
W5JX79_ANODA/192-452-------------------------------FHN---------------------------------SLHAADVTQ--ST
E0W1Y2_PEDHC/164-397-------------------------------YHN---------------------------------AIHATDVTQ--AM
E9GD11_DAPPU/572-804-------------------------------YHN---------------------------------WTHGFAVAN--SM
B8CDS3_THAPS/83-323-------------------------------YHN---------------------------------NVHGADVIQ--ST
B6KFK7_TOXGO/863-1092-------------------------------YHN---------------------------------HLHGAQVAH--NT
G0NVA1_CAEBE/450-686-------------------------------YHN---------------------------------ATHAADVLQ--AT
G0QL72_ICHMG/166-409-------------------------------FHN---------------------------------FQHGLSVMQ--SC
C4JVT9_UNCRE/362-620-------------------------------YHN---------------------------------FRHAIDVLQ--SL
C3YZV4_BRAFL/424-658-------------------------------YHN---------------------------------WYHAFSVSH--FC
I1BY86_RHIO9/30-312-------------------------------YHS---------------------------------FYHAVDVVM--VL
W5KJ99_ASTMX/620-849-------------------------------...---------------------------------...AFQEGQ--EF
A7SW30_NEMVE/369-596-------------------------------YHN---------------------------------WCHAFSVAH--SL
F4PP12_DICFS/106-337-------------------------------FHS---------------------------------FNHAVTVTQ--MV
V4ZBC8_TOXGO/684-919-------------------------------YHN---------------------------------QIHGAMVAH--YM
H2WG47_CAEJA/281-522-------------------------------YHN---------------------------------FIHAADVAQ--SM
U9UJM3_RHIID/88-393-------------------------------YHS---------------------------------FLHAVDVVV--VL
A2E8W5_TRIVA/810-1039-------------------------------YHN---------------------------------WTHAVDVVE--YV
H0V2T6_CAVPO/559-804-------------------------------YHN---------------------------------WRHGFNVGQ--TM
A4H9L9_LEIBR/384-615-------------------------------YHN---------------------------------SMHAADVLQ--IT
X6N5T0_RETFI/264-501-------------------------------YHN---------------------------------ALHGADVMK--SM
T1JI29_STRMM/203-435-------------------------------FHN---------------------------------FRHSFSVAQ--MM
A4RV03_OSTLU/70-313-------------------------------YHC---------------------------------FKHAVDVTH--TT
K1QIC6_CRAGI/569-804-------------------------------YHN---------------------------------WRHAFNVTQ--TM
T1HBJ9_RHOPR/64-297-------------------------------YHN---------------------------------WKHAFNVAQ--VM
G7Y655_CLOSI/526-809-------------------------------YHN---------------------------------ATHAADVLQ--ST
A5JZK3_PLAVS/500-735-------------------------------YHN---------------------------------CIHAAMVAE--QC
F0ZGW8_DICPU/600-832-------------------------------YHN---------------------------------STHATDVLQ--NL
A4HWN7_LEIIN/680-918-------------------------------YHN---------------------------------FYHVVDVCQ--TL
I7M9B7_TETTS/309-544-------------------------------YHN---------------------------------RLHAFDVLQ--TA
D7EJS6_TRICA/294-520-------------------------------FHN---------------------------------FRHCFCVAQ--MM
D2W310_NAEGR/443-678-------------------------------YHN---------------------------------FTHAVDVTQ--FA
I1CN45_RHIO9/145-393-------------------------------YHN---------------------------------FAHAVDVLQ--CL
J9JUC9_ACYPI/671-903-------------------------------YHN---------------------------------WRHAFNVAQ--VM
D8TN75_VOLCA/173-409-------------------------------YHN---------------------------------NTHAADVTQ--TA
A0BY96_PARTE/723-962-------------------------------FHN---------------------------------YDHGVSVMQ--NI
A7SVX8_NEMVE/580-827-------------------------------YHN---------------------------------STHAADVLH--AT
S2JSI2_MUCC1/64-347-------------------------------YHS---------------------------------FYHATDVVI--VL
B0WPM1_CULQU/529-761-------------------------------YHN---------------------------------WTHGFSVAN--TM
F2TXI1_SALR5/447-690-------------------------------YHT---------------------------------NTHGADVLH--VM
A2FQ29_TRIVA/905-1135-------------------------------YHN---------------------------------FLHAVDVMQ--FA
W4XPC7_STRPU/865-1088-------------------------------YHN---------------------------------FRHAFNVQQ--VM
B3S1R3_TRIAD/64-305-------------------------------YHN---------------------------------NIHAADVAQ--SV
F6X0V1_MOUSE/186-412-------------------------------YHN---------------------------------LVHAADVTQ--TV
M2UPY5_COCH5/359-618-------------------------------YHN---------------------------------FRHVVDVLQ--AL
F0ZDL5_DICPU/435-669-------------------------------YHN---------------------------------FMHAFDVTQ--IV
T1G1B3_HELRO/66-293-------------------------------YHN---------------------------------DIHAADVAQ--TV
K3W5A7_PYTUL/578-816-------------------------------YHN---------------------------------NCHAADVVS--SV
D2V582_NAEGR/457-695-------------------------------YHN---------------------------------NMHATDVTQ--CM
J9JUG8_ACYPI/874-1109-------------------------------YHN---------------------------------WRHAFNVAQ--MM
X6N2F3_RETFI/447-691-------------------------------YHN---------------------------------ALHGTDVMK--SM
PDE2_CAEEL/421-657-------------------------------YHN---------------------------------WSHAFAVTH--FC
C3Z5T1_BRAFL/93-328-------------------------------YHN---------------------------------WRHAFNVAQ--MM
A2DCH1_TRIVA/873-1097-------------------------------FHD---------------------------------YHHSIDVLT--QC
V8PIT4_OPHHA/336-577-------------------------------YHN---------------------------------SLHAADVTQ--ST
G4VIQ4_SCHMA/572-807-------------------------------YHN---------------------------------WMHAFSVAH--FV
F0VID9_NEOCL/1105-1345-------------------------------YHN---------------------------------FFHALNVAQ--IC
G1QFQ3_MYOLU/566-820-------------------------------YHN---------------------------------STHTADVLH--AT
F1SIK3_PIG/193-420-------------------------------YHN---------------------------------LMHAADVTQ--TV
B9Q8H3_TOXGO/59-299-------------------------------YHN---------------------------------FYHALNVTQ--VL
E4XVC9_OIKDI/280-532-------------------------------YHN---------------------------------STHAADVLS--AT

PF12917

F4BLQ7_CARS1/1-213----------------------------------------------------------MGMHQYIKSLSDLENIFR--CP
Q8Y4F3_LISMO/1-213----------------------------------------------------------MGIHQYFQSLSDLENIYR--CP

PF13023

Q4X103_ASPFU/38-201-------------------------------------------------------------------LERLKTTKR--EG
C4XNQ3_DESMR/208-394-------------------------------------------------------------------LGQLRFQTR--..
Q0RHP9_FRAAA/26-188-------------------------------------------------------------------IDQLKSVLR--QS
D1B724_THEAS/195-373-------------------------------------------------------------------VAQLRFQKR--..
A5FA91_FLAJ1/42-204-------------------------------------------------------------------IDKVKYIQR--KT
D3UJA3_HELM1/196-376-------------------------------------------------------------------FGQLRFQKR--..
B2WMG2_PYRTR/50-213-------------------------------------------------------------------LERLKTTKR--AG
A1B6A0_PARDP/14-168-------------------------------------------------------------------ADRLKSVER--AN
B8DPL6_DESVM/204-399-------------------------------------------------------------------CGQLRFQKR--..
D3V8Z8_XENNA/23-184-------------------------------------------------------------------LDKLKYVHR--KT
D3PCV5_DEFDS/21-178-------------------------------------------------------------------VGILQQIQR--SG
D2QII1_SPILD/16-178-------------------------------------------------------------------VDKLKYILR--KT
D4KY93_9FIRM/14-176-------------------------------------------------------------------LDKIKKITR--QT
Q4PHJ8_USTMA/1464-1623-------------------------------------------------------------------VEQLKTNKR--TG
D2V2T7_NAEGR/17-193-------------------------------------------------------------------VSKLKHTLR--TG
D4LY09_9FIRM/15-177-------------------------------------------------------------------VDKVKKIVR--QT
A8AWX8_STRGC/15-177-------------------------------------------------------------------LEKLKATHR--NN
Q0U692_PHANO/57-221-------------------------------------------------------------------LQRLKTTKR--AG
C4JFR9_UNCRE/38-203-------------------------------------------------------------------LERLKTTKR--EG
Q30Y45_DESAG/203-388-------------------------------------------------------------------CGQLRFQKR--..
B6HH14_PENCW/35-198-------------------------------------------------------------------IERLKTTKR--EG
C7YYC0_NECH7/65-229-------------------------------------------------------------------LERLKTTKR--EG
Q2NRF1_SODGM/23-185-------------------------------------------------------------------IDKLKNIQR--RT
B8IZP1_DESDA/203-392-------------------------------------------------------------------CGQLRFQIR--..
C4LZN2_ENTHI/11-165-------------------------------------------------------------------MNDLKHIPR--TG
Q2H1W3_CHAGB/59-223-------------------------------------------------------------------LERLKTTKR--EG
Q1MS33_LAWIP/31-190-------------------------------------------------------------------AENLKNTLR--SA
C6VYP4_DYAFD/17-182-------------------------------------------------------------------AERLKFELR--HS
B2IX53_NOSP7/16-178-------------------------------------------------------------------IDRLKQIMR--QT
B9E9R1_MACCJ/24-185-------------------------------------------------------------------IEKLKTVKR--RS
Q1MQW5_LAWIP/210-402-------------------------------------------------------------------SGQLRFQIR--..
A1B6A0_PARDP/194-361-------------------------------------------------------------------ADRLKSVLR--AS
C5GNI9_AJEDR/38-202-------------------------------------------------------------------LERLKTTKR--EG
Q6CED3_YARLI/61-223-------------------------------------------------------------------VERLKTTPR--TG
Q5LRU6_RUEPO/205-368-------------------------------------------------------------------ADRLKTVLR--AS
B8M402_TALSN/38-202-------------------------------------------------------------------LERLKTTKR--EG
D3RWY1_FERPA/11-164-------------------------------------------------------------------LASLKNVPR--SG
B1ZVD2_OPITP/30-194-------------------------------------------------------------------VDKLKDIFR--QT
A0RU59_CENSY/9-173-------------------------------------------------------------------AALLKTVPR--QG
C1AC57_GEMAT/21-180-------------------------------------------------------------------AESLKHSPR--TS
D7B965_NOCDD/27-189-------------------------------------------------------------------ADKLKRILR--QS
C8V219_EMENI/39-202-------------------------------------------------------------------LERLKTTKR--EG
HDDC2_BOVIN/25-182-------------------------------------------------------------------VGQLKRVPR--TG
A7HZD8_CAMHC/190-378-------------------------------------------------------------------GGRLRFQKR--..
A7F8M1_SCLS1/48-212-------------------------------------------------------------------LERLKTTKR--EG
Q15QK7_PSEA6/14-178-------------------------------------------------------------------IDKLKAVYR--KT
Q5LRU6_RUEPO/15-178-------------------------------------------------------------------ADRLKSVER--AN
B8CBS4_THAPS/17-179-------------------------------------------------------------------TRSLKTTKR--TG
O25415_HELPY/203-385-------------------------------------------------------------------FGQLRFQKR--..
E6VWX3_DESAO/205-393-------------------------------------------------------------------CGRLRFQKR--..
Q5ZYU3_LEGPH/18-179-------------------------------------------------------------------INKLKLVFR--NT
A4FQR8_SACEN/31-193-------------------------------------------------------------------VDKLKTVLR--QS
Q16R43_AEDAE/33-190-------------------------------------------------------------------VGNLKHTKR--TG
Q7N1B9_PHOLL/23-184-------------------------------------------------------------------LDKLKKVQR--RI
Q1GH96_RUEST/205-371-------------------------------------------------------------------ADRLKSVLR--AS
B3SA48_TRIAD/14-165-------------------------------------------------------------------CGQLKKVKR--TG
C8X0T1_DESRD/204-389-------------------------------------------------------------------CGQLRFQKR--..
Q2SKN3_HAHCH/16-175-------------------------------------------------------------------AEQLKNVIR--SA
D4JG23_9FIRM/15-177-------------------------------------------------------------------IDKEKTITR--QT
D4LER9_RUMC1/15-177-------------------------------------------------------------------IDKEKRIGR--QT
Q3A7Q9_PELCD/11-169-------------------------------------------------------------------VGMLKRTPR--TG
A8GIQ6_SERP5/23-185-------------------------------------------------------------------IDKLKSVQR--RT
B2VFS5_ERWT9/24-185-------------------------------------------------------------------.DKLKTVER--RT
B4EFY1_BURCJ/16-171-------------------------------------------------------------------AERLKDVLR--SG
B4F0N6_PROMH/23-183-------------------------------------------------------------------.DKLKRVYR--KN
B7VP19_VIBSL/14-176-------------------------------------------------------------------IEQLKDVHR--QT
C5AY39_METEA/21-183-------------------------------------------------------------------IDGLKAVLR--QN
C9A5T3_ENTCA/14-179-------------------------------------------------------------------ADKLKSILR--QS
E0SLP7_DICD3/23-185-------------------------------------------------------------------IDKLKSVQR--RS
G4Q3V2_ACIIR/202-379-------------------------------------------------------------------IGKLRFQKR--..
Q0PCB0_CAMJE/191-378-------------------------------------------------------------------.GRLRFQKR--..
Q24VU9_DESHY/19-181-------------------------------------------------------------------IDALKDITR--QS
Q2VZ21_MAGSA/19-173-------------------------------------------------------------------IDKLKGVLR--QT
Q6LQV5_PHOPR/14-176-------------------------------------------------------------------IEKLKSVIR--NT
Q81SJ1_BACAN/12-170-------------------------------------------------------------------AEKLKYEMR--HS
Q87NK1_VIBPA/15-176-------------------------------------------------------------------.DKLKSVLR--RT
Q9I2L9_PSEAE/16-171-------------------------------------------------------------------AERLKDVLR--SA
R5C105_9FIRM/14-176-------------------------------------------------------------------IDKVKNVFR--QT
R5KLA6_9CLOT/15-176-------------------------------------------------------------------VDKSKFVVR--QT
R5QTI2_9FIRM/29-188-------------------------------------------------------------------ADKVKSVFR--QT
R5TM75_9CLOT/14-169-------------------------------------------------------------------.EKLKCNTR--HN
R6G8E2_9FIRM/30-191-------------------------------------------------------------------.DKEKFIGR--QT
R6LS50_9FIRM/16-178-------------------------------------------------------------------IDKEKFIGR--QT
R6N9T8_9FIRM/15-175-------------------------------------------------------------------VDKEKFIGR--QT
R6QCB8_9FIRM/14-176-------------------------------------------------------------------VDKLKDIIR--QT
R6SD54_9FIRM/20-182-------------------------------------------------------------------IDKEKFITR--QT
R7FVV2_9FIRM/13-167-------------------------------------------------------------------AERLKCNMR--..

PF13735

C9AAQ5_ENTCA/248-396---------------------------------------------------------------------IPLENET--AA
CCA_STRMU/250-396---------------------------------------------------------------------FTFSTSE--QA
CCA_PEDPA/243-389---------------------------------------------------------------------KLLENPE--QV
CCA_LACS1/248-396---------------------------------------------------------------------FKLNTEE--EC
CCA_BACLD/243-391---------------------------------------------------------------------YQLQKSA--DI
CCA_LACLA/251-394---------------------------------------------------------------------FHFQNSE--QA
CCA_LACSS/248-396---------------------------------------------------------------------EQLHDES--AV
CCA_BACSU/243-391---------------------------------------------------------------------FSLTSRE--EL
D3G0K4_BACPE/235-381---------------------------------------------------------------------LKNEKEE--VI
Q7VFG8_HELHP/293-459---------------------------------------------------------------------LTPRSHT--LA
CCA_LEUMM/247-393---------------------------------------------------------------------DQATNYT--VA
C0ZCG8_BREBN/240-398---------------------------------------------------------------------RHLQTVT--QK
CCA_BACSK/225-369---------------------------------------------------------------------QQWDSGD--RA
D3E7N1_GEOS4/257-422---------------------------------------------------------------------IEPDHAT--IR
B7K9H1_CYAP7/243-397---------------------------------------------------------------------FKVTEET--LG
CCA_STRSV/250-393---------------------------------------------------------------------.RFSASE--QA
CCA_STRSY/251-396---------------------------------------------------------------------.RFSTSE--QA
G2SNU2_LACRR/248-394---------------------------------------------------------------------.EIQDEI--EA
I3U153_ENTFC/2-146---------------------------------------------------------------------...KEES--QA
CCA_LACC3/249-388---------------------------------------------------------------------.QLTSLA--SG
CCA_STRT2/251-396---------------------------------------------------------------------.RFTSSE--QA
CCA_BACAN/243-391---------------------------------------------------------------------.SFETDI--EA
CCA_ENTFA/249-396---------------------------------------------------------------------.QIETEA--EA
CCA_LACPL/249-398---------------------------------------------------------------------.HLPSIE--ST
CCA_STRR6/249-394---------------------------------------------------------------------FTFESSE--QA
CCA_STRP1/250-396---------------------------------------------------------------------FTFSDYH--QA
T0TWB0_9ENTE/82-228---------------------------------------------------------------------..LNNEA--SA

PF08668

Q312E7_DESAG/87-282-WT---I---S--MD-PRL-----------------------T-ASLLRLVNSPL-------FG..LRVKVD.TV--S--
Q30XT4_DESAG/21-218-EL---V---S--RD-PSL-----------------------A-VRILSLANSAY-------YG..LQAEVT.TV--G--
Q47EK7_DECAR/16-210-QQ---I---S--HD-QAL-----------------------T-ARLLRVANSSF-------YG..LQSRIS.TI--N--
Q726T5_DESVH/188-383-EV---I---T--RD-AGL-----------------------T-AWLLRVVNSAS-------YG..LSGRVD.TV--T--
Q2S9N5_HAHCH/19-212-QL---I---S--QD-VGL-----------------------A-GTVLKFVNSPM-------FG..LSNKIA.SI--A--
Q30WC1_DESAG/87-282-RV---I---S--RD-AGL-----------------------S-AFLLRMVNSAF-------YS..FPSRID.TV--S--
Q479K8_DECAR/17-212-GI---V---E--QD-PGL-----------------------A-SRILRVANSPA-------LR..RGTELK.NL--E--
Q73KD9_TREDE/241-434-QL---I---S--SD-IGL-----------------------A-TDLLKHVNSVA-------FG..LSKPCM.NI--V--
Q31F11_THICR/31-224-AL---V---A--QD-PRL-----------------------T-AGIIGAVNSAR-------YS..PGYNIT.NI--E--
Q72CV0_DESVH/23-218-EI---I---S--YD-PDL-----------------------A-SRLLRFANSAY-------FG..LRSPVD.NI--N--
Q2SKE1_HAHCH/26-214-KV---I---Q--GD-QAL-----------------------A-ARVMRIANSVA-------YS..PNASIV.SL--Q--
Q3JE99_NITOC/16-212-RV---I---Q--AD-PAL-----------------------A-GRLLKFANSAS-------VG..VRRPVV.AI--E--
Q30WG2_DESAG/22-218-EL---L---A--MD-PVL-----------------------A-ATILELVNSPY-------YG..QRNPVS.DM--Q--
Q2S8R9_HAHCH/193-393-DI---V---E--TD-PSL-----------------------S-AQVVSWASSSF-------YA..APGKIR.SV--H--
Q2SA21_HAHCH/160-347-KV---I---V--RD-PVL-----------------------T-AKLIRSANSPL-------YR..GFKEIE.CC--E--
Q3A583_PELCD/28-222-NI---I---S--KD-PSL-----------------------T-ARMMKIANSSL-------FG..FGGKIK.TI--E--
Q312Z8_DESAG/87-282-RE---I---S--ND-LGL-----------------------T-AKLLKLVNSPF-------YG..LAHTVE.DV--S--
Q72F84_DESVH/140-337-TL---I---Q--RD-MAL-----------------------S-ANLLRLVNSAF-------YG..FARRIS.MP--E--
Q39QJ3_GEOMG/20-214-EL---L---L--TD-QVM-----------------------A-ARVLKMVNSPL-------YR..PATVIT.SL--K--
Q5E6F6_VIBF1/39-240-DT---L---L--ED-PSL-----------------------T-AIVIRMANSVV-------FN..HRNITCTDV--L--
A6TLC8_ALKMQ/18-213-NQ---I---M--KD-QGL-----------------------T-TRVLRRANSAY-------YG..YPRRIS.SI--S--
Q72DM6_DESVH/18-215-EV---V---G--RD-QAL-----------------------S-TRLLRMANSAY-------YG..LQSEVP.SV--Q--
Q311L6_DESAG/19-208-RV---I---A--YD-QVL-----------------------S-AKVLKMVNSPI-------YG..FPGRIS.SV--Q--
Q9WZV8_THEMA/16-211-NT---L---M--MD-ASL-----------------------S-ARVLKLANSAY-------YG..VPRKIT.TL--S--
Q3J8D7_NITOC/32-219-KI---I---V--TD-TAL-----------------------S-VRLIKIANSPL-------YR..GRHPIN.NV--Q--
Q7P1W8_CHRVO/14-205-DM---V---M--HD-QVL-----------------------S-ARVLRLANSAR-------FG..SSRRVG.SL--D--
Q7UJI6_RHOBA/74-269-KP---I---E--AD-PGL-----------------------M-GQVLRFVNSSY-------FG..FSREIM.SI--P--
Q5DZR1_VIBF1/13-204-KT---I---S--LE-QVV-----------------------S-GRVLRLANSAH-------FS..RGKSVS.SV--N--
Q3A5R3_PELCD/31-223-QV---I---S--RD-PVV-----------------------A-ASVLKVANSSY-------YS..FQRQIN.NL--E--
Y073_TREPA/254-447-AL---I---S--QD-VAL-----------------------V-TDLLKLVNSAR-------FG..MNKRCL.DI--S--
Q2W316_MAGSA/143-340-AL---I---D--KD-MAM-----------------------T-AELLRLTNSAY-------FT..VAAPVT.TT--L--
Q30YJ4_DESAG/188-383-EV---I---A--ND-TDL-----------------------S-ARLLRLVNSTF-------YG..LRAKVD.TI--T--
Q315F2_DESAG/150-345-EV---V---S--TD-ASL-----------------------A-ARLLRLVNSPF-------YG..FPSKID.SI--A--
Q39ZN9_GEOMG/20-214-DL---L---L--MD-QVL-----------------------T-IRLLRLANSPY-------YS..TMKNIV.SL--K--
Q47F47_DECAR/17-209-HH---V---E--RD-PVI-----------------------T-ARVLSIANSAA-------MAGHSGSDVH.DV--R--
Q2RWK0_RHORT/140-335-RM---I---A--ED-MAM-----------------------T-AELLKITNSSY-------FA..LPSRIT.TA--A--
Q9I6M3_PSEAE/161-349-AE---F---G--RD-PQI-----------------------T-AGLIAAANSAA-------RH..VGPACQ.TL--G--
Q893W4_CLOTE/30-227-LE---I---L--ND-QSL-----------------------T-TKILRLANSTY-------YG..YARKIS.TV--S--
Q6AL41_DESPS/16-211-QL---V---S--QD-ISL-----------------------S-AKMLKVVNSAH-------YG..FPQDIS.SI--N--
Q39X38_GEOMG/18-206-RL---V---S--SD-QIL-----------------------S-ARVLRLVNSPS-------YG...FYRVS.TI--S--
Q74AQ6_GEOSL/25-219-DL---L---L--QD-QVL-----------------------T-ARVVHLANSPL-------YS..AARPIS.SI--R--
Q47BZ2_DECAR/19-212-RL---I---S--QD-VAL-----------------------A-GHVMLIANSPA-------FS..TGHKLA.SI--T--
Q74A15_GEOSL/20-215-RI---I---I--DD-QGL-----------------------T-ARILKLANSPM-------FG..FFSKVD.SI--S--
Q729J3_DESVH/10-205-AI---V---S--KD-PRL-----------------------T-ASLLKLVNSPH-------FG..FSTPIE.TV--S--
Q7MK26_VIBVY/15-206-KK---I---S--MD-QVL-----------------------S-ARLLRMANSAH-------FG..GTKSIA.TI--N--
G8MPC2_9BURK/14-206-EK---V---R--QD-QAL-----------------------S-AKVIRVANSSF-------YG..ERGRIS.SV--E--
Q4KGR2_PSEF5/23-203-KV---I---G--RD-TAL-----------------------S-ARLIKVVNSPL-------LR..AAQEVT.DL--H--
Q88AT3_PSESM/164-350-QE---L---R--ND-PHI-----------------------T-AVLIAAANSAA-------QH..LGKPVQ.TM--G--
Q88RB8_PSEPK/160-345-EE---V---R--ND-PQV-----------------------T-AVLIAAANSAA-------LH..REAPVQ.TL--L--
Q8EXT4_LEPIN/15-212-KE---I---S--ND-PGL-----------------------T-ADVIKLSNSAY-------YR..AAKPIK.TV--Q--
Q8F5F6_LEPIN/263-457-SE---I---E--KN-PAL-----------------------S-VDLLKLSNSAG-------FA..SRNKVN.TI--V--
Q8F7S8_LEPIN/248-443-EV---I---K--KD-VAL-----------------------S-ANILKLANSAA-------FI..RANKVE.SL--D--
Q8PAV4_XANCP/2-187-NV---I---G--MD-MAL-----------------------S-ARMLRVANSPL-------YA..SRRRID.NL--G--

PF01966

O17828_CAEEL/89-184-GI---I---N--NH-VF.........................-FMVVRIRAGPT-------LH---------DL--L--
D4FZG3_BACNB/50-149-VD---L---E--MD-PS.........................-.....TIAGGF-------LH---------DV--V--
DGTP_SHIBO/66-184-RY---I---A--KE-ILSRMKE....LKLL.EAYGL.DELTG-PFESIVEMSCL-------MH---------DI--G--
Q9Y9C8_AERPE/32-133-GE---I---A--WR-ARS...........S.G........LQ-ASPEKAVAIAL-------YH---------DM--A--
N1P9P6_YEASC/58-164-ML---I---T--DK-..........................N-VDRNKCIRIAL-------VH---------DF--A--
O67745_AQUAE/51-169-ER---I---C--ES-LK........................V-KEKELVKLAGL-------LH---------DL--G--
Q9Z9D3_CHLPN/480-625-EA---A---A--QA-IG.........................-ADSLYCLVAAH-------YH---------DI--G--
Y205_CLOB8/33-134-QL---I---N--LE-ESL.......................G-FNKEIIYTTAI-------LH---------DI--G--
Q9RU30_DEIRA/189-293-MK---I---G--RS-LGL.............S.........S-RELEELWFAAT-------LH---------DL--G--
YS48_CAEEL/92-193-YA---L---V--DK-LRHSQ........PS.LN......ITE-SDLICTSVAAL-------LH---------DV--G--
Q9RWF0_DEIRA/280-403-TR---L---A--QR-LGW.............D.........E-EQVRALRWGAY-------LH---------DL--G--
Q9X1N3_THEMA/52-163-GL---Y---A--RN-LFK.............E.........S-DRIRIVRLAAL-------LH---------DV--G--
Q9X1H8_THEMA/254-377-KK---I---A--KR-LGF.............S.........P-KMVERIYNAAF-------LH---------DI--G--
D4G2U1_BACNB/61-181-RR---M---V--DD-VFKG.........RP.EW.......DD-SERELCLAAAL-------LH---------DL--G--
SPOT_AQUAE/49-145-AE---L---G--MD-HE.........................-.....TIIAAL-------LH---------DT--L--
O24769_BACME/28-137-HI---L---C--E.-LKET..........L.EG.......KK-INKEKLLLYAL-------YH---------DV--T--
F7UTY5_SYNYG/586-734-ES---A---A--RE-LR.........................-CNVELVRTGTL-------YH---------DI--G--
E8VG54_BACST/160-279-KA---I---A--DL-YP........................S-LDRDLLYAGVI-------LH---------DL--G--
Q9YBD1_AERPE/68-180-ST---L---S--DG-TLE...........D.V.........E-EAKAVVLLAAF-------LH---------DI--G--
RNY_MYCMY/238-331-GA---I---A--SE-LG.........................-LDVEKAIRAGL-------LH---------DI--G--
J9DNF1_9THEM/20-135-RK---L---G--EM-YG.........................-ADSNKLELAAI-------SH---------DL--F--
RELA_STREQ/50-149-AD---L---H--..-...........................-LDAVTV.ACGF-------LH---------DV--V--
Q9X1J6_THEMA/238-380-ET---A---A--EK-IG.........................-ANPILARIGAY-------YH---------DI--G--
A0A008B076_STAAU/57-156-TE---M---R--LD-GP.........................-.....TIVAGF-------LH---------DV--I--
SPOT_MYCPN/62-167-VE---W---N--MD-SN.........................-.....TVCAGL-------LH---------DI--I--
B7J1D0_BORBZ/62-161-AK---F---Q--LD-FK.........................-.....ATIAGL-------LH---------DV--L--
D4FWU4_BACNB/336-429-GL---M---A--SE-LG.........................-EDAKLAKRAGL-------LH---------DI--G--
A0A038F966_MYCTX/105-202-AE---L---G--MD-TT.........................-.....TLVAAL-------LH---------DT--V--
M1UP73_BACIU/501-643-EA---A---C--EA-VG.........................-ANGLLARVGAY-------YH---------DL--G--
Y778_METJA/18-130-YE---L---A--LA-IKN...........K.G........YE-VDVELVRLGGL-------LH---------DI--G--
A0A017JHE0_ECOLX/30-142-HA---L---A--AI-KNRK..........F.G........GN-VNAERIALLAM-------YH---------DA--S--
RNY_DEIRA/388-481-GI---M---A--DE-LG.........................-LDAALARRAGL-------MH---------DV--G--
Q9RV39_DEIRA/227-347-QL---L---T--RR-PD.........................-.ADLLLRWATL-------LH---------DV--G--
O29268_ARCFU/5-101-RY---I---A--ER-EG.........................-ARLDVVLKAAE-------LH---------DI--A--
F5M2J7_RHOSH/51-140-GR---C---Q--PR-VQT.......................R-.....WRLAAL-------LH---------DA--P--
Y461_MYCGE/55-184-RR---I---L--NS-SAFL..........N.I........DQ-IKKQTVLVAGL-------LH---------DL--G--
GLND_RHILV/488-604-SE---I---D--KG-RAEDLH......PLA.NKL....MPGI-EDREALYVAVL-------LH---------DI--A--
SPOT_HAEIN/18-117-AQ---L---H--LD-HE.........................-.....AVMAAL-------LH---------DV--I--
Y1020_METJA/58-173-YK---K---G--IE-PSFVK........DC.KG......SFE-DSLVITLLGAY-------LH---------DI--G--
F7UME6_SYNYG/335-476-RK---Y---Q--VD-LGFGERVAQFATSFFDQLRGVLHDWGE-TEREWLWAAAI-------LH---------NC--G--
Q9X0Q2_THEMA/445-567-VE---I---G--RM-FDL.............G.........D-EKLEKLYWAGL-------LH---------DI--G--
CAS10_METJA/1-92-NE---Y---T--A.-...........................-.....LKIGAL-------LH---------DI--G--
A0A026MC82_ECOLX/26-132-QK---L---A--AD-DD.........................-VDMLVILTACY-------FH---------DI--V--
Q9X225_THEMA/394-516-QE---I---A--RR-KGL.............P.........D-QVVERIRIAAV-------LH---------DI--G--
I0LL24_CORGK/383-503-AL---E---T--VT-VA.........................-.RPDLLVLGAL-------YH---------DI--G--
B9X448_BORBG/324-419-EI---L---A--KE-MK.........................-LDPVVVKRACL-------LH---------DI--G--
SAMH1_HUMAN/164-319-GC---L---V--HA-LGEKQ........PE.LQ......ISE-RDVLCVQIAGL-------CH---------DL--G--
E8VDR1_BACST/18-132-IE---L---A--ER-FG.........................-ADSKKAEIAAI-------FH---------DY--A--
O59597_PYRHO/37-137-LH---I---G--SK-EN.........................-ADLEILALAAL-------LH---------DI--A--
RNY_AQUAE/374-467-GL---M---A--EE-LG.........................-LDAKLARRAGL-------LH---------DI--G--
RNY_THEMA/324-417-GY---M---A--SE-LG.........................-LNADKARRGGL-------LH---------DI--G--
F7UK95_SYNYG/36-134-LE---M---G--GS-ED.........................-.....EAIAAL-------LH---------DA--V--
B2S3P0_TREPS/581-722-EN---A---C--RS-IG.........................-AHSLLARVGAY-------YH---------DI--G--
RNY_MYCGE/293-385-AH---L---A--AL-IE.........................-LDSELSLKCGL-------LH---------DI--G--
F6BQM3_SINMB/494-610-SR---I---E--RG-LEEEAH......PLT.AML....MPGI-EDREALYVAVL-------LH---------DI--A--
A0A017I4K6_ECOLX/228-329-AM---L---S--PQ-VD.........................-.....VRFATL-------CH---------DL--G--
O34203_FERIS/166-297-DS---I---C--KI-YG........................Q-LDRDLLVTGAL-------LH---------DI--G--
Q9WXP4_THEMA/15-134-AQ---I---A--EK-MN.........................-LDPNVSFLSGL-------IH---------DL--G--
M1GE25_MYCPM/300-392-AY---L---A--LL-VN.........................-FKPDVALKCGL-------YH---------DI--G--
F7UP12_SYNYG/21-136-VQ---W---A--PL-HK.........................-VDPIKAGQAGL-------LH---------DL--A--
MESH1_DROME/33-128-SV---E---A--CI-TDE.......................G-.....VLMAAL-------LH---------DV--V--
Q9V1T1_PYRAB/57-183-KK---L---S--QE-LNL.............H.........Y-EESLLIQLAAL-------LH---------DI--G--
GLND_VIBF1/451-585-NK---F---S--DT-TNRDKH......PIC.CEI....FPKI-MKKELLIIAAI-------FH---------DI--A--
Q9UY89_PYRAB/33-132-LL---L---L--NK-IKE...........E.G........VK-IDENRVLKMAI-------IH---------DI--G--
Q9WZI8_THEMA/93-197-AG---L---G--VD-VT.........................-.....TLVAAL-------LH---------DV--V--
D6EPR5_STRLI/149-246-AE---L---G--MD-PA.........................-.....TLMAGL-------LH---------DT--V--
G4EUQ1_BACIU/26-129-AY---I---G--EK-EK.........................-ADLFIVETAAL-------VH---------DL--I--
B2S403_TREPS/156-278-VV---I---G--LQ-LKM.............Q.........P-FKIIELATSCL-------LH---------EI--G--
C9MIV2_HAEIF/446-580-ES---F---L--PK-GSAQEH......PIA.HRI....FSQL-SDRTLLYIAAL-------FH---------DI--A--
O30165_ARCFU/578-749-AD---Y---F--GY-E.Y.......................N-EFVNLIKCITA-------LH---------DL--G--
C7GMY9_YEAS2/77-183-ML---I---K--DS-..........................R-VNRDKCVRIAL-------VH---------DI--A--
O58617_PYRHO/35-142-LN---I---D--VK-...........................-LAEELLKKAYI-------FH---------DI--G--
DGT1B_DEIRA/61-211-VG---I---L--LE-IQRRF.......AGS.NIE.....KYL-PDERLLEAICL-------SH---------DY--G--
Q9RYW9_DEIRA/337-458-RE---L---F--DR-LLAA.........GE.TF.......PP-PARSLLTAAAV-------LH---------EA--G--
D6EMA1_STRLI/270-395-MA---L---E--S.-..........................E-GPDLTLRLAAL-------LH---------DI--G--
Q9X0N1_THEMA/184-308-AL---V---A--EA-MGC.............S.........S-EFVELIEKAAP-------FH---------DI--G--
SPOT_SPICI/49-148-AQ---W---R--MG-PK.........................-.....TLIAGL-------LH---------DV--L--
O26251_METTH/50-159-SR---L---A--EH-LGL.............G.........H-EKKRVLRLCAL-------LH---------DV--G--
DGTL1_ZYMMO/68-203-RT---I---A--RV-LR.........................-LNEDLTEALCL-------AH---------DL--G--
O27704_METTH/15-122-LE---L---S--RE-LP.........................-VDMKLVEEGAI-------LH---------DI--G--
O28840_ARCFU/39-129-FI---L---A--LK-SGE.............S.........V-EKACKAATAAL-------FH---------DL--H--
YPEC_LACLC/25-141-VQ---Q---K--EI-NQ........................F-ISKSQAFVAGL-------MH---------DI--G--
Q9RTC7_DEIRA/78-187-AR---L---G--MD-TD.........................-.....SLMAGL-------LH---------DT--V--
Y2027_AQUAE/19-141-QL---I---G--KE-LGL.............T.........S-QEIELLKLGGY-------IH---------DV--G--
A0A017I0H4_ECOLX/45-144-AE---M---K--LD-YE.........................-.....TLMAAL-------LH---------DV--I--
D5AVY7_RICPP/62-198-RS---V---A--NT-LN.........................-LSSDLAETIAL-------AH---------DL--G--
O83882_TREPA/204-327-II---V---A--QH-LGF.............S.........E-KDIFDLVVASL-------LH---------DI--G--
O27154_METTH/3-97-..---.---.--..-...........................-MNLEDIQLAAL-------LH---------DI--G--
Q56418_THETH/27-147-LW---L---W--PE-APL.......................E-.....ARLAAL-------FH---------DV--G--
RSH3C_ARATH/237-341-AD---I---G--AN-ST.........................-.....VVVAGI-------LH---------DT--L--
O57915_PYRHO/21-126-ER---I---L--ER-INY.............P.........S-EARDCILMHVF-------LH---------DV--G--
O58085_PYRHO/33-132-LV---L---A--DV-LEK...........R.G........KR-IDVEKALKMAI-------VH---------DL--A--
RELA_MYXXA/63-165-GE---L---K--LD-EA.........................-.....SIVTGL-------LH---------DT--I--
Q9RJG7_STRCO/66-190-SL---Q---A--AA-LGL.......................R-PDPELLYVAAL-------FH---------DT--G--
RNY_HELPJ/342-435-GL---I---A--EQ-LG.........................-GDKKLARRAGI-------LH---------DI--G--
Q9RVH0_DEIRA/24-142-QR---I---A--EH-HP........................D-LDPARAHTLGL-------LH---------DI--G--
YC0H_SCHPO/38-144-.M---L---C--ND-PS.........................-INKERCLKIAV-------VH---------DM--A--
Y048_RHOCB/51-140-AR---A---N--PG-IGE.......................R-.....WRLAAL-------LH---------DA--P--
Q9RYB1_DEIRA/218-341-ER---L---G--ER-LGL.............D.........F-DERRELRWGAY-------LH---------DL--G--
D4GBT9_TREPC/186-314-RL---I---A--EY-LYDIN........LY.PQ......VDT-DFVENIAFLAA-------MH---------DV--G--
F7UP82_SYNYG/158-280-EG---F---G--EF-IGL.............E.........Q-GQIDDLVFAAR-------LH---------DL--G--
Q9YW52_MSEPV/52-162-NM---H---M--IK-YDMKI.......YNV.YKT....QKLP-GNLNIFQFIGL-------FH---------DI--G--
B2S4Q5_TREPS/320-413-SM---L---A--SE-IG.........................-ADVAIAKRGAL-------LH---------DI--G--
A0A038FDD5_MYCTX/72-222-RG---M---A--IG-LG.........................-CDLDLVELAGL-------AH---------DI--G--
O67911_AQUAE/273-423-EQ---V---I--ED-RAKYLSA...ELLEN.FGKKR.VLGEF-TDVELLKWGAL-------FH---------DI--G--
D4G0S6_BACNB/23-139-YR---L---S--VK-AD.........................-INPDLAAKAAL-------LH---------DI--G--
G4EZI1_BACIU/49-154-KK---L---G--GT-IE.........................-.....EQIAGL-------LH---------DV--S--
D0KRE5_SULS9/50-168-TI---L---G--EK-FRQL..........G.II.......TD-EESTYLKLSAL-------LH---------DI--G--
O29044_ARCFU/20-133-MK---I---A--EN-IRK...........K.G........HE-VDMDAVLKGAL-------LH---------DI--G--
O69970_STRCO/99-196-AE---L---G--AE-TT.........................-.....TLTASL-------LH---------DT--V--
Y240_MYCGE/140-252-KQ---L---A--IA-NK.........................-LDAKRAFVAGA-------YH---------DL--A--
Q9RWG4_DEIRA/36-142-LT---L---A--EY-APT.......................G-TDVGRVVRLLL-------MH---------DL--V--
Q59534_MYCLR/269-391-..---I---A--LE-DN.........................-GPDLVLRWAAL-------LH---------DI--G--
Q9WZJ8_THEMA/110-231-ER---V---G--KK-LGL.............S.........E-EKLSLLREYAM-------LH---------DV--G--
O28849_ARCFU/51-157-RI---L---Q--ER-MG.........................-.FDDVVVAAAL-------LH---------DV--G--
Q9UXZ9_PYRAB/35-137-LC---I---G--AR-EG.........................-GNLEVIALSAI-------LH---------DI--A--
Q9RRB2_DEIRA/9-122-RE---I---A--EA-AAL.............S.........P-EEIAQAYAAGI-------LH---------DI--A--
B1LB67_THESQ/20-135-RA---L---A--RE-FN.........................-EDEEKWGLAGL-------LH---------DL--D--
A0A038FBC4_MYCTX/430-550-AP---L---A--TR-VA.........................-.RPDLLALGAL-------LH---------DI--G--
B0R8Y7_HALS3/34-139-LL---Y---A--DQ-ED.........................-VDRQKAVTMAL-------IH---------DL--G--
D5EU34_PRER2/267-390-AM---H---S--DN-LW.........................-.....LRWAAL-------LH---------DV--G--
F7UQ39_SYNYG/76-175-RD---L---G--GD-EA.........................-.....MIAAGF-------LH---------DV--V--
J9H327_9THEM/170-294-GR---I---A--EE-MGM.............S.........E-VFVTEIQFAAP-------LH---------DI--G--
O24771_BACME/49-153-RY---L---N--GS-IL.........................-.....EQIAGL-------LH---------DI--S--
O30203_ARCFU/70-165-KS---L---A--RE-LG.........................-EDEEKWWTIGI-------LH---------DI--D--
A4QEM7_CORGB/77-174-AE---I---G--MD-TT.........................-.....TLVAAL-------LH---------DT--V--
GLND_STRCO/431-550-AG---F---T--RR-VH.........................-.RPDLLLIAAL-------LH---------DI--G--
O59446_PYRHO/39-165-RK---L---S--LE-LQL.............P.........R-EDSLLIQLAAL-------LH---------DI--G--
DGT1A_DEIRA/76-198-RT---A---A--LS-LG.........................-LNETLAETVAL-------AH---------DL--G--
B2S3X9_TREPS/13-131-CM---L---V--RR-YAL...........E.A.........Q-LEPHVY.CAGI-------AH---------DM--C--
Q9VMB3_DROME/209-311-FL---L---D--GS-EG.........................-LNQIRCMELAL-------VH---------DL--A--
O81418_ARATH/34-167-GE---L---E--LD-WE.........................-.....SIVAGL-------LH---------DT--V--
GLND_KLEOX/465-599-ES---F---A--KE-ETRSRH......PLW.LEL....WPRL-THPELILIAAL-------FH---------DI--A--
Q9UZX4_PYRAB/16-187-ER---M---Y--IS-RNYGEF......LSR.VLN....LRKE-KAEGLLRKAYI-------IH---------DV--G--
Q16CX0_ROSDO/51-140-TR---I---A--D.-...........................-KSPAKWRLAAL-------LH---------DA--P--
Q9R6H4_RHIRD/41-147-VT---L---A--PS-LEH.......................P-VDLGHVLKLII-------VH---------DL--A--
F7USP6_SYNYG/61-155-RS---L---G--RM-VGDQII......KRH.QLQA...IEAA-DFGDILSAACL-------AH---------DI--G--
Q9WXP4_THEMA/224-342-EK---M---A--EK-AG.........................-RNSEDLFIAGL-------YH---------DI--G--
Q9RRR5_DEIRA/48-141-RW---Y---A--RH-WG.........................-EDEETYAVTGL-------LH---------DF--D--
MPTB_METJA/58-172-LK---M---A--DV-LEEV..........Y.G........VE-VNRDYIIAGAL-------LH---------DI--M--
Q9RYH1_DEIRA/488-612-AH---I---A--LA-LGW.............S.........Q-ADAELLMLASR-------LH---------DV--G--
Q56749_WOLSC/57-181-KI---L---A--LG-MGL.............S.........E-LEAELVKVASP-------MH---------DI--G--
O82212_ARATH/108-212-LI---S---S--DI-PG.........................-VNRDKCMKMAI-------VH---------DI--A--
J3TU75_MYCGT/49-154-VE---W---N--..-...........................-MDPITI.CAGL-------LH---------DI--I--
Q9RZM5_DEIRA/48-178-HE---L---S--EG-LD........................P-FDRAALLLAAA-------LH---------DI--G--
Q9X210_THEMA/387-509-KF---F---A--EE-MGL.............D.........E-DLVHKIYLYAP-------LH---------DI--G--
M1GES7_MYCPM/55-184-RR---I---L--NT-PAFA..........P.I........DE-NKKQTVLVAGL-------LH---------DI--G--
F7UPV4_SYNYG/177-315-RA---L---A--EQ-LKNHP........RF.QKF.....LTD-HTINLLYKSAP-------LH---------DI--G--
A0A008AQ38_STAAU/159-278-KS---I---C--DI-YP........................L-LNKSLLYSGII-------LH---------DI--G--
Y336_MYCPN/193-304-KT---L---A--VA-NK.........................-LDGKTAYTAGA-------YH---------DL--A--
Q9RH69_BRAJP/95-194-TD---L---K--LD-DA.........................-.....TIVAAL-------LH---------DT--I--
L8F915_MYCSM/72-222-RG---M---A--IG-LG.........................-CDPDLVDLAGL-------AH---------DI--G--
Q9X0M9_THEMA/171-296-EE---I---G--KI-VGL.............D.........E-KRLAKLYLAGL-------LH---------DI--G--
Y1154_METJA/50-150-SK---I---A--EK-IN.........................-ADVELTRVSAL-------LH---------DI--G--

PF13328

A9U2H3_PHYPA/119-274.AA---I...G..VS-NT.-----------------------.-.....VIAAGL-------LH---------DA--I..
A1T4E6_MYCVP/17-161.ID---D...GGTEE-QA.-----------------------.-.......IAAL-------LH---------DC--V..
CRSH3_ORYSJ/79-231.AD---L...Q..MD-AE.-----------------------.-.....VISAGM-------VR---------GA--L..
D0J716_COMT2/42-203.KK---I......GG-SE.-----------------------.-.....TMQAAI-------YL---------VH--ASV
D3HT91_LEGLN/40-196.AD---L...E..VD-QE.-----------------------.-.....TLAAAI-------IF---------EN--V..
A4G620_HERAR/30-203.SE---L...E..TD-AD.-----------------------.-.....TRIAAL-------LF---------EL--E..
C5A8B1_BURGB/16-182.RT---L...N..VD-PQ.-----------------------.-.....AVQAAA-------LF---------SL--T..
B1Y0Q8_LEPCP/41-202.KS---V......GA-AP.-----------------------.-.....SMQAAV-------YL---------VY--A..
C1DRX7_AZOVD/40-203.AD---L...K..LD-QD.-----------------------.-.....SLVAAV-------LY---------RG--V..
Q7NIR7_GLOVI/11-155.IR---C...G..YS-ED.-----------------------.-.....VAIAAL-------LH---------DV--V..
Q2KUM4_BORA1/36-197.AN---L...H..TD-AA.-----------------------.-.....TRAAAL-------LA---------TL--PAD
A6VKS4_ACTSZ/37-191.HS---L...N..MD-GD.-----------------------.-.....TLLAAM-------LF---------PV--V..
Q1QX17_CHRSD/40-201.GE---L...K..LD-QA.-----------------------.-.....ILEAAV-------LY---------RV--V..
Q3JBJ7_NITOC/22-174.AK---L...Q..VD-TE.-----------------------.-.....TQIAGL-------LL---------PA--M..
Q0VP27_ALCBS/38-202.VD---L...G..AD-SD.-----------------------.-.....VLPAAI-------LY---------RA--V..
Q5NYK8_AROAE/35-194.AS---L...R..LD-VE.-----------------------.-.....TRVAAL-------LF---------AV--G..
C6WYQ5_METML/40-203.VS---L...N..LD-AE.-----------------------.-.....SIIATI-------LY---------AV--P..
A0LAH5_MAGSM/29-180.WG---L......VD-AA.-----------------------.-.....GICAAL-------LH---------DS--I..
A4RTL9_OSTLU/39-191.AK---L...G..MD-AK.-----------------------.-.....TVAVGL-------LH---------DT--L..
A4YUR2_BRASO/10-154.RV---L...SAGGS-EV.-----------------------.-.....QAIAGL-------LH---------DA--A..
A1WR12_VEREI/38-195.KG---I......GG-SEA-----------------------M-QAASYLVQACI-------HL---------NK--P..
Q01DM6_OSTTA/79-231.AK---L...G..MD-TK.-----------------------.-.....TVAVGL-------LH---------DT--L..
Q2Y627_NITMU/35-194.AG---L...R..VD-SD.-----------------------.-.....TLAAGV-------LH---------AV--P..
C1DDC8_LARHH/40-201.AD---L...N..LP-SV.-----------------------.-.....TTAATL-------LA---------GL--PL.
D3RPV6_ALLVD/41-199.AR---L...R..MD-HE.-----------------------.-.....TLVAAL-------LK---------GC--L..
A1WXU2_HALHL/39-197.AE---L...G..LD-AA.-----------------------.-.....TLAAAL-------IH---------DL--P..
Q1H1S1_METFK/41-206.VG---M...S..MD-AE.-----------------------.-.....TIAATV-------LH---------AC--P..
Q9CJX4_PASMU/37-191.HS---L...N..MD-AD.-----------------------.-.....SLLTAM-------LY---------PT--I..
D5CLC9_SIDLE/41-202.IG---L..HM...D-HE.-----------------------.-.....TIAATA-------LH---------AI--P..
Q7VTF3_BORPE/36-199.AS---L...H..TD-QA.-----------------------.-.....TRVAAV-------LA---------SL--P..
Q21WQ7_ALBFT/39-207.RI---I...G..GS-EA.-----------------------.-.....MQAASY-------LV---------YA--C..
C7RQP8_ACCPU/48-214.AG---L...K..LD-AD.-----------------------.-.....SRLAAL-------LF---------AV--P..
C4YVJ8_9RICK/45-189.AD---Y...L..FR-TD.-----------------------.-.....ILVSSI-------LH---------DT--I..
D0MFP1_RHOM4/19-189.DR---A...G..WD-DV.-----------------------.-.....TVAAAF-------LH---------DA--L..
E6U0A6_BACCJ/9-157.QT---HLHGSSFSD-EER-----------------------.-...MNIIIAIL-------LH---------DV--I..
Q0KBZ4_CUPNH/23-190.DG---L...R..VD-DA.-----------------------.-.....ARAAAC-------LF---------GL--V..
D9SJ75_GALCS/35-194.IG---M...N..MD-HE.-----------------------.-.....TIAATI-------LH---------AV--P..
Q6AP30_DESPS/31-180.AS---M...Q..LD-LD.-----------------------.-.....TILAAL-------LH---------GT--I..
D5X0W0_THIK1/25-183.RE---I...G..AD-AD.-----------------------.-.....AQAAAY-------LN---------LV--V..
Q0A9N8_ALKEH/39-195.SG---L...R..LD-AA.-----------------------.-.....TLAAGL-------LH---------DL--P..
A5UZY0_ROSS1/13-154.LR---H...G..FD-ED.-----------------------.-.....VVIAGL-------LH---------DV--I..
A1K650_AZOSB/35-194.AS---L...R..LD-AD.-----------------------.-.....TRIAAL-------LF---------SA--N..
C4ZK28_THASP/35-194.AS---L...R..LD-AE.-----------------------.-.....TRVAAL-------LF---------AA--W..
D4IMI0_9BACT/28-187ISE---V...GLGRN-...-----------------------.-.....STISAI-------LH---------DV--V..
A2SG51_METPP/47-209.QA---I......GA-AP.-----------------------.-.....TMRAAA-------YL---------VY--AGD
Q8LSZ7_CHLRE/200-352.AG---L...G..LD-AE.-----------------------.-.....TVAAAL-------LH---------EC--V..
E0ULD0_CYAP2/16-160.LE---D...G..GD-ED.-----------------------.-.....EAIAGL-------LH---------DA--V..
Q2SL26_HAHCH/40-204.SE---L...Q..LD-SP.-----------------------.-.....SLIAAV-------LY---------RA--V..
A6VUQ3_MARMS/40-204.SG---F...R..AD-QD.-----------------------.-.....SLVAAA-------LY---------RV--V..
Q47C74_DECAR/36-202.AG---L..KL...D-VE.-----------------------.-.....SRIAAV-------LF---------AI--P..
Q3A521_PELCD/26-176.IR---L...K..MD-VP.-----------------------.-.....TITTGL-------LH---------DI--L..
A1VQB2_POLNA/39-200.KT---I...G..GS-EA.-----------------------.-.....VQAATY-------LV---------HS--C..
A1U2U8_MARAV/44-203.AE---L...H..LD-QA.-----------------------.-.....SLVAAV-------LY---------RA--V..
A1WAJ9_ACISJ/45-206.KH---L...G..GS-ET.-----------------------.-.....MQAAAY-------LV---------YA--C..
C4YZG9_9RICK/69-212.SD---Y...L..FR-TD.-----------------------.-.....IIVTSI-------LH---------DC--I..
G2IXS4_PSEUL/40-200.AD---L...D..LL-TD.-----------------------.-.....AVVATL-------LF---------AV--P..
O25466_HELPY/45-202.AF---C...G..GD-EA.-----------------------.-.....MVCAAL-------LH---------DV--V..
RELA_HAEIN/37-193.HE---L...N..MD-AE.-----------------------.-.....TLLTAM-------LF---------PI--V..
Q13WF6_BURXL/19-186.RT---L...N..VD-PP.-----------------------.-.....AVLAAA-------LF---------AL--T..
Q31Q06_SYNE7/14-158.ME---H...G..GD-ED.-----------------------.-.....QTIAAL-------LH---------DA--I..
Q5F707_NEIG1/40-201.DE---L...D..LL-PD.-----------------------.-.....AVAATL-------LA---------DI--G..
Q5NEV0_FRATT/39-192.FK---I...R..AD-EE.-----------------------.-.....SVSAGI-------LY---------EL--Y..
Q83BW2_COXBU/24-180.QP---L...H..CD-SE.-----------------------.-.....TLAAAL-------LY---------PT--V..
Q885Y7_PSESM/37-199.AD---L...K..LD-QD.-----------------------.-.....SLVAAV-------MY---------RG--V..
Q8PBN2_XANCP/11-164.LE---C...G..GD-ED.-----------------------.-.....QAIAGL-------LH---------DV--V..
Q8XZ30_RALSO/33-195.EG---L...R..VD-AP.-----------------------.-.....SLQAAA-------LF---------LL--P..
R7JMQ2_9BACT/28-185LEE---I...G..LG-GD.-----------------------.-.....SVVAAI-------LH---------DV--V..

PF07514

A1U8B0_MARAV/20-345-VR---I---S--QG-YIL----------PPNAEPESIAESAD-RWRFAAMIAIL-------SH---------DL--GKI
A1TJN5_ACIAC/34-347-LK---L---R--QS-HLL----------PAGATPEAQAAQAE-AWTAGVAYAAL-------LH---------DI--GKI
A1TQV2_ACIAC/57-390-MT---W---R--NA-HLL----------PGGSEIEEVDAQRD-QWTYVVFFAAL-------LH---------DI--AKP
A6THL2_KLEP7/23-338-IR---L---R--QG-YLL----------PPEVGAEEQARQAS-AWTVTVVCAAL-------LH---------DT--GKI
Q47CV4_DECAR/17-338-LQ---G---T--DA-HIF----------SGRMSISARRQLEP-RWRHATFIAGL-------CC---------EL--HRL
Q21QJ1_ALBFT/57-380-AQ---S---A--DG-RIF----------AANEGIERRRQTEA-AWRHAAFLTGL-------TC---------EL--FRP
B4EWU3_PROMH/32-353-AQ---A---A--EG-IIF----------VASGTPVEKKELEP-RWRVAAALGGL-------FH---------DI--GKP
H6URM8_PROSM/46-357-AQ---A---S--ES-VIF----------SIEGTPRERRDNEP-RWRLASCFSGL-------LH---------DV--GKP
M9X6X6_PASHA/34-346-AK---V---R--QN-YIL----------PPNVAPEEQSKQRD-AWTAAAIYLAL-------VH---------DI--GKV
Q13VV9_BURXL/28-340-LK---L---R--QS-HLL----------PAGSTPEDQAAQSE-AWTAAVAYAAL-------LH---------DV--GKL
Q889C1_PSESM/24-338-LK---I---R--QM-YLL----------PIGAPPESQAAQSE-AWSAASAYGAL-------VH---------DL--GKI
S6BRE4_PSERE/59-379-LD---G---C--LT-TAF----------DTNETPARRSMRLR-RWYVAGIASGL-------LH---------DA--GKP

PF13487

C4LEW6_TOLAT/829-894-GT...L------------------------------------------------------------------TD--E--
C7RLF4_ACCPU/828-893-GT...L------------------------------------------------------------------SE--E--
A4XWP5_PSEMY/838-903-GT...L------------------------------------------------------------------TA--E--
C6C118_DESAD/445-510-GN...L------------------------------------------------------------------TA--E--
Q1LGI2_RALME/831-896-GT...L------------------------------------------------------------------SE--E--
A1SW11_PSYIN/823-888-GT...L------------------------------------------------------------------TA--E--
B9L9U4_NAUPA/308-373-GT...L------------------------------------------------------------------TP--E--
Q88JQ0_PSEPK/644-709-GT...L------------------------------------------------------------------TD--E--
E6VRY4_DESAO/573-635-GR...L------------------------------------------------------------------TD--E--
A1U2G6_MARAV/797-862-GT...L------------------------------------------------------------------TE--E--
B1YGB8_EXIS2/181-244-KR...Y------------------------------------------------------------------EA--M--
Q88IQ7_PSEPK/258-320-DQ...L------------------------------------------------------------------MH--S--
B7KEJ3_CYAP7/323-385-NQ...L------------------------------------------------------------------NE--T--
A4XQI8_PSEMY/237-307-GE...P------------------------------------------------------------------EE--A--
B8IYF0_DESDA/583-645-GV...L------------------------------------------------------------------TP--E--
Q8EE49_SHEON/255-317-TD...L------------------------------------------------------------------YN--R--
Q47Z39_COLP3/249-311-DT...L------------------------------------------------------------------TQ--Q--
C6BWJ1_DESAD/540-602-GK...L------------------------------------------------------------------TP--E--
E6VWT1_DESAO/206-269-RA...L------------------------------------------------------------------DG--E--
B2JVC1_BURP8/302-364-SR...L------------------------------------------------------------------SQ--A--
E6VTW0_DESAO/225-288-QQ...L------------------------------------------------------------------TP--T--
Q10WT1_TRIEI/323-385-DE...L------------------------------------------------------------------DP--K--
A4XNT7_PSEMY/287-349-GP...L------------------------------------------------------------------LD--G--
Q21JZ3_SACD2/197-260-KN...L------------------------------------------------------------------TA--E--
A6TVP0_ALKMQ/242-306-LK...H------------------------------------------------------------------NT--S--
Q6MM25_BDEBA/342-407-AK..DY------------------------------------------------------------------TP--E--
Q2W8H3_MAGSA/209-272-QR...L------------------------------------------------------------------TP--V--
Q15VN2_PSEA6/250-311-SE...L------------------------------------------------------------------NY--N--
A8ESC2_ARCB4/238-300-EK...L------------------------------------------------------------------SS--S--
Q0ATW9_SYNWW/203-268-NSGEYL------------------------------------------------------------------CP--D--
Q2W315_MAGSA/210-273-EA...L------------------------------------------------------------------TE--L--
F2G724_ALTMD/249-310-SK...L------------------------------------------------------------------KY--Q--
Q2RWJ9_RHORT/206-269-EP...L------------------------------------------------------------------SD--E--
C4XMD6_DESMR/203-269-ERGRQL------------------------------------------------------------------SA--D--
D7E117_NOSA0/301-367-SA...S------------------------------------------------------------------TS--Y--
C6BRZ3_DESAD/205-267-DV...F------------------------------------------------------------------GS--V--
B0JHT5_MICAN/324-384-.....L------------------------------------------------------------------EG--A--
B7JY25_CYAP8/324-385-.Q...L------------------------------------------------------------------ND--A--
D4ZCM2_SHEVD/914-979-GT...L------------------------------------------------------------------TP--E--
E3FLC4_STIAD/302-361-......------------------------------------------------------------------NA--S--
E3FSY9_STIAD/376-441-GT...L------------------------------------------------------------------SP--D--
K0HSG2_9BURK/850-915-GT...L------------------------------------------------------------------TA--E--
Q0VML8_ALCBS/381-446-GT...L------------------------------------------------------------------TP--E--
Q63JR8_BURPS/285-346-.R...L------------------------------------------------------------------TP--D--
Q72BS2_DESVH/821-886-GT...L------------------------------------------------------------------TS--E--

PF05153

MIOX_DICDI/35-292-EL---L---NTIID-ESDPDSNIPQINHCLQTAEAIRKVYPD-SKYDWFHLTGF-------IH---------DL--G--
Q9VTU9_DROME/38-292-EK---L---NDLVD-ESDPDLDLPNIIHAFQAAERARAEFPE-H..DWLHLTAL-------IH---------DL--G--
MIOX_PONAB/31-285-DL---L---DGLVD-ESDPDVDFPNSFHAFQTAEGIRKAHPD-K..DWFHLVGL-------LH---------DL--G--
MIOX2_ARATH/61-317-EL---L---NNVVD-ESDPDLDEPQIQHLLQTAEAIRRDYPD-E..DWLHLTAL-------IH---------DL--G--
Q01Z78_SOLUE/31-278-EF---L---NTLVD-ESDPDTDLSQIQHLMQTSEAIRRD.GH-P..RWMILTGF-------LH---------DL--G--
Q4PIN4_USTMA/80-332-EK---L---DTLVD-ESDPDTSLSQIQHLLQTAEAMRRD.GK-P..DWMQLTGL-------IH---------DL--G--
A8XBD0_CAEBR/22-276-DM---L---ATFLD-ESDPDVDEANLIHAYQTAEKIRENHPD-K..PWMHLAGL-------IH---------DL--G--
Q5AKC6_CANAL/89-340-EK---L---NKLLD-DSDPDTELSQIDHALQTAEAIRRD.GK-P..RWFQLVGL-------IH---------DL--G--
MIOX5_ARATH/58-314-EL---S---KEVVD-ESDPDLDEPQIQHLLQSAEAIRKDYPN-E..DWLHLTAL-------IH---------DL--G--
Q6CNQ4_KLULA/67-318-CQ---L---SKLID-ESDPDTELSQIDHALQTAEAIRND.GK-P..RWMQLVGL-------IH---------DL--G--
Q16XZ8_AEDAE/38-292-ER---L---NDLVD-ESDPDLDLPNIVHAFQTAERAREEYPE-W..DWLHLTGL-------IH---------DL--G--
Q5KEW8_CRYNJ/65-315-EL---L---DNLVD-ESDPDTSVGQIEHLLQTAEAIRRD.GK-P..EWMQLTGL-------IH---------DL--G--
A1C675_ASPCL/63-315-EK---L---NTLID-ESDPDTSLSQIEHLLQSAEAIRRD.GK-P..RWMQLTGL-------IH---------DL--G--
Q0DBI8_ORYSJ/52-308-EL---L---NEFID-DSDPDLDMPQIEHLLQTAEAIRKDFPD-E..DWLHLTGL-------IH---------DL--G--
Q2GML9_CHAGB/59-314-EK---L---NTLVD-DSDPDTSLSQIQHLLQSAEAIRRD.GK-P..RWMQLTGL-------IH---------DL--G--
A5FF81_FLAJ1/46-295-EF---L---NTLVD-DSDPDIDLDQTQHLLQTSEAIRAD.GH-P..DWFVLTGF-------IH---------DL--G--
F6Z3P9_XENTR/31-279-SL---L---DNLVD-ESDPDVDFPNSFHAYQTAEGIRRIHPD-K..DWFQLVGL-------LH---------DV--G--
H9J8E4_BOMMO/127-375-IK---L---NELVD-ESDPDTDLPNIVHAFQTAERIREDHPD-E..DWFHLTGL-------IH---------DL--G--
K5WF63_PHACS/46-296-EL---L---NTLVD-QSDPDTSVSQIEHLLQTAEAIRRD.GK-P..EWMQVAGL-------VH---------DL--G--
Q1K733_NEUCR/98-352-EC---L---NSLID-ESDPDTELSQIQHLLQSAEAIRRD.GK-P..RWMQLVGL-------IH---------DL--G--

PF00233

K3XBL4_PYTUL/325-572FMM---L.S.S--TG-LGEK....................ISS.HNQVGALLAAV-------MH---------DI..E--
F6R4G9_ORNAN/251-478YSM---I.S.L--CH-LQEK....................FSQ.MDILILMTASI-------CH---------DL..D--
G0QQ35_ICHMG/67-322HML---T.K.C--QK-SQSI....................LKD.IDVFTVIFSGL-------CH---------DV..G--
G3N3Y5_GASAC/183-410HYL---L.L.K--TG-MM.H...W................LSE.LEIFAIILAAA-------IH---------DY..E--
A2F408_TRIVA/808-1039TYE---I.I.L--SG-AEKI....................LSN.MELFALIVAAL-------CH---------DA..N--
A0EGL5_PARTE/997-1235HFM---L.Q.C--GK-AKQF....................IDD.FRRMATIISGL-------CH---------DV..S--
F6Z586_MONDO/224-458NCF---L.K.E--PK-LS.S...F................LTP.LDIMLGLLSAV-------TH---------DL..D--
F7BCQ1_XENTR/185-414YCF---L.K.E--PK-LA.K...S................FTP.WDILLGLIAAA-------TH---------DL..D--
A9UR22_MONBE/86-321YLL---F.K.D--IK-GCW......................EP.FEVVTLLIAAL-------CH---------DI..D--
A0C8A0_PARTE/631-860HVI---V.N.K--ML-SLKQYKDI................LDQ.TTKLALILGGL-------CH---------DV..G--
G4VPI6_SCHMA/343-584HFL---L.Q.A--EA-LD.D...V................FSD.LEILAVLFAAA-------IH---------DV..D--
G6DFF8_DANPL/405-640YAA---IINYK--LV-SQGY....................YTE.LQGLMYMVAGL-------VH---------DM..D--
C1MV36_MICPC/57-286HCL---R.K.A--LP-DV......................FSA.VETLALYLAAL-------GH---------DA..G--
Q23AZ3_TETTS/471-707HFF---I.S.R--CK-FG.E.LAK................LKS.MERAAMYFSAA-------IH---------DF..D--
G3SHK9_GORGO/356-600HVL---L.A.T--PA-LE.A...V................FTD.LEILAALFASA-------IH---------DV..D--
H2XQX1_CIOIN/516-756FLL---LDRMT--PG-IDKA....................FND.REKFALVVACF-------CH---------DI..D--
A0BEN8_PARTE/463-688.LF---F.L.E--NG-LQ......................VTQ.FEQCCLIISAL-------SH---------DV..G--
A2DYU6_TRIVA/820-1055AYE---L.K.T--SG-FDEM....................LSP.LEKFALLLSAV-------CH---------DA..N--
D0MT23_PHYIT/280-525FMM---L.W.N--TS-LGEK....................ISQ.HNQIGALLAAV-------MH---------DV..E--
I1CMJ2_RHIO9/36-262YFA---V.T.E--LE-ASTC....................FTN.KEIAILFIAAI-------CH---------DV..G--
K1R0I4_CRAGI/563-798FCM---L.K.S--GQ-MDNI....................LTE.TEKLALIIACL-------CH---------DL..D--
A0D8M4_PARTE/180-432FSC---Y.M.K--SD-LKKF....................CTQ.LEIFSAILAGL-------GH---------DL..N--
A7RY89_NEMVE/476-708FCM---L.T.T--GG-MASV....................ITK.LECLGLIVGCL-------CH---------DL..D--
V4ZU93_TOXGO/723-961HLF---L.A.F--FD-TQIK..................GFFNS.REILAALLAAV-------VW---------DY..Q--
G5BDY7_HETGA/501-733YAI---L.Q.N--ND-......GL................FTD.LERKGLLIACL-------CH---------DL..D--
F6YX00_XENTR/336-571FAA---L.R.T--GK-IQGK....................LND.LEILALMIATL-------SH---------DL..D--
E7QL51_YEASZ/264-483WRL---C.T.Y--LL-KDNP........................VQTLLLCMAAI-------GH---------DV..G--
T1G2P4_HELRO/239-480HVL---L.S.L--PA-LE.N...L................FTD.LEILATIFASC-------IH---------DI..D--
H3CTB8_TETNG/485-730FTL---L.L.T--GK-LKKY....................YSD.LDAFAMVAAGF-------CH---------DI..D--
Q17L35_AEDAE/238-472YSL---MVNLK--LI-ENGV....................ITK.MQGFSFLIAAF-------CH---------DL..D--
G3PQF3_GASAC/493-744AYF---L.C.K--ER-VK.Q...S................LDP.IDEVAALIAAT-------VH---------DV..D--
Q7Q8G2_ANOGA/621-858FAI---L.T.S--TQ-WWKI....................FGE.IECLALIIACL-------CH---------DL..D--
E9GSA7_DAPPU/245-472HYV---L.Y.Q--TG-LM.N...W................LTD.LEIFAAIIAAI-------IH---------DF..E--
H2Y9W1_CIOSA/248-489HVL---L.S.S--AA-LD.S...V................FTD.LEILSALIASA-------MH---------DV..D--
H0X6I7_OTOGA/562-803FTL---L.M.T--GK-LKSY....................YTD.LEAFAMVTAGL-------CH---------DI..D--
A7AR41_BABBO/497-730LCL---A.S.Y--TG-LLEH....................LSI.LDEALLMVAAL-------SH---------DV..G--
D8TZH6_VOLCA/22-283HVL---V.V.R--GG-LIGH..................GYCDE.VSLTSCYLSAI-------IH---------DF..E--
F2U4B8_SALR5/364-601YGA---L.M.S--SE-MGTY....................FSD.LEKAGILIAAL-------SH---------DL..D--
F2TZN0_SALR5/451-687YLL---L...T--SV-ATEF....................ITE.VELLAMLIAAL-------SH---------DL..D--
PDE3_DICDI/212-445FLI---L.L.K--TN-LFNI....................LSP.IEKLSIIIASI-------CH---------DL..D--
A0EHP5_PARTE/664-893YYM---I.K.N--KL-LDEY....................LDQ.TEQFAAILSSL-------CH---------DI..D--
R4XC23_TAPDE/151-415FYM---L.L.S--SA-VLPQ.MSETCQEFEAIGCSVLPLLMTP.QYMLGACIVGI-------GH---------DV..G--
T1J3H1_STRMM/460-696YLT---IKNFE--LI-QKGH....................LTS.LECLALFIACL-------CH---------DL..D--
A8PF04_BRUMA/39-279NVL---I.S.S--PA-LQ.N...V................FSE.LEVLASIFAGA-------IH---------DV..D--
G3XS32_ASPNA/355-613FCF---L.L.H--IG-ALPP.YGP..NSPTIDDKCPMASLLTP.FDTLTLLISAI-------GH---------DV..G--
F0YJF8_AURAN/57-300HLL---L.T.K--QD-LAKR....................CSP.DELLAAYVGAA-------VH---------DY..S--
K0SZ48_THAOC/210-457FSL---L.Q.M--GA-DK.Y.ST..................AP.LEIFTLLFAAV-------CH---------DQ..G--
F6XN91_ORNAN/135-378FTL---L.M.T--GR-LKKY....................YTD.LEAFAMVAAAF-------CH---------DI..D--
H3A1Y1_LATCH/622-855FVM---I.T.T--AV-FQEI....................LTD.TEILALLVGCL-------CH---------DL..D--
A0CZ03_PARTE/433-669NFL---L.N.R--CK-FI.E.IGQ................LDE.QDIACVLIAGA-------IH---------DY..G--
B3RRH3_TRIAD/64-293YYL---T.T.K--TG-LL.N...W................LTD.LEVFALLLAAA-------IH---------DY..E--
D0NX90_PHYIT/873-1108YTL---M.R.S--PE-VLSV....................IKE.LEALSLLVAAL-------GH---------DA..D--
B7QLS8_IXOSC/587-822FAI---L.T.N--TK-LHEV....................LGD.LETFGLIVACF-------CH---------DL..D--
K1Q9Q8_CRAGI/1379-1613FLC---IKNLN--LQ-Q..S....................LDD.IELFALFVSCL-------CH---------DL..D--
B3RW84_TRIAD/250-489YGM---I.Y.A--CQ-LDKH....................LTK.AELATLLTSAV-------CH---------DL..D--
F2UNV2_SALR5/160-397FAL---F.A.N--SE-QLRT.K..................LSS.LDILCCLVLGL-------AH---------DM..D--
B3RXL9_TRIAD/261-492YYI---I.K.N--SP-......GM................FDR.LECLAMFIGCL-------CH---------DL..D--
G3NKI6_GASAC/413-649FAM---L.T.T--AG-FQET....................LTE.VETLALIVGCV-------CH---------DL..D--
E9FT33_DAPPU/300-536YVL---IKRLR--LV-QQEY....................LTD.LEALALLVSSL-------CH---------DI..D--
G3W7P6_SARHA/125-355HCF---L.M.E--PK-VRIS...V................ITF.LWVVLSFLPFA-------IH---------KVYRA--
U6HPK0_ECHMU/682-932FVM---F.K.S--GG-IEAV....................FSE.LECLSIIIACL-------SH---------DL..D--
A4VDP2_TETTS/828-1069FMI---G.C.R--TN-ANKY....................LNS.IQEFSLVFSGL-------CH---------DV..S--
A0E8K4_PARTE/474-706.GF---F.L.E--NG-VN.E...M................LDE.FEQACLIISSL-------VH---------DI..G--
I7MEB2_TETTS/181-435FTV---Y.F.T--SD-FKDL....................IDS.FEFFVGLLSGL-------AH---------DM..N--
T1J0B6_STRMM/178-405HCF---L.Q.E--EK-IA.R...H................ITP.LEIMSALIASV-------AH---------DL..D--
K7IPZ8_NASVI/211-437HYI---L.C.R--TG-LM.N...W................LTD.LEIFATLVAAL-------IH---------DY..E--
A0BWQ6_PARTE/357-590YFF---I.E.K--CN-FK.E.IGK................LTK.LDYSILLLSAA-------AH---------DV..D--
C1G9S6_PARBD/375-630FHL---L.V.C--MG-VLPR.YPD..GITQCSTRSPIALLLTP.FDALTLLITAL-------GH---------DV..G--
T1JHX2_STRMM/149-384FAI---I.T.T--AQ-FWKV....................LGD.LECLALLVACL-------CH---------DL..D--
A2FKH2_TRIVA/811-1047TYE---L.I.T--SG-YDKI....................LSS.FELYGLLVACL-------CH---------DA..N--
E5SJ10_TRISP/256-483HWL---L.A.Q--SG-LV.E...C................LTD.LELFAYLFAAM-------VH---------DF..E--
A8J0S4_CHLRE/4-240HVI---I.H.G--AQ-LHVH...................YLDP.LGLFAAYWAAI-------VH---------DY..R--
H3B4D9_LATCH/251-482YGM---I.H.L--CN-LQEK....................LTL.NDFGILMTAAV-------CH---------DL..D--
G0QN94_ICHMG/88-327YYF---L.N.Q--KL-FEQY....................LDF.LDEFTLLFSAL-------GH---------DV..A--
F0YF22_AURAN/6-233YTL---L.L.A--TK-VAHR....................LEP.IELAAAFVGAI-------CH---------DL..D--
G1N629_MELGA/537-772FTL---L.M.T--GK-LKRY....................YTD.LEAFAMVTAAL-------CH---------DI..D--
PDE6A_BOVIN/558-803FSL---L.V.T--GK-LKRY....................FTD.LEALAMVTAAF-------CH---------DI..D--
I7M0W2_TETTS/670-909YFF---I.N.A--KF-LARY....................LDY.LEQFTLLFSSL-------GH---------DV..S--
B8BX07_THAPS/28-275FAL---L.R.M--GG-DK.Y.AT..................TP.LETFSIICAAF-------CH---------DM..G--
Q4D9B7_TRYCC/425-657YYI---M.M.I--AG-LK.E.KCH................LSK.EKVLAGVLAGA-------IH---------DF..D--
L9KNU5_TUPCH/284-521AYF---L.C.K--ER-VK.E...T................LDP.VDEVAALIAAT-------IH---------DV..D--
B7Q413_IXOSC/244-479YLL---LKNLN--LV-GP.Y....................LTE.LEGLSLFVACL-------CH---------DL..D--
A0A023B5L4_GRENI/875-1106MTL---M.N.A--VR-ITDY....................CSE.EQIVAYVTAGL-------GH---------CI..G--
G7YHN2_CLOSI/450-692DKL---F.C.F--ND-LQ.S...M................FSD.LEVFSTLFACI-------IH---------DI..D--
W4Y0R5_STRPU/42-276HCY---L.Q.E--EK-LR.E...A................LKP.IEIMGALLGSA-------MH---------DL..D--
E9GTK1_DAPPU/140-372AYF---L.Q.R--NR-IK.A...L................LDP.LDLTACLIAAA-------IH---------DV..D--
C3Y3W7_BRAFL/483-718FVI---L.K.T--AP-FSSM....................FSD.VEIFAMMTASL-------CH---------DL..D--
G0QM75_ICHMG/438-673HFF---M.R.K--CN-FC.D.LSK................TTK.LEQIAMYIAAA-------AH---------DY..D--
A9VBQ1_MONBE/959-1201FLL---M.E.A--PI-VR.N...C................LND.LEVLAAVIAAA-------GH---------DV..G--
G4VM44_SCHMA/758-999HVL---L.N.A--QS-LE.S...V................FTD.LEIFTVLFACA-------IH---------DV..G--
Q38F42_TRYB2/668-906YTF---L.Y.R--GN-VYEK....................LTE.LECFVLLITAL-------VH---------DL..D--
H2YGD4_CIOSA/110-343YFM---V.C.E--LN-LLQK....................MST.LQIGILLVACI-------CH---------DL..D--
H0WWX2_OTOGA/185-414HCY---L.K.E--PK-LA.N...S................VTP.WDILLSLIAAA-------TH---------DL..D--
A2F4K8_TRIVA/824-1056MFM---N.Q.L--GT-LGQV....................LNV.VEMHAILASIF-------CY---------SM..K--
G0QL69_ICHMG/309-544NFF---I.K.R--CL-FK.N.VGG................LNP.LEIGTMYIAAA-------IH---------DL..E--
G3UQY0_MELGA/561-809FTL---L.M.T--GR-IKKY....................YTD.LEAFAMVAAAF-------CH---------DI..D--
A2DBZ3_TRIVA/890-1109FVC---L.T.R--NK-FGNC....................MNV.DQKAALLCASL-------LH---------DV..N--
G1KNF9_ANOCA/182-411HTI---L.L.H--TG-IM.H...W................FTD.LEILAFIFGTS-------IH---------DY..D--
Q57V52_TRYB2/430-668YYI---I.F.I--AG-MK.E.RCQ................LRP.EEQLGAVLAAA-------VH---------DF..D--
H9GNX4_ANOCA/147-379HCY---L.K.E--PK-LA.N...F................LTP.LDIMLGLLAAA-------AH---------DV..D--
A7RQM4_NEMVE/269-513HVL---L.S.A--QA-FD.N...V................FTD.LEILSAIIASA-------VH---------DV..D--
A0CDZ4_PARTE/797-1028HFL---C.S.L--PR-AHQY....................LSE.IVHFATVISGL-------CH---------DI..S--
F9WY25_MYCGM/19-262YCF---L.K.K--..-................KSNALERLLTP.VDALTLLVSAI-------GH---------DV..G--
F4P4T4_BATDJ/201-438YSF---V.V.N--GV-LDGV....................LDH.IEQYAMFVACL-------NH---------DI..D--
T1G0C4_HELRO/267-508HAL---L.L.I--PA-FE.N...K................FTE.LEIFATIFGSA-------IH---------DV..D--
H3A4S4_LATCH/186-412HCF---L.I.S--TG-LV.H...W................LTE.LEILAVLFAAA-------VH---------DY..E--
I6NCN3_ERECY/237-472YKL---C.E.M--LE-........................LDS.NIALAICISAI-------GH---------DV..G--
E7F690_DANRE/664-899FAM---L.Q.T--KE-LKSN....................LSS.LEVLALMIASL-------SH---------DL..D--
H9JP37_BOMMO/450-678FMI---L.V.N--NT-......GY................FEF.AEVAALMISGL-------CH---------DL..D--
K4E297_TRYCR/367-596FSL---V.S.A--AK-PL...MEH................LTP.LECKAAAFAAL-------TH---------DV..C--
G6D0G3_DANPL/510-749FLI---L.T.N--NN-......GY................FDF.VETAALMLSGL-------CH---------DL..D--
G3X2A9_SARHA/458-685YAI---L.Q.N--NQ-......GL................FTD.LERKGLLIACL-------CH---------DL..D--
F6UGJ6_HORSE/648-882YLL---CKNLE--LT-N..Y....................LED.IEIFALFISCM-------CH---------DL..D--
E9C7I3_CAPO3/34-276FSF---A.K.R--FR-ADEL....................LTQ.ADILVLLIGAL-------GH---------DV..D--
D2UZF3_NAEGR/172-403MYL---L.D.L--IG-MIPF....................LTH.EELLAVILAAA-------MH---------DF..Q--
A2E0E8_TRIVA/899-1134SHA---L.V.I--AN-LREF....................FTQ.QEILVLLTACI-------CH---------DA..N--
G0QTW0_ICHMG/347-581HFF---M.K.K--CK-FT.Y.IAK................LSK.LEQAAMYIAAA-------AH---------DY..D--
T1ID25_RHOPR/266-496YAI---I.K.H--SN-......GT................FTS.NECLALYIGAL-------CH---------DL..D--
K0TNY7_THAOC/1104-1338NAM---L.Q.L--GG-KQ.Y.A.................................-------..---------.....--
E9H1H3_DAPPU/584-819FAI---V.T.G--TR-WWEI....................LGE.IEVLSLIMACL-------CH---------DL..D--
A2FET3_TRIVA/891-1121YSI---V.K.R--GK-MSPRA...................INP.MQTTALILACL-------LH---------DI..C--
A2ENJ2_TRIVA/832-1067TFE---L.E.T--SG-IVSK....................LTK.FDIFALLVAAI-------CH---------DA..N--
K1Q862_CRAGI/623-859FAT---L.K.M--SG-VRRH....................ISD.KESLALVVACL-------CH---------DL..D--
T1KF46_TETUR/201-442HVL---L.L.A--PA-LE.S...V................FTD.LEILAVLFSAA-------IH---------DI..D--
I1C756_RHIO9/55-278YYM---L.N.E--LD-AKHY....................LTN.KQIAVLMISAI-------CH---------DI..G--
L5LYV0_MYODS/378-630AYF---L.C.Q--ER-IK.Q...A................LDS.VDQAAALIAAA-------VH---------DL..D--
G0R0C4_ICHMG/193-446HFF---I.T.R--CE-FI.S.LAD................LNP.LEIGTMYISSA-------IH---------DL..Q--
I1FCX2_AMPQE/486-721YSL---IKNCP--KL-RD.M....................LTD.LEVLTLFIGCL-------CH---------DL..D--
I3MB41_SPETR/221-447HCF---L.L.R--TG-MV.H...C................LSE.IEVLAIVFAAA-------IH---------DY..E--
F0VH18_NEOCL/757-991HYF---L.T.I--GK-LGTL....................LSE.YDVFLCHFCAL-------VC---------HF..G--
B6H979_PENCW/364-622FCF---L.L.H--IG-ALPP.YES..IGQSPVPETPITSLLTP.FDALTLLISAI-------GH---------DV..G--
A8XFQ4_CAEBR/454-686FAT---L.V.N--SP-......EA................FTK.LESLALYVSCL-------CH---------DL..D--
M4AGW4_XIPMA/350-586FAM---L.MAT--DQ-LQKN....................LSR.LEILALMIATL-------NH---------DI..D--
I7MF95_TETTS/428-661HFF---L.K.K--CN-FV.Q.IGK................LNK.IDIGTVFVAAA-------IH---------DV..E--
Q7RNG1_PLAYO/216-445SIL---I.T.S--LD-TVNI....................LKD.NEMAAFLISAL-------GH---------DI..G--
A2FBN7_TRIVA/832-1064SYE---M.R.L--GE-LENI....................FTK.FEIFAMLVAAV-------CH---------DA..G--
U4LEJ5_PYROM/325-578FYF---M.L.S--LG-VLPA.YGGVDNTSQYPDS..LSHIITP.LDALTLLIVAI-------GH---------DV..G--
Q4E0Y6_TRYCC/668-905YTF---L.Y.K--GA-VCEK....................LTE.LDCFVLLVTAL-------VH---------DL..D--
G7Y3Q5_CLOSI/247-479YFL---L.K.I--SE-......HR................FVP.IERVCLFVAAI-------CH---------DL..D--
A7S9Q1_NEMVE/571-806YAM---L.K.K--PS-IGKY....................FTV.IEQYALIVACL-------SH---------DL..D--
J9JP99_ACYPI/205-438HCF---L.Q.E--DK-IK.N...F................LTP.LEIMASLIAAV-------AH---------DL..D--
B5YN05_THAPS/24-269HSL---L.S.M--AV-DG.I.TSV................LSK.IDVFSLLLAAV-------SH---------DI..A--
F0XZ44_AURAN/6-240YTL---L.L.A--TH-VAER....................LRP.VELAAAYIAAV-------CH---------DL..D--
G4VD32_SCHMA/194-450AYF---L.Q.H--SL-IR.S...I................CTN.IDEVATLLAAI-------VH---------DV..D--
U6IBZ4_HYMMI/336-560HVV---L.T.T--SK-LR.D...Y................LSD.LDIFSVIFAAL-------AH---------DF..E--
G3NZM0_GASAC/269-495HFL---M.L.H--TG-LM.H...W................LSE.LEILAMVFAAA-------IH---------DF..E--
A0C8Q0_PARTE/698-935NCF---I.K.Q--LS-KQLD.QQF................FNN.MTKFCLLLSAL-------CH---------DV..A--
A2E5S0_TRIVA/1039-1262YYI---L.T.T--TD-LKNI....................LTD.LEKLALIVSTI-------CH---------DI..D--
H3HCQ7_PHYRM/257-492HHF---L.S.V--GN-LGSL....................FTE.RTKCTALLAAI-------VH---------DV..G--
G6DIL5_DANPL/640-871YVI---I.K.K--DH-RK.C.LDY....................KMRLALFVACL-------CH---------DL..D--
X6MLN0_RETFI/437-724HYF---LIN.V--QR-IQSV....................LRK.LDICAVLIAAL-------CH---------DI..N--
A2G2M9_TRIVA/856-1091SYQ---V.R.I--TN-SHKI....................LTQ.FELLAVCVAAL-------CH---------DA..G--
B8MH55_TALSN/358-616FYI---L.I.R--IG-ALPT.YDI.SNTNTSPSKSPVASLITP.FDALSLLIAAI-------GH---------DV..G--
F2U3P6_SALR5/586-820FTM---L.Q.Q--PA-VKHR....................LSV.LRRMALLVACL-------CH---------DL..D--
H2KQX0_CLOSI/666-901YIC---GKNLP--LA-GK.F....................LKN.IEFLALFVASL-------CH---------DI..D--
A2F9J4_TRIVA/865-1099FSC---I.I.R--GH-LRQY....................LND.LEIFALLLAAI-------CH---------DV..D--
A8QAS5_BRUMA/427-656YCL---L.R.T--TT-I.......................FNL.KQSLALYIACL-------CH---------DL..D--
H9JH54_BOMMO/108-347FAI---L.T.E--TQ-WWKI....................FGE.LECLALIIGCL-------CH---------DL..D--
E9FX16_DAPPU/491-726FAL---L.K.T--GK-MEQF....................MTD.LDILSLLIACL-------CH---------DL..D--
V8PBU9_OPHHA/202-428YSM---I.S.L--CN-LQAK....................ISQ.MDILMLMTASV-------CH---------DL..D--
G7YD67_CLOSI/310-534HMI---M.H.L--NN-LR.N...W................LTD.LDAFALLFAAV-------IH---------DY..E--
K7JB77_NASVI/291-525HCF---L.Q.E--EQ-IR.R...H................LSY.LEIMASLIAAV-------TH---------DL..D--
A0CDV7_PARTE/494-726.AF---F.L.Q--NG-LS.T...L................IDD.FQATCLLISSL-------AH---------DI..G--
A2D762_TRIVA/830-1065AYE---V.S.T--AE-LDKV....................YKP.LELLAMFVAAV-------CH---------DA..G--
K7JCC9_NASVI/433-669YLL---MKNLN--LV-RDGY....................MTS.LQALVFLVSCL-------CH---------DI..D--
A2FZL3_TRIVA/843-1079SYQ---C.K.I--TN-ADSI....................LTH.LELLAVCVAAI-------CH---------DA..G--
Q5CIN1_CRYHO/124-384NNW---L.D.K--PS-VRHY....................VNS.LEAYCLIISSL-------SH---------DL..D--
A2DV74_TRIVA/897-1132AVL---I.I.K--TG-LDKI....................LTK.FEILSLLVASL-------CH---------DA..N--
G4M0K8_SCHMA/183-425YQL---F.Q.C--NS-LK.N...I................FSD.LETFAIFFASA-------IH---------DI..D--
G7YCW0_CLOSI/404-645HVL---L.N.A--SA-LM.S...V................FTD.LEVMAVLFACA-------IH---------DV..D--
G0QNS6_ICHMG/258-503YVI---S.C.H--TS-ASQI....................IKD.LNEFALILSGL-------CH---------DI..S--
C5LYC9_PERM5/76-308NYL---L.R.A--TG-MP......................VSA.LDYTAFLVACI-------CH---------DV..G--
Q5CHC0_CRYHO/724-964ICL---S.R.A--TG-LWSH....................LDT.VERLASVIASL-------GH---------DV..G--
G7Y525_CLOSI/169-406HCF---I.S.Q--PK-LL.C...L................LSP.VEILASLLAAA-------CH---------DA..D--
F4P9V8_BATDJ/55-290NYF---T.T.Q--PK-IR.Q...M................LKV.DEELAVLIAPI-------IH---------DY..M--
A0D3N1_PARTE/161-414FCV---Y.E.K--SD-LKLF....................VSK.QDIFAALLASL-------SH---------DI..N--
G3H1T4_CRIGR/86-313FAM---L.T.T--AG-FQEI....................LTE.VEILAVIVGCL-------CH---------DL..D--
W5L340_ASTMX/213-441HCY---L.K.E--PK-LA.K...S................LTS.CDILLGLLAAA-------TH---------DL..D--
B6AJ92_CRYMR/946-1223NQW---L.D.D--ES-IRLL....................FNS.FEAYCLVIAAL-------GH---------DI..D--
I1FF72_AMPQE/584-825NYL---L.N.A--TV-LE.N...V................FSP.LEILAVLIAAA-------VH---------DV..D--
U6HDD1_ECHMU/294-535HVL---L.Q.A--PA-LD.S...V................FTD.LELAAVIIACA-------VH---------DV..N--
F0Y3P3_AURAN/5-236HAL---L.I.Q--NE-AFDG.S..................LNE.DTILVVLVAAL-------AH---------DV..G--
A2EA57_TRIVA/862-1082YYT---L.L.K--SR-LCNK....................LDP.HQIVGLLFATL-------LH---------DV..S--
I3IVG8_ORENI/238-473YCY---L.K.E--PK-LA.E...H................LSP.LDVFLGLMAAA-------AH---------DV..D--
A2EY05_TRIVA/672-907SYE---I.K.L--TN-SHNH....................LKS.QELLSVLVAAL-------CH---------DV..G--
K3W5J5_PYTUL/499-740NYL---I.T.A--LS-DGQI.RDT................LTN.LEFYAAIVAAA-------IH---------DF..R--
I3KLG1_ORENI/165-393YSM---I.C.L--CS-LQEK....................FTQ.MDILALMTAAV-------CH---------DL..D--
H9K9C1_APIME/440-676YLL---IENLN--LI-NENY....................LTH.LEALIFLVSCL-------CH---------DI..D--
U6ILW1_HYMMI/656-907FAM---F.K.S--GG-MQEV....................FSD.LECLSIIIACL-------SH---------DL..D--
E5S1Y7_TRISP/469-710HVM---L.S.T--PS-LE.S...V................FTD.LEKLAVIFAAA-------IH---------DV..D--
E2B075_CAMFO/438-674YLL---IKNMQ--LI-EENY....................MTP.LQALVFLVSCL-------CH---------DI..D--
T1JTY5_TETUR/534-761HYM---L.S.K--MG-LV.N...W................LTD.LEIFATLLAAI-------IH---------DF..Q--
G0R5R3_ICHMG/354-593FYF---L.N.Q--KL-LDQY....................LDT.IEQFTLLFSAM-------GH---------DV..S--
C9SP75_VERA1/352-608FNF---L.V.H--IG-IISP.YPL.DLHSQAPATSPVADLLSP.VDGLTLLITAI-------GH---------DV..G--
A7S0H3_NEMVE/17-252FTI---M.K.T--GS-LCKY....................FSD.LEVFALIVACL-------CH---------DL..D--
I3J4D3_ORENI/620-856FVM---I.T.T--AS-FQDV....................LSD.AEILALMVGCL-------CH---------DL..D--
B3RPK8_TRIAD/484-719FAI---I.K.N--TK-LGNT....................FSH.IECLALIVGCI-------CH---------DL..D--
A0D0P6_PARTE/709-947HAI---S.L.E--IM-KTKH.AHL................LTQ.FTKFALILAAL-------CH---------DV..S--
H2TUF6_TAKRU/91-321YGL---I.W.M--TD-IRSK....................LSK.LDLLTMLASAL-------CH---------DL..D--
S2JNF3_MUCC1/101-338WYF---LNSIS--SE-SMSL...................LLRP.IDVLALLMAAI-------GH---------DV..G--
H9IXR0_BOMMO/575-809YAI---L.K.S--DV-KE.R.FDY................NKA.SSRLALFVACL-------CH---------DL..D--
T1K846_TETUR/97-334FSI---L.V.S--TT-LCTS....................LGE.LDTLALIMACL-------CH---------DL..D--
E9BZV2_CAPO3/556-788HHF---V.I.Q--PP-LF.G...V................LEP.CEVMALLLACI-------VH---------DM..D--
W4XSF6_STRPU/406-647HFL---L.S.A--PA-LE.N...V................FTD.LEIMAALFSAA-------IH---------DV..H--
C5LW71_PERM5/59-291GSL---M.R.Y--GG-ADEF....................CSP.LEQLALLIAAV-------SH---------DV..G--
F1Q4S3_DANRE/251-478YGM---I.H.L--CG-LQDR....................LTM.TDMCILMTAAV-------CH---------DL..D--
A2DG30_TRIVA/778-1007AYQ---V.H.I--SH-LDEK....................IPK.VELFALLVAAI-------CH---------DL..N--
U1LY64_ASCSU/200-424HFM---L.S.Q--TG-LA.S...S................LSD.LDLLAVIFGAL-------IH---------DY..E--
Q22CV4_TETTS/972-1213YML---S.K.C--QR-ATQV....................LKP.IDIFTVILSGL-------CH---------DV..G--
M4AEC3_XIPMA/46-276YGL---I.W.L--TD-LRNK....................LEN.IDLLIMMTSAV-------CH---------DL..D--
W5MCE7_LEPOC/202-428HCL---L.L.R--TG-LV.H...W................LSE.LEVLAVLFAAA-------IH---------DF..E--
E1FRJ3_LOALO/357-588YLL---LRTET--AH-N..A....................LNE.LESFALFVASL-------CH---------DI..D--
B4R3X9_DROSI/617-847NVL---L.N.T--PA-LE.G...V................FTP.LEVGGALFAAC-------IH---------DV..D--
D8TP55_VOLCA/67-324HCL---L.T.R--GG-LHRR....................LGEDVAIFASYLAAI-------TH---------DY..E--
PDE8A_MOUSE/550-801AYF---L.S.R--DK-IK.E...T................LDR.IDEVAALIAAT-------VH---------DV..D--
F0YCZ9_AURAN/8-254FCF---A.E.G--KL-LGEAGGRRAFGAPKVV........FDD.LEVHAMMLAGF-------CH---------DL..D--
A2EIP4_TRIVA/1084-1320AYQ---I.L.V--SG-CNTI....................LSK.FEIFAILVACL-------CH---------DV..G--
K1PID2_CRAGI/187-413HNI---L.S.Q--SK-LA.H...W................LTD.LEVFATIVAAL-------IH---------DF..E--
T1EIY3_HELRO/187-428HVI---L.K.K--AP-LL.D...V................FTD.LEILSVIFSSI-------IH---------DV..D--
U6I2M0_HYMMI/497-738HVL---L.Q.A--ET-LA.N...V................FSD.IEILASIFASA-------IH---------DV..H--
A2E8N2_TRIVA/822-1057VYQ---L.E.K--AE-LSKV....................FSP.FEILAILVATI-------CH---------DA..N--
G0QLG1_ICHMG/322-557HIY---L.E.K--KE-FA.Q.ITQ................LNS.LEIAQIYIAAA-------AH---------DY..G--
F4PDL8_BATDJ/236-451YAL---L.H.V--TS-VHKK....................FTQ.IEKLSLIVAAI-------GH---------DL..D--
G3NNN6_GASAC/516-748FAI---L.Q.K--TS-......GM................FTE.LEKKGLLIACL-------CH---------DL..D--
G0QX25_ICHMG/75-311NFF---M.I.K--CQ-FS.S.IAN................LSK.LEQAAMYISAA-------AH---------DY..D--
I7M6Z2_TETTS/95-332YYI---I.K.Q--GI-TNKH....................LNQ.LEKFSLLFSAL-------CH---------DV..D--
K3WGS8_PYTUL/507-737YIM---I...R--RE-CSSY....................YSS.VDIFTMLVAAL-------CH---------DI..D--
Q01CI7_OSTTA/263-505AYF---I...E--TS-LRDQ....................IEP.IHIFALLLSAV-------VH---------DV..G--
D8TVU3_VOLCA/73-301HVI---I.H.G--AQ-LHVH...................YLDQ.LGLLAAYFAAI-------VH---------DY..G--
E4V020_ARTGP/368-626FHI---L.V.R--VG-VIPP.FPL..GSERRSSGTGMSCLLTP.FDALALLVIAL-------GH---------DV..G--
C1E004_MICSR/344-598GYF---L...S--SG-LRTQ....................LTD.VQAAAFVLAAA-------AH---------DV..G--
T1IWR2_STRMM/725-967ACF---L.D.R--DH-IK.Q...I................FDP.LDEAACLLAAA-------IH---------DT..D--
E9IWT3_SOLIN/637-872FAM---L.K.T--GK-MEQF....................MTD.LEILGLLVACL-------CH---------DL..D--
H0XDY2_OTOGA/233-455YSM---V.W.L--CG-LQEK....................FSQ.MDILILMTAAI-------CH---------DL..D--
F9WTZ7_TRYVY/241-479HTF---L.Y.R--GG-AHER....................LTE.LECFVLLITAL-------AH---------DL..D--
Q16J23_AEDAE/167-399HCF---L.Q.E--KR-IL.E...N................LSP.LEIMASLIGAV-------TH---------DL..D--
C0NC75_AJECG/367-624FHL---L.V.S--IG-ALPP.YPN..GTRRLSAVSPMALLLTP.ANALTLLITAI-------GH---------DV..G--
T1IN43_STRMM/372-598HFM---L.C.Q--TG-LM.H...W................LTD.LEIFATLIAAV-------TH---------DF..E--
B3RT43_TRIAD/444-691ACF---L.D.C--DR-VK.N...L................LDP.LDIMASLIAAI-------VH---------DV..D--
T1G4C8_HELRO/177-404HGV---L.I.S--TG-LA.S...W................LTD.LELLTVLTSCM-------IH---------DF..E--
I1FSR8_AMPQE/302-535HCI---V.L.D--PV-MYSK....................MTS.VEILATFLASL-------CH---------DL..D--
A4RUJ3_OSTLU/354-596AYL---I...E--TS-LESQ....................IEP.IHTFAMLVAAM-------SH---------DV..G--
Q5CXM2_CRYPI/1551-1826YII---L.R.N--FG-IMLV....................LND.LNKFILLFAAL-------CH---------DI..D--
T1G2T5_HELRO/253-496HHM---L.N.F--SV-FK.N...V................FTE.LEVFAALFAAA-------VH---------DV..D--
B8C496_THAPS/64-313NTI---L.Q.L--GG-DE.F.AH..................SS.LDIFSLLVAAT-------IH---------DV..K--
C3Z0J8_BRAFL/157-377HYL---L.Y.S--TG-LV.Q...W................LAD.VEILAVVLSAA-------IH---------DV..E--
G7Y619_CLOSI/692-940FAV---L.L.N--AD-LNSL....................FTD.LECLALMVACL-------SH---------DL..D--
H2YVD4_CIOSA/588-824FCM---V.K.T--GG-LDTV....................FSD.FEKLALLVSCL-------SH---------DL..D--
E0VPK2_PEDHC/654-888FAI---L.M.G--CE-MKGT....................FSD.LEVLGMFVGCL-------CH---------DL..D--
I7MHG9_TETTS/819-1072YML---C.C.Q--TV-AQTI....................IKE.INEFALIFSGL-------CH---------DV..S--
A0DRT9_PARTE/368-610YYI---I.K.S--KS-MNQY....................FDK.FIQFTALLSAL-------CH---------DI..D--
A9UVX6_MONBE/192-425YAL---Y.M.H--SD-VLSK.H..................FTH.VDIFCCLVLGL-------GH---------DI..D--
B3RPP8_TRIAD/504-735YTI---I.K.K--NP-......NL................FTE.LEAIGLYVACL-------CH---------DL..D--
T1JG26_STRMM/622-856FAL---F.T.T--AE-MKGI....................FTD.IERLGMFTGCL-------CH---------DL..D--
G7Y2X2_CLOSI/386-622YLC---MINAQ--QR-IHEF....................LSP.LELLALLVGTL-------CH---------DI..D--
S2JJA8_MUCC1/205-462YYF---T.C.Q--LG-LVPF.....ADGTPCMTNSKTYRILRP.RDLFALFIAAI-------GH---------DT..A--
A0BZK9_PARTE/736-969HYF---C.S.E--LA-QTSK.SKI................IDN.FNRFILMISSF-------GH---------DV..G--
W4XPS9_STRPU/508-740FMI---L.L.H--SE-GR......................FTD.EEMYAMFFGSI-------CH---------DM..D--
T1G9G6_HELRO/40-271YAM---L.K.T--LD-LSAK....................LAP.LDIFILLFSGA-------CH---------DL..D--
F6YN13_CIOIN/497-735AYF---L.K.K--DR-LK.N...W................MEP.LDEIAALLAAI-------IH---------DV..D--
S2JM15_MUCC1/91-344FFM---L.C.E--LS-VLPF...TKKYKSNSKLNRKPQDLLRP.KDVFALLIAAI-------GH---------DA..A--
T1EEC2_HELRO/179-455YFL---T.Q.T--PS-IK.D...S................LTD.MDLIATFVAAA-------IH---------DV..D--
G3W5Y3_SARHA/633-868FAA---L.K.S--GR-IQNQ....................LTD.LEILALLIAAL-------SH---------DL..D--
H2N2Q2_ORYLA/19-254FAL---L.K.S--GR-LQNN....................LSD.LEILALMIATL-------SH---------DL..D--
A2DJF3_TRIVA/756-991SYQ---L.V.V--SG-VYKI....................LKP.IELYALLIAAI-------CH---------DV..N--
T1FZK3_HELRO/143-369HFV---I.S.S--TD-FI.L...W................LSD.LDVFAVLVSAL-------IH---------DY..E--
F0YND2_AURAN/33-267YTL---L.L.A--TH-LAKR....................LRP.IELAAAFIAAV-------CH---------DL..D--
B3S4Q2_TRIAD/437-672YRI---F.Q.A--KE-FGGL....................LND.LEKLSLLVACL-------CH---------DL..D--
A7SC93_NEMVE/229-460YLL---LKNSH--ME-S..K....................LQD.IERMALFVACL-------CH---------DL..D--
Q4Y3R0_PLACH/81-319KSM---L.F.M--LD-LNHK....................ISG.IDEFCLHVSSL-------CH---------DV..G--
D0MQY9_PHYIT/829-1076YCL---L.RRS--GV-AHSY....................FAR.VEIFAMLIAAL-------CH---------DL..D--
W5JX79_ANODA/192-452HAL---L.H.S--PA-LD.G...V................FTP.LEVCAALVAAC-------IH---------DV..D--
E0W1Y2_PEDHC/164-397HCF---L.Q.E--KK-IR.E...H................LTP.LEIMASIIAAV-------TH---------DL..D--
E9GD11_DAPPU/572-804YVI---L.K.R--AP-......DA................FKP.LEAVALFVSAL-------CH---------DL..D--
B8CDS3_THAPS/83-323HAL---I.Q.M--GE-VN.M.ALA................YTP.FEIYTILLAAA-------LH---------DV..R--
B6KFK7_TOXGO/863-1092VWL---A.R.K--LE-LASS....................LTA.PELVALIVAAL-------CH---------DI..G--
G0NVA1_CAEBE/450-686SFF---L.D.S--PS-VA.I...H................VNE.SHAVAALLAAA-------VH---------DL..D--
G0QL72_ICHMG/166-409YML---S.K.C--KK-AVQA....................MKN.IDIFTVVFSGL-------CH---------DV..G--
C4JVT9_UNCRE/362-620FHF---L.V.K--VG-TLPP.YPP..GSEEVSTGSGMASILTP.FDALTLLITAI-------GH---------DV..G--
C3YZV4_BRAFL/424-658YLL---YKNLR--ID-Q..L....................LTD.VELFALFVACL-------CH---------DL..D--
I1BY86_RHIO9/30-312YHF---L.E.L--YE-MSEH....................LTR.IEVTLLIIAAL-------CH---------DI..G--
W5KJ99_ASTMX/620-849FIH---M.V.T--QN-MKEV....................IKQ.IN.MNLLVPCL-------KL---------GM..D--
A7SW30_NEMVE/369-596WIV---I.R.D--N.-......KS................LTD.YEKLSLFIAGI-------CH---------DV..D--
F4PP12_DICFS/106-337FLI---I.L.R--SE-LNEK....................LTI.LEKLSLLIAAV-------SH---------DL..D--
V4ZBC8_TOXGO/684-919VCL---L.R.G--LG-INRE....................MNS.LSTAACAVAAL-------CH---------DI..G--
H2WG47_CAEJA/281-522HVL---L.M.S--PV-LT.E...V................FSD.LEVLAAIFAGA-------IH---------DV..D--
U9UJM3_RHIID/88-393YYM---L.T.D--LG-SAKY....................ISS.LDAICLLIAGL-------CH---------DI..G--
A2E8W5_TRIVA/810-1039SYE---I.T.T--AK-LENV....................LTP.LEIFALLLSAV-------CH---------DA..G--
H0V2T6_CAVPO/559-804FTL---L.M.T--GR-LKKY....................YTD.LEAFAMVAAAF-------CH---------DI..D--
A4H9L9_LEIBR/384-615HFV---I.T.Q--GG-LA.K.RCN................LSD.IQVFSAMLAAS-------IH---------DF..D--
X6N5T0_RETFI/264-501YYW---T.Q.S--DE-FR.S...Y................VSE.MDVLVALVASC-------VH---------DF..K--
T1JI29_STRMM/203-435YSV---M.H.I--CQ-LENY....................FSR.FELGVLFISCI-------CH---------DL..D--
A4RV03_OSTLU/70-313YLY---I.C.A--VK-EQVS....................MTQ.VEIFSLLVAAL-------VH---------DL..D--
K1QIC6_CRAGI/569-804FTI---L.Y.T--GG-LIKK....................FEG.LEVLGLLVACL-------CH---------DL..D--
T1HBJ9_RHOPR/64-297FAI---L.M.G--CE-MKGT....................FSD.IEVLGMFVGCL-------CH---------DL..D--
G7Y655_CLOSI/526-809AYF---L.R.V--DL-LS.S...V................FDE.MEEVGSLLAAV-------VH---------DL..D--
A5JZK3_PLAVS/500-735NIL---V.N.N--LD-TANI....................LRD.NEMAAFLLAAL-------GH---------DI..G--
F0ZGW8_DICPU/600-832NFF---I.E.K--.S-IR.R...Y................LTE.IEFFSMILAAI-------VH---------DF..K--
A4HWN7_LEIIN/680-918HTY---L.Y.T--GK-ASEL....................LTE.LECYVLLVTAL-------VH---------DL..D--
I7M9B7_TETTS/309-544NFF---L.K.S--CN-FI.E.IAA................INE.FDLCTIYISAA-------CH---------DY..D--
D7EJS6_TRICA/294-520YAI---S.W.S--VD-LPSK....................VGD.LEVLILLTSCI-------CH---------DL..D--
D2W310_NAEGR/443-678YHL---L.L.V--DR-IS.Q...M................FSP.MEKFALMFSAI-------MH---------DV..G--
I1CN45_RHIO9/145-393FFM---L.C.E--LG-LLPF.......TNKIKQQGKPQDMLSA.IDIFALFIAAI-------GH---------DA..A--
J9JUC9_ACYPI/671-903FAI---M.M.G--CD-MKNT....................FSD.LEVLGMFVGCL-------CH---------DL..D--
D8TN75_VOLCA/173-409AVI---L.E.S--FK-KQVK...E................IPK.LEYFSIIIASA-------VH---------DL..G--
A0BY96_PARTE/723-962HAI---L.F.Q--LH-QTNN.ASI................LST.FNQFALLLSGL-------CH---------DV..S--
A7SVX8_NEMVE/580-827AVF---L.A.K--ER-VK.A...V................LEP.LDEVASLIAAI-------VH---------DV..D--
S2JSI2_MUCC1/64-347YYI---M.L.D--LK-SKKY....................FSD.KEIATLFIAAI-------CH---------DA..G--
B0WPM1_CULQU/529-761YSI---I.K.N--CG-......AV................FRP.NECLALFIGSL-------CH---------DL..D--
F2TXI1_SALR5/447-690ACL---L.D..--..-...S.VSY................FTP.TEAFAAIVAAG-------VH---------DV..G--
A2FQ29_TRIVA/905-1135VYL---L.K.K--SK-LESE....................ISK.FEILGLIISCL-------CH---------DI..N--
W4XPC7_STRPU/865-1088FAI---L.Q.N--TG-VAKY....................LSD.IEQLTLLVGCL-------CH---------DL..D--
B3S1R3_TRIAD/64-305HVL---L.S.S--PV-LS.S...V................FTD.LEILAAIFAGA-------IH---------DV..N--
F6X0V1_MOUSE/186-412HYI---M.L.H--TG-IM.H...W................LTE.LEILAMVFAAA-------IH---------DY..E--
M2UPY5_COCH5/359-618FHF---L.V.R--IG-TLPM.YPP.DTRNVSAPKSPIASLLKP.FDALTLLISAI-------GH---------DV..G--
F0ZDL5_DICPU/435-669YTF---L.T.S--FN-AVQY....................LTH.LDVLALLISCM-------CH---------DL..N--
T1G1B3_HELRO/66-293NSV---I.S.Q--TE-LK.A...C................LTD.SEIFATLFAAI-------IH---------DY..E--
K3W5A7_PYTUL/578-816EYL---I.S.V--MD-NGYI.QDL................LNY.QEVFAAIIAAA-------VH---------DF..R--
D2V582_NAEGR/457-695HYI---I.S.K--GG-LS.Q...F................MTD.EDILASLLSCI-------VH---------DY..Q--
J9JUG8_ACYPI/874-1109FSI---I.T.A--TR-WWQV....................FGD.LECLALIIACL-------CH---------DL..D--
X6N2F3_RETFI/447-691YYW---I.K.S--DE-YT.S...Y................IRD.IDVLVALVAAC-------VH---------DF..K--
PDE2_CAEEL/421-657WLT---LRTDA--IR-R..A....................LSD.MERLSLLIACL-------CH---------DI..D--
C3Z5T1_BRAFL/93-328FTM---L.K.T--GS-MEDL....................LDD.IEGLALLLACL-------CH---------DL..D--
A2DCH1_TRIVA/873-1097IQM---C.K.S--SY-GQV.....................LLP.IERLSLYIAAI-------SH---------DS..L--
V8PIT4_OPHHA/336-577HVL---L.S.T--PA-LD.A...V................FTD.LEILAAIFAAA-------IH---------DV..D--
G4VIQ4_SCHMA/572-807YVC---IKNLP--LA-NN.Q....................LDD.IEILALFVASL-------CH---------DI..D--
F0VID9_NEOCL/1105-1345CLL---M.A.L--PD-VAAQ....................FQP.IDYFVLSVAAL-------GH---------DL..G--
G1QFQ3_MYOLU/566-820ACF---L.C.Q--ER-IK.Q...A................LDS.VDEAAALIAAA-------IH---------DL..D--
F1SIK3_PIG/193-420HYL---L.Y.K--TG-VA.N...W................LTE.LEIFAIIFSAA-------IH---------DY..E--
B9Q8H3_TOXGO/59-299CLL---L.A.L--PD-VAAQ....................FSP.IDYLVLSVAAL-------GH---------DL..G--
E4XVC9_OIKDI/280-532AYF---L.R.T--ER-CK.N...L................LSE.FDMVASLIAAI-------IH---------DV..D--

PF12917

F4BLQ7_CARS1/1-213GKF---KY---EDHS-VAAHSFKVTQIAQFLGTVEEQAGNEINWRALYEKA---L-------NH---------DY--T--
Q8Y4F3_LISMO/1-213GKF---KY---QEHS-VAEHSYKVTSIAQFFGAVEEEAGNEVNWRALYEKA---L-------NH---------DY--S--

PF13023

Q4X103_ASPFU/38-201WRR---FG.ISTGES-ISDHMYRMSIMTMLAPPTLA...SRLNLPHCMKMA...L-------IH---------DM--A--
C4XNQ3_DESMR/208-394WSQ---TP.RIPETS-VLGHMFLVAAYGYFFSLAVG.....ACPARRLNNFFAGL-------VH---------DM--P--
Q0RHP9_FRAAA/26-188HLI---DR.S.RREN-DAEHSWHLAMLAVVLGEYAA...AEVDQARVIRML...L-------IH---------DL--V--
D1B724_THEAS/195-373WTR---VQ.RIPNTS-VLGHMFFVGFLSFLMSAMCG.....LNTNRWGWNFFGGL-------MH---------DL--P--
A5FA91_FLAJ1/42-204KLF---NS.D.RCEN-DAEHSWHLALMAIVLAEHSN...EPIDVLKVVKMV...L-------IH---------DI--V--
D3UJA3_HELM1/196-376WSQ---TP.RVPATS-VLGHTLIVALSGYLLSYDIG.....ACKQMRINHFLCGL-------FH---------DL--P--
B2WMG2_PYRTR/50-213WHR---FG.I.EGES-ISDHMYRMSILTMMAPKSIS...EHLDILKCCRMA...L-------IH---------DM--A--
A1B6A0_PARDP/14-168VLM---DL.S.RPEN-SAEHSWHVALYALVFGASD..........RAIAML...L-------LH---------DL--V--
B8DPL6_DESVM/204-399WSQ---TP.RIPETS-VIGHMFIVACYAYFFSIAVG.....ACPARRLNNFFCGL-------FH---------DL--P--
D3V8Z8_XENNA/23-184KLL---NN.T.RHEN-SAEHSWHFALAVIGFAPYA....GDVDISRVIQMA...L-------IH---------DI--V--
D3PCV5_DEFDS/21-178IPF---LG.S.GKQS-IAEHIFRTVVIGYQLSKLAN.....ADTTKVLLMC...L-------FH---------DL--E--
D2QII1_SPILD/16-178KLF---GS.N.RNEN-DAEHSWHLALMALVLADHAN...VQVDLLKVIKML...L-------IH---------DL--V--
D4KY93_9FIRM/14-176YLS---DG.S.RKEN-DAEHSWHLALMAFVLADYAN...EPIDVLKTMKMV...L-------LH---------DV--I--
Q4PHJ8_USTMA/1464-1623WLH---HR.VAAPES-IADHMYRMAMLCLLCPAEAD.....VDLGKCVQLA...I-------VH---------DL--A--
D2V2T7_NAEGR/17-193WVD---CK.VKQPET-IAGHMYRMAIISMLTKNQPN.....ICTERCIKMS...I-------IH---------DL--S--
D4LY09_9FIRM/15-177YLS---DA.S.RKEN-DAEHSWHLALMAVLLKEYSN...EDVDLAKVIPMV...L-------IH---------DL--V--
A8AWX8_STRGC/15-177RTL---DA.Y.RFEN-SAEHSWQGALMALVFREYIP...EEVNLEKVMSML...L-------IH---------DL--G--
Q0U692_PHANO/57-221WQR---FG.IPAPES-ISDHMYRMSIITMLAPASLS...SKLDMAKCCRMA...L-------IH---------DM--A--
C4JFR9_UNCRE/38-203WRR---FN.ITHGES-ISDHMYRMAIMTMLAPPSLA...RKLNIPHCTKMA...L-------IH---------DM--A--
Q30Y45_DESAG/203-388WSQ---TP.RIPETS-VLGHMFLVACYSYFFSLAVN.....ACGARRQNNFFIGL-------FH---------DL--P--
B6HH14_PENCW/35-198WRR---FG.I.NGES-ISDHMYRMSIMTMMAPPSLA...TKINIPHCTKMA...L-------IH---------DM--A--
C7YYC0_NECH7/65-229WRR---FG.IERGES-IADHMYRMSMISMFAPPSLA...PKLDLAKCMKMC...L-------IH---------DM--A--
Q2NRF1_SODGM/23-185KVL---NT.Q.RQEN-TAEHSWHFAVAAMTLTPYAD...DGVDMTRVTQMA...L-------IH---------DI--V--
B8IZP1_DESDA/203-392WTQ---AP.RIPATS-VLGHMFIVACFAYFFSLSVN.....ACRARANNNFFCGL-------FH---------DL--P--
C4LZN2_ENTHI/11-165WVY---NN.VPNPES-ISDHMYRMAILAMIFCPSH......LDRNHAIMVS...L-------CH---------DM--A--
Q2H1W3_CHAGB/59-223WRR---FG.IDRGES-ISDHMYRMSMMSMLAPPALA...AKLDLAKCMKMC...L-------IH---------DM--A--
Q1MS33_LAWIP/31-190HTS---QG...RQES-AAEHSWRLCLLILVFAKYF....EHADVNKLLRLA...V-------VH---------DL--G--
C6VYP4_DYAFD/17-182YTS---SG...RQES-VAEHTWRMSLMAVLMEPYLD...KSIDMAKLLKMI...I-------IH---------DL--I--
B2IX53_NOSP7/16-178LLM---DG.S.RREN-SAEHSWHLAVMAIALVDYAP...EGVDIFHAIKML...L-------IH---------DL--V--
B9E9R1_MACCJ/24-185DTL---DG...RFEN-SAEHSWQAALISNEFAPYYP...ESIDISMVTRML...L-------VH---------DL--G--
Q1MQW5_LAWIP/210-402WSD---TP.RVPETS-VLGHMFLVAGYVYFCSLVIG.....CCPARCVNNFFAGL-------FH---------DL--P--
A1B6A0_PARDP/194-361LLC---DG.S.RREN-SAEHSWHLALYALVMAAHAG...PGVEIGRVIRML...L-------LH---------DL--V--
C5GNI9_AJEDR/38-202WRR---FG.IAHGES-ISDHMYRMSIMTMFAPPALA...SRLNIPRCTKMA...L-------IH---------DM--A--
Q6CED3_YARLI/61-223WLR---YKMIDDPES-IADHQYRMSIIAMLS....L...SPVNQNTCVKMA...L-------VH---------DM--A--
Q5LRU6_RUEPO/205-368RLM---DD.S.RFEN-SAEHSWHIMLYAWVLGEYAA...APVDIDRVLRML...L-------LH---------DL--V--
B8M402_TALSN/38-202WRR---FG.LDRAES-ISDHMYRMAIITMLAPPSLS...SRLNVPHCTKMA...L-------IH---------DM--A--
D3RWY1_FERPA/11-164WLK---LG.IVEPES-VAEHSFLTAAIAFILAYMET.....KSLDEASKACVAAL-------FH---------DA--H--
B1ZVD2_OPITP/30-194VTT---QT.R.RAEN-DAEHSWHLCLCVIVLAEHANC.GAALDVLRVLKMV...I-------VH---------DL--V--
A0RU59_CENSY/9-173WIE---KTGIANPES-VADHSYSASVISMVFGDMLG.....LDADKMVRMS...L-------LH---------DL--A--
C1AC57_GEMAT/21-180WTS---TG...LPET-VAAHTWRLCLMALVLAPHF....PGIDVGKLLRIC...L-------VH---------DL--G--
D7B965_NOCDD/27-189LLV---DG.S.RREN-SAEHSWHLALSARTFAEYAP...EGTDIDRVVEML...V-------LH---------DI--V--
C8V219_EMENI/39-202WRR---FN.INDGES-ISDHMYRMSMMTMLAPPSLA...ARLDLPRCMKMA...L-------VH---------DM--A--
HDDC2_BOVIN/25-182WVY---RN.VQKPES-VSDHMYRMAVMALVTKDEH......LNKDRCVRLA...L-------VH---------DM--A--
A7HZD8_CAMHC/190-378WTQ---TP.RVPETS-VLGHMLIVAILSYFYSLEVK.....ACDSRLIHNFFCAL-------FH---------DL--P--
A7F8M1_SCLS1/48-212WRR---FG.IKRGES-ISDHMYRMSLITMFAPESLA...SKINIPHCTKMA...L-------VH---------DM--A--
Q15QK7_PSEA6/14-178VVE---AD.DNRQEN-SAEHSWHIALLANVMVEYAD...EPVDILRVTKML...L-------IH---------DI--V--
Q5LRU6_RUEPO/15-178VLL---DL.S.RPEN-SAEHSWHLALWALVLSPFAA...PDVDVDRAIRML...L-------LH---------DL--V--
B8CBS4_THAPS/17-179WIM---RK.VHQPES-IADHMYRMSLMSMIASFSD....GALDTNRCIKLA...L-------IH---------DL--A--
O25415_HELPY/203-385WSQ---TP.RVPQTS-VLGHTLCVALMGYLLSFDLK.....ACKSMRINHFLGGL-------FH---------DL--P--
E6VWX3_DESAO/205-393WSQ---TP.RVPETS-VLGHLFIVAAFSWFFSMEVG.....ACRARCQNNFFAGL-------FH---------DL--P--
Q5ZYU3_LEGPH/18-179VTN---PQ...RNES-TAEHSWSASMITLILMNQLKREFTEVDELKTIKLV...L-------IH---------DV--V--
A4FQR8_SACEN/31-193PLA---AV.E.RREN-DAEHCWHLAMMVPVLAEYSD...EPIDVGRTIQLV...V-------VH---------DL--I--
Q16R43_AEDAE/33-190WVL---RN.VKDCET-ISGHMYRMGMMSFLLDGQQD.....LDRIHVMELA...L-------VH---------DL--A--
Q7N1B9_PHOLL/23-184KLL---DN.H.RQEN-SAEHSWHLAIAAMSFAPYA....QEVDIQRVIQMA...L-------IH---------DI--V--
Q1GH96_RUEST/205-371RIA---SG.T.RYEN-SAEHSWHIMLYGWILAPHSL...SEVDVSRVLKML...L-------LH---------DL--V--
B3SA48_TRIAD/14-165WVN---HQ.VTAPES-VAGHMYRMAMMTFLLDDPE....ISLDKTRCMKVA...I-------VH---------DL--A--
C8X0T1_DESRD/204-389WSQ---IP.RIPETS-VLGHMFIVASYAFCMNLVLE.....TGQRRRMNTFFSGL-------FH---------DL--P--
Q2SKN3_HAHCH/16-175WTS---AG...RKES-TAEHTWRLCLMAMVFEKAL....PELDFAKLLKIC...I-------IH---------DL--G--
D4JG23_9FIRM/15-177LLT---NG.I.QKED-DAQHAWHMAIMTLLLSEYAN...EEIDILKTISML...L-------IH---------DI--V--
D4LER9_RUMC1/15-177YLT---GA.I.RKEN-DAEHAWHIALMAILLAEHAN...EPIDVLKTVTML...L-------IH---------DL--V--
Q3A7Q9_PELCD/11-169FQF---LG.S.GAES-VAEHSFRTAVIGFTLARLD....GQVDVGRVLQLC...L-------FH---------DV--P--
A8GIQ6_SERP5/23-185KVL---GT.Q.RQEN-SAEHSWHFAIAAMSLAPYAS...EGVDIQRVIQMA...L-------LH---------DI--V--
B2VFS5_ERWT9/24-185RLL---GN.T.RQEN-SAEHSWHLAMAAMSLAPFAP...QAVDLPHVIRMA...L-------LH---------DV--V--
B4EFY1_BURCJ/16-171HTS---AG...RAES-TAEHSWRLCLMALVFAEAL....PGVDTLKLLKLC...V-------VH---------DL--G--
B4F0N6_PROMH/23-183NVL---DN.S.RAEN-TAEHSWHFAVAAMSFQPYAG....DIDIGRAIQLA...L-------VH---------DI--V--
B7VP19_VIBSL/14-176KPV---GL.D.RYEN-SAEHSWHVCLSALMLKDYAN...EEIDITRVMKML...L-------IH---------DL--G--
C5AY39_METEA/21-183RTI---GE.R.RREN-SAEHSWHLAMFALVLGDRA....PGLDLNRVVAML...L-------VH---------DI--V--
C9A5T3_ENTCA/14-179TLI---YD.RNQREN-DAEHTWHLTLCALLLAEHVAT.EGQVDLLRALKML...I-------IH---------DM--V--
E0SLP7_DICD3/23-185KVI---GT.D.RQED-SAEHSWHFAVAVMSLAPYAD...DGIDITHVLKMA...L-------IH---------DI--V--
G4Q3V2_ACIIR/202-379WSQ---SP.RVPETS-VMGHVLVVAIMGYFCARKLG.....ACRSRVVNDFLGGL-------WH---------DL--P--
Q0PCB0_CAMJE/191-378WAQ---TP.RIPETA-VLGHMLVVAILGYFYSLKIK.....ACDKRLENNFYCAL-------FH---------DL--P--
Q24VU9_DESHY/19-181ITT---GS.R.RQEN-DAEHSWHLAVMAMILSEYAE..DQTIDIAKVISMV...L-------IH---------DL--V--
Q2VZ21_MAGSA/19-173LLM---DS.S.RREN-DAEHSWHIATMSFLLAEYAD...QPVEIGRVARML...L-------IH---------DI--V--
Q6LQV5_PHOPR/14-176RPV---GL..ERYEN-SAEHSWHVCLSALMLKDYAN...EPVDINRVIKML...L-------IH---------DL--G--
Q81SJ1_BACAN/12-170WLS---NG...RQES-VAEHTWRMSLMAILVEPYLD...QKVNIEKLLKMV...I-------IH---------DL--V--
Q87NK1_VIBPA/15-176RVK---SA.EGRLEN-SGEHSWHVALMAVLMEEHAN...APVDICRVMKML...L-------IH---------DV--V--
Q9I2L9_PSEAE/16-171HTS---SG...RPES-TAEHSWRLCLMALAFEDQLA....GLDLGKVLRMC...V-------VH---------DL--G--
R5C105_9FIRM/14-176YLA---DG.N.RKEN-DAEHSWHMAIMAFLLKEYAQ...EEVDIMRVVLMV...L-------IH---------DL--V--
R5KLA6_9CLOT/15-176YLT---DG.I.RKED-DAEHSWHIALMAILLAEYSN...EPVDVLRVVSML...L-------VH---------DL--I--
R5QTI2_9FIRM/29-188YLA---DG.S.RKEN-DAEHSWHLALSAILLKEHMD...APVDLMKVIVMV...L-------IH---------DL--V--
R5TM75_9CLOT/14-169WTT---SG...RRES-VAEHSWRLAVMAFLLKDEF....PELDMDRVVDMC...L-------IH---------DW--G--
R6G8E2_9FIRM/30-191YLS---DG.K.RKEN-DAEHAWHLALMTLLLSEYAN...EKIDTLKTMTMV...L-------FH---------DV--V--
R6LS50_9FIRM/16-178YLT---DG.V.RKEN-DAEHAWHMAIMTVLLAGYAN...EKIDVLKTVTML...L-------IH---------DI--V--
R6N9T8_9FIRM/15-175YLS---DG.I.RKEN-DAEHAWHLALTAALLAEYSE...EKIDLAKTMLMV...L-------VH---------DL--V--
R6QCB8_9FIRM/14-176NLT---NG.E.RKEN-DAEHSWHLALMAVFLSEYAK...EPVDVLQVIKMV...L-------IH---------DL--V--
R6SD54_9FIRM/20-182FLS---DA.K.RREN-DAEHAWHMAIMTLLLSEYAN...EEIDVLRVLSML...L-------IH---------DL--V--
R7FVV2_9FIRM/13-167HSR---TA.ENRRES-VAEHTYRLCVFAWLVKEEF....PDCDMDKVMRMS...L-------FH---------DL--G--

PF13735

C9AAQ5_ENTCA/248-396WVL---LI---DQMG.LAPEAVRSFLKAWKCSNDCI-----RQVHTAYQALLARR.......NG---------EW--N--
CCA_STRMU/250-396WAA---VL---LYLN.V..ENPRSFLKSWKTSNDFQ-----KTVEKLLAIYRLRE.......DR---------QI--K--
CCA_PEDPA/243-389WTM---IA---WSLK.LTPQEVMPFLKQWKTSNDLI-----KNVSATLQVLSMDK.......ND---------QN--E--
CCA_LACS1/248-396WTL---LS---DVFK.LKDTDISNLLRSWKSSNNII-----KYVIAASLCVQKIK.......DS---------KL--D--
CCA_BACLD/243-391WAA---FI---HMIS.INPAEAHRFLKGWKLPGKVI-----RQALHTAE....RI.......DQ---------KW--D--
CCA_LACLA/251-394WAA---LL---TRFS...NVDVKTFLRKWKVSNEFA-----KFVADLVSAYELD..........---------SW--D--
CCA_LACSS/248-396WLV---VT---YLLG.QTPAQAGRFLKHWKSANDVI-----DAVKAGLVLLPKLL.......TA---------TA--D--
CCA_BACSU/243-391WAA---LL---INLG.IVLKDAPLFLKAWKLPGKVI-----KEAIHIADTFG...........Q---------SL--D--
D3G0K4_BACPE/235-381WTF---IC---LSMN.LT...SESHLKGFLFSNQLT-----KDVRNRLAAFSYRN.......NH---------SW--E--
Q7VFG8_HELHP/293-459WVA---FL---YHTD...ELKARDILQSLKFDTYNK-----DYICSLLVYVKKPL.......NN---------NL--T--
CCA_LEUMM/247-393WAH---IL---SRTQ.FDDKKRRQFMYDWKMSRNVM-----KTVNAIVPIVHNPK.........---------KS--T--
C0ZCG8_BREBN/240-398WSL---LL---FAAN.YSPVQAREVCRFLKMSKRET-----EAICCLVELLTRLQPKWDVPQEI---------EW--G--
CCA_BACSK/225-369WLE---FA---ICTG.GP.....SSMAALPLPKKRK-----QLVAAGLKAFEYRQ......TQQ---------RW--S--
D3E7N1_GEOS4/257-422WSL---LL---LACG.TTAQQAEELLRSWTFSNKQR-----ESIVKLLSLHESYLQQP.NAGDA---------ES--S--
B7K9H1_CYAP7/243-397IAK---LT---CLVS.HVPEQAELELIDLKYSRAEI-----RAVTTTLKAIFQLQE.....HSD---------QM--T--
CCA_STRSV/250-393WAA---LL---LALD.V..QNVKGFLKKWKTSREFA-----KKAEDLVEIAAIRS.......ER---------DL--T--
CCA_STRSY/251-396WAL---LF---VCLG.ID..NIKSFLKKWKTSNDFQ-----RSVVKLVEIYQLRQ.......AG---------PV--T--
G2SNU2_LACRR/248-394WTL---LS---YCLK.MDGKDLAKLLRAWKSSNETI-----AQTEKAVAALESIA.......DR---------RV--T--
I3U153_ENTFC/2-146WAL---LI---SQLD.LKENEIRSFLKSWKCSNQMI-----KDVQALVQGLRQRE.......TG---------AL--E--
CCA_LACC3/249-388WAA---LI---FLLR....TQPLVMLKAWKQSNELI-----TLVTQTVKLLQVMP.........---------NP--T--
CCA_STRT2/251-396WAA---TL---LALK...HDNPRSFLKKWKTSVNFQ-----KTVQSLIEIFRFRM.......ER---------EV--T--
CCA_BACAN/243-391WAF---FL---YCIG...EEHPSVFLRQWKFSNKKI-----KDIVAVLLTIRKRK.......EK---------DW--D--
CCA_ENTFA/249-396WTL---LI---QSLN.LPEAEIRSFLKAWKLSNQLI-----QNVSQLVRGLRFRL.......SN---------DW--Q--
CCA_LACPL/249-398WTL---LS---WTMQRTDEAAVRQLLKTWKTSNELI-----NHVTAAIKALMALK......HNG---------QL--T--
CCA_STRR6/249-394WAA---LL---WALE.I..ENAQSFLKSWKTSRQFA-----KQVQDLLIILALRE.......NG---------EL--S--
CCA_STRP1/250-396WAY---VM---ISLA.I..EDPKSFLKAWKTSNDFQ-----RYVTKLIALYRIRQ.......ER---------SF--E--
T0TWB0_9ENTE/82-228WTL---LI---DQIG.LSTAEVRPFLKQWKCSNELI-----RMVQSLFEGVLLRK.......AG---------PF--S--

PF08668

Q312E7_DESAG/87-282----------------------------------------------RA-----VA--.I----LG---------------
Q30XT4_DESAG/21-218----------------------------------------------RA-----VT--.V----LG---------------
Q47EK7_DECAR/16-210----------------------------------------------EA-----VV--.V----LG---------------
Q726T5_DESVH/188-383----------------------------------------------QA-----VA--.V----VG---------------
Q2S9N5_HAHCH/19-212----------------------------------------------QA-----VS--.L----LG---------------
Q30WC1_DESAG/87-282----------------------------------------------RA-----VA--.L----VG---------------
Q479K8_DECAR/17-212----------------------------------------------TC-----LI--.A----LG---------------
Q73KD9_TREDE/241-434----------------------------------------------EA-----VK--.F----VG---------------
Q31F11_THICR/31-224----------------------------------------------EA-----VQ--.R----LG---------------
Q72CV0_DESVH/23-218----------------------------------------------RA-----VI--.V----IG---------------
Q2SKE1_HAHCH/26-214----------------------------------------------QA-----IA--.R----LG---------------
Q3JE99_NITOC/16-212----------------------------------------------DA-----VK--.L----LG---------------
Q30WG2_DESAG/22-218----------------------------------------------RA-----VV--.V----LG---------------
Q2S8R9_HAHCH/193-393----------------------------------------------DA-----IV--RV----LG---------------
Q2SA21_HAHCH/160-347----------------------------------------------DA-----VV--.R----LG---------------
Q3A583_PELCD/28-222----------------------------------------------NA-----LT--.V----LG---------------
Q312Z8_DESAG/87-282----------------------------------------------HA-----IA--.I----VG---------------
Q72F84_DESVH/140-337----------------------------------------------QA-----VV--.L----LG---------------
Q39QJ3_GEOMG/20-214----------------------------------------------GA-----LV--.Y----LG---------------
Q5E6F6_VIBF1/39-240----------------------------------------------TA-----VS--.R----LG---------------
A6TLC8_ALKMQ/18-213----------------------------------------------QA-----TV--.L----LG---------------
Q72DM6_DESVH/18-215----------------------------------------------RA-----VA--.V----LG---------------
Q311L6_DESAG/19-208----------------------------------------------HA-----LV--.L----LG---------------
Q9WZV8_THEMA/16-211----------------------------------------------EA-----VM--.I----LG---------------
Q3J8D7_NITOC/32-219----------------------------------------------TA-----LA--.R----LG---------------
Q7P1W8_CHRVO/14-205----------------------------------------------DA-----VI--.L----LG---------------
Q7UJI6_RHOBA/74-269----------------------------------------------QA-----IT--.L----VG---------------
Q5DZR1_VIBF1/13-204----------------------------------------------QA-----VV--.R----LG---------------
Q3A5R3_PELCD/31-223----------------------------------------------GA-----IA--.V----LG---------------
Y073_TREPA/254-447----------------------------------------------EA-----VK--.R----VG---------------
Q2W316_MAGSA/143-340----------------------------------------------QA-----VR--.T----IG---------------
Q30YJ4_DESAG/188-383----------------------------------------------RA-----VT--.I----IG---------------
Q315F2_DESAG/150-345----------------------------------------------RA-----IT--.L----IG---------------
Q39ZN9_GEOMG/20-214----------------------------------------------EA-----IL--.Y----LG---------------
Q47F47_DECAR/17-209----------------------------------------------KA-----VS--.L----IG---------------
Q2RWK0_RHORT/140-335----------------------------------------------QA-----VR--.L----LG---------------
Q9I6M3_PSEAE/161-349----------------------------------------------QA-----LR--.R----LG---------------
Q893W4_CLOTE/30-227----------------------------------------------GA-----TV--.L----LG---------------
Q6AL41_DESPS/16-211----------------------------------------------QA-----VS--.L----LG---------------
Q39X38_GEOMG/18-206----------------------------------------------NA-----LI--.L----LG---------------
Q74AQ6_GEOSL/25-219----------------------------------------------DA-----VI--.Y----LG---------------
Q47BZ2_DECAR/19-212----------------------------------------------QA-----IN--.V----LG---------------
Q74A15_GEOSL/20-215----------------------------------------------KA-----VT--.I----IG---------------
Q729J3_DESVH/10-205----------------------------------------------RA-----VA--.A----SG---------------
Q7MK26_VIBVY/15-206----------------------------------------------DA-----LI--.R----VG---------------
G8MPC2_9BURK/14-206----------------------------------------------RA-----IN--.I----VG---------------
Q4KGR2_PSEF5/23-203----------------------------------------------TA-----IT--.R----LG---------------
Q88AT3_PSESM/164-350----------------------------------------------GA-----LG--.I----LG---------------
Q88RB8_PSEPK/160-345----------------------------------------------QA-----LN--.K----LG---------------
Q8EXT4_LEPIN/15-212----------------------------------------------ES-----LM--.T----LG---------------
Q8F5F6_LEPIN/263-457----------------------------------------------QA-----VK--.V----VG---------------
Q8F7S8_LEPIN/248-443----------------------------------------------RA-----IQ--.L----IG---------------
Q8PAV4_XANCP/2-187----------------------------------------------QA-----LT--.M----LG---------------

PF01966

O17828_CAEEL/89-184----------------------------------------------KC-----LS--SD----KM---------------
D4FZG3_BACNB/50-149----------------------------------------------ED-----T.--.D----VT---------------
DGTP_SHIBO/66-184----------------------------------------------NP-----PF--GH----FG---------------
Q9Y9C8_AERPE/32-133----------------------------------------------ES-----VI--GD----..---------------
N1P9P6_YEASC/58-164----------------------------------------------ES-----LV--GD----IT---------------
O67745_AQUAE/51-169----------------------------------------------HP-----PF--SH----..---------------
Q9Z9D3_CHLPN/480-625----------------------------------------------KL-----IN--PG----FF---------------
Y205_CLOB8/33-134----------------------------------------------KS-----LQ--YE----..---------------
Q9RU30_DEIRA/189-293----------------------------------------------KI-----H.--..----..---------------
YS48_CAEEL/92-193----------------------------------------------HG-----PF--S.----..---------------
Q9RWF0_DEIRA/280-403----------------------------------------------KI-----AI--PD----..---------------
Q9X1N3_THEMA/52-163----------------------------------------------HG-----PF--SH----QF---------------
Q9X1H8_THEMA/254-377----------------------------------------------KI-----GI--PD----HI---------------
D4G2U1_BACNB/61-181----------------------------------------------HG-----PF--SH----SF---------------
SPOT_AQUAE/49-145----------------------------------------------ED-----T.--..----..---------------
O24769_BACME/28-137----------------------------------------------EV-----VS--TH----..---------------
F7UTY5_SYNYG/586-734----------------------------------------------KM-----HD--PL----GF---------------
E8VG54_BACST/160-279----------------------------------------------KV-----KE--LS----GP---------------
Q9YBD1_AERPE/68-180----------------------------------------------NS-----VH--RD----..---------------
RNY_MYCMY/238-331----------------------------------------------KA-----I.--..----..---------------
J9DNF1_9THEM/20-135----------------------------------------------RD-----VP--PR----KL---------------
RELA_STREQ/50-149----------------------------------------------ED-----T.--.D----IT---------------
Q9X1J6_THEMA/238-380----------------------------------------------KM-----KR--PH----FF---------------
A0A008B076_STAAU/57-156----------------------------------------------ED-----TP--Y.----TF---------------
SPOT_MYCPN/62-167----------------------------------------------ED-----T.--.Q----VT---------------
B7J1D0_BORBZ/62-161----------------------------------------------ED-----T.--NV----EK---------------
D4FWU4_BACNB/336-429----------------------------------------------KA-----I.--..----..---------------
A0A038F966_MYCTX/105-202----------------------------------------------ED-----T.--.G----YT---------------
M1UP73_BACIU/501-643----------------------------------------------KT-----KR--PQ----YF---------------
Y778_METJA/18-130----------------------------------------------RS-----RT--HG----..---------------
A0A017JHE0_ECOLX/30-142----------------------------------------------EV-----LT--GD----..---------------
RNY_DEIRA/388-481----------------------------------------------KS-----I.--..----..---------------
Q9RV39_DEIRA/227-347----------------------------------------------KP-----RT--FA----..---------------
O29268_ARCFU/5-101----------------------------------------------RG-----YP--N.----..---------------
F5M2J7_RHOSH/51-140----------------------------------------------EY-----VI--GD----..---------------
Y461_MYCGE/55-184----------------------------------------------HG-----PH--SH----AF---------------
GLND_RHILV/488-604----------------------------------------------KG-----RQ--ED----..---------------
SPOT_HAEIN/18-117----------------------------------------------ED-----T.--..----..---------------
Y1020_METJA/58-173----------------------------------------------NS-----VH--RD----..---------------
F7UME6_SYNYG/335-476----------------------------------------------TY-----VS--HS----..---------------
Q9X0Q2_THEMA/445-567----------------------------------------------KI-----YV--PQ----VV---------------
CAS10_METJA/1-92----------------------------------------------KF-----IQ--RA----..---------------
A0A026MC82_ECOLX/26-132----------------------------------------------SL-----AK--NH----PQ---------------
Q9X225_THEMA/394-516----------------------------------------------KI-----GV--KG----AI---------------
I0LL24_CORGK/383-503----------------------------------------------KG-----FP--RP----..---------------
B9X448_BORBG/324-419----------------------------------------------KG-----M.--.E----SI---------------
SAMH1_HUMAN/164-319----------------------------------------------HG-----PF--S.----..---------------
E8VDR1_BACST/18-132----------------------------------------------KF-----RP--KE----EM---------------
O59597_PYRHO/37-137----------------------------------------------RP-----L.--..----..---------------
RNY_AQUAE/374-467----------------------------------------------KA-----I.--..----..---------------
RNY_THEMA/324-417----------------------------------------------KA-----V.--..----..---------------
F7UK95_SYNYG/36-134----------------------------------------------ED-----QG--GM----ET---------------
B2S3P0_TREPS/581-722----------------------------------------------KM-----EN--GE----YF---------------
RNY_MYCGE/293-385----------------------------------------------KS-----N.--..----..---------------
F6BQM3_SINMB/494-610----------------------------------------------KG-----RP--ED----..---------------
A0A017I4K6_ECOLX/228-329----------------------------------------------KG-----L.--..----..---------------
O34203_FERIS/166-297----------------------------------------------KV-----KE--YM----VN---------------
Q9WXP4_THEMA/15-134----------------------------------------------LI-----LP--YE----GK---------------
M1GE25_MYCPM/300-392----------------------------------------------KA-----D.--..----..---------------
F7UP12_SYNYG/21-136----------------------------------------------KF-----FP--PT----KL---------------
MESH1_DROME/33-128----------------------------------------------ED-----T.--..----..---------------
Q9V1T1_PYRAB/57-183----------------------------------------------HG-----PF--SH----TF---------------
GLND_VIBF1/451-585----------------------------------------------KG-----RG--GD----..---------------
Q9UY89_PYRAB/33-132----------------------------------------------EA-----LI--TD----IP---------------
Q9WZI8_THEMA/93-197----------------------------------------------ED-----GE--NV----SL---------------
D6EPR5_STRLI/149-246----------------------------------------------ED-----T.--.E----YG---------------
G4EUQ1_BACIU/26-129----------------------------------------------DV-----KL--PD----..---------------
B2S403_TREPS/156-278----------------------------------------------MA-----R.--..----VI---------------
C9MIV2_HAEIF/446-580----------------------------------------------KG-----RG--GD----..---------------
O30165_ARCFU/578-749----------------------------------------------KL-----NI--N.----WQ---------------
C7GMY9_YEAS2/77-183----------------------------------------------ES-----LV--GD----..---------------
O58617_PYRHO/35-142----------------------------------------------KC-----L.--..----..---------------
DGT1B_DEIRA/61-211----------------------------------------------HP-----PF--GH----GG---------------
Q9RYW9_DEIRA/337-458----------------------------------------------QI-----VS--QS----..---------------
D6EMA1_STRLI/270-395----------------------------------------------KP-----RT--RR----..---------------
Q9X0N1_THEMA/184-308----------------------------------------------KV-----FI--PE----SI---------------
SPOT_SPICI/49-148----------------------------------------------ED-----T.--PA----TF---------------
O26251_METTH/50-159----------------------------------------------HG-----PF--SH----..---------------
DGTL1_ZYMMO/68-203----------------------------------------------HP-----PF--GH----IG---------------
O27704_METTH/15-122----------------------------------------------RC-----RT--SG----..---------------
O28840_ARCFU/39-129----------------------------------------------EA-----RT--MD----..---------------
YPEC_LACLC/25-141----------------------------------------------GV-----YP--NH----QR---------------
Q9RTC7_DEIRA/78-187----------------------------------------------ED-----V.--..----..---------------
Y2027_AQUAE/19-141----------------------------------------------KV-----AI--PD----VI---------------
A0A017I0H4_ECOLX/45-144----------------------------------------------ED-----T.--..----..---------------
D5AVY7_RICPP/62-198----------------------------------------------HT-----PF--GH----AG---------------
O83882_TREPA/204-327----------------------------------------------MQ-----HV--PA----DI---------------
O27154_METTH/3-97----------------------------------------------KF-----YQ--RT----SS---------------
Q56418_THETH/27-147----------------------------------------------KP-----LT--RR----..---------------
RSH3C_ARATH/237-341----------------------------------------------DD-----SF--M.----SY---------------
O57915_PYRHO/21-126----------------------------------------------KL-----D.--.D----RF---------------
O58085_PYRHO/33-132----------------------------------------------EA-----II--TD----..---------------
RELA_MYXXA/63-165----------------------------------------------ED-----T.--..----..---------------
Q9RJG7_STRCO/66-190----------------------------------------------LV-----PP--YR----GD---------------
RNY_HELPJ/342-435----------------------------------------------KA-----LT--QE----..---------------
Q9RVH0_DEIRA/24-142----------------------------------------------RR-----TG--PN----KD---------------
YC0H_SCHPO/38-144----------------------------------------------ES-----IV--GD----..---------------
Y048_RHOCB/51-140----------------------------------------------EY-----VL--GD----..---------------
Q9RYB1_DEIRA/218-341----------------------------------------------KI-----SL--PD----EI---------------
D4GBT9_TREPC/186-314----------------------------------------------KI-----GI--PD----YV---------------
F7UP82_SYNYG/158-280----------------------------------------------LI-----QV--PD----..---------------
Q9YW52_MSEPV/52-162----------------------------------------------KP-----F.--..----..---------------
B2S4Q5_TREPS/320-413----------------------------------------------KG-----VE--TD----..---------------
A0A038FDD5_MYCTX/72-222----------------------------------------------HP-----PY--GH----NG---------------
O67911_AQUAE/273-423----------------------------------------------KP-----QT--FA----..---------------
D4G0S6_BACNB/23-139----------------------------------------------HY-----EW--YT----DG---------------
G4EZI1_BACIU/49-154----------------------------------------------HT-----AF--S.----..---------------
D0KRE5_SULS9/50-168----------------------------------------------QF-----PF--SH----SL---------------
O29044_ARCFU/20-133----------------------------------------------RA-----IT--HD----PF---------------
O69970_STRCO/99-196----------------------------------------------ED-----TE--VT----..---------------
Y240_MYCGE/140-252----------------------------------------------KQ-----LP--VD----QL---------------
Q9RWG4_DEIRA/36-142----------------------------------------------EI-----GA--GD----..---------------
Q59534_MYCLR/269-391----------------------------------------------KP-----AT--RR----HE---------------
Q9WZJ8_THEMA/110-231----------------------------------------------KI-----GI--EQ----LM---------------
O28849_ARCFU/51-157----------------------------------------------HA-----PF--SH----GS---------------
Q9UXZ9_PYRAB/35-137----------------------------------------------RP-----L.--..----..---------------
Q9RRB2_DEIRA/9-122----------------------------------------------RD-----LP--ES----EL---------------
B1LB67_THESQ/20-135----------------------------------------------YD-----YT--KD----KP---------------
A0A038FBC4_MYCTX/430-550----------------------------------------------KG-----RG--TD----..---------------
B0R8Y7_HALS3/34-139----------------------------------------------EA-----RT--GD----..---------------
D5EU34_PRER2/267-390----------------------------------------------KT-----KS--KR----WD---------------
F7UQ39_SYNYG/76-175----------------------------------------------ED-----T.--DI----SI---------------
J9H327_9THEM/170-294----------------------------------------------KI-----GI--PD----RI---------------
O24771_BACME/49-153----------------------------------------------HT-----AF--SH----VV---------------
O30203_ARCFU/70-165----------------------------------------------YE-----QT--QG----..---------------
A4QEM7_CORGB/77-174----------------------------------------------ED-----T.--.D----YS---------------
GLND_STRCO/431-550----------------------------------------------KG-----WP--GD----..---------------
O59446_PYRHO/39-165----------------------------------------------HG-----PF--SH----TF---------------
DGT1A_DEIRA/76-198----------------------------------------------HP-----PF--GH----AG---------------
B2S3X9_TREPS/13-131----------------------------------------------RE-----HS--EV----FL---------------
Q9VMB3_DROME/209-311----------------------------------------------ES-----LV--GD----..---------------
O81418_ARATH/34-167----------------------------------------------ED-----TN--FI----TF---------------
GLND_KLEOX/465-599----------------------------------------------KG-----AG--GD----..---------------
Q9UZX4_PYRAB/16-187----------------------------------------------KG-----LE--E.----FQ---------------
Q16CX0_ROSDO/51-140----------------------------------------------EY-----VI--GD----..---------------
Q9R6H4_RHIRD/41-147----------------------------------------------EV-----KV--GD----IP---------------
F7USP6_SYNYG/61-155----------------------------------------------NP-----PF--GH----AG---------------
Q9WXP4_THEMA/224-342----------------------------------------------KI-----SV--SY----KI---------------
Q9RRR5_DEIRA/48-141----------------------------------------------YE-----LH--PE----..---------------
MPTB_METJA/58-172----------------------------------------------KP-----Y.--..----..---------------
Q9RYH1_DEIRA/488-612----------------------------------------------KI-----GI--PD----SI---------------
Q56749_WOLSC/57-181----------------------------------------------KV-----AI--PD----AI---------------
O82212_ARATH/108-212----------------------------------------------EA-----IV--GD----..---------------
J3TU75_MYCGT/49-154----------------------------------------------ED-----T.--..----..---------------
Q9RZM5_DEIRA/48-178----------------------------------------------KA-----LT--TR----EE---------------
Q9X210_THEMA/387-509----------------------------------------------KI-----KV--PK----EI---------------
M1GES7_MYCPM/55-184----------------------------------------------HA-----PH--SH----AF---------------
F7UPV4_SYNYG/177-315----------------------------------------------KV-----GV--PD----HI---------------
A0A008AQ38_STAAU/159-278----------------------------------------------KV-----RE--LS----GP---------------
Y336_MYCPN/193-304----------------------------------------------KQ-----LP--Q.----AQ---------------
Q9RH69_BRAJP/95-194----------------------------------------------ED-----T.--..----..---------------
L8F915_MYCSM/72-222----------------------------------------------HP-----PY--GH----NG---------------
Q9X0M9_THEMA/171-296----------------------------------------------KV-----Y.--..----ID---------------
Y1154_METJA/50-150----------------------------------------------HP-----PF--SH----..---------------

PF13328

A9U2H3_PHYPA/119-274......D..-----............D......S...NFCL.....KR----.LR..DT....LG---------------
A1T4E6_MYCVP/17-161......E..-----............D......AG.GPPTL.....AE----.IR..AN....FG---------------
CRSH3_ORYSJ/79-231......D..-----...................TG..ALAM.....AD----.VE..AQ....LG---------------
D0J716_COMT2/42-203....HLN..-----............K......P...........QEV----.IA..KA....FG---------------
D3HT91_LEGLN/40-196......H..-----...................YA..DLSV.....DD----.VA..EQ....LG---------------
A4G620_HERAR/30-203.........-----...................M......IAPAAAEK----.IE..ER....FG---------------
C5A8B1_BURGB/16-182......PH.-----..........LHD......P...........EAE----.IT..QR....FG---------------
B1Y0Q8_LEPCP/41-202......G..-----............D......FLTDPETV.......----.VS..QA....FG---------------
C1DRX7_AZOVD/40-203......R..-----............Q......K....QIA....LDE----.VQ..RR....FG---------------
Q7NIR7_GLOVI/11-155......E..-----............D......C...NVSL.....EA----.IE..TA....FG---------------
Q2KUM4_BORA1/36-197LSASPLR..-----............N...................DP----.LT..KV....FG---------------
A6VKS4_ACTSZ/37-191......N..-----...................A....KIV....NTE----QIK..ED....FG---------------
Q1QX17_CHRSD/40-201......R..-----............E.......G..LITL.....EA----.IE..KR....FG---------------
Q3JBJ7_NITOC/22-174......E..-----...................A....GLL....KQE----IIT..RN....LA---------------
Q0VP27_ALCBS/38-202......R..-----............E.......G..QVTL.....LE----.VE..KE....FG---------------
Q5NYK8_AROAE/35-194......D..-----...................YG..EDPI.....ET----.VT..AR....FG---------------
C6WYQ5_METML/40-203......A..-----............H......I............DN----.WQ..ETLKLRFG---------------
A0LAH5_MAGSM/29-180......E..-----............DAPPEKQA...........DQA----.IR..AL.....D---------------
A4RTL9_OSTLU/39-191......D..-----............V......T....SST....KED----.LR..KR....FS---------------
A4YUR2_BRASO/10-154......E..-----............D......QG.GQATL.....DE----.IR..RR....FG---------------
A1WR12_VEREI/38-195......E..-----................................EL----.IT..KT....FG---------------
Q01DM6_OSTTA/79-231......D..-----...................VT..SCEV.....DE----.LR..ER....FS---------------
Q2Y627_NITMU/35-194......EYL-----..........EG.......Y...........EEE----.LA..TA....FG---------------
C1DDC8_LARHH/40-201....CRD..-----............D......A............HA----WLT..EK....MG---------------
D3RPV6_ALLVD/41-199.........-----............D......WS..GGEL.....TE----.AALLEG....FG---------------
A1WXU2_HALHL/39-197......E..-----...................LQ..EGSI.....AG----.LR..KH....LG---------------
Q1H1S1_METFK/41-206......E..-----............Y......L....PGW....KEK----.LQ..QA....FS---------------
Q9CJX4_PASMU/37-191......H..-----............H......K....LVE....LSQ----.IN..ED....FG---------------
D5CLC9_SIDLE/41-202......D..-----...................FL..DDWK.....SV----.LE..ER....FG---------------
Q7VTF3_BORPE/36-199......A..-----............D......L...NAPAPTLRNDP----.VA..SE....FG---------------
Q21WQ7_ALBFT/39-207......D..-----............H......L...NKPQ.....EV----.IA..KA....FG---------------
C7RQP8_ACCPU/48-214......A..-----...................IL..EFGL.....TR----.IE..SD....FG---------------
C4YVJ8_9RICK/45-189......E..-----............D......T....ELT....KEM----.VA..QV....FG---------------
D0MFP1_RHOM4/19-189......E..-----............DTNRHGQQ....LRY.....EV----.LR..ER....MG---------------
E6U0A6_BACCJ/9-157......E..-----............D......T...DGTV.....EQ----.IT..NI....FG---------------
Q0KBZ4_CUPNH/23-190......AF.-----..........VPG......T...........EAE----.IA..PR....FG---------------
D9SJ75_GALCS/35-194......EY.-----...........LD...........DWA.....EK----.LK..TD....FG---------------
Q6AP30_DESPS/31-180......K..-----............H......G....VEI.....TE----.LR..DA....FG---------------
D5X0W0_THIK1/25-183......P..-----............Q......L....AHP....QDQ----.LS..KH....FG---------------
Q0A9N8_ALKEH/39-195......T..-----...................LD..DTAL.....GR----.IR..KQ....LG---------------
A5UZY0_ROSS1/13-154......E..-----............D......C....GVS....PQQ----.LE..TL....FG---------------
A1K650_AZOSB/35-194......EY.-----..........LDD......A...........PTL----.IE..ER....FG---------------
C4ZK28_THASP/35-194......E..-----............E......L....EAP....AEE----.IE..AR....FG---------------
D4IMI0_9BACT/28-187......RLA-----HKQLPAEEFLALS...................AD----.IR..KR....FG---------------
A2SG51_METPP/47-209Y..LAKP..-----............E...................EV----.IA..KA....YG---------------
Q8LSZ7_CHLRE/200-352......D..-----...................M....VSR.....SQ----.LE..EF....MP---------------
E0ULD0_CYAP2/16-160......E..-----............D......QG..GEAT....RQE----.IS..RQ....FG---------------
Q2SL26_HAHCH/40-204......R..-----............E...........GKL.....SL----.VRVNEE....FG---------------
A6VUQ3_MARMS/40-204.....RE..-----............D......Q....LPI.....SR----.VT..EM....FG---------------
Q47C74_DECAR/36-202......S..-----............H......DE..HGIT....S..----.IE..SR....FG---------------
Q3A521_PELCD/26-176......Q..-----............Q......N....LVD....ATE----.LQ..TH....FG---------------
A1VQB2_POLNA/39-200......Q..-----............H......L....NKP....QDV----.IA..KA....FG---------------
A1U2U8_MARAV/44-203......R..-----............E......E....RVP....LEE----.VR..KE....FG---------------
A1WAJ9_ACISJ/45-206......S..-----............H......L....NKP....EEV----.IT..KA....FG---------------
C4YZG9_9RICK/69-212......E..-----............D......T...LLTK.....EM----.IV..KE....FG---------------
G2IXS4_PSEUL/40-200......D..-----............F......R....EDW....HEW----.MT..NE....FN---------------
O25466_HELPY/45-202......E..-----............D......T...PCKI.....ET----.IE..QE....FG---------------
RELA_HAEIN/37-193......A..-----............N......K....LTD....WES----.LK..EK....FG---------------
Q13WF6_BURXL/19-186......P..-----............H......L...QDPE.....RV----.IA..DN....FG---------------
Q31Q06_SYNE7/14-158......E..-----............D......TG..PESE.....AL----.IR..EQ....FG---------------
Q5F707_NEIG1/40-201......R..-----............Y......V...PDWN.....LL----.VS..ER....CN---------------
Q5NEV0_FRATT/39-192......N..-----............F......G....DIS....DED----.IE..QA....TN---------------
Q83BW2_COXBU/24-180......T..-----............Q......S...GISQ.....EA----.LT..DQ....IG---------------
Q885Y7_PSESM/37-199......R..-----............E......G...VIPL.....PD----.VE..QR....FG---------------
Q8PBN2_XANCP/11-164......E..-----............D......CG..GGHE.....GS----.IR..AQ....FG---------------
Q8XZ30_RALSO/33-195......I..-----............L......A...TDNE.....KA----.IE..PA....FG---------------
R7JMQ2_9BACT/28-185......RTA-----S.......RQDEE......TF..LRLT.....DE----.IR..DR....FG---------------

PF07514

A1U8B0_MARAV/20-345VTDIEVVYRL..PEKQFQIWHPWYGNIPPGAAYR....YRFRRKIE.N-----TRLAKTLHEKSA---------------
A1TJN5_ACIAC/34-347AVDLEVELD.....DGS.RWNAWHGVLRRPYRFR....YR.......R-----GR.EYRLHGAAS---------------
A1TQV2_ACIAC/57-390MTDLRIQWRCDGMADSI.RWAATGGSLVQIAGRRPAAEYLVDFAPK.S-----QR.DYSAHGRLA---------------
A6THL2_KLEP7/23-338AVDMEIHQR.....DGT.RWHSWQGNLAQPYRWQ....YQ......SH-----GR.DYHLHPAAT---------------
Q47CV4_DECAR/17-338MSHVIVTDT.....VGE.AWPVFLMPLADWLAAHRAERYFLRWRPQAI-----EA......RGLG---------------
Q21QJ1_ALBFT/57-380LTEMMIFDP.....KGN.QWSPFVAPLTEWARQQGADRFFVRWHQHDD-----AR...SVANTLS---------------
B4EWU3_PROMH/32-353VSDLSITDE.....DGRYQWNPFLQTLSQWATNNRIERYFIRWRDGRC-----KR.....HEQFS---------------
H6URM8_PROSM/46-357LSDVSITDK.....DGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRH-----KR.....HEQFS---------------
M9X6X6_PASHA/34-346VVDIEITLK.....DGS.RWFAWNGLPPQPYKFK....YI.......K-----GR.DYHLHPVLG---------------
Q13VV9_BURXL/28-340AVDLHVELA.....DGS.TWHPWHGPLRQPYRFR....YR.......E-----DR.EYRLHSAAT---------------
Q889C1_PSESM/24-338AVDVKVELA.....DGT.TWHPWHGPLDQPYRFK....YV.......K-----GR.DYRLHGAAS---------------
S6BRE4_PSERE/59-379LTDIRATDF.....EGNNQWIYAQETLHDWSVRNKLTRYFLHWNSNRH-----GN.....HVQVS---------------

PF13487

C4LEW6_TOLAT/829-894----------------------------------------------ER--------------------------------
C7RLF4_ACCPU/828-893----------------------------------------------ER--------------------------------
A4XWP5_PSEMY/838-903----------------------------------------------ER--------------------------------
C6C118_DESAD/445-510----------------------------------------------ER--------------------------------
Q1LGI2_RALME/831-896----------------------------------------------ER--------------------------------
A1SW11_PSYIN/823-888----------------------------------------------DR--------------------------------
B9L9U4_NAUPA/308-373----------------------------------------------EY--------------------------------
Q88JQ0_PSEPK/644-709----------------------------------------------ER--------------------------------
E6VRY4_DESAO/573-635----------------------------------------------EM--------------------------------
A1U2G6_MARAV/797-862----------------------------------------------ER--------------------------------
B1YGB8_EXIS2/181-244----------------------------------------------QQ--------------------------------
Q88IQ7_PSEPK/258-320----------------------------------------------DR--------------------------------
B7KEJ3_CYAP7/323-385----------------------------------------------HS--------------------------------
A4XQI8_PSEMY/237-307----------------------------------------------DL--------------------------------
B8IYF0_DESDA/583-645----------------------------------------------ER--------------------------------
Q8EE49_SHEON/255-317----------------------------------------------ER--------------------------------
Q47Z39_COLP3/249-311----------------------------------------------EK--------------------------------
C6BWJ1_DESAD/540-602----------------------------------------------EI--------------------------------
E6VWT1_DESAO/206-269----------------------------------------------EM--------------------------------
B2JVC1_BURP8/302-364----------------------------------------------AW--------------------------------
E6VTW0_DESAO/225-288----------------------------------------------EQ--------------------------------
Q10WT1_TRIEI/323-385----------------------------------------------SL--------------------------------
A4XNT7_PSEMY/287-349----------------------------------------------DL--------------------------------
Q21JZ3_SACD2/197-260----------------------------------------------ER--------------------------------
A6TVP0_ALKMQ/242-306----------------------------------------------NS--------------------------------
Q6MM25_BDEBA/342-407----------------------------------------------EL--------------------------------
Q2W8H3_MAGSA/209-272----------------------------------------------EE--------------------------------
Q15VN2_PSEA6/250-311----------------------------------------------QQ--------------------------------
A8ESC2_ARCB4/238-300----------------------------------------------EL--------------------------------
Q0ATW9_SYNWW/203-268----------------------------------------------EE--------------------------------
Q2W315_MAGSA/210-273----------------------------------------------EQ--------------------------------
F2G724_ALTMD/249-310----------------------------------------------QQ--------------------------------
Q2RWJ9_RHORT/206-269----------------------------------------------ER--------------------------------
C4XMD6_DESMR/203-269----------------------------------------------DA--------------------------------
D7E117_NOSA0/301-367----------------------------------------------EK--------------------------------
C6BRZ3_DESAD/205-267----------------------------------------------DY--------------------------------
B0JHT5_MICAN/324-384----------------------------------------------NA--------------------------------
B7JY25_CYAP8/324-385----------------------------------------------SF--------------------------------
D4ZCM2_SHEVD/914-979----------------------------------------------DR--------------------------------
E3FLC4_STIAD/302-361----------------------------------------------WK--------------------------------
E3FSY9_STIAD/376-441----------------------------------------------ER--------------------------------
K0HSG2_9BURK/850-915----------------------------------------------DR--------------------------------
Q0VML8_ALCBS/381-446----------------------------------------------ER--------------------------------
Q63JR8_BURPS/285-346----------------------------------------------ES--------------------------------
Q72BS2_DESVH/821-886----------------------------------------------ER--------------------------------

PF05153

MIOX_DICDI/35-292----------------------------------------------KV-----LL--SKKF..KE---------------
Q9VTU9_DROME/38-292----------------------------------------------KI-----MA--F..Y...G---------------
MIOX_PONAB/31-285----------------------------------------------KV-----LA--L..F...G---------------
MIOX2_ARATH/61-317----------------------------------------------KV-----LL--LPEF..GG---------------
Q01Z78_SOLUE/31-278----------------------------------------------KA-----LC--L..Y...G---------------
Q4PIN4_USTMA/80-332----------------------------------------------KL-----LC--F..F..GA---------------
A8XBD0_CAEBR/22-276----------------------------------------------KI-----MS--V..W...G---------------
Q5AKC6_CANAL/89-340----------------------------------------------KL-----LY--F..F..DS---------------
MIOX5_ARATH/58-314----------------------------------------------KV-----LT--LPQF..GG---------------
Q6CNQ4_KLULA/67-318----------------------------------------------KI-----LY--F..F..ES---------------
Q16XZ8_AEDAE/38-292----------------------------------------------KV-----MA--F..Y...G---------------
Q5KEW8_CRYNJ/65-315----------------------------------------------KL-----LC--F..F..GA---------------
A1C675_ASPCL/63-315----------------------------------------------KL-----LY--F..F..DA---------------
Q0DBI8_ORYSJ/52-308----------------------------------------------KV-----LL--HPSF..GE---------------
Q2GML9_CHAGB/59-314----------------------------------------------KL-----ML--F..FEGCC---------------
A5FF81_FLAJ1/46-295----------------------------------------------KV-----LC--L..F...G---------------
F6Z3P9_XENTR/31-279----------------------------------------------KI-----MA--L..D...N---------------
H9J8E4_BOMMO/127-375----------------------------------------------KV-----MA--F..Y...D---------------
K5WF63_PHACS/46-296----------------------------------------------KL-----LH--I..F..GS---------------
Q1K733_NEUCR/98-352----------------------------------------------KL-----ML--F..F.ELA---------------

PF00233

K3XBL4_PYTUL/325-572----------------------------------------------HS----GLTNDFLIKT..N...............
F6R4G9_ORNAN/251-478----------------------------------------------HP----GYNNTYQINA..R...............
G0QQ35_ICHMG/67-322----------------------------------------------HT----GRTNNFEIAV..Q...............
G3N3Y5_GASAC/183-410----------------------------------------------HT----GTTNNFHIQT..R...............
A2F408_TRIVA/808-1039----------------------------------------------HD----GFTNVFNEKA..E...............
A0EGL5_PARTE/997-1235----------------------------------------------HT----GRTNMFMINS..Q...............
F6Z586_MONDO/224-458----------------------------------------------HP----GVNQLFLIKT..N...............
F7BCQ1_XENTR/185-414----------------------------------------------HP----GVNQSFLIKT..N...............
A9UR22_MONBE/86-321----------------------------------------------HQ----GLSNSYYQNS..K...............
A0C8A0_PARTE/631-860----------------------------------------------HT----GRTNYFEINN..L...............
G4VPI6_SCHMA/343-584----------------------------------------------HP----GVTNQFLINT..G...............
G6DFF8_DANPL/405-640----------------------------------------------HR----GTTNSFQIQG..Q...............
C1MV36_MICPC/57-286----------------------------------------------HF----RLNNAFLKNS..K...............
Q23AZ3_TETTS/471-707----------------------------------------------HP----GYNNVFLINT..Q...............
G3SHK9_GORGO/356-600----------------------------------------------HP----GVSNQFLINT..I...............
H2XQX1_CIOIN/516-756----------------------------------------------HR----GTNNAFLIRA..G...............
A0BEN8_PARTE/463-688----------------------------------------------HP----GLNNGFLVAS..Q...............
A2DYU6_TRIVA/820-1055----------------------------------------------HE----GFNNIFNIKA..Q...............
D0MT23_PHYIT/280-525----------------------------------------------HV----GLTNDFLIKT..S...............
I1CMJ2_RHIO9/36-262----------------------------------------------HP----GFNNDFQVKT..R...............
K1R0I4_CRAGI/563-798----------------------------------------------HR----GTNNQFQIKT..S...............
A0D8M4_PARTE/180-432----------------------------------------------HK----GVNNMYKIKK..S...............
A7RY89_NEMVE/476-708----------------------------------------------HR----GTNNAFQAKT..D...............
V4ZU93_TOXGO/723-961----------------------------------------------HP----GFSSAFLIKT..Q...............
G5BDY7_HETGA/501-733----------------------------------------------HR----GFSNTYLQKF..D...............
F6YX00_XENTR/336-571----------------------------------------------HR----GVNNSFIQRS..E...............
E7QL51_YEASZ/264-483----------------------------------------------HP----GTNNQLLCNC..E...............
T1G2P4_HELRO/239-480----------------------------------------------HP----GFTNNYFITT..G...............
H3CTB8_TETNG/485-730----------------------------------------------HR----GTNNLYQTKS..L...............
Q17L35_AEDAE/238-472----------------------------------------------HR----GTSNTYQTQS..S...............
G3PQF3_GASAC/493-744----------------------------------------------HP----GRTNSFLCNA..G...............
Q7Q8G2_ANOGA/621-858----------------------------------------------HR----GTNNSFQIKA..S...............
E9GSA7_DAPPU/245-472----------------------------------------------HT----GTTNSFHVMS..G...............
H2Y9W1_CIOSA/248-489----------------------------------------------HP----GLSNQYHCSN..S...............
H0X6I7_OTOGA/562-803----------------------------------------------HR----GTNNLYQMKS..Q...............
A7AR41_BABBO/497-730----------------------------------------------HP----GRNNAFFVRT..H...............
D8TZH6_VOLCA/22-283----------------------------------------------HK----GVNNDYLIRV..S...............
F2U4B8_SALR5/364-601----------------------------------------------HR----GTNNTFEKKY..S...............
F2TZN0_SALR5/451-687----------------------------------------------HN----GLTNAFHINS..R...............
PDE3_DICDI/212-445----------------------------------------------HP----ALSNRFQINM..K...............
A0EHP5_PARTE/664-893----------------------------------------------HT----GRTNGFEVAR..M...............
R4XC23_TAPDE/151-415----------------------------------------------HP----GVNNALLVAT..K...............
T1J3H1_STRMM/460-696----------------------------------------------HR----GTTSSFQVES..K...............
A8PF04_BRUMA/39-279----------------------------------------------HP----GFTNHYLINT..N...............
G3XS32_ASPNA/355-613----------------------------------------------HP----GVNNFFLVKL..N...............
F0YJF8_AURAN/57-300----------------------------------------------HP----GSSNAHEVKV..A...............
K0SZ48_THAOC/210-457----------------------------------------------HP----GTNNAFECNT..R...............
F6XN91_ORNAN/135-378----------------------------------------------HR----GTNNLYQMKS..A...............
H3A1Y1_LATCH/622-855----------------------------------------------HR----GTNNAFQAKS..G...............
A0CZ03_PARTE/433-669----------------------------------------------HP----GLTNAFLINS..K...............
B3RRH3_TRIAD/64-293----------------------------------------------HT----GTTNSFLVAS..G...............
D0NX90_PHYIT/873-1108----------------------------------------------HP----GNDNQFEVDS..S...............
B7QLS8_IXOSC/587-822----------------------------------------------HR----GTNNSFQIKS..S...............
K1Q9Q8_CRAGI/1379-1613----------------------------------------------HR----GTNNQYQVAS..K...............
B3RW84_TRIAD/250-489----------------------------------------------HP----GYNNAYQINA..K...............
F2UNV2_SALR5/160-397----------------------------------------------HP----GVNNAFLVKT..R...............
B3RXL9_TRIAD/261-492----------------------------------------------HR----GTNNAFQVKS..E...............
G3NKI6_GASAC/413-649----------------------------------------------HR----GTNNAFQAKT..G...............
E9FT33_DAPPU/300-536----------------------------------------------HR----GTTNSFQLAS..N...............
G3W7P6_SARHA/125-355----------------------------------------------RK----GKGKYLEVHT..K...............
U6HPK0_ECHMU/682-932----------------------------------------------HR----GTNNQFQIRT..M...............
A4VDP2_TETTS/828-1069----------------------------------------------HR----GKTNAFEVNT..M...............
A0E8K4_PARTE/474-706----------------------------------------------HP----GLNNGFMMSN..R...............
I7MEB2_TETTS/181-435----------------------------------------------HK----GVNNLYKVKR..K...............
T1J0B6_STRMM/178-405----------------------------------------------HP----GVNQPFLIAT..S...............
K7IPZ8_NASVI/211-437----------------------------------------------HT----GTTNNFHVMS..G...............
A0BWQ6_PARTE/357-590----------------------------------------------HP----GLNNIFLNNT..R...............
C1G9S6_PARBD/375-630----------------------------------------------HP----GVNNIFLVKL..S...............
T1JHX2_STRMM/149-384----------------------------------------------HR----GTNNSFQIKA..S...............
A2FKH2_TRIVA/811-1047----------------------------------------------HD----GFTNVYNVKA..E...............
E5SJ10_TRISP/256-483----------------------------------------------HT----GHTNNYHVQS..S...............
A8J0S4_CHLRE/4-240----------------------------------------------HP----GLTNDFLIAT..G...............
H3B4D9_LATCH/251-482----------------------------------------------HP----GYNNAFEPII..L...............
G0QN94_ICHMG/88-327----------------------------------------------HT----GRTNTFEVAI..Q...............
F0YF22_AURAN/6-233----------------------------------------------HP----GLSNTWQNNE..Q...............
G1N629_MELGA/537-772----------------------------------------------HR----GTNNLYQMNT..................
PDE6A_BOVIN/558-803----------------------------------------------HR----GTNNLYQMKS..Q...............
I7M0W2_TETTS/670-909----------------------------------------------HT----GRTNAFEVAT..L...............
B8BX07_THAPS/28-275----------------------------------------------HE----GKSNAYHVNS..K...............
Q4D9B7_TRYCC/425-657----------------------------------------------HP----GLNNNFHTKT..N...............
L9KNU5_TUPCH/284-521----------------------------------------------HP----GRTNSFLCNS..G...............
B7Q413_IXOSC/244-479----------------------------------------------HR----GTNNSFQLTS..K...............
A0A023B5L4_GRENI/875-1106----------------------------------------------HS----GRNNLFYIQG..D...............
G7YHN2_CLOSI/450-692----------------------------------------------HP----AVTNQYLINT..N...............
W4Y0R5_STRPU/42-276----------------------------------------------HP----GVNQKYLINS..K...............
E9GTK1_DAPPU/140-372----------------------------------------------HP----GKTSGFLCNS..G...............
C3Y3W7_BRAFL/483-718----------------------------------------------HR----GTNNAFQSKI..E...............
G0QM75_ICHMG/438-673----------------------------------------------HP----GYNNVFLINT..N...............
A9VBQ1_MONBE/959-1201----------------------------------------------HF----GFNNTFLAAT..S...............
G4VM44_SCHMA/758-999----------------------------------------------HP----GVTNQYLINT..N...............
Q38F42_TRYB2/668-906----------------------------------------------HM----GLNNSFYLKT..E...............
H2YGD4_CIOSA/110-343----------------------------------------------HP----GLSNLYHQKA..H...............
H0WWX2_OTOGA/185-414----------------------------------------------HP----GVNQPFLIKT..N...............
A2F4K8_TRIVA/824-1056----------------------------------------------HD----GTTDIYNEHA..N...............
G0QL69_ICHMG/309-544----------------------------------------------HP----GFNNLYQINM..K...............
G3UQY0_MELGA/561-809----------------------------------------------HR----GTNNLYQMKS..A...............
A2DBZ3_TRIVA/890-1109----------------------------------------------HD----GTNTLFLNQT..S...............
G1KNF9_ANOCA/182-411----------------------------------------------HP----GTTNHFHVAT..R...............
Q57V52_TRYB2/430-668----------------------------------------------HP----GLNNNFHTRT..N...............
H9GNX4_ANOCA/147-379----------------------------------------------HP----GVNQPFLINT..K...............
A7RQM4_NEMVE/269-513----------------------------------------------HP----GVNNHFLVAT..N...............
A0CDZ4_PARTE/797-1028----------------------------------------------HT----GRTNQFEINS..K...............
F9WY25_MYCGM/19-262----------------------------------------------HP----GVNNAFLVAS..N...............
F4P4T4_BATDJ/201-438----------------------------------------------HR----GTNNMFQKQA..H...............
T1G0C4_HELRO/267-508----------------------------------------------HP----GVTNQYLINT..G...............
H3A4S4_LATCH/186-412----------------------------------------------HT----GTTNSFHIQT..K...............
I6NCN3_ERECY/237-472----------------------------------------------HP----GTNNGLLCNF..K...............
E7F690_DANRE/664-899----------------------------------------------HR----GVNNSYIQRS..N...............
H9JP37_BOMMO/450-678----------------------------------------------HP----GYNNNFLMLC..K...............
K4E297_TRYCR/367-596----------------------------------------------HP----GRTNAFLAAV..Q...............
G6D0G3_DANPL/510-749----------------------------------------------HP----GYNNNFLSLC..K...............
G3X2A9_SARHA/458-685----------------------------------------------HR----GFSNSYLQKF..D...............
F6UGJ6_HORSE/648-882----------------------------------------------HR----GTNNSFQVAS..K...............
E9C7I3_CAPO3/34-276----------------------------------------------HP----GLTNDFLVKT..R...............
D2UZF3_NAEGR/172-403----------------------------------------------HP----GTTNQFQILS..S...............
A2E0E8_TRIVA/899-1134----------------------------------------------HD----GFSNSYNLKA..Q...............
G0QTW0_ICHMG/347-581----------------------------------------------HQ----GYNNVFLINT..S...............
T1ID25_RHOPR/266-496----------------------------------------------HR----GKNNKFMLET..E...............
K0TNY7_THAOC/1104-1338----------------------------------------------HP----GLNNNYQVNS..R...............
E9H1H3_DAPPU/584-819----------------------------------------------HR----GTNNSFQIQT..K...............
A2FET3_TRIVA/891-1121----------------------------------------------HD----GTSNEYHIKA..K...............
A2ENJ2_TRIVA/832-1067----------------------------------------------HD----GFTNVYNVKA..E...............
K1Q862_CRAGI/623-859----------------------------------------------HR----GTNNAFQQKT..S...............
T1KF46_TETUR/201-442----------------------------------------------HP----GVTNQYLINT..S...............
I1C756_RHIO9/55-278----------------------------------------------HP----GFNNDFQTKT..K...............
L5LYV0_MYODS/378-630----------------------------------------------HP----GRTNLFLCNA..G...............
G0R0C4_ICHMG/193-446----------------------------------------------HP----GFTNLYQINT..R...............
I1FCX2_AMPQE/486-721----------------------------------------------HR----GTNNAFQESS..N...............
I3MB41_SPETR/221-447----------------------------------------------HT----GTTNSFHIQT..K...............
F0VH18_NEOCL/757-991----------------------------------------------HP----GVSNTFLVKS..R...............
B6H979_PENCW/364-622----------------------------------------------HP----GVNNFFLVKL..N...............
A8XFQ4_CAEBR/454-686----------------------------------------------HR----GKNNAYMKSM..E...............
M4AGW4_XIPMA/350-586----------------------------------------------HR----GVSNSYIERS..Q...............
I7MF95_TETTS/428-661----------------------------------------------HP----GFNNPFQMNA..K...............
Q7RNG1_PLAYO/216-445----------------------------------------------HF----GRTNMFLKNC..S...............
A2FBN7_TRIVA/832-1064----------------------------------------------HS----GFNNIYNVKA..E...............
U4LEJ5_PYROM/325-578----------------------------------------------HP----GVNNAFLVTL..K...............
Q4E0Y6_TRYCC/668-905----------------------------------------------HM----GLNNSFYLKT..D...............
G7Y3Q5_CLOSI/247-479----------------------------------------------HR----GYDNRFMKKY..S...............
A7S9Q1_NEMVE/571-806----------------------------------------------HR----GTNNSFQIKS..A...............
J9JP99_ACYPI/205-438----------------------------------------------HP----GVNQPFLIAT..S...............
B5YN05_THAPS/24-269----------------------------------------------HP----GTNNLYQVHA..L...............
F0XZ44_AURAN/6-240----------------------------------------------HP----GLSNTYQNNE..N...............
G4VD32_SCHMA/194-450----------------------------------------------HP----GKTNPFLVNS..N...............
U6IBZ4_HYMMI/336-560----------------------------------------------HT----GTTNNFHIQT..Q...............
G3NZM0_GASAC/269-495----------------------------------------------HT----GTTNNFHIHA..R...............
A0C8Q0_PARTE/698-935----------------------------------------------HT----GKTNAYEANS..L...............
A2E5S0_TRIVA/1039-1262----------------------------------------------YT----SVDDSNQSTE..................
H3HCQ7_PHYRM/257-492----------------------------------------------HT----SYSNNFHITI..N...............
G6DIL5_DANPL/640-871----------------------------------------------HR----GYTNKYLNEI..A...............
X6MLN0_RETFI/437-724----------------------------------------------HP----GNDNLYEINV..E...............
A2G2M9_TRIVA/856-1091----------------------------------------------HQ----GLNNAFNVNA..E...............
B8MH55_TALSN/358-616----------------------------------------------HP----GVNNVFLVKL..N...............
F2U3P6_SALR5/586-820----------------------------------------------HR----GTNNAFQKTA..N...............
H2KQX0_CLOSI/666-901----------------------------------------------HR----GTNNTFQLQS..K...............
A2F9J4_TRIVA/865-1099----------------------------------------------HH----GLNNAFHKKA..R...............
A8QAS5_BRUMA/427-656----------------------------------------------HR----GKNNAYMKSM..S...............
H9JH54_BOMMO/108-347----------------------------------------------HR----GTNNSFQIKA..S...............
E9FX16_DAPPU/491-726----------------------------------------------HR----GTNNAFQSKV..M...............
V8PBU9_OPHHA/202-428----------------------------------------------HP----GYNNTYQINA..R...............
G7YD67_CLOSI/310-534----------------------------------------------HT----GTTNNFHIST..A...............
K7JB77_NASVI/291-525----------------------------------------------HP----GVNQPFLVAT..S...............
A0CDV7_PARTE/494-726----------------------------------------------HP----GLNNGFMTAN..R...............
A2D762_TRIVA/830-1065----------------------------------------------HE----GLNNIYNVKA..E...............
K7JCC9_NASVI/433-669----------------------------------------------HR----GTNNSFQTKC..G...............
A2FZL3_TRIVA/843-1079----------------------------------------------HE----GYNNNYNINA..Q...............
Q5CIN1_CRYHO/124-384----------------------------------------------HP----GLTNDMIKEL..NIVSRKVLQEFTTEEQ
A2DV74_TRIVA/897-1132----------------------------------------------HD----GFSNTYNINA..Q...............
G4M0K8_SCHMA/183-425----------------------------------------------HP----GLTNQYLINT..N...............
G7YCW0_CLOSI/404-645----------------------------------------------HP----GLTNQFLINT..N...............
G0QNS6_ICHMG/258-503----------------------------------------------HT----ARTNVFEVNS..M...............
C5LYC9_PERM5/76-308----------------------------------------------HS----GKNNGFYVET..G...............
Q5CHC0_CRYHO/724-964----------------------------------------------HI----GRTSNFLVNS..R...............
G7Y525_CLOSI/169-406----------------------------------------------HP----GVNQMYLERT..E...............
F4P9V8_BATDJ/55-290----------------------------------------------HP----GVNNAFLMAT..S...............
A0D3N1_PARTE/161-414----------------------------------------------HK----GVNNLYKVKK..S...............
G3H1T4_CRIGR/86-313----------------------------------------------HR----GTNNAFQAKS..D...............
W5L340_ASTMX/213-441----------------------------------------------HP----GVNQPFLIKT..N...............
B6AJ92_CRYMR/946-1223----------------------------------------------HP----GVNNEFLHKL..Q.......DKFISENY
I1FF72_AMPQE/584-825----------------------------------------------HP----GTTNQFLINS..N...............
U6HDD1_ECHMU/294-535----------------------------------------------HP----GVTNQYLINT..N...............
F0Y3P3_AURAN/5-236----------------------------------------------HP----GLTNAFLVET..Q...............
A2EA57_TRIVA/862-1082----------------------------------------------HN----GYNDEYHKNN..K...............
I3IVG8_ORENI/238-473----------------------------------------------HP----GVNQPFLIKT..R...............
A2EY05_TRIVA/672-907----------------------------------------------HQ----GFNNAYNINV..K...............
K3W5J5_PYTUL/499-740----------------------------------------------HP----GKSNNYLIKA..K...............
I3KLG1_ORENI/165-393----------------------------------------------HP----GFNNMYQINA..R...............
H9K9C1_APIME/440-676----------------------------------------------HR----GTNNMFQMIS..S...............
U6ILW1_HYMMI/656-907----------------------------------------------HR----GTNNQFQIQT..M...............
E5S1Y7_TRISP/469-710----------------------------------------------HP----GLTNQFLVNS..G...............
E2B075_CAMFO/438-674----------------------------------------------HR----GTNNSFQTLC..G...............
T1JTY5_TETUR/534-761----------------------------------------------HT----GTTNNFHVMS..E...............
G0R5R3_ICHMG/354-593----------------------------------------------HT----GHTNTFEIAT..Q...............
C9SP75_VERA1/352-608----------------------------------------------HP----GVNNGFLVTL..N...............
A7S0H3_NEMVE/17-252----------------------------------------------HR----GTNNAFQTKT..D...............
I3J4D3_ORENI/620-856----------------------------------------------HR----GTNNAFQAKT..G...............
B3RPK8_TRIAD/484-719----------------------------------------------HR----GTNNAYQIKS..G...............
A0D0P6_PARTE/709-947----------------------------------------------HT----GRTNTFEINS..L...............
H2TUF6_TAKRU/91-321----------------------------------------------HP----GYNNIYQINA..K...............
S2JNF3_MUCC1/101-338----------------------------------------------HP----GITTA.......................
H9IXR0_BOMMO/575-809----------------------------------------------HR----GYTNKYMSET..A...............
T1K846_TETUR/97-334----------------------------------------------HR----GTNNSFQIKS..S...............
E9BZV2_CAPO3/556-788----------------------------------------------HP----GFTNAFLVNT..Q...............
W4XSF6_STRPU/406-647----------------------------------------------HP----GLNNQFLCTT..S...............
C5LW71_PERM5/59-291----------------------------------------------HN----GVNNDYYVKK..V...............
F1Q4S3_DANRE/251-478----------------------------------------------HP----GYNNTYQINA..R...............
A2DG30_TRIVA/778-1007----------------------------------------------HD----GFTNDYNVKA..E...............
U1LY64_ASCSU/200-424----------------------------------------------HT----GHTNNFHIQS..G...............
Q22CV4_TETTS/972-1213----------------------------------------------HT----GRTNNFEISV..Q...............
M4AEC3_XIPMA/46-276----------------------------------------------HT----GYNNAYQINA..R...............
W5MCE7_LEPOC/202-428----------------------------------------------HT----GTTNNFHIRT..R...............
E1FRJ3_LOALO/357-588----------------------------------------------HR----GTTNAFQVQS..R...............
B4R3X9_DROSI/617-847----------------------------------------------HP----GLTNQFLVNS..S...............
D8TP55_VOLCA/67-324----------------------------------------------HK----GLNNDFLVRV..G...............
PDE8A_MOUSE/550-801----------------------------------------------HP----GRTNSFLCNA..G...............
F0YCZ9_AURAN/8-254----------------------------------------------HP----GLNNGFHVNC..G...............
A2EIP4_TRIVA/1084-1320----------------------------------------------HD----GFTNAFNEKA..E...............
K1PID2_CRAGI/187-413----------------------------------------------HT----GTTNNFHIQT..G...............
T1EIY3_HELRO/187-428----------------------------------------------HP----GLTNNHLINT..N...............
U6I2M0_HYMMI/497-738----------------------------------------------HP----GLTNQFLVNT..G...............
A2E8N2_TRIVA/822-1057----------------------------------------------HN----GFNNQYNEKA..Q...............
G0QLG1_ICHMG/322-557----------------------------------------------HP----GQNNTFLINS..L...............
F4PDL8_BATDJ/236-451----------------------------------------------HP----GFNNAYQVNA..C...............
G3NNN6_GASAC/516-748----------------------------------------------HR----GYSNSYLQKF..D...............
G0QX25_ICHMG/75-311----------------------------------------------HP----GFSNIYLKNT..K...............
I7M6Z2_TETTS/95-332----------------------------------------------HT----GHSNAYETNS..K...............
K3WGS8_PYTUL/507-737----------------------------------------------HP----GNNNDFEVKS..V...............
Q01CI7_OSTTA/263-505----------------------------------------------HP----GLNNAYLVAR..Q...............
D8TVU3_VOLCA/73-301----------------------------------------------HP----GLTNDFLVAT..S...............
E4V020_ARTGP/368-626----------------------------------------------HP----GVNNMFLVKL..N...............
C1E004_MICSR/344-598----------------------------------------------HP----GLNNAHLVNT..E...............
T1IWR2_STRMM/725-967----------------------------------------------HP----GKNSAFLCNS..N...............
E9IWT3_SOLIN/637-872----------------------------------------------HR----GTNNAFQMKT..E...............
H0XDY2_OTOGA/233-455----------------------------------------------HP----GYNNTYQINA..R...............
F9WTZ7_TRYVY/241-479----------------------------------------------HM----GLNNSFYLKT..E...............
Q16J23_AEDAE/167-399----------------------------------------------HP----GVNQPFLIAT..S...............
C0NC75_AJECG/367-624----------------------------------------------HP----GVNNVFLVRL..N...............
T1IN43_STRMM/372-598----------------------------------------------HT----GTTNNFHVNS..G...............
B3RT43_TRIAD/444-691----------------------------------------------HP----GVTSAFLCNS..H...............
T1G4C8_HELRO/177-404----------------------------------------------HT----GTTNNYHINT..A...............
I1FSR8_AMPQE/302-535----------------------------------------------HP----GVNHNYLVNS..G...............
A4RUJ3_OSTLU/354-596----------------------------------------------HP----GVNNTFLVNC..K...............
Q5CXM2_CRYPI/1551-1826----------------------------------------------HP----GVNNCFLTIS..N...............
T1G2T5_HELRO/253-496----------------------------------------------HP----GVTNQYLINT..N...............
B8C496_THAPS/64-313----------------------------------------------HP----GLNNNFQVNS..R...............
C3Z0J8_BRAFL/157-377----------------------------------------------HT----GETNSFHVMS..K...............
G7Y619_CLOSI/692-940----------------------------------------------HR----GTDNQFQVKT..M...............
H2YVD4_CIOSA/588-824----------------------------------------------HR----GTNNAFQAKI..E...............
E0VPK2_PEDHC/654-888----------------------------------------------HR----GTNNSFQQKT..G...............
I7MHG9_TETTS/819-1072----------------------------------------------HT----ARTNLFEVNS..M...............
A0DRT9_PARTE/368-610----------------------------------------------HT----GRNNHFESQK..L...............
A9UVX6_MONBE/192-425----------------------------------------------HP----GVNNAFLIKT..R...............
B3RPP8_TRIAD/504-735----------------------------------------------HR----GRNNAFMVNS..S...............
T1JG26_STRMM/622-856----------------------------------------------HR----GKNNAFQEKT..G...............
G7Y2X2_CLOSI/386-622----------------------------------------------HR----GLNNSFQQLT..N...............
S2JJA8_MUCC1/205-462----------------------------------------------HP----GVNNAFLINT..S...............
A0BZK9_PARTE/736-969----------------------------------------------HT----GKTNVFEINS..L...............
W4XPS9_STRPU/508-740----------------------------------------------HR----GLTNSFHAKF..G...............
T1G9G6_HELRO/40-271----------------------------------------------HT----GFNNTFHINA..Q...............
F6YN13_CIOIN/497-735----------------------------------------------HP----GRTNNFLVNS..S...............
S2JM15_MUCC1/91-344----------------------------------------------HP----GVNNMFLINS..S...............
T1EEC2_HELRO/179-455----------------------------------------------HP----GVTNQYLVNS..E...............
G3W5Y3_SARHA/633-868----------------------------------------------HR----GVNNSYIQRS..E...............
H2N2Q2_ORYLA/19-254----------------------------------------------HR----GVNNSYIQRS..E...............
A2DJF3_TRIVA/756-991----------------------------------------------HD----GFTNVYNEKA..E...............
T1FZK3_HELRO/143-369----------------------------------------------HT----GTTNAFQVNT..K...............
F0YND2_AURAN/33-267----------------------------------------------HP----GLSNTFQCKA..R...............
B3S4Q2_TRIAD/437-672----------------------------------------------HR----GTNNAFQLKT..Q...............
A7SC93_NEMVE/229-460----------------------------------------------HR----GTNNAFQVSS..N...............
Q4Y3R0_PLACH/81-319----------------------------------------------HP----GLNNFFLIKS..E...............
D0MQY9_PHYIT/829-1076----------------------------------------------HP----GNTNDFEVKT..H...............
W5JX79_ANODA/192-452----------------------------------------------HP----GLTNQFLINS..S...............
E0W1Y2_PEDHC/164-397----------------------------------------------HP----GVNQPFLIAT..S...............
E9GD11_DAPPU/572-804----------------------------------------------HR----GKNNKFMLDT..A...............
B8CDS3_THAPS/83-323----------------------------------------------HP----GTNNNYQINK..Q...............
B6KFK7_TOXGO/863-1092----------------------------------------------HQ----GKNNAFYVAS..R...............
G0NVA1_CAEBE/450-686----------------------------------------------HP----GRGNAYLINT..R...............
G0QL72_ICHMG/166-409----------------------------------------------HT----GRTNNFEVLI..Q...............
C4JVT9_UNCRE/362-620----------------------------------------------HP----GVNNVFLVKL..N...............
C3YZV4_BRAFL/424-658----------------------------------------------HR----GTNNAFQVSS..K...............
I1BY86_RHIO9/30-312----------------------------------------------HP----GKNNHFEISC..R...............
W5KJ99_ASTMX/620-849----------------------------------------------YS----SGKN........K...............
A7SW30_NEMVE/369-596----------------------------------------------HR----GKNNAFMLHC..K...............
F4PP12_DICFS/106-337----------------------------------------------HP----GLTNRFQINS..K...............
V4ZBC8_TOXGO/684-919----------------------------------------------HP----GRNNNFFVAS..G...............
H2WG47_CAEJA/281-522----------------------------------------------HP----GFTNQYLINS..N...............
U9UJM3_RHIID/88-393----------------------------------------------HP----GLNNVYQVNA..R...............
A2E8W5_TRIVA/810-1039----------------------------------------------HD----GFNNVYNEKS..E...............
H0V2T6_CAVPO/559-804----------------------------------------------HR----GTNNLYQMKS..T...............
A4H9L9_LEIBR/384-615----------------------------------------------HP----GTNNNFHVKT..G...............
X6N5T0_RETFI/264-501----------------------------------------------HP----GTTQEFHIKT..S...............
T1JI29_STRMM/203-435----------------------------------------------HP----GLTNSYQVNA..R...............
A4RV03_OSTLU/70-313----------------------------------------------HP----GVTNGYLIAT..H...............
K1QIC6_CRAGI/569-804----------------------------------------------HR----GTNNAFQVKV..A...............
T1HBJ9_RHOPR/64-297----------------------------------------------HR----GTNNAYQQKA..G...............
G7Y655_CLOSI/526-809----------------------------------------------HP----GRTNPFLVNS..N...............
A5JZK3_PLAVS/500-735----------------------------------------------HF----GRTNLFLKNS..S...............
F0ZGW8_DICPU/600-832----------------------------------------------HP----GVNNHFQINS..K...............
A4HWN7_LEIIN/680-918----------------------------------------------HM----GVNNSFYLKT..D...............
I7M9B7_TETTS/309-544----------------------------------------------HP----GVNNAFIINT..S...............
D7EJS6_TRICA/294-520----------------------------------------------HP----GYNNIYQINA..K...............
D2W310_NAEGR/443-678----------------------------------------------HP----GVNNNYLINI..K...............
I1CN45_RHIO9/145-393----------------------------------------------HP----GVNNMFLVNA..S...............
J9JUC9_ACYPI/671-903----------------------------------------------HR----GTNNSFQEKA..R...............
D8TN75_VOLCA/173-409----------------------------------------------HL----GVNNDFLINS..R...............
A0BY96_PARTE/723-962----------------------------------------------HT----GRTNTFEINS..L...............
A7SVX8_NEMVE/580-827----------------------------------------------HP----GYTNSFLCNA..G...............
S2JSI2_MUCC1/64-347----------------------------------------------HT----GYNNDYHVKL..K...............
B0WPM1_CULQU/529-761----------------------------------------------HR----GKNNKFMLDT..E...............
F2TXI1_SALR5/447-690----------------------------------------------HP----GYTNSFLMKT..G...............
A2FQ29_TRIVA/905-1135----------------------------------------------HD----GFSNSYNEKA..Q...............
W4XPC7_STRPU/865-1088----------------------------------------------HR----GTNNAYQEKS..Q...............
B3S1R3_TRIAD/64-305----------------------------------------------HP----GLNNQFLIQT..M...............
F6X0V1_MOUSE/186-412----------------------------------------------HT----GTTNNFHIQT..R...............
M2UPY5_COCH5/359-618----------------------------------------------HP----GVNNAFLVAL..N...............
F0ZDL5_DICPU/435-669----------------------------------------------HP----GFNNTFQVNA..Q...............
T1G1B3_HELRO/66-293----------------------------------------------HT----GTTNSYHVNT..E...............
K3W5A7_PYTUL/578-816----------------------------------------------HP----GKTNNFMVKS..G...............
D2V582_NAEGR/457-695----------------------------------------------HP----GLNNNFQMNS..H...............
J9JUG8_ACYPI/874-1109----------------------------------------------HR----GTNNSFQIKV..S...............
X6N2F3_RETFI/447-691----------------------------------------------HP----GTNQDFHNKT..E...............
PDE2_CAEEL/421-657----------------------------------------------HR----GTTNSFQMQSLQK...............
C3Z5T1_BRAFL/93-328----------------------------------------------HR----GTNNSFQMKS..N...............
A2DCH1_TRIVA/873-1097----------------------------------------------HD----GFVN........................
V8PIT4_OPHHA/336-577----------------------------------------------HP----GVSNQFLINT..N...............
G4VIQ4_SCHMA/572-807----------------------------------------------HR----GTNNSFQVQS..K...............
F0VID9_NEOCL/1105-1345----------------------------------------------HP----GTNNLFVNRN..N...............
G1QFQ3_MYOLU/566-820----------------------------------------------HP----GRTNLFLCDA..G...............
F1SIK3_PIG/193-420----------------------------------------------HT----GTTNNFHIQT..R...............
B9Q8H3_TOXGO/59-299----------------------------------------------HP----GANNLFMTRF..D...............
E4XVC9_OIKDI/280-532----------------------------------------------HP----GRTNAFLCNS..R...............

PF12917

F4BLQ7_CARS1/1-213----------------------------------------------EL----FIGDIKTPVKYAT---------------
Q8Y4F3_LISMO/1-213----------------------------------------------EL----FIGDIKTPVKYAT---------------

PF13023

Q4X103_ASPFU/38-201----------------------------------------------ES----IVGDITPVD....---------------
C4XNQ3_DESMR/208-394----------------------------------------------EL----LTRDIISPVKQ.S---------------
Q0RHP9_FRAAA/26-188----------------------------------------------EV----YAGDTFLYD....---------------
D1B724_THEAS/195-373----------------------------------------------EA----LTRDVISPLKR.E---------------
A5FA91_FLAJ1/42-204----------------------------------------------EI----DAGDVFIYD....---------------
D3UJA3_HELM1/196-376----------------------------------------------EI----LTRDIISPIKQ.S---------------
B2WMG2_PYRTR/50-213----------------------------------------------ES----LVGDITPVD....---------------
A1B6A0_PARDP/14-168----------------------------------------------EI----DCGDHPIHL....---------------
B8DPL6_DESVM/204-399----------------------------------------------EV----LTRDIISPVKR.S---------------
D3V8Z8_XENNA/23-184----------------------------------------------EI----DAGDVIAFD....---------------
D3PCV5_DEFDS/21-178----------------------------------------------ET----RTGDL........---------------
D2QII1_SPILD/16-178----------------------------------------------EI----DAGDTFIYD....---------------
D4KY93_9FIRM/14-176----------------------------------------------EI----DAGDTYAYD....---------------
Q4PHJ8_USTMA/1464-1623----------------------------------------------EA----EVGDLTPLD....---------------
D2V2T7_NAEGR/17-193----------------------------------------------EA----IAGDITPHA....---------------
D4LY09_9FIRM/15-177----------------------------------------------EI----DAGDTYAYD....---------------
A8AWX8_STRGC/15-177----------------------------------------------EI----YAGDTFIFD....---------------
Q0U692_PHANO/57-221----------------------------------------------EA----LVGDITPVD....---------------
C4JFR9_UNCRE/38-203----------------------------------------------ES----VVGDITPVD....---------------
Q30Y45_DESAG/203-388----------------------------------------------EL----LTRDIISPVKK.S---------------
B6HH14_PENCW/35-198----------------------------------------------EA----LVGDITPVD....---------------
C7YYC0_NECH7/65-229----------------------------------------------EL----LVGDITPVD....---------------
Q2NRF1_SODGM/23-185----------------------------------------------EI----DAGDVLVYD....---------------
B8IZP1_DESDA/203-392----------------------------------------------EV----LTRDIISPVKR.S---------------
C4LZN2_ENTHI/11-165----------------------------------------------EA----LIGDITPND....---------------
Q2H1W3_CHAGB/59-223----------------------------------------------ES----IVGDITPVD....---------------
Q1MS33_LAWIP/31-190----------------------------------------------EA----VCGDIPAIA....---------------
C6VYP4_DYAFD/17-182----------------------------------------------EA----EAGDVPVTEMM.R---------------
B2IX53_NOSP7/16-178----------------------------------------------EI----DAGDTFCYD....---------------
B9E9R1_MACCJ/24-185----------------------------------------------EI----YAGDTWVFD....---------------
Q1MQW5_LAWIP/210-402----------------------------------------------EL----LTRDIITPVKR.S---------------
A1B6A0_PARDP/194-361----------------------------------------------EI----DTGDVPIHAQN.G---------------
C5GNI9_AJEDR/38-202----------------------------------------------ES----IVGDITPAD....---------------
Q6CED3_YARLI/61-223----------------------------------------------EA----IVGDITPFD....---------------
Q5LRU6_RUEPO/205-368----------------------------------------------EI----DAGDNPIHG....---------------
B8M402_TALSN/38-202----------------------------------------------ES----LVGDITPVD....---------------
D3RWY1_FERPA/11-164----------------------------------------------ET----RTLDLHK......---------------
B1ZVD2_OPITP/30-194----------------------------------------------EI----DAGDTFAYD....---------------
A0RU59_CENSY/9-173----------------------------------------------ET----VTSDITPEK....---------------
C1AC57_GEMAT/21-180----------------------------------------------EA----IGGDISAVQ....---------------
D7B965_NOCDD/27-189----------------------------------------------EI----DAGDTFLFD....---------------
C8V219_EMENI/39-202----------------------------------------------ES----LVGDITPND....---------------
HDDC2_BOVIN/25-182----------------------------------------------EC----IVGDIAPAD....---------------
A7HZD8_CAMHC/190-378----------------------------------------------ES----LTRDIISPVKY.G---------------
A7F8M1_SCLS1/48-212----------------------------------------------EA----LVGDITPVD....---------------
Q15QK7_PSEA6/14-178----------------------------------------------EI----DAGDLFAFA....---------------
Q5LRU6_RUEPO/15-178----------------------------------------------EI----ETGDHPIHE....---------------
B8CBS4_THAPS/17-179----------------------------------------------EA----KVGDITPHC....---------------
O25415_HELPY/203-385----------------------------------------------EI----LTRDIITPIKQ.S---------------
E6VWX3_DESAO/205-393----------------------------------------------EL----LTRDIISPVKS.S---------------
Q5ZYU3_LEGPH/18-179----------------------------------------------EI----YAGDVLAFD....---------------
A4FQR8_SACEN/31-193----------------------------------------------EI----YAGDTPLYD....---------------
Q16R43_AEDAE/33-190----------------------------------------------ES----IVGDITPYC....---------------
Q7N1B9_PHOLL/23-184----------------------------------------------EI----DAGDVMVYD....---------------
Q1GH96_RUEST/205-371----------------------------------------------EI----DAGDVPIHSN...---------------
B3SA48_TRIAD/14-165----------------------------------------------ES----IVGDITPFD....---------------
C8X0T1_DESRD/204-389----------------------------------------------EL----LTRDIISPVKR.S---------------
Q2SKN3_HAHCH/16-175----------------------------------------------EA----ISGDIPATE....---------------
D4JG23_9FIRM/15-177----------------------------------------------EI----DAGDTYAYD....---------------
D4LER9_RUMC1/15-177----------------------------------------------EI----DAGDTYAYD....---------------
Q3A7Q9_PELCD/11-169----------------------------------------------EA----RLGDL........---------------
A8GIQ6_SERP5/23-185----------------------------------------------EI----DAGDVLVYD....---------------
B2VFS5_ERWT9/24-185----------------------------------------------EI----DAGDVMVYD....---------------
B4EFY1_BURCJ/16-171----------------------------------------------EA----LHGDIPAIE....---------------
B4F0N6_PROMH/23-183----------------------------------------------EI----DAGDVMVYD....---------------
B7VP19_VIBSL/14-176----------------------------------------------EI----DAGDTIIYA....---------------
C5AY39_METEA/21-183----------------------------------------------EV----DAGDVPIHG....---------------
C9A5T3_ENTCA/14-179----------------------------------------------EI----EAGDTYCYD....---------------
E0SLP7_DICD3/23-185----------------------------------------------EI----DAGDVLVYD....---------------
G4Q3V2_ACIIR/202-379----------------------------------------------EV----LTRDIISPIKRSI---------------
Q0PCB0_CAMJE/191-378----------------------------------------------ES----LTRDIISPVKYGI---------------
Q24VU9_DESHY/19-181----------------------------------------------EI----YAGDTYCYD....---------------
Q2VZ21_MAGSA/19-173----------------------------------------------EI----DAGDTFIHD....---------------
Q6LQV5_PHOPR/14-176----------------------------------------------EI----DAGDTIIYA....---------------
Q81SJ1_BACAN/12-170----------------------------------------------EA----EAGDIPAFD....---------------
Q87NK1_VIBPA/15-176----------------------------------------------EI----DAGDTFVYD....---------------
Q9I2L9_PSEAE/16-171----------------------------------------------EA----IHGDIPAVE....---------------
R5C105_9FIRM/14-176----------------------------------------------EI----DAGDTYAYD....---------------
R5KLA6_9CLOT/15-176----------------------------------------------EI----DAGDTYAYD....---------------
R5QTI2_9FIRM/29-188----------------------------------------------EI----DA<