Sequence alignment for CL0242

PF03041

O39625_GVCP/3-165SHYETYHP...RRAIDPPKLYKVDMFLRHW.VNVNGNTAFLPGGRYFLVVGRCLLNLVEKSKSFEEHTKV..........
LEF2_NPVLD/8-179RASLNYRPAMKASDVDPDAEYAVPLEHFD..VEVSPYTVFERGGTCVRVSGRRLACLLRNGSRGESAPAPAAAAASAGQP
Q9WSV4_9BBAC/3-166KA.VPYRR.....DIDDNQWYLVDIFARDWSSVIDFYTEFETGGLRFYAYGKQLRHMIKQCPTFEELNDTEIN.......
Q9WFZ9_9ABAC/2-167SL.ILWNP...ALTIDKNATYLIDPDDFIGKIVLTPYTVFHENGLYITVSGLRLSMLLKTPSTTTTTTTTTTTATTQLLL
Q9QAB3_9CBAC/5-166IIYIKSADELKRAQNDDLRNVYVHYTLYS..GILSPLQTLDKTRLYVFVKNVNDPNLKPKNVNDIKSPSKN.........
Q9QPA0_9ABAC/3-170PL.LSWTPSNID.DIDKNAEYSVLFSDIP..LQVTCLTPFIDKGLRVKINGHRLYYLIKNKDQYAEALTPKNNK..WSLN
Q9YWC0_NPVBS/11-174P..LEWKPSLSNKQIDKQRFYIVPIENFD..FDLTCYTQFTDDGQSVLIPGLRLFHLMRNTLERNETQS.......AAVL
LEF2_NPVOP/1-165ME.RVWNPAAGIDGLKRSETYLVDPHDFVGVLTLSPYTVFER.GLFVRMSGMRLLALLAAPKPQEPQPAVR.....R...
Q9Q9U4_9ABAC/35-204RQ.LLWNPSICKSKIDKKAVYLVRFEDFE..LNLSPYTQFEQNGLLVRVYGTQLYHLLDNKTNNATTVYDRKPA..IAKN
Q9PZ08_GVXN/17-181KKLLRYQP...FSDIDTTQHYLVDVFTRDWRKVVDAYTIFVPGGLYFVVNGLNLKNMIKTCPEELSSEKQ..........
LEF2_NPVAC/5-171SY.NVWSPLIRASCLDKKATYLIDPDDFIDKLTLTPYTVFYNGGVLVKISGLRLYMLLTAPPTINEIKNSN.........

PF04104

Q6BXE4_DEBHA/218-500NFIKLPFDKVP.NLVA..SR........SVLLK.SGYAYIPSTLQLNLLSIEFQDILTR..NLMRTFQTLP..RL....E
Q7Q5K2_ANOGA/192-455DFYAVHFTEVL.NLVR..DR........KCFLK.AGVAYITPEHFAHVIGKKHQQLIED..GLKGHLRLLP..TL....E
Q4DEH8_TRYCC/235-525DYFSVPMTLAT.RLIK..TR........SVLCL.KGHAILHRDQAQEVFVTVFRSKLNK..GLHEAYLARM..RLTSNED
Q2URN0_ASPOR/198-484SWYKVDWERVP.ELVE..RR........SVFLY.RGKAYVPGREQLSMIIAEFTARLER..SLELTSRALP..RL....D
Y701_METJA/142-388LPNKISVWEFI.KIASRSRINDL..HLERLDLE.NGFVDITKIK.EIFAKEIIRVELMK..LGENIKKRKL..PDDSVVK
PRIL_ARCFU/173-363KGWKMHVSTFV.RVSARIKDDKW..RLVNRKLR.NGWVETTKAEVLRGLEELLRMKLFE..KVPV...SEAVSEAVRELS
Q69PX2_ORYSJ/177-443VFFKVPFEEVP.DLVA..SR........RVFLS.KGYAYVAMSQVVSLVVTQFRCNISK..ALVLTNRKWT..ATIKE.Q
Q8SRV4_ENCCU/143-386SEVLVHFTKVI.DLIG..KR........AVVPE.GGYLRLNDEGIGSLLVSEFRRYLSN..RMDELVEISS..N.....E
PRIL_SULTO/138-301LKYSLNFIDFL.KYTRELRKIDNKFSLASHILK.DGKVYLTKEEIVRILVFQIRDKLMK..MVNVSDVVIP.........
PRIL_METKA/207-398EQDHARRCS...NCRGRMRKPDP..NLLEMLKEPEGYLIMHFKTLARTFREDVRRLVVS..DIESRDDVED..EELREFC
E9ACF6_LEIMA/237-526NYYAVPLSLAT.RLIK..KR........YVLCR.AGQAILFRDQVQEVFLTVFCARLNR..GLHNAYLARV..KQQALEE
Q6M1A7_METMP/114-360GDSKINIWDFI.DVAANSRNNDL..HLERMILE.GDTVLLNQKNQSIYNFEKIRLKLKN..YVEKVRNA....EMPKEIK
Q4XXL6_PLACH/149-419KLFKVPFFPDAYFLVK..DH........KVCVE.KGIAYVPDTYLDAILITQFKINIQE..SFKYLEQNEK..LLLDV.Q
Q4P7R1_USTMA/205-486TFFKVDWTRVT.DLVE..KR........RVFMR.AGQAWVPIKEQSSLVLAEFQSRLLR..DLEMTARALP..RL....D
PRIL_PYRHO/131-367PEYTMKISDFL........DLVPDEKLANYYIY.EGRVYLKREDLIRIWSKAFERNVER..GVNMLYEIRD..ELPEFYR
Q919P4_NPVCO/9-204PPYRLALEQVC.APLDPSTR..........FVR.HGTIVAPISKAEALRYTRRAKVMEP..QVNFTPNSTP..QTGECLK
Q6L0D5_PICTO/111-313NNYKMDFSFFV.SYNKRISGYKY..RLVYQSLD.HGYINLDIETFSNIMREYIVSRLLD..IYNSIDKDQA.IKAMNNYI
PRIL_METBF/127-327LQFSMHFADYI.RFSSSIREPVW..KLTNRQLR.SGMVVVTKKDFVRLLQEAIKERIEK..SFPIPKIPSEVSSFCAPYV
PRI2_SCHPO/186-453SFFKVPFFKVP.DLVE..RR........AVFVH.KGYAYVPFSEQVSLVVEEFEENLKK..ALESTAKSLP..RL....D
Q5ZM06_CHICK/182-448MFYKVGLSDAV.DLFR..AR........RVFIK.DGFAFVPLKDIDAIVLNNYRKSLSK..ALALTARSLP..SI....Q
A8B5U6_GIAIC/227-526TFYLTRREKFS.ACIELAAK........RVPCV.AGMFLLAAEDLISLLLIKFTA.IYK..ASQSICASVS..DI....R
Q6FLP8_CANGA/212-487KFIKLPFESVI.ELVG..NR........QVFLK.NGYAYLPQFQQLNLIANEFSTKLQE..ELIKTYQYLP..RL....N
PRI2_YEAST/223-504KFIKLPFENVI.ELVG..NR........LVFLK.DGYAYLPQFQQLNLLSNEFASKLNQ..ELIKTYQYLP..RL....N
PRIL_THEVO/115-319ERFEIGVFDFV.KYASRVTGSQY..RLSNQSVI.KGIVYCQKDVAIKILRESFVSNMFK..VIDSIDQTTA.SPVLSDQT
PRIL_SULSO/136-302KEFCVHFIDYL.KYTKDLKEDW...KLSGQILH.KGYVYLDKNQLIGLIAESIKSKIVE..............MIRPLNL
PRIL_HALMA/135-332DGYRVEVGAYL.DLAADQRGDSW..RLVNRPLT.DGEVRVTAEELNVLLKQAIRHRVTD..GLPF.TVPDAIADELTAEV
Q4RQ99_TETNG/188-454DFYRVPFQDAL.DLVR..AR........KVYLK.AGYAYIPHQDIVTIVLNDFRTRLSK..ALALTARSLP..AV....H
PRI2_RAT/182-448SVYKVPFADAL.DLFR..GR........KVYLE.DGFAYVPLKDIVAIILNEFRATLSK..ALALTARSLP..AV....Q
Q3ITU9_NATPD/139-334GRFSVAATAYL.ELAAGLDDPQW..RLATRPLS.AGTLPVSRPELYTLLREAVARRVAE..GLPL.SVPDVIAEPLDGEL
Q6CL91_KLULA/208-479KYYKLPMENVM.DLVG..SR........QIFIK.KGWAYVPQFQQLNLISNEFSDCLQT..ELMGTYQMIP..KL....N
PRI2_CAEEL/201-472TFYKVDFIDAI.ELIR..RG........SVHLK.KGFAYFPFDDLVTILVTKMKNNMMA..AMARSFKHLA..IL....E
Q649Q2_9ARCH/133-334EHVQMPFVDYL.RFTTNLRDKKW..KLVNRGLE.KGRVKLEKGEFIRIIQEAIYERIMK..DLPL.NVSADVCDAIRGYT
Q5A1D4_CANAL/229-511NFIKLPFEKITGNLIS..NR........SIFLF.KGYGYLPASLQLNLLSIEFINILND..NLIKTFQTIP..RL....E
Q38BT5_TRYB2/235-528EYFLVPLSLAT.RLIK..AR........SVLCL.RGHAILHRDQVQEVFVTMFLSKLNK..GLHEAYLARM..KLSSHED
Q5KAH0_CRYNJ/196-478TWFKVPWYTVP.DLVG..AR........RVLVK.GGLAFVPQSLQLSLVLQVFADRLEK..ALEFTAKNLP..RL....D
Q4MZT6_THEPA/228-498SIFMVPFYPDANQLVR..MK........LVAIK.NSIAYVPPNSLFIVISTKFRNELQH..SMKYLNENQS..MLDSVIV
PRIL_HALSA/138-335DAHTVDVPTYL.LLASSLRDDDW..RLVNRALD.DGRVPVTDAELDTLIREAIRERVAD..GLPL.SVPDQIADALDEPV
PRI2_ARATH/172-438IYYKVPFEEVP.DLVA..SR........RVLLQ.KGFAFVAGTQLVSLVVTQFRSHLSK..ALILTNRKWT..TTIRE.R
PRI2_DROME/194-456DFYKVPFTQVL.DLVR..GR........RCFLK.AGYAYVNTHDLVSLVGTKQQDEIEQ..GLQAAKTMVE..DV....E
PRIL_THEAC/126-330HLYRIGVADFA.TYASRVTGSKY..RLSNQIVR.EGYVYVDEDVMAKVLREAFVSFMFD..TLDQIRKEDA.IETIKSVL
PRIL_METTH/183-419DEFITSFQDSI........RDRSPDRLYDILV........GLEVRETMISRMIMQRTEE..YIGMVREMSSTVEVHPLIL
PRIL_PYRFU/131-367PEYIVSLREFL........DLVPDEKLSSYYVY.DGNVYLRKDDLLKVWSKAFERNVEK..AVNIIYEIRD..ELPEFYR
PRI2_DICDI/173-438HFYKLPFQDIP.KLID..TK........KAIII.KGEAYIYISNFKDMVIHTFKNYMNF..ALDRIKADKT..RI..K.E
Q5CW71_CRYPI/234-522RLFKIPFWPDGFRFIK..NR........KYFIK.DGICFIPDTEIESLFIYKYKKELIN..SFINLKENEI..ILEKTIL
Q5JJ73_PYRKO/146-383IKYKIPIKDLL.........NLWGSSLKEVYIR.NGYAYLRWETALKMWEKAFEKRFER..AVNILYEYRD..ELPEFYH
Q6C2W5_YARLI/188-453DYVKVDWQKVA.DLVD..SR........RVFLR.AGKVYVPASLQQNLVVNEFESRLAV..AMETAAMLLS..RL....D
Q8ZVK5_PYRAE/111-307TPVAIKWTSYL.RYAPPD..PFW..AMINRVVV.KGWVILPLDDFERILEEAYEEQILRIASENELAVGRVSASIDMSLI
Q75DH0_ASHGO/207-483RFLKLPFESVI.DLVG..PR........HVLLR.GGWAYLPQFMQLNHIAAEYAARLAT..DLRATYQHLP..AL....A

PF03041

O39625_GVCP/3-165EENAKKVKVCFEDCG-------------------------------G.NREAIIAKFRKLFYSR.PNAKTEPSFNKLCVR
LEF2_NPVLD/8-179GRKRSCKNVCFKG.A-------------------------------T.SRRELERTLTARVN...LPPCMTGLLRQFEIR
Q9WSV4_9BBAC/3-166KSNKKKKNVCFKDVT-------------------------------S..RAAMIDRYRKLFYDNAQKTTTAQAFSNLCVR
Q9WFZ9_9ABAC/2-167MKKKSKKNVCF...I-------------------------------N...NSMMNILNSHIN...TPLCIKKITQELMTS
Q9QAB3_9CBAC/5-166HSYKRQRYPCFNTIS-------------------------------G....STIHKICNVMK...PPPCVRHALKLIDER
Q9QPA0_9ABAC/3-170NIYKSHKNVCFQNVS-------------------------------..SINNVVDILKTKLN...MPDCMQRFLADFQVR
Q9YWC0_NPVBS/11-174TRKKNCRNVCFKKAF-------------------------------T.NKKDVIALLRSSLK...LPECINNLLNLISIS
LEF2_NPVOP/1-165FPQRSRRNVCLKACA-------------------------------D.GAQSLAKVLAARVS...MPPCMSKTMADLSSA
Q9Q9U4_9ABAC/35-204GMHKSLRNVCFVNTQ-------------------------------Y.KRQHIINTLRKALK...LPACIELILYDILVR
Q9PZ08_GVXN/17-181AIKAKTIKLCFLDAI-------------------------------KKGRKEVISLYTKHLY...SKTTNTTEDFKALCQ
LEF2_NPVAC/5-171FKKRSKRNICMKECV-------------------------------E.GKKNVVDMLNNKIN...MPPCIKKILNDLKEN

PF04104

Q6BXE4_DEBHA/218-500EDDR..LLPLLNNLS.HNFSNIQYES............AFGSDPSLISDINAQS..ITTPAINKHYPLCASHLQKNL...
Q7Q5K2_ANOGA/192-455IDER..FAMLLKSIH.TSYTGKN..................YTVAKTGSVPVES..L.DQLSKKSFALCMRNVHDTL...
Q4DEH8_TRYCC/235-525DEERETVMRMLDAFL.EYFVSDPT...............SAIQEAASGAVSAGE..V.RRIAQTHFPLCMRQVDEHL...
Q2URN0_ASPOR/198-484EDDR..LTPILNHLS.KNFGSAESVY............SEGEGFVDGAPITAQN..I.DQLS.QHFPLCMRSLHMSL...
Y701_METJA/142-388ELLNEISDYLKDKVK............................YEQISGIKALN..YKGNIPLEWHPPCIRGILNDI...
PRIL_ARCFU/173-363RKAKRESEKFAMDLG............................................EVDLNCLPPCMREILSEL...
Q69PX2_ORYSJ/177-443EKDR..LTPIVEALS.NAYFGPD.................YSQPKDAVEISLKD..I.DQLAKTSFPLCMRHMLEKL...
Q8SRV4_ENCCU/143-386PDER......MRVLS.TSLLANP..................TGYERGTNFSLES.......SERYFPPCMQDIMERL...
PRIL_SULTO/138-301EQIRKLADELKGRKT...................................................PPCILEL.......
PRIL_METKA/207-398LKLFPKVRKRLERVE............................................KGAGGRFPPCIRELLRRA...
E9ACF6_LEIMA/237-526ETAKSTVMAMLDAFL.QQFISDPV...............DTLQEGVAGSVRARD..V.QRLAQAHFPPCMRAIDWHL...
Q6M1A7_METMP/114-360DLLVKKSEEAFEGIN..........................IGYNIESGIKVSTKEYSGEIPEDWHPPCMREILNDI...
Q4XXL6_PLACH/149-419NDSR..ISSFLAALP.KAYVAKDFR..............QNYEHTEDTRLMPQN..L.YSIYKQSFPPCMRRIFVNY...
Q4P7R1_USTMA/205-486EDDR..LLPVLSHLS.MGFLAGISTD...........YTGSSITADGSTTVTAG..MVDALVKTHAPMCMKNLQSTL...
PRIL_PYRHO/131-367KVLGEIQAFAEEEFG................................RKFGEIQGGK...LRPEFFPPCIKNALKGV...
Q919P4_NPVCO/9-204LSYESKLCAMNEIIV..............................................AYQGLPPCIANGLYRMFVS
Q6L0D5_PICTO/111-313NKIESMRREFKESIR......................................KYTPSGKIRWENFPPCIKAYINEI...
PRIL_METBF/127-327AEIKDKFEVHKKKFG.......................................TTDFGVVEPDLFPPCISHALANV...
PRI2_SCHPO/186-453EDDR..LLPILNHLS.KGFVAPES................SIVAPKSGAITAGQ..V.DSFV.SHFPLCAKHLHEVL...
Q5ZM06_CHICK/182-448SDER..LQPLLNHLS.HSYVGPD.................YSVQKNTGKISLEH..I.DALSVKSFPLCMRQLHKAL...
A8B5U6_GIAIC/227-526IPQFAELLEILRQTRIDSNSLEA.................KVQLDEDRKLSRKN..IDAAIRAGCIPPCMLHCINGL...
Q6FLP8_CANGA/212-487EDDR..LIPILNHLS.SGYTIADSGS...........FDSQFGNNEDNEINAKS..VWSEEISKHYPLSVKNLFYGL...
PRI2_YEAST/223-504EDDR..LLPILNHLS.SGYTIADFNQQ..........KANQFSENVDDEINAQS..VWSEEISSNYPLCIKNLMEGL...
PRIL_THEVO/115-319DSINELREFYKKSVY......................................AKLTIGRGNTKAFPPCMKEIIRNL...
PRIL_SULSO/136-302KEIPEKLKSLIERRG.................................................IIPPCIENI.......
PRIL_HALMA/135-332EQLEEVLSELELTRE..........................................IDTVVPELFPPCMKSLLDQV...
Q4RQ99_TETNG/188-454SDER..LQPLLTHLS.HAYVGQD.................YSVQKNVGRISLEQ..V.DSLSGKSFPLCMRQLHQSL...
PRI2_RAT/182-448SDER..LQPLLSHLS.HSYTGQD.................YSTQKSTGKISLDQ..I.DSLSTKSFPPCMRQLHKAL...
Q3ITU9_NATPD/139-334AAIRRQIEDLDPPTG..........................................FETVTPGLFPPCMRALLSRA...
Q6CL91_KLULA/208-479EDDR..ILPILHHLS.SGYVVTESQ..............ELNGAGVNDEFTHRS..VKTKKVMEHFPLCAKQLMEQL...
PRI2_CAEEL/201-472EEGR..LLPRLSLLSNNAYSGKD.................YNGEQPDGSIIVTRHMI.DKLSRRSFAPCMKQMHNHL...
Q649Q2_9ARCH/133-334EDIKRELEETRKKFG......................................YAEGFIVKDPNCFPPCISYILSNL...
Q5A1D4_CANAL/229-511EDDR..LLPLLNNLS.KNFSNFQYES...........EINKLDEEFISDINSKS..IITPKITKHYPLCAQHLQRNL...
Q38BT5_TRYB2/235-528HDERETVMKMLDAFL.EYFIEDTM...............NEVQEASAGAVGAGD..V.RHLAQTHFPLCMRQVDEHL...
Q5KAH0_CRYNJ/196-478EDER..LGPVIDHLA.SSFLSGIGASD..........YQPSDELGDGMTVTADT..I.DDVARKHFPPCMRHLYEKL...
Q4MZT6_THEPA/228-498NDER..LCDFMRVLP.ESYLANDY...............SKITFTDDTRLTLSN..I.NQVYKFTFPPCMRRMFSHL...
PRIL_HALSA/138-335AAIQDALADLDLTRE..........................................IDTVVPELFPPCMKHLLDQV...
PRI2_ARATH/172-438EKDR..LTPIVEALS.TSYLGPD.................YSQSNEYADISLKD..I.DQVSKSSFPLCMRHLFEKL...
PRI2_DROME/194-456ADER..ISRTLKALH.NSYTGRD..................YTVCRDAAVPIES..L.DQLSKTSMPLCMRMCHEHI...
PRIL_THEAC/126-330DDLEKIRESYRKAHN......................................VRMIAGKGDASMFPPCMKEIIKNL...
PRIL_METTH/183-419ETAERIRETVEEIMS................................FTGGPVKSARPGKLVQEAFPPCIRGTLDGV...
PRIL_PYRFU/131-367RLAGEIRSFAEKEFS................................DKFREVQAGE...LKHHLFPPCVKNALRGV...
PRI2_DICDI/173-438EFPE..LIQFFTTLP.KAGDGTN.................KPQLGNTKHIRKED..V.SPLSKTSFPMCMRVMYDSL...
Q5CW71_CRYPI/234-522SDQR..VSSLIREIS.EFYFTSNDFRGGGSLLSSPFNSLSENQAIENFKLDTSN..I.YQVYLSSFPLCMRHLFESL...
Q5JJ73_PYRKO/146-383RLREKLEEIAEEYFK.................................ERGEMFKGTASPLRFDLFPPCVKEALKGV...
Q6C2W5_YARLI/188-453ESTR..LMPILDHLA.QFGVTETF................QKNEALDGKIGPSN..I.DSVV.KHMPLCMSQLHTTL...
Q8ZVK5_PYRAE/111-307EDLLRKYAQRPVNIT...........................................KLSTEGPDPPCMKAILDAL...
Q75DH0_ASHGO/207-483GDDR..LPPILAHLS.AGHVVAP..................PPPPTGGGLTAAD..LAAEPVRAALPLCARGLLDGL...

PF03041

O39625_GVCP/3-165..PRRQRYACRLSFNFLVV-----------------------KR------------------------------------
LEF2_NPVLD/8-179..NRGDRYRKRFVFNCYLI-----------------------NT------------------------------------
Q9WSV4_9BBAC/3-166..PRGGRHQNRLSFSWKIV-----------------------NS------------------------------------
Q9WFZ9_9ABAC/2-167..PRNGMYRKRFIWNCYIL-----------------------NV------------------------------------
Q9QAB3_9CBAC/5-166..PMKHRFQQRFVVQTYMS-----------------------RK------------------------------------
Q9QPA0_9ABAC/3-170..PRGKRFRKRFIFNAYIA-----------------------NV------------------------------------
Q9YWC0_NPVBS/11-174..PRGGRYRKRFVLNCYVA-----------------------NL------------------------------------
LEF2_NPVOP/1-165..PRGNMYRKRFEFNCYLA-----------------------NV------------------------------------
Q9Q9U4_9ABAC/35-204..PRNGRFRKRFVFNCYIS-----------------------NL------------------------------------
Q9PZ08_GVXN/17-181.RSRHNRFQNRVKFTYKIV-----------------------KS------------------------------------
LEF2_NPVAC/5-171NVPRGGMYRKRFILNCYIA-----------------------NV------------------------------------

PF04104

Q6BXE4_DEBHA/218-500ILNSHMKYQGRQQLGLFLK.......................GIGLNV......DEALKFWSYQFTKSS...NAINLEKF
Q7Q5K2_ANOGA/192-455RATHHLKHVGRMQYTLFLK.......................AIGVTM......EDALRFWREELTRG.....KVPIEKF
Q4DEH8_TRYCC/235-525RREGHLKHHGRFTYGLFLK.......................AIGLSL......QDSMTLFSSLMTVKG...VAGNSEAF
Q2URN0_ASPOR/198-484RKNNHLKHYGRLQYTLFLK.......................GIGLSL......EECILFWRQSFKG.......FTDDEF
Y701_METJA/142-388LSGGSPSHYARRSFVVYWFCAKFNPNLRPLDKNGNLVNVSATDIASEEEIERFIDELIEMLFK............NVEDF
PRIL_ARCFU/173-363QRGMNIPHTARFAITSFLL.......................NIGMTV......DEIIALFKSA.............PDF
Q69PX2_ORYSJ/177-443RENHHLKHGGRMQFGLFLK.......................GAGLKL......EDALAFWRAEFSQK......VGSERF
Q8SRV4_ENCCU/143-386RKNKHLKYNDRQTLCLFLK.......................DCGMSV......EDGIAFFRGSFKA........PREVF
PRIL_SULTO/138-301KRKKELNNTELGVLIAYYI.......................DIGDE.......KSVIDLTKDE................
PRIL_METKA/207-398QEGENLPHEARFALAAFLV.......................NVGWDV......DRVVEVFSNL.............PDF
E9ACF6_LEIMA/237-526RREGHLKHHGRFMYGLFLK.......................SIGLSL......EDSLELFATLMKVKG....GGSVEAF
Q6M1A7_METMP/114-360LSGGSPSHYARRSFVVYRFVSQFDPNLRPI.EEGIITNRSAQDIATEEQIERFLDEIINIFKSV.............GDF
Q4XXL6_PLACH/149-419IKDKHLKHWGRQQLWLFLK.......................GAGMTL......DENIQTNRSIWMQ.........PDKF
Q4P7R1_USTMA/205-486TTTGHLKHYGRLQYNLFLK.......................ELGLPV......EEALVFWRRSFKH.......ITDDKF
PRIL_PYRHO/131-367.PQGIRNYAITVLLTSFLSYARICPNPPR...RNVRVKDCIKDIRVIT......EEILPIIIEAANR........CSPPL
Q919P4_NPVCO/9-204PVGYREANSLRFNVAAYLNKKSRCP...........CPKSSVDSCVYKTLCWLMDNKAELCSEL................
Q6L0D5_PICTO/111-313NDGGNPAHLARLTLATFLH.......................HIGMPN......DEIVKVFSGT.............ADF
PRIL_METBF/127-327QGGVNLAHSMRFAMTSFLL.......................SVGMSV......DEILNLFNVS.............PDF
PRI2_SCHPO/186-453KRDKHLRHFGRLQYGLFLK.......................DIGLSV......DEALVFWRKSFT.N......VTEDKF
Q5ZM06_CHICK/182-448RENHHLRHGGRMQYGLFLK.......................GIGLTL......EQALEFWKKEFIKG.....KVDADKF
A8B5U6_GIAIC/227-526KANNKLKYQARLQLTSFFN.......................SCGMSC......EDDLEYQKSFYTRV......IPEEKF
Q6FLP8_CANGA/212-487KENNHLRYHGRQQLTLFLK.......................GIGLSV......DEALKFWHDAFTKNN....KMTTEKF
PRI2_YEAST/223-504KKNHHLRYYGRQQLSLFLK.......................GIGLSA......DEALKFWSEAFTRNG....NMTMEKF
PRIL_THEVO/115-319HEGINVPHMGRLAIASFLH.......................KVGYTE......DEIVEYFRNA.............PDF
PRIL_SULSO/136-302LAKEKLNEEEIRTLITFYI.......................DIGKGL......SGIVSIMKK.................
PRIL_HALMA/135-332QKGEHLEHHSRFAIATFLV.......................GIGMTT......DEIVDLFQVN.............PGF
Q4RQ99_TETNG/188-454RENHHLRHGGRMQYGLFLK.......................GIGLSL......EQALQFWRSEFIRG.....KVDADKF
PRI2_RAT/182-448RENHHLRHGGRMQYGLFLK.......................GIGLTL......EQALQFWKQEFIKG.....KMDPDKF
Q3ITU9_NATPD/139-334RDGESLPDESAFSLVSFLL.......................GVGLDR......DAVIEL.................CSF
Q6CL91_KLULA/208-479QTNHHLRYQGRQQLSFFLK.......................GIGLSV......DEALQFWTESFTSGG....KMTVDQF
PRI2_CAEEL/201-472RVNHHLKYGARRQYGLFLK.......................GIGLSL......DEAIAMMRDEFTKK......ITSDKF
Q649Q2_9ARCH/133-334KAGINVTHGARFAVTAFLL.......................NLGLSE......EEIIEIYKNS.............PDF
Q5A1D4_CANAL/229-511IANSHLKYNGRQQLGIFLK.......................GIGLNV......DEALKFWSSQFIKNN....SMSLETF
Q38BT5_TRYB2/235-528RREGHLKHQGRFTYGLFLK.......................AIGLSM......QDSMVLFSSLMTLKAGAAGKGDPESF
Q5KAH0_CRYNJ/196-478KKDHHLKHWGRLQLTLFLK.......................GLGLPL......DQAILFWRRSYGTS......MTDDKF
Q4MZT6_THEPA/228-498LKNHHIKHEGRQQLWLFLK.......................GCGLTM......EESLQLNRTLWND.........SGNF
PRIL_HALSA/138-335QRGDHLPHHARFAITSFLS.......................NVGLST......DEIVDIYEVN.............PGF
PRI2_ARATH/172-438REDHHLKHGGRMQLGLFLK.......................GVGLKL......DDALAFWREEFTKK......VGSERF
PRI2_DROME/194-456RANHHIKHSGRMQYGLFLK.......................GIGVAL......EDSLRFWREEFTKK......MDADKF
PRIL_THEAC/126-330ESGVNVSHMGRLALASFLH.......................KAGYSE......DEIVPYFRNA.............PDF
PRIL_METTH/183-419.RSGNRNDAIVLLLTSFISYARLYPSVFRD.RTPMKVSDLDPDLRITL......GEILPVIYDAADR........CEPPL
PRIL_PYRFU/131-367.PQGMRNYAITVLLTSFLSYARICPNPPR...RNVKIRDCIKDMRVIT......EEILPIIIEAGNR........CSPPL
PRI2_DICDI/173-438VETSSLKYEGRLQFGTFLK.......................GIGLPY......DEAINFWRIAFSKR......VSNTDF
Q5CW71_CRYPI/234-522KKDHHLKHWSRLQLWLFLK.......................GCGMKL......EEQLSLWKSLWTD.........ANSF
Q5JJ73_PYRKO/146-383.PAGMRNYAITVLLTSFLSYARICPNPPK...KDVRIKDCINDLKIIE......EEILPVIIEAGNR........CKPPL
Q6C2W5_YARLI/188-453RQKNHLKHDGRFQYGLFIK.......................GLGFSV......DEALQFWREAF..K......VTDDKF
Q8ZVK5_PYRAE/111-307KAGENLPHAARFAIATYLL.......................HKGWEV......EQIVDLFRTS.............PDF
Q75DH0_ASHGO/207-483AANHHLRYLGRQQLALFLK.......................GAGMSA......DDALRFWADAFTAG.....PTSLDRF

PF03041

O39625_GVCP/3-165--------------------------------------LQCCR-----CDN.--------------KCVYDALKRF----
LEF2_NPVLD/8-179--------------------------------------TTCTA-----CDR.--------------RCFVNAAAVL----
Q9WSV4_9BBAC/3-166--------------------------------------LKCDE-----CNH.--------------TCVYESLKLF----
Q9WFZ9_9ABAC/2-167--------------------------------------LTCVK-----CSN.--------------KCLLEAMTIF----
Q9QAB3_9CBAC/5-166--------------------------------------YLCES-----CTDN--------------ECLNQILSEL----
Q9QPA0_9ABAC/3-170--------------------------------------ITCTK-----CNK.--------------LCLVKAMSYI----
Q9YWC0_NPVBS/11-174--------------------------------------LTCTK-----CNK.--------------NCLFVAMQVL----
LEF2_NPVOP/1-165--------------------------------------ITCTK-----CKT.--------------ACLIGALLHF----
Q9Q9U4_9ABAC/35-204--------------------------------------LTCTK-----CNK.--------------QCIERAMIAL----
Q9PZ08_GVXN/17-181--------------------------------------IQCNV-----CDNS--------------CCVYDALKLF----
LEF2_NPVAC/5-171--------------------------------------VSCAK-----CEN.--------------RCLIKALTHF----

PF04104

Q6BXE4_DEBHA/218-500NK.EYK..YNIRHNYG..........LEGARIN.....YKPWD.....CARILSKPKP.SKG....EYHG...CPY..RD
Q7Q5K2_ANOGA/192-455EK.EYA..YAIRHNYG..........KEGSRIN.....YSPFS.....CMKVITTPIG..PG....ETHG...CPF..KN
Q4DEH8_TRYCC/235-525AKTAYG..YNIRHNYG..........MEGKKTS.....YSSMS.....CATLLALPPVVDRF....DCHG...CPF..RF
Q2URN0_ASPOR/198-484NS.RYK..YNIRHAYG..........DVGGDVNRRGRGYPPYS.....CQKILGDSNP.GVG....QTHG...CPY..RH
Y701_METJA/142-388DEKKTR..YYIMHNIG......................YKVGHGRLTHCEYCKNWQDDGGKG....LSYY...C......
PRIL_ARCFU/173-363DDEKTR..YQVEHIAG..........ERGKGAE.....YTSPS.....CDTM..............RTYS..NC......
Q69PX2_ORYSJ/177-443DK.EYA..YSIRHNYG..........KEGKRTD.....YTPYS.....CQKIISATPG..VG....DHHG...CPY..RH
Q8SRV4_ENCCU/143-386DK.EYL..YSIRHNYG..........LEGKRAN.....YSCFS.....CSKIANMTN...EE....RRSS...CPF..VG
PRIL_SULTO/138-301........NIVKKFKG............DKKTK.....YILYS.....CKKM..............KELG..LC......
PRIL_METKA/207-398DEERTQ..YQVRHIAG..........EVGGGTR.....YLPPN.....CDKM..............KAWG..LCP.....
E9ACF6_LEIMA/237-526AKTAYG..YNVRHNYG..........MEGKKMS.....YSSAS.....CATILGLPPVVDQH....DCHG...CPF..RF
Q6M1A7_METMP/114-360DVEKTK..YYISHNIG......................YKVANHI.THCEYCKNWRDDGGKG....LGYY...C......
Q4XXL6_PLACH/149-419DK.EHR..YTIRYMYG..........KEGKKTD.....FTPYN.....CSKIINNFPIPSSG....DTHG...CPF..KN
Q4P7R1_USTMA/205-486NK.EYR..YNIRHGYG..........LEGRRMN.....YPAKS.....CARILTQDQP.GPQ....DSHG...CPF..RH
PRIL_PYRHO/131-367FEDQPNEIKNIWYHLGFGYTANPSLEDSGNSTW.....YFPPN.....CEKI..............RANAPQLC......
Q919P4_NPVCO/9-204........YNVW.TKG......................MSPFN.....CSKAKLQT..........TKSGIPLCPSLN..
Q6L0D5_PICTO/111-313DENSAT..YQVNHLTG...........KISGTE.....YSPPK.....CDTL..............RSNH..LCFM....
PRIL_METBF/127-327DAEVTL..YQIEHIAG............ATGNV.....YKPPA.....CDTM..............RTYG..NCI.....
PRI2_SCHPO/186-453NK.EYR..YNIRHTYG..........LEGNRKN.....YKGYN.....CQQILTGPQL.GPG....DAHG...CPY..RT
Q5ZM06_CHICK/182-448DK.GYA..YSIRHNYG..........KEGKRTD.....YTPYS.....CMKIIMSNPP.SQG....DYHG...CPF..RH
A8B5U6_GIAIC/227-526TR.EYA..YNIKHIHG..........KVGGRKP.....AMCRG.....CNTIGTLVPTGDRSGQQLEVHG...CPF..VH
Q6FLP8_CANGA/212-487NK.EYR..YNIRHSYG..........LEGNRIN.....YKPWD.....CRTILSKPRP.NRG....EYHG...CPF..RD
PRI2_YEAST/223-504NK.EYR..YSFRHNYG..........LEGNRIN.....YKPWD.....CHTILSKPRP.GRG....DYHG...CPF..RD
PRIL_THEVO/115-319DESITR..YQIKHLSG...........EISGVE.....YSPPK.....CETM..............RSNH..LCFM....
PRIL_SULSO/136-302........YNVSNVEDLY.....RKYRGDKGTR.....YIVYS.....CAKM..............KQLG..LC......
PRIL_HALMA/135-332GEEATR..YQVDHIRG...........DTSPTE.....YSTPA.....CSTM..............QSYG..DCV.....
Q4RQ99_TETNG/188-454DK.AYA..YGIRHMFG..........KEGKRAD.....YTPYS.....CMKVILSNAP.GQG....DHHG...CPF..RH
PRI2_RAT/182-448DK.GYS..YNIRHSFG..........KEGKRTD.....YTPFS.....CMKIILTNPP.SQG....DFHG...CPF..RH
Q3ITU9_NATPD/139-334DGERAA..RVRDRIQR.........LETDDGVV.....ATPPS.....CTVI..............DEYG..DCV.....
Q6CL91_KLULA/208-479NK.EYK..YNFRHNYG..........LEGNRIN.....YKPWD.....CRTILSKPRP.SRG....EYHG...CPY..RD
PRI2_CAEEL/201-472DK.EYG..YNIRYMYG..........KEGRRVA.....QTAMS.....CATIILRNPP.SAV....DCHG...CPF..RH
Q649Q2_9ARCH/133-334DVERTR..YQVRHIAG...........GTGSVR.....YTAPS.....CATM..............RTYG..NCV.....
Q5A1D4_CANAL/229-511NK.DYK..YNIRHQYG..........LEGARIN.....YKPWD.....CSTILSEPRPNIKS....EYHG...CPY..RD
Q38BT5_TRYB2/235-528AKTSYG..YNIRHNYG..........MEGKKTS.....YSSLS.....CTSLLGLPPVVDKF....DCHG...CPF..RF
Q5KAH0_CRYNJ/196-478NK.EYR..YNIRHSYG..........QEGRRAN.....YPPKN.....CQQILTQDQP.GTQ....DAHG...CPF..RH
Q4MZT6_THEPA/228-498DK.EHA..YNIRHLYG..........KEGKRTS.....YPPYS.....CTRMIKNSPPNVSG....TAHG...CPF..KE
PRIL_HALSA/138-335GEEMTR..YQTDHIQG...........DSSPTE.....YTAPS.....CATM..............KAYG..NCV.....
PRI2_ARATH/172-438DK.EYA..YAIRHNYG..........KEGKRTD.....YTPYA.....CSKIITSAPG..AG....DHHG...CPY..RH
PRI2_DROME/194-456TR.SYE..YNIYHNYG..........KKGSMVN.....YTPYS.....CAKIIKDVAG..PG....DCHG...CPY..KN
PRIL_THEAC/126-330DENITR..YQIKHISG...........EISGTE.....YTPPK.....CETM..............RSNH..LCYM....
PRIL_METTH/183-419FEDDPQEKLNITAKLGFGVHDMPELENEGESKW.....YTPMS.....CEKI..............KIHLPDLC......
PRIL_PYRFU/131-367FEDQPNEIKNIWYHLGFGYTANPTLEDSGNSTW.....YFPPN.....CDKI..............KANAPQLC......
PRI2_DICDI/173-438DK.EYL..YNIRHNYG..........LEGKSTN.....YSPYS.....CPRIISKSPHNGDK....LVHG...CPY..IQ
Q5CW71_CRYPI/234-522DK.EIK..YNIRHAYG..........QEGKRSN.....YSPYP.....CNKIINGLPLPGNG....QNHG...CPF..KT
Q5JJ73_PYRKO/146-383FEDQPHEIKNIWYHLGFGLTDSPTMEDSGNSTW.....YFPPN.....CDKI..............RANAPQLC......
Q6C2W5_YARLI/188-453NK.EYQ..YNILHNYG..........LKGSGKN.....YAPKD.....CKSIIANNPPANSE....LVHG...CPY..RS
Q8ZVK5_PYRAE/111-307NEKITR..YQVQHIAG..........QVGGRKE.....YAVPN.....CETM..............NSWG..LCPT....
Q75DH0_ASHGO/207-483NR.EYR..YALRHTYG..........LEGNRIN.....YRPWD.....CRTILAKPRP.ARN....EFHG...CPY..RD

PF03041

O39625_GVCP/3-165------YKMDSK--------------------------------------------------------------------
LEF2_NPVLD/8-179------YERDEK--------------------------------------------------------------------
Q9WSV4_9BBAC/3-166------YQYDAK--------------------------------------------------------------------
Q9WFZ9_9ABAC/2-167------YKGETK--------------------------------------------------------------------
Q9QAB3_9CBAC/5-166------YHNEKK--------------------------------------------------------------------
Q9QPA0_9ABAC/3-170------YGFDEK--------------------------------------------------------------------
Q9YWC0_NPVBS/11-174------YDHDDK--------------------------------------------------------------------
LEF2_NPVOP/1-165------YRMDAK--------------------------------------------------------------------
Q9Q9U4_9ABAC/35-204------YQNDEK--------------------------------------------------------------------
Q9PZ08_GVXN/17-181------YCNDIK--------------------------------------------------------------------
LEF2_NPVAC/5-171------YNHDSK--------------------------------------------------------------------

PF04104

Q6BXE4_DEBHA/218-500......LSVDALVNNLN.........EMG..INDQQDING.................VIDDVSRNDYTVACTRVFEMTHK
Q7Q5K2_ANOGA/192-455......LDSSTLKMKLT.........GYG...LSAIDADE.................VAGYATKGHYQIACGKYFEVVHE
Q4DEH8_TRYCC/235-525......KDEGAFRSMLLKEQLNPLGKEHPPLRPSASDIEE.................IVQDCKGQHYTRACYKYFVATHP
Q2URN0_ASPOR/198-484......FSVDNLIGLLQ.........STG..VSDRELLRG.................VREDVEKTRYHIACNRVFEWTHK
Y701_METJA/142-388.......KPDEL....................................................................
PRIL_ARCFU/173-363................................................................................
Q69PX2_ORYSJ/177-443......FGEDNLRAALN.........KMG...ISGHPLEE.................IMDKVKNRHYQLACTMTFEAEHG
Q8SRV4_ENCCU/143-386.......DPEHIRERIK...............DVGADIED.................IMG...EGPFNGKCTRLLEKLTC
PRIL_SULTO/138-301................................................................................
PRIL_METKA/207-398................................................................................
E9ACF6_LEIMA/237-526......RDEGALRTMLGKETENPKGCDYPSVRPTPGDIED.................IVSDSKAQHYTRACYKYFMATHP
Q6M1A7_METMP/114-360.......RPDST....................................................................
Q4XXL6_PLACH/149-419......FDEPHLKSLLF.........FFG...LNDDQIKA.................IMPFKKNNEYQLACVKFFTETHP
Q4P7R1_USTMA/205-486......FSTTNLSTAMV........QHYG...LNQAEQSE.................ILASVKQGHYHVACTRIFEITHQ
PRIL_PYRHO/131-367.......TPDKH....................................................................
Q919P4_NPVCO/9-204................................................................................
Q6L0D5_PICTO/111-313.......DDDPL....................................................................
PRIL_METBF/127-327.......GKDRL....................................................................
PRI2_SCHPO/186-453......YSVNNLVSALA.........SMGI.APDSAGCRE.................VVEAVKARHYHIACTRVFELTHP
Q5ZM06_CHICK/182-448......SDPELLKQKLQ.........SYK...VPPSGVTQ.................ILELVKGMHYQLACQKYFELTHD
A8B5U6_GIAIC/227-526MYDKNTGDPTRLKTFLQ........NNYRV.TAYERDIEDKILCAVSNHQDKGWLGYITAPLREGEPKVACNHLFELVHG
Q6FLP8_CANGA/212-487......WNHDRLTSELS.........KMG...LTTQQITD.................VLDSCDKHEYTIACTKVFEMTHN
PRI2_YEAST/223-504......WSHERLSAELR.........SMK...LTQAQIIS.................VLDSCQKGEYTIACTKVFEMTHN
PRIL_THEVO/115-319.......DDDKL....................................................................
PRIL_SULSO/136-302................................................................................
PRIL_HALMA/135-332.......NMDDL....................................................................
Q4RQ99_TETNG/188-454......SDPELLKQKLQ.........VYK...VPPSGIGQ.................ILELVKGMHYQLACQKYFELTHN
PRI2_RAT/182-448......SDAELLKQKMQ.........TYK...IPASGISQ.................ILDLVKGNHYQVACQKYFEMTHN
Q3ITU9_NATPD/139-334.......DPDET....................................................................
Q6CL91_KLULA/208-479......YHPDKLVATLK.........EMS...LTQQQVNS.................VVESCQQQDYTIACTKVFEAVHK
PRI2_CAEEL/201-472......SEKQVLKQKLG.........SDA..ILKKEQIER.................IAELAELNQYDKACTRYFEFMHN
Q649Q2_9ARCH/133-334.......GSDDI....................................................................
Q5A1D4_CANAL/229-511......FNLDVLINNLN.........NMG..ITDQQDLNS.................IVDDVNKHDYTIACTRVFELTHQ
Q38BT5_TRYB2/235-528......KNESAFRGVLLKEQLHPLGKGHSSIRLAASDIED.................IIQDCKGQHYTRACYKYFMATHP
Q5KAH0_CRYNJ/196-478......FSPENLTTFLTNT....YPDHFS...RTSPEMRD.................ILDSVKASHYHVACTRVFEVTRG
Q4MZT6_THEPA/228-498......LDPKSLYQLLQ.........EFG...LNSTQIEP.................IIDLKTSFQFQLACVEYFNQTTP
PRIL_HALSA/138-335.......NPDDL....................................................................
PRI2_ARATH/172-438......FSEDNLKAALS.........RMG...LSSRGMED.................VMDKVRNRHYQLACTLTFEAVYG
PRI2_DROME/194-456......MDQGSLKTKLS.........SYG...LSASAIDE.................VMFFVSRGHYQIGCGKYFQLTHN
PRIL_THEAC/126-330.......DDDPL....................................................................
PRIL_METTH/183-419.......RPDKL....................................................................
PRIL_PYRFU/131-367.......TPDKH....................................................................
PRI2_DICDI/173-438.......SLERLEQKLL.........DLG..IDDFQRIQI.................L..EATKTSPNVACTKHFNFLHP
Q5CW71_CRYPI/234-522......FDNYPLQKLLQ........TYYGH.IIPNEDIKN.................ITQLSKSGHYQLSCIQLFKSLHL
Q5JJ73_PYRKO/146-383.......KPDKY....................................................................
Q6C2W5_YARLI/188-453......LRPEELVGRLK.........NMG..IEDRMELNK.................ITDQVKNTNYHGACTRVLELTHP
Q8ZVK5_PYRAE/111-307................................................................................
Q75DH0_ASHGO/207-483......WAPDRLAAALA.........AMQ...LAPPAVAA.................VRDACARREYTLACTHVFDACHG

PF03041

O39625_GVCP/3-165--------------CVSQVD-------G
LEF2_NPVLD/8-179--------------CVREMM-------S
Q9WSV4_9BBAC/3-166--------------CVAEIN-------Y
Q9WFZ9_9ABAC/2-167--------------CVNEVL-------H
Q9QAB3_9CBAC/5-166--------------CMTQLK-------H
Q9QPA0_9ABAC/3-170--------------CVQEFD-------R
Q9YWC0_NPVBS/11-174--------------CVREFH-------A
LEF2_NPVOP/1-165--------------CVGEVT-------H
Q9Q9U4_9ABAC/35-204--------------CVREFQ-------S
Q9PZ08_GVXN/17-181--------------CEREVD-------Y
LEF2_NPVAC/5-171--------------CVGEVM-------H

PF04104

Q6BXE4_DEBHA/218-500NQLDK.....SNKATEGMHI.NHPNLYF
Q7Q5K2_ANOGA/192-455T.............KLEEGI.NHPNQYF
Q4DEH8_TRYCC/235-525G.............VKRDTLFRSPFEYY
Q2URN0_ASPOR/198-484AEIKRVKEDGTWNQTDLDTI.VHPNTYF
Y701_METJA/142-388..............CKKKFI.IHPLDYL
PRIL_ARCFU/173-363..............VADCRV.SHPLIYY
Q69PX2_ORYSJ/177-443V.............SCDTGI.NHPNQYF
Q8SRV4_ENCCU/143-386R.............KQSRLV.ATPVRYY
PRIL_SULTO/138-301..............VASCNT.LNPLQFY
PRIL_METKA/207-398..............GKDCGV.KNPLAYY
E9ACF6_LEIMA/237-526G.............ARRDTLFRSPYEYY
Q6M1A7_METMP/114-360..............CSRKDI.IHPLDYL
Q4XXL6_PLACH/149-419N.............SPGDGVGNHPNSFY
Q4P7R1_USTMA/205-486RQGVKK...GQGLDGRGETV.THPNRYF
PRIL_PYRHO/131-367..............CKY..I.RNPLTYY
Q919P4_NPVCO/9-204..............GECGEV.RNPMVLF
Q6L0D5_PICTO/111-313..............CRQ..V.KHPLQYY
PRIL_METBF/127-327..............CEK..I.NHPLAYY
PRI2_SCHPO/186-453NV...........GSLEESI.HHPLQYF
Q5ZM06_CHICK/182-448V............DDIGFSL.NHPNQYF
A8B5U6_GIAIC/227-526..............DVRIDL.MHPVKFF
Q6FLP8_CANGA/212-487VP...........EGESMHI.SHPNLYF
PRI2_YEAST/223-504SASA......DLEIGEQTHI.AHPNLYF
PRIL_THEVO/115-319..............CHQDWM.KHPLTYY
PRIL_SULSO/136-302..............VSSCNV.KNPLQLY
PRIL_HALMA/135-332..............CEA..I.SHPMGYY
Q4RQ99_TETNG/188-454V............EDVSFSL.SHPNQYF
PRI2_RAT/182-448V............DDCGFSL.NHPNQFF
Q3ITU9_NATPD/139-334..............CNR..I.QHPLSYY
Q6CL91_KLULA/208-479T............TTADLQI.VHPNQYF
PRI2_CAEEL/201-472LE..........EGGLGQLI.THPNQFY
Q649Q2_9ARCH/133-334..............CEK..I.SHPLNYY
Q5A1D4_CANAL/229-511KQLM.......GKENMNMHI.NHPNLYF
Q38BT5_TRYB2/235-528G.............ARRDTLFRSPHEYY
Q5KAH0_CRYNJ/196-478VKKG.......EGLGNGESV.SHPNKWA
Q4MZT6_THEPA/228-498N.............ACADGIGTSPNTFF
PRIL_HALSA/138-335..............CDA..I.NHPLSYY
PRI2_ARATH/172-438T.............SCDTGI.NHPNQYF
PRI2_DROME/194-456S.............PVEPSI.NHPNNYF
PRIL_THEAC/126-330..............CHREWM.KHPLTYY
PRIL_METTH/183-419..............CSS..I.SNPLTYY
PRIL_PYRFU/131-367..............CRY..I.RNPLTYY
PRI2_DICDI/173-438N............NTLTKLI.NHPNQFY
Q5CW71_CRYPI/234-522K.............SDSDGIGNHPNSYF
Q5JJ73_PYRKO/146-383..............CRG..I.KNPLSYY
Q6C2W5_YARLI/188-453G............LKVEEVV.QHPNDYF
Q8ZVK5_PYRAE/111-307..............NLGCGV.KNPLQYG
Q75DH0_ASHGO/207-483HVAPSA..PGHVPAPDMSHI.VHPNQFF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window