Sequence alignment for CL0242

PF03041

Q91F12_GVCPM/6-164ETYHP........RRA...IDPTKLYKVDMFLRHWVNVNGNTAFLPGGRYFLVVGRCLLNLVEKSKSFEE..HTKVEENA
Q773J1_NPVR1/7-171NVWSPLISASCLDKKATYLIDP......DDFIDK.LTLTPYTVFYNGGGLIKISGLRLYMLLTAPPTINEIKNSNFKKRS

PF04104

Q6BXE4_DEBHA/218-500NFIKL-----PFDKVP.NLVA..SR........SVLLK.SGYAYIPSTLQLNLLSIEFQDILTR..NLMR--TFQTLP..
Q7Q5K2_ANOGA/192-455DFYAV-----HFTEVL.NLVR..DR........KCFLK.AGVAYITPEHFAHVIGKKHQQLIED..GLKG--HLRLLP..
Q4DEH8_TRYCC/235-525DYFSV-----PMTLAT.RLIK..TR........SVLCL.KGHAILHRDQAQEVFVTVFRSKLNK..GLHE--AYLARM..
Q2URN0_ASPOR/198-484SWYKV-----DWERVP.ELVE..RR........SVFLY.RGKAYVPGREQLSMIIAEFTARLER..SLEL--TSRALP..
PRIL_METJA/142-388LPNKI-----SVWEFI.KIASRSRINDL..HLERLDLE.NGFVDITKIK.EIFAKEIIRVELMK..LGEN--IKKRKL..
PRIL_ARCFU/173-363KGWKM-----HVSTFV.RVSARIKDDKW..RLVNRKLR.NGWVETTKAEVLRGLEELLRMKLFE..KVPV--...SEAVS
Q69PX2_ORYSJ/177-443VFFKV-----PFEEVP.DLVA..SR........RVFLS.KGYAYVAMSQVVSLVVTQFRCNISK..ALVL--TNRKWT..
Q8SRV4_ENCCU/143-386SEVLV-----HFTKVI.DLIG..KR........AVVPE.GGYLRLNDEGIGSLLVSEFRRYLSN..RMDE--LVEISS..
PRIL_SULTO/138-301LKYSL-----NFIDFL.KYTRELRKIDNKFSLASHILK.DGKVYLTKEEIVRILVFQIRDKLMK..MVNV--SDVVIP..
PRIL_METKA/207-398EQDHA-----RRCS...NCRGRMRKPDP..NLLEMLKEPEGYLIMHFKTLARTFREDVRRLVVS..DIES--RDDVED..
E9ACF6_LEIMA/237-526NYYAV-----PLSLAT.RLIK..KR........YVLCR.AGQAILFRDQVQEVFLTVFCARLNR..GLHN--AYLARV..
Q6M1A7_METMP/114-360GDSKI-----NIWDFI.DVAANSRNNDL..HLERMILE.GDTVLLNQKNQSIYNFEKIRLKLKN..YVEK--VRNA....
Q4XXL6_PLACH/149-419KLFKV-----PFFPDAYFLVK..DH........KVCVE.KGIAYVPDTYLDAILITQFKINIQE..SFKY--LEQNEK..
Q4P7R1_USTMA/205-486TFFKV-----DWTRVT.DLVE..KR........RVFMR.AGQAWVPIKEQSSLVLAEFQSRLLR..DLEM--TARALP..
Q919P4_NPVCO/9-204PPYRL-----ALEQVC.APLDPSTR..........FVR.HGTIVAPISKAEALRYTRRAKVMEP..QVNF--TPNSTP..
Q6L0D5_PICTO/111-313NNYKM-----DFSFFV.SYNKRISGYKY..RLVYQSLD.HGYINLDIETFSNIMREYIVSRLLD..IYNS--IDKDQA.I
PRI2_SCHPO/186-453SFFKV-----PFFKVP.DLVE..RR........AVFVH.KGYAYVPFSEQVSLVVEEFEENLKK..ALES--TAKSLP..
Q5ZM06_CHICK/182-448MFYKV-----GLSDAV.DLFR..AR........RVFIK.DGFAFVPLKDIDAIVLNNYRKSLSK..ALAL--TARSLP..
A8B5U6_GIAIC/227-526TFYLT-----RREKFS.ACIELAAK........RVPCV.AGMFLLAAEDLISLLLIKFTA.IYK..ASQS--ICASVS..
Q6FLP8_CANGA/212-487KFIKL-----PFESVI.ELVG..NR........QVFLK.NGYAYLPQFQQLNLIANEFSTKLQE..ELIK--TYQYLP..
PRI2_YEAST/223-504KFIKL-----PFENVI.ELVG..NR........LVFLK.DGYAYLPQFQQLNLLSNEFASKLNQ..ELIK--TYQYLP..
PRIL_SULSO/136-302KEFCV-----HFIDYL.KYTKDLKEDW...KLSGQILH.KGYVYLDKNQLIGLIAESIKSKIVE......--........
PRIL_HALMA/135-332DGYRV-----EVGAYL.DLAADQRGDSW..RLVNRPLT.DGEVRVTAEELNVLLKQAIRHRVTD..GLPF--.TVPDAIA
Q4RQ99_TETNG/188-454DFYRV-----PFQDAL.DLVR..AR........KVYLK.AGYAYIPHQDIVTIVLNDFRTRLSK..ALAL--TARSLP..
PRI2_RAT/182-448SVYKV-----PFADAL.DLFR..GR........KVYLE.DGFAYVPLKDIVAIILNEFRATLSK..ALAL--TARSLP..
Q3ITU9_NATPD/139-334GRFSV-----AATAYL.ELAAGLDDPQW..RLATRPLS.AGTLPVSRPELYTLLREAVARRVAE..GLPL--.SVPDVIA
Q6CL91_KLULA/208-479KYYKL-----PMENVM.DLVG..SR........QIFIK.KGWAYVPQFQQLNLISNEFSDCLQT..ELMG--TYQMIP..
PRI2_CAEEL/201-472TFYKV-----DFIDAI.ELIR..RG........SVHLK.KGFAYFPFDDLVTILVTKMKNNMMA..AMAR--SFKHLA..
Q5A1D4_CANAL/229-511NFIKL-----PFEKITGNLIS..NR........SIFLF.KGYGYLPASLQLNLLSIEFINILND..NLIK--TFQTIP..
Q38BT5_TRYB2/235-528EYFLV-----PLSLAT.RLIK..AR........SVLCL.RGHAILHRDQVQEVFVTMFLSKLNK..GLHE--AYLARM..
Q5KAH0_CRYNJ/196-478TWFKV-----PWYTVP.DLVG..AR........RVLVK.GGLAFVPQSLQLSLVLQVFADRLEK..ALEF--TAKNLP..
Q4MZT6_THEPA/228-498SIFMV-----PFYPDANQLVR..MK........LVAIK.NSIAYVPPNSLFIVISTKFRNELQH..SMKY--LNENQS..
PRIL_HALSA/138-335DAHTV-----DVPTYL.LLASSLRDDDW..RLVNRALD.DGRVPVTDAELDTLIREAIRERVAD..GLPL--.SVPDQIA
PRI2_ARATH/172-438IYYKV-----PFEEVP.DLVA..SR........RVLLQ.KGFAFVAGTQLVSLVVTQFRSHLSK..ALIL--TNRKWT..
PRI2_DROME/194-456DFYKV-----PFTQVL.DLVR..GR........RCFLK.AGYAYVNTHDLVSLVGTKQQDEIEQ..GLQA--AKTMVE..
PRIL_THEAC/126-330HLYRI-----GVADFA.TYASRVTGSKY..RLSNQIVR.EGYVYVDEDVMAKVLREAFVSFMFD..TLDQ--IRKEDA.I
PRIL_METTH/183-419DEFIT-----SFQDSI........RDRSPDRLYDILV........GLEVRETMISRMIMQRTEE..YIGM--VREMSSTV
PRIL_PYRFU/131-367PEYIV-----SLREFL........DLVPDEKLSSYYVY.DGNVYLRKDDLLKVWSKAFERNVEK..AVNI--IYEIRD..
PRI2_DICDI/173-438HFYKL-----PFQDIP.KLID..TK........KAIII.KGEAYIYISNFKDMVIHTFKNYMNF..ALDR--IKADKT..
Q5CW71_CRYPI/234-522RLFKI-----PFWPDGFRFIK..NR........KYFIK.DGICFIPDTEIESLFIYKYKKELIN..SFIN--LKENEI..
PRIL_THEKO/146-383IKYKI-----PIKDLL.........NLWGSSLKEVYIR.NGYAYLRWETALKMWEKAFEKRFER..AVNI--LYEYRD..
Q6C2W5_YARLI/188-453DYVKV-----DWQKVA.DLVD..SR........RVFLR.AGKVYVPASLQQNLVVNEFESRLAV..AMET--AAMLLS..
Q8ZVK5_PYRAE/111-307TPVAI-----KWTSYL.RYAPPD..PFW..AMINRVVV.KGWVILPLDDFERILEEAYEEQILRIASENE--LAVGRVSA
Q75DH0_ASHGO/207-483RFLKL-----PFESVI.DLVG..PR........HVLLR.GGWAYLPQFMQLNHIAAEYAARLAT..DLRA--TYQHLP..

PF03041

Q91F12_GVCPM/6-164KKVKVCFEDCGGNREAIIAKFR----------------------------------------------KLFYSRPNAKTE
Q773J1_NPVR1/7-171KR.NICMKECAEGKKNVVDMLN----------------------------------------------SKINMPP.....

PF04104

Q6BXE4_DEBHA/218-500RL....EEDDR..LLPLLNNLS.HNFSNIQYES............AFGSDPSLISDINAQS..ITTPAINKHYPL-----
Q7Q5K2_ANOGA/192-455TL....EIDER..FAMLLKSIH.TSYTGKN..................YTVAKTGSVPVES..L.DQLSKKSFAL-----
Q4DEH8_TRYCC/235-525RLTSNEDDEERETVMRMLDAFL.EYFVSDPT...............SAIQEAASGAVSAGE..V.RRIAQTHFPL-----
Q2URN0_ASPOR/198-484RL....DEDDR..LTPILNHLS.KNFGSAESVY............SEGEGFVDGAPITAQN..I.DQLS.QHFPL-----
PRIL_METJA/142-388PDDSVVKELLNEISDYLKDKVK............................YEQISGIKALN..YKGNIPLEWHPP-----
PRIL_ARCFU/173-363EAVRELSRKAKRESEKFAMDLG............................................EVDLNCLPP-----
Q69PX2_ORYSJ/177-443ATIKE.QEKDR..LTPIVEALS.NAYFGPD.................YSQPKDAVEISLKD..I.DQLAKTSFPL-----
Q8SRV4_ENCCU/143-386N.....EPDER......MRVLS.TSLLANP..................TGYERGTNFSLES.......SERYFPP-----
PRIL_SULTO/138-301.......EQIRKLADELKGRKT...................................................PP-----
PRIL_METKA/207-398EELREFCLKLFPKVRKRLERVE............................................KGAGGRFPP-----
E9ACF6_LEIMA/237-526KQQALEEETAKSTVMAMLDAFL.QQFISDPV...............DTLQEGVAGSVRARD..V.QRLAQAHFPP-----
Q6M1A7_METMP/114-360EMPKEIKDLLVKKSEEAFEGIN..........................IGYNIESGIKVSTKEYSGEIPEDWHPP-----
Q4XXL6_PLACH/149-419LLLDV.QNDSR..ISSFLAALP.KAYVAKDFR..............QNYEHTEDTRLMPQN..L.YSIYKQSFPP-----
Q4P7R1_USTMA/205-486RL....DEDDR..LLPVLSHLS.MGFLAGISTD...........YTGSSITADGSTTVTAG..MVDALVKTHAPM-----
Q919P4_NPVCO/9-204QTGECLKLSYESKLCAMNEIIV..............................................AYQGLPP-----
Q6L0D5_PICTO/111-313KAMNNYINKIESMRREFKESIR......................................KYTPSGKIRWENFPP-----
PRI2_SCHPO/186-453RL....DEDDR..LLPILNHLS.KGFVAPES................SIVAPKSGAITAGQ..V.DSFV.SHFPL-----
Q5ZM06_CHICK/182-448SI....QSDER..LQPLLNHLS.HSYVGPD.................YSVQKNTGKISLEH..I.DALSVKSFPL-----
A8B5U6_GIAIC/227-526DI....RIPQFAELLEILRQTRIDSNSLEA.................KVQLDEDRKLSRKN..IDAAIRAGCIPP-----
Q6FLP8_CANGA/212-487RL....NEDDR..LIPILNHLS.SGYTIADSGS...........FDSQFGNNEDNEINAKS..VWSEEISKHYPL-----
PRI2_YEAST/223-504RL....NEDDR..LLPILNHLS.SGYTIADFNQQ..........KANQFSENVDDEINAQS..VWSEEISSNYPL-----
PRIL_SULSO/136-302MIRPLNLKEIPEKLKSLIERRG.................................................IIPP-----
PRIL_HALMA/135-332DELTAEVEQLEEVLSELELTRE..........................................IDTVVPELFPP-----
Q4RQ99_TETNG/188-454AV....HSDER..LQPLLTHLS.HAYVGQD.................YSVQKNVGRISLEQ..V.DSLSGKSFPL-----
PRI2_RAT/182-448AV....QSDER..LQPLLSHLS.HSYTGQD.................YSTQKSTGKISLDQ..I.DSLSTKSFPP-----
Q3ITU9_NATPD/139-334EPLDGELAAIRRQIEDLDPPTG..........................................FETVTPGLFPP-----
Q6CL91_KLULA/208-479KL....NEDDR..ILPILHHLS.SGYVVTESQ..............ELNGAGVNDEFTHRS..VKTKKVMEHFPL-----
PRI2_CAEEL/201-472IL....EEEGR..LLPRLSLLSNNAYSGKD.................YNGEQPDGSIIVTRHMI.DKLSRRSFAP-----
Q5A1D4_CANAL/229-511RL....EEDDR..LLPLLNNLS.KNFSNFQYES...........EINKLDEEFISDINSKS..IITPKITKHYPL-----
Q38BT5_TRYB2/235-528KLSSHEDHDERETVMKMLDAFL.EYFIEDTM...............NEVQEASAGAVGAGD..V.RHLAQTHFPL-----
Q5KAH0_CRYNJ/196-478RL....DEDER..LGPVIDHLA.SSFLSGIGASD..........YQPSDELGDGMTVTADT..I.DDVARKHFPP-----
Q4MZT6_THEPA/228-498MLDSVIVNDER..LCDFMRVLP.ESYLANDY...............SKITFTDDTRLTLSN..I.NQVYKFTFPP-----
PRIL_HALSA/138-335DALDEPVAAIQDALADLDLTRE..........................................IDTVVPELFPP-----
PRI2_ARATH/172-438TTIRE.REKDR..LTPIVEALS.TSYLGPD.................YSQSNEYADISLKD..I.DQVSKSSFPL-----
PRI2_DROME/194-456DV....EADER..ISRTLKALH.NSYTGRD..................YTVCRDAAVPIES..L.DQLSKTSMPL-----
PRIL_THEAC/126-330ETIKSVLDDLEKIRESYRKAHN......................................VRMIAGKGDASMFPP-----
PRIL_METTH/183-419EVHPLILETAERIRETVEEIMS................................FTGGPVKSARPGKLVQEAFPP-----
PRIL_PYRFU/131-367ELPEFYRRLAGEIRSFAEKEFS................................DKFREVQAGE...LKHHLFPP-----
PRI2_DICDI/173-438RI..K.EEFPE..LIQFFTTLP.KAGDGTN.................KPQLGNTKHIRKED..V.SPLSKTSFPM-----
Q5CW71_CRYPI/234-522ILEKTILSDQR..VSSLIREIS.EFYFTSNDFRGGGSLLSSPFNSLSENQAIENFKLDTSN..I.YQVYLSSFPL-----
PRIL_THEKO/146-383ELPEFYHRLREKLEEIAEEYFK.................................ERGEMFKGTASPLRFDLFPP-----
Q6C2W5_YARLI/188-453RL....DESTR..LMPILDHLA.QFGVTETF................QKNEALDGKIGPSN..I.DSVV.KHMPL-----
Q8ZVK5_PYRAE/111-307SIDMSLIEDLLRKYAQRPVNIT...........................................KLSTEGPDPP-----
Q75DH0_ASHGO/207-483AL....AGDDR..LPPILAHLS.AGHVVAP..................PPPPTGGGLTAAD..LAAEPVRAALPL-----

PF03041

Q91F12_GVCPM/6-164PSFNKLCVR...........PRRQRYACRLSFNFLVV------------------------------------KRLQCCR
Q773J1_NPVR1/7-171......CIKKILGDLKENNVPRGGMYRKRFILNCYIA------------------------------------NVVSCAK

PF04104

Q6BXE4_DEBHA/218-500------CASHLQKNL...ILNSHMKYQGRQQLGLFLK.......................GIGLNV......DEALKFWS
Q7Q5K2_ANOGA/192-455------CMRNVHDTL...RATHHLKHVGRMQYTLFLK.......................AIGVTM......EDALRFWR
Q4DEH8_TRYCC/235-525------CMRQVDEHL...RREGHLKHHGRFTYGLFLK.......................AIGLSL......QDSMTLFS
Q2URN0_ASPOR/198-484------CMRSLHMSL...RKNNHLKHYGRLQYTLFLK.......................GIGLSL......EECILFWR
PRIL_METJA/142-388------CIRGILNDI...LSGGSPSHYARRSFVVYWFCAKFNPNLRPLDKNGNLVNVSATDIASEEEIERFIDELIEMLF
PRIL_ARCFU/173-363------CMREILSEL...QRGMNIPHTARFAITSFLL.......................NIGMTV......DEIIALFK
Q69PX2_ORYSJ/177-443------CMRHMLEKL...RENHHLKHGGRMQFGLFLK.......................GAGLKL......EDALAFWR
Q8SRV4_ENCCU/143-386------CMQDIMERL...RKNKHLKYNDRQTLCLFLK.......................DCGMSV......EDGIAFFR
PRIL_SULTO/138-301------CILEL.......KRKKELNNTELGVLIAYYI.......................DIGDE.......KSVIDLTK
PRIL_METKA/207-398------CIRELLRRA...QEGENLPHEARFALAAFLV.......................NVGWDV......DRVVEVFS
E9ACF6_LEIMA/237-526------CMRAIDWHL...RREGHLKHHGRFMYGLFLK.......................SIGLSL......EDSLELFA
Q6M1A7_METMP/114-360------CMREILNDI...LSGGSPSHYARRSFVVYRFVSQFDPNLRPI.EEGIITNRSAQDIATEEQIERFLDEIINIFK
Q4XXL6_PLACH/149-419------CMRRIFVNY...IKDKHLKHWGRQQLWLFLK.......................GAGMTL......DENIQTNR
Q4P7R1_USTMA/205-486------CMKNLQSTL...TTTGHLKHYGRLQYNLFLK.......................ELGLPV......EEALVFWR
Q919P4_NPVCO/9-204------CIANGLYRMFVSPVGYREANSLRFNVAAYLNKKSRCP...........CPKSSVDSCVYKTLCWLMDNKAELCS
Q6L0D5_PICTO/111-313------CIKAYINEI...NDGGNPAHLARLTLATFLH.......................HIGMPN......DEIVKVFS
PRI2_SCHPO/186-453------CAKHLHEVL...KRDKHLRHFGRLQYGLFLK.......................DIGLSV......DEALVFWR
Q5ZM06_CHICK/182-448------CMRQLHKAL...RENHHLRHGGRMQYGLFLK.......................GIGLTL......EQALEFWK
A8B5U6_GIAIC/227-526------CMLHCINGL...KANNKLKYQARLQLTSFFN.......................SCGMSC......EDDLEYQK
Q6FLP8_CANGA/212-487------SVKNLFYGL...KENNHLRYHGRQQLTLFLK.......................GIGLSV......DEALKFWH
PRI2_YEAST/223-504------CIKNLMEGL...KKNHHLRYYGRQQLSLFLK.......................GIGLSA......DEALKFWS
PRIL_SULSO/136-302------CIENI.......LAKEKLNEEEIRTLITFYI.......................DIGKGL......SGIVSIMK
PRIL_HALMA/135-332------CMKSLLDQV...QKGEHLEHHSRFAIATFLV.......................GIGMTT......DEIVDLFQ
Q4RQ99_TETNG/188-454------CMRQLHQSL...RENHHLRHGGRMQYGLFLK.......................GIGLSL......EQALQFWR
PRI2_RAT/182-448------CMRQLHKAL...RENHHLRHGGRMQYGLFLK.......................GIGLTL......EQALQFWK
Q3ITU9_NATPD/139-334------CMRALLSRA...RDGESLPDESAFSLVSFLL.......................GVGLDR......DAVIEL..
Q6CL91_KLULA/208-479------CAKQLMEQL...QTNHHLRYQGRQQLSFFLK.......................GIGLSV......DEALQFWT
PRI2_CAEEL/201-472------CMKQMHNHL...RVNHHLKYGARRQYGLFLK.......................GIGLSL......DEAIAMMR
Q5A1D4_CANAL/229-511------CAQHLQRNL...IANSHLKYNGRQQLGIFLK.......................GIGLNV......DEALKFWS
Q38BT5_TRYB2/235-528------CMRQVDEHL...RREGHLKHQGRFTYGLFLK.......................AIGLSM......QDSMVLFS
Q5KAH0_CRYNJ/196-478------CMRHLYEKL...KKDHHLKHWGRLQLTLFLK.......................GLGLPL......DQAILFWR
Q4MZT6_THEPA/228-498------CMRRMFSHL...LKNHHIKHEGRQQLWLFLK.......................GCGLTM......EESLQLNR
PRIL_HALSA/138-335------CMKHLLDQV...QRGDHLPHHARFAITSFLS.......................NVGLST......DEIVDIYE
PRI2_ARATH/172-438------CMRHLFEKL...REDHHLKHGGRMQLGLFLK.......................GVGLKL......DDALAFWR
PRI2_DROME/194-456------CMRMCHEHI...RANHHIKHSGRMQYGLFLK.......................GIGVAL......EDSLRFWR
PRIL_THEAC/126-330------CMKEIIKNL...ESGVNVSHMGRLALASFLH.......................KAGYSE......DEIVPYFR
PRIL_METTH/183-419------CIRGTLDGV....RSGNRNDAIVLLLTSFISYARLYPSVFRD.RTPMKVSDLDPDLRITL......GEILPVIY
PRIL_PYRFU/131-367------CVKNALRGV....PQGMRNYAITVLLTSFLSYARICPNPPR...RNVKIRDCIKDMRVIT......EEILPIII
PRI2_DICDI/173-438------CMRVMYDSL...VETSSLKYEGRLQFGTFLK.......................GIGLPY......DEAINFWR
Q5CW71_CRYPI/234-522------CMRHLFESL...KKDHHLKHWSRLQLWLFLK.......................GCGMKL......EEQLSLWK
PRIL_THEKO/146-383------CVKEALKGV....PAGMRNYAITVLLTSFLSYARICPNPPK...KDVRIKDCINDLKIIE......EEILPVII
Q6C2W5_YARLI/188-453------CMSQLHTTL...RQKNHLKHDGRFQYGLFIK.......................GLGFSV......DEALQFWR
Q8ZVK5_PYRAE/111-307------CMKAILDAL...KAGENLPHAARFAIATYLL.......................HKGWEV......EQIVDLFR
Q75DH0_ASHGO/207-483------CARGLLDGL...AANHHLRYLGRQQLALFLK.......................GAGMSA......DDALRFWA

PF03041

Q91F12_GVCPM/6-164C--------------------DNKCVYDALKRF-----------------------YKMDS-------------------
Q773J1_NPVR1/7-171C--------------------ENRCLINALTHF-----------------------YNHDS-------------------

PF04104

Q6BXE4_DEBHA/218-500YQFTKSS...NAINLEKFNK.EYK..YNIRHNYG..........LEGARIN.....YKPWD.....CARILSKPKP.SKG
Q7Q5K2_ANOGA/192-455EELTRG.....KVPIEKFEK.EYA..YAIRHNYG..........KEGSRIN.....YSPFS.....CMKVITTPIG..PG
Q4DEH8_TRYCC/235-525SLMTVKG...VAGNSEAFAKTAYG..YNIRHNYG..........MEGKKTS.....YSSMS.....CATLLALPPVVDRF
Q2URN0_ASPOR/198-484QSFKG.......FTDDEFNS.RYK..YNIRHAYG..........DVGGDVNRRGRGYPPYS.....CQKILGDSNP.GVG
PRIL_METJA/142-388K............NVEDFDEKKTR..YYIMHNIG......................YKVGHGRLTHCEYCKNWQDDGGKG
PRIL_ARCFU/173-363SA.............PDFDDEKTR..YQVEHIAG..........ERGKGAE.....YTSPS.....CDTM..........
Q69PX2_ORYSJ/177-443AEFSQK......VGSERFDK.EYA..YSIRHNYG..........KEGKRTD.....YTPYS.....CQKIISATPG..VG
Q8SRV4_ENCCU/143-386GSFKA........PREVFDK.EYL..YSIRHNYG..........LEGKRAN.....YSCFS.....CSKIANMTN...EE
PRIL_SULTO/138-301DE........................NIVKKFKG............DKKTK.....YILYS.....CKKM..........
PRIL_METKA/207-398NL.............PDFDEERTQ..YQVRHIAG..........EVGGGTR.....YLPPN.....CDKM..........
E9ACF6_LEIMA/237-526TLMKVKG....GGSVEAFAKTAYG..YNVRHNYG..........MEGKKMS.....YSSAS.....CATILGLPPVVDQH
Q6M1A7_METMP/114-360SV.............GDFDVEKTK..YYISHNIG......................YKVANHI.THCEYCKNWRDDGGKG
Q4XXL6_PLACH/149-419SIWMQ.........PDKFDK.EHR..YTIRYMYG..........KEGKKTD.....FTPYN.....CSKIINNFPIPSSG
Q4P7R1_USTMA/205-486RSFKH.......ITDDKFNK.EYR..YNIRHGYG..........LEGRRMN.....YPAKS.....CARILTQDQP.GPQ
Q919P4_NPVCO/9-204EL........................YNVW.TKG......................MSPFN.....CSKAKLQT......
Q6L0D5_PICTO/111-313GT.............ADFDENSAT..YQVNHLTG...........KISGTE.....YSPPK.....CDTL..........
PRI2_SCHPO/186-453KSFT.N......VTEDKFNK.EYR..YNIRHTYG..........LEGNRKN.....YKGYN.....CQQILTGPQL.GPG
Q5ZM06_CHICK/182-448KEFIKG.....KVDADKFDK.GYA..YSIRHNYG..........KEGKRTD.....YTPYS.....CMKIIMSNPP.SQG
A8B5U6_GIAIC/227-526SFYTRV......IPEEKFTR.EYA..YNIKHIHG..........KVGGRKP.....AMCRG.....CNTIGTLVPTGDRS
Q6FLP8_CANGA/212-487DAFTKNN....KMTTEKFNK.EYR..YNIRHSYG..........LEGNRIN.....YKPWD.....CRTILSKPRP.NRG
PRI2_YEAST/223-504EAFTRNG....NMTMEKFNK.EYR..YSFRHNYG..........LEGNRIN.....YKPWD.....CHTILSKPRP.GRG
PRIL_SULSO/136-302K.........................YNVSNVEDLY.....RKYRGDKGTR.....YIVYS.....CAKM..........
PRIL_HALMA/135-332VN.............PGFGEEATR..YQVDHIRG...........DTSPTE.....YSTPA.....CSTM..........
Q4RQ99_TETNG/188-454SEFIRG.....KVDADKFDK.AYA..YGIRHMFG..........KEGKRAD.....YTPYS.....CMKVILSNAP.GQG
PRI2_RAT/182-448QEFIKG.....KMDPDKFDK.GYS..YNIRHSFG..........KEGKRTD.....YTPFS.....CMKIILTNPP.SQG
Q3ITU9_NATPD/139-334...............CSFDGERAA..RVRDRIQR.........LETDDGVV.....ATPPS.....CTVI..........
Q6CL91_KLULA/208-479ESFTSGG....KMTVDQFNK.EYK..YNFRHNYG..........LEGNRIN.....YKPWD.....CRTILSKPRP.SRG
PRI2_CAEEL/201-472DEFTKK......ITSDKFDK.EYG..YNIRYMYG..........KEGRRVA.....QTAMS.....CATIILRNPP.SAV
Q5A1D4_CANAL/229-511SQFIKNN....SMSLETFNK.DYK..YNIRHQYG..........LEGARIN.....YKPWD.....CSTILSEPRPNIKS
Q38BT5_TRYB2/235-528SLMTLKAGAAGKGDPESFAKTSYG..YNIRHNYG..........MEGKKTS.....YSSLS.....CTSLLGLPPVVDKF
Q5KAH0_CRYNJ/196-478RSYGTS......MTDDKFNK.EYR..YNIRHSYG..........QEGRRAN.....YPPKN.....CQQILTQDQP.GTQ
Q4MZT6_THEPA/228-498TLWND.........SGNFDK.EHA..YNIRHLYG..........KEGKRTS.....YPPYS.....CTRMIKNSPPNVSG
PRIL_HALSA/138-335VN.............PGFGEEMTR..YQTDHIQG...........DSSPTE.....YTAPS.....CATM..........
PRI2_ARATH/172-438EEFTKK......VGSERFDK.EYA..YAIRHNYG..........KEGKRTD.....YTPYA.....CSKIITSAPG..AG
PRI2_DROME/194-456EEFTKK......MDADKFTR.SYE..YNIYHNYG..........KKGSMVN.....YTPYS.....CAKIIKDVAG..PG
PRIL_THEAC/126-330NA.............PDFDENITR..YQIKHISG...........EISGTE.....YTPPK.....CETM..........
PRIL_METTH/183-419DAADR........CEPPLFEDDPQEKLNITAKLGFGVHDMPELENEGESKW.....YTPMS.....CEKI..........
PRIL_PYRFU/131-367EAGNR........CSPPLFEDQPNEIKNIWYHLGFGYTANPTLEDSGNSTW.....YFPPN.....CDKI..........
PRI2_DICDI/173-438IAFSKR......VSNTDFDK.EYL..YNIRHNYG..........LEGKSTN.....YSPYS.....CPRIISKSPHNGDK
Q5CW71_CRYPI/234-522SLWTD.........ANSFDK.EIK..YNIRHAYG..........QEGKRSN.....YSPYP.....CNKIINGLPLPGNG
PRIL_THEKO/146-383EAGNR........CKPPLFEDQPHEIKNIWYHLGFGLTDSPTMEDSGNSTW.....YFPPN.....CDKI..........
Q6C2W5_YARLI/188-453EAF..K......VTDDKFNK.EYQ..YNILHNYG..........LKGSGKN.....YAPKD.....CKSIIANNPPANSE
Q8ZVK5_PYRAE/111-307TS.............PDFNEKITR..YQVQHIAG..........QVGGRKE.....YAVPN.....CETM..........
Q75DH0_ASHGO/207-483DAFTAG.....PTSLDRFNR.EYR..YALRHTYG..........LEGNRIN.....YRPWD.....CRTILAKPRP.ARN

PF03041

Q91F12_GVCPM/6-164----KCVS------------------------------------------------------------------------
Q773J1_NPVR1/7-171----KCVG------------------------------------------------------------------------

PF04104

Q6BXE4_DEBHA/218-500....EYHG...CPY..RD......LSVDALVNNLN.........EMG..INDQQDING.................VIDDV
Q7Q5K2_ANOGA/192-455....ETHG...CPF..KN......LDSSTLKMKLT.........GYG...LSAIDADE.................VAGYA
Q4DEH8_TRYCC/235-525....DCHG...CPF..RF......KDEGAFRSMLLKEQLNPLGKEHPPLRPSASDIEE.................IVQDC
Q2URN0_ASPOR/198-484....QTHG...CPY..RH......FSVDNLIGLLQ.........STG..VSDRELLRG.................VREDV
PRIL_METJA/142-388....LSYY...C.............KPDEL..................................................
PRIL_ARCFU/173-363....RTYS..NC....................................................................
Q69PX2_ORYSJ/177-443....DHHG...CPY..RH......FGEDNLRAALN.........KMG...ISGHPLEE.................IMDKV
Q8SRV4_ENCCU/143-386....RRSS...CPF..VG.......DPEHIRERIK...............DVGADIED.................IMG..
PRIL_SULTO/138-301....KELG..LC....................................................................
PRIL_METKA/207-398....KAWG..LCP...................................................................
E9ACF6_LEIMA/237-526....DCHG...CPF..RF......RDEGALRTMLGKETENPKGCDYPSVRPTPGDIED.................IVSDS
Q6M1A7_METMP/114-360....LGYY...C.............RPDST..................................................
Q4XXL6_PLACH/149-419....DTHG...CPF..KN......FDEPHLKSLLF.........FFG...LNDDQIKA.................IMPFK
Q4P7R1_USTMA/205-486....DSHG...CPF..RH......FSTTNLSTAMV........QHYG...LNQAEQSE.................ILASV
Q919P4_NPVCO/9-204....TKSGIPLCPSLN................................................................
Q6L0D5_PICTO/111-313....RSNH..LCFM...........DDDPL..................................................
PRI2_SCHPO/186-453....DAHG...CPY..RT......YSVNNLVSALA.........SMGI.APDSAGCRE.................VVEAV
Q5ZM06_CHICK/182-448....DYHG...CPF..RH......SDPELLKQKLQ.........SYK...VPPSGVTQ.................ILELV
A8B5U6_GIAIC/227-526GQQLEVHG...CPF..VHMYDKNTGDPTRLKTFLQ........NNYRV.TAYERDIEDKILCAVSNHQDKGWLGYITAPL
Q6FLP8_CANGA/212-487....EYHG...CPF..RD......WNHDRLTSELS.........KMG...LTTQQITD.................VLDSC
PRI2_YEAST/223-504....DYHG...CPF..RD......WSHERLSAELR.........SMK...LTQAQIIS.................VLDSC
PRIL_SULSO/136-302....KQLG..LC....................................................................
PRIL_HALMA/135-332....QSYG..DCV............NMDDL..................................................
Q4RQ99_TETNG/188-454....DHHG...CPF..RH......SDPELLKQKLQ.........VYK...VPPSGIGQ.................ILELV
PRI2_RAT/182-448....DFHG...CPF..RH......SDAELLKQKMQ.........TYK...IPASGISQ.................ILDLV
Q3ITU9_NATPD/139-334....DEYG..DCV............DPDET..................................................
Q6CL91_KLULA/208-479....EYHG...CPY..RD......YHPDKLVATLK.........EMS...LTQQQVNS.................VVESC
PRI2_CAEEL/201-472....DCHG...CPF..RH......SEKQVLKQKLG.........SDA..ILKKEQIER.................IAELA
Q5A1D4_CANAL/229-511....EYHG...CPY..RD......FNLDVLINNLN.........NMG..ITDQQDLNS.................IVDDV
Q38BT5_TRYB2/235-528....DCHG...CPF..RF......KNESAFRGVLLKEQLHPLGKGHSSIRLAASDIED.................IIQDC
Q5KAH0_CRYNJ/196-478....DAHG...CPF..RH......FSPENLTTFLTNT....YPDHFS...RTSPEMRD.................ILDSV
Q4MZT6_THEPA/228-498....TAHG...CPF..KE......LDPKSLYQLLQ.........EFG...LNSTQIEP.................IIDLK
PRIL_HALSA/138-335....KAYG..NCV............NPDDL..................................................
PRI2_ARATH/172-438....DHHG...CPY..RH......FSEDNLKAALS.........RMG...LSSRGMED.................VMDKV
PRI2_DROME/194-456....DCHG...CPY..KN......MDQGSLKTKLS.........SYG...LSASAIDE.................VMFFV
PRIL_THEAC/126-330....RSNH..LCYM...........DDDPL..................................................
PRIL_METTH/183-419....KIHLPDLC.............RPDKL..................................................
PRIL_PYRFU/131-367....KANAPQLC.............TPDKH..................................................
PRI2_DICDI/173-438....LVHG...CPY..IQ.......SLERLEQKLL.........DLG..IDDFQRIQI.................L..EA
Q5CW71_CRYPI/234-522....QNHG...CPF..KT......FDNYPLQKLLQ........TYYGH.IIPNEDIKN.................ITQLS
PRIL_THEKO/146-383....RANAPQLC.............KPDKY..................................................
Q6C2W5_YARLI/188-453....LVHG...CPY..RS......LRPEELVGRLK.........NMG..IEDRMELNK.................ITDQV
Q8ZVK5_PYRAE/111-307....NSWG..LCPT..................................................................
Q75DH0_ASHGO/207-483....EFHG...CPY..RD......WAPDRLAAALA.........AMQ...LAPPAVAA.................VRDAC

PF03041

Q91F12_GVCPM/6-164------------------------------------QV-.D-----
Q773J1_NPVR1/7-171------------------------------------EV-MH-----

PF04104

Q6BXE4_DEBHA/218-500SRNDYTVACTRVFEMTHKNQLDK.....SNKATEGMHI.NHPNLYF
Q7Q5K2_ANOGA/192-455TKGHYQIACGKYFEVVHET.............KLEEGI.NHPNQYF
Q4DEH8_TRYCC/235-525KGQHYTRACYKYFVATHPG.............VKRDTLFRSPFEYY
Q2URN0_ASPOR/198-484EKTRYHIACNRVFEWTHKAEIKRVKEDGTWNQTDLDTI.VHPNTYF
PRIL_METJA/142-388................................CKKKFI.IHPLDYL
PRIL_ARCFU/173-363................................VADCRV.SHPLIYY
Q69PX2_ORYSJ/177-443KNRHYQLACTMTFEAEHGV.............SCDTGI.NHPNQYF
Q8SRV4_ENCCU/143-386.EGPFNGKCTRLLEKLTCR.............KQSRLV.ATPVRYY
PRIL_SULTO/138-301................................VASCNT.LNPLQFY
PRIL_METKA/207-398................................GKDCGV.KNPLAYY
E9ACF6_LEIMA/237-526KAQHYTRACYKYFMATHPG.............ARRDTLFRSPYEYY
Q6M1A7_METMP/114-360................................CSRKDI.IHPLDYL
Q4XXL6_PLACH/149-419KNNEYQLACVKFFTETHPN.............SPGDGVGNHPNSFY
Q4P7R1_USTMA/205-486KQGHYHVACTRIFEITHQRQGVKK...GQGLDGRGETV.THPNRYF
Q919P4_NPVCO/9-204................................GECGEV.RNPMVLF
Q6L0D5_PICTO/111-313................................CRQ..V.KHPLQYY
PRI2_SCHPO/186-453KARHYHIACTRVFELTHPNV...........GSLEESI.HHPLQYF
Q5ZM06_CHICK/182-448KGMHYQLACQKYFELTHDV............DDIGFSL.NHPNQYF
A8B5U6_GIAIC/227-526REGEPKVACNHLFELVHG..............DVRIDL.MHPVKFF
Q6FLP8_CANGA/212-487DKHEYTIACTKVFEMTHNVP...........EGESMHI.SHPNLYF
PRI2_YEAST/223-504QKGEYTIACTKVFEMTHNSASA......DLEIGEQTHI.AHPNLYF
PRIL_SULSO/136-302................................VSSCNV.KNPLQLY
PRIL_HALMA/135-332................................CEA..I.SHPMGYY
Q4RQ99_TETNG/188-454KGMHYQLACQKYFELTHNV............EDVSFSL.SHPNQYF
PRI2_RAT/182-448KGNHYQVACQKYFEMTHNV............DDCGFSL.NHPNQFF
Q3ITU9_NATPD/139-334................................CNR..I.QHPLSYY
Q6CL91_KLULA/208-479QQQDYTIACTKVFEAVHKT............TTADLQI.VHPNQYF
PRI2_CAEEL/201-472ELNQYDKACTRYFEFMHNLE..........EGGLGQLI.THPNQFY
Q5A1D4_CANAL/229-511NKHDYTIACTRVFELTHQKQLM.......GKENMNMHI.NHPNLYF
Q38BT5_TRYB2/235-528KGQHYTRACYKYFMATHPG.............ARRDTLFRSPHEYY
Q5KAH0_CRYNJ/196-478KASHYHVACTRVFEVTRGVKKG.......EGLGNGESV.SHPNKWA
Q4MZT6_THEPA/228-498TSFQFQLACVEYFNQTTPN.............ACADGIGTSPNTFF
PRIL_HALSA/138-335................................CDA..I.NHPLSYY
PRI2_ARATH/172-438RNRHYQLACTLTFEAVYGT.............SCDTGI.NHPNQYF
PRI2_DROME/194-456SRGHYQIGCGKYFQLTHNS.............PVEPSI.NHPNNYF
PRIL_THEAC/126-330................................CHREWM.KHPLTYY
PRIL_METTH/183-419................................CSS..I.SNPLTYY
PRIL_PYRFU/131-367................................CRY..I.RNPLTYY
PRI2_DICDI/173-438TKTSPNVACTKHFNFLHPN............NTLTKLI.NHPNQFY
Q5CW71_CRYPI/234-522KSGHYQLSCIQLFKSLHLK.............SDSDGIGNHPNSYF
PRIL_THEKO/146-383................................CRG..I.KNPLSYY
Q6C2W5_YARLI/188-453KNTNYHGACTRVLELTHPG............LKVEEVV.QHPNDYF
Q8ZVK5_PYRAE/111-307................................NLGCGV.KNPLQYG
Q75DH0_ASHGO/207-483ARREYTLACTHVFDACHGHVAPSA..PGHVPAPDMSHI.VHPNQFF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window