Sequence alignment for CL0243

PF01896

VG63_ICHVA/354-534FDIDRKFSGLLD.-.PMGAIDNICEIFVAFLHRAVEKFFNFNR----VDK--NRIG----------EVAVFVR----RAA
Q98518_PBCV1/74-236LDI...LTTREN.-...................AKKMTTGVFT----DEI--K...----------.NVFYTI----CV.
PRIPO_HUMAN/113-234FDLE..FNKPAN.-....PGADGKKMVALLIEYVCKALQELYG----VNC--SAED----------VLNLDSS----TD.
PRIM_OSHVF/83-231FDMD..FKSKDEF-GFGCDIPP.NQVVVMFMEELQLFVNKLIG----HDS--GKF.----------.NAKEVL----ITQ
Q8QNM0_ESV1K/68-345FDVD..MLDTDV.-.......LGVEASSRIFSVIQSVIKSYYA----GDQ--NDD.----------.......----...
VF184_IIV6/68-257VDID..LKKEVNG-YPNYGSNDFYND..EDIINVVKIFQNAVS----ENV--NRH.----------.AKKLTN----KN.
D5_FOWPN/70-218FDVD..MDGRLD.-.......DKYQATHNFVNIITKFV.....----ADY--AYND----------CKMISNH----RD.
B3ENE3_CHLPB/152-266LVID..FDDAE..-...............WRDDAQAFMETS..----GSL--TIP.----------.ASFEIS----RS.
Q30YF6_DESAG/146-260LAAD..FDEAD..-...............WREDARAFMQSC..----REL--AIP.----------.AALEIS----RS.
Q6R7G2_OSHVF/509-680FDID..LSPTPM.-...RNDLNITKLCKDIVDLTNMVLDKLAP----VVS--SKN.----------.VTHYLF----HSE
Q3IV37_RHOS4/113-247IDHD..GLQDGTC-LSREDLLERLYACAPSLRQVKILALPSSS----SHI--CRT.----------.DTGEDL----TG.
Q4QB95_LEIMA/176-313MDID..AQVPQEY-WTMSKIRVYQRKVLDDVLTPLKEEIEKIG----EEI--ETQ.----------.VVLQSP----NL.
Q5Z219_NOCFA/139-260FDLD..PGPGVGL-PECAE...............VALAVRDMI----EDI--GM..----------.HAFPVT----SG.
Q82MG4_STRAW/134-256LDLD..PQPGTD.-.............YADAVRAAHELRAVL.----HEY--GDL.----------.RGWPKT----SG.
Q5Z031_NOCFA/140-262IDLDP.MPDCP..-.............WSRVQRVAGVVQEVL.----GEL--GAV.----------..GWPKT----SG.
Q9ZC15_STRCO/150-270FDLDPAQDDFEA.-................VRAAARLLAGLL.----DEL--KLP.----------..SAPMT----TG.
Q98DP8_RHILO/666-787FDLD..PDEGVD.-.............VKAVREAALDIRGKL.----DEL--SLP.----------..NFVKT----SG.
Q3J300_RHOS4/693-814FDLD..PDEGLD.-.............FAHVRTAAAELRGLL.----TDL--GLP.----------..SVPML----SG.
Q54MM7_DICDI/132-357FDID..VDDYNPI-RVCCSSTSLCEKCWGFLAVSAEFIDNYLR----ECF--GFQ.----------.QIMYVF----SG.
A8XA78_CAEBR/105-345FDID..LTDYDNI-RNCCKEATVCPKCWKFMVLAVKILDFLLD----DMF--GFN.----------.ARMWVF----SG.
PRI1_CAEEL/105-345FDID..LTDYDPV-RNCCKDATVCPKCWKFMVLAVKILDFQLE----DMF--DFK.----------.ARMWVF----SG.
Q8SRD5_ENCCU/91-243FDVD..LTDYP..-RECCSEKLVCNRCLVLIKAAVEILNYSLR----EEF--GFK.----------.DVGFVF----SG.
Q6CF04_YARLI/130-364FDID..MDDYDKF-RTCCSGASVCNKCWRYVQVAVKMVNSALK----EDF--GYK.----------.HIMWVF----SG.
Q6CVI9_KLULA/134-371FDID..MDDYDSY-RTCCSGAQVCPKCWHFIKLAMKVINSSLE----NDF--GFD.----------.EFIWVF----SG.
Q6FKQ9_CANGA/110-346FDID..MDDYDTF-RTCCSGAQVCYKCWRFISLAMEIINVALK----EDF--GYN.----------.DFVWVF----SG.
Q5AJZ0_CANAL/124-362FDID..LTDYDDI-RTCCQGTDICCKCWKFIQVGSKIIEAALR----EDF--GFE.----------.HLVWVF----SG.
Q6BRU1_DEBHA/140-384FDID..LTDYDDI-RTCCSGTDICKKCWKFIQVASKIIDQALR----EDF--GFK.----------.HLIWVF----SG.
PRI1_SCHPO/130-363FDID..MTDYDDV-RTCCSKTNICEKCWPFITIAVQVLDICFH----EDF--GFK.----------.HILWVY----SG.
Q5CQA3_CRYPI/92-326FDID..MNDYDDI-RTCCQEKTICEKCWLYVTVAIRLIDTSLR----QDF--GFK.----------.HILWLY----SG.
Q7Q633_ANOGA/117-350FDID..MTDYDDI-RTCCNEANVCQLCWKFMSIACRVLDEALR----EDF--GFE.----------.HLLWVF----SG.
PRI1_DROME/126-364FDID..MTDYDEV-RTCCSGAGVCLKCWKFMVLAARVLDVALR----EDF--GFE.----------.HIIWIF----SG.
Q7UJ06_RHOBA/82-191FDID..REGDID.-...............SATQDARRLAMMLV----ERY--RIDE----------SELLLFF----SG.
Q6MJT8_BDEBA/62-177IDID..SKDLEA.-...............SLTVTIAIVKEFIE----KGL--TFD.----------KDFSVAF----SG.
PRIS_AERPE/96-266FDID..VDSLEG.-...CGEVLGDSCLSRGYKQAVRLVEALY.----RDF--GVP.----------..STLYF----TG.
Q81EV1_BACCR/73-211FDLD..HAEDPS.-..............VSQKDAIKLVE.FFT----KEM--DIRE----------SDMWIYF----SG.
PRIS_PYRAE/87-245FDID...GDHLDT-EACRESKIVSLRCLEDAREEANKLIDVLI----QEL--DLK.----------.PTRIVF----SG.
PRIS_ARCFU/95-273FDID..ADHLPV.-.....KAQSFEKALEMAKREIKKLTAVLR----ADF--GIR.----------.DMKIYF----SG.
PRIS_METAR/97-336FDLD..ADHLPG.-...VKNMTYGEMLDNVKVEIIRLIDEFLI----DDL--GFRE----------KDMDIVF----SG.
PRIS_THEAC/85-256FDLD..SDHLPG.-...SEKLSQKEMLIQIRDQTERLVSDFLI----ADF--GIPK----------SSIKIYF----SG.

PF03090

Q88BW7_PSESM/60-189TRVR--PREYALR.YPYMQVNRPGMVSWLVFDLDHA.NAL.AW....DDA..GLP...........APNLMVR....NR-
W5XWL3_9CORY/13-160NLYR--IDSDKLGRCEYVMLTSKQYASVMVIDVDQIGKAGGHP....ENLNSYVKGVIWALVQHGIGPAWAGI....NP-
A1U7R1_MARHV/39-170..TR--PKELAVR.HPYIQVNPKCLVSWLIFDLDDV.EDWYSW....ETA..DLP...........PPNLVVR....NR-
Q8FLI2_COREF/69-215RMYR--VDSEALGKCEYVQLTNKQYASVLVVDIDLPGDAGGHP....VNLPEQVKQKFSQLIAHYLGPAWVGI....NP-
W5Y4I6_9CORY/44-175IYRT--SRKNALD.KRYVEANPDALSNLLVVDIDQE.DALLRSLWDREDW................RPNAVVE....NP-
J9E5Q3_WUCBA/41-173IQHH--PRQKALK.RAYIDPNPSALVWAMVFDVDRP.EAATAW....QDAPTECP...........RPNWVTQ....NP-
B2VJT7_ERWT9/27-157VRIA--GKERAIL.AKYIQFNQPHAMFWLGFDVDRL.GAAIDW....SDR..NAP...........APTLTIT....NP-
Q3L8W9_RHOE4/34-165QYRM--SRDDALA.MRYVEHSPHALLGSIVIDCDHV.DAAMRA....FEQPSDHP...........APNWVAQ....SP-
Q145D4_BURXL/27-156LKVR--KKQDAIS.YNYVGLNKP.LTKYIALDLDKGVESTYMF....EKK..NLP...........VPTLIVI....NR-
D5X778_THIK1/26-158.LIR--SRARALQ.FPYIQVNPPKLRFWLPFDLDKP.GGAVAW....EDA..LLP...........PPAVAIG....NP-
S6AZ16_PSERE/25-155LKIN--KKEKAAL.ARHIQPNGPTHKLWLVYDVDRR.DAGLHW....EQV..GAP...........PPNLIAR....NP-
W0DSF8_9GAMM/25-153ARVL--PREYAIK.QPYMQVNQPGLASWLVFDLDHT.NSW.IW....EDE..GLP...........EPNLIVS....NP-
A5WI41_PSYWF/38-192IFVR--SKKQAIK.HRFIQPNHPCVIKWLVFDIDHP.DALFTF....IDT..GLP...........KPQVIIK....NP-
F5Z415_ALTSS/43-176.TYR--YRFSALQKYLHIQVNPINTKCWLIFDLDGT.DPF.IW....EDK..LLP...........PPNIIVSGQGPKA-
H2G1Y5_OCESG/28-158LFIA--GAVRAAQ.ARYVQPNGPTHRYWLVFDVDRP.GALLDW....DDR..GAP...........APNIAVI....NH-
V9XSH1_9NOCA/31-163VYRM--PRHDALE.RRYLEANPQALSNLLVVDVDHP.DAALRT....LSAAGNHP...........LPNAIVE....NP-
B2UGA9_RALPJ/26-155TKFR--KREKVDQ.FAYCGLNPM.YRSYLSFDLDMP.GSAFRF....EDA..HLP...........PPTIITI....NP-
C6WSQ5_METML/26-154TKFR--KREKVQQ.FAYCGLNPM.YRQYLSFDLDEQ.GSAFKF....EDV..NLP...........PPTIITI....NP-
Q93MK3_CORJK/102-249KLYR--VETDAMRRCQYVVLTHKQRASVVVIDIDRRGHSGGRV....EDIDSKVYDKLSLLAAGNISPAWIGV....NP-
D5X745_THIK1/44-173TRVR--PREYAIR.YPYMQVNRPGFVSWLIFDLDHA.KAM.IW....EDA..GLP...........APNLIVR....NR-

PF01896

VG63_ICHVA/354-534.........LPGK--FSARFTWFPAYELC..FQNIREAADFTGVFQELL.........................ME....
Q98518_PBCV1/74-236.........ATAM--MFD...ITKTTVTM..CISNIPKKKDDGVKVGVH.........................LT....
PRIPO_HUMAN/113-234.........EKFS--QHL...IFQLHDVA..FKDNIHVGNFLRK....................................
PRIM_OSHVF/83-231CKRLDRP..DKHS--FHL...VYPKIVFR..NITQMRAFVLSFGHYLF................................
Q8QNM0_ESV1K/68-345.........R...--FRC...VVCDTTVKKVPSSDGEIALTKNGYHVIYPNLRINLSQALQLRYSVVNELEKTLGPRADG
VF184_IIV6/68-257.............--LRC...VVLEKDIFIERINESEDKYIVKKGIHLH..........................F....
D5_FOWPN/70-218.........KDKM--ITD...MKSNFSIT..ESTDKEKTSFHLIFFNCY.........................TT....
B3ENE3_CHLPB/152-266.........GNG.--AHI...WIFFADAI..PARDARQLGAA......................................
Q30YF6_DESAG/146-260.........GNG.--AHA...WIFFAEPV..PAREARQLGAA......................................
Q6R7G2_OSHVF/509-680MPDPDQPKEKYG.--IHH...HVRLPDNV..VMTTEVVGCIVNVLGQI..........................RY....
Q3IV37_RHOS4/113-247.........ARG.--LHL...YIPVKDAR..DIPRIGKVLTDL.....................................
Q4QB95_LEIMA/176-313.........KKAS--FHV...HTRLKDAA..FAD..........FYSLH.........................GF....
Q5Z219_NOCFA/139-260.........SKG.--IHL...YVPLDRVL..SPGGASTVA..................................KQ....
Q82MG4_STRAW/134-256.........GRG.--LHV...FVPIERRW..TFTQVRRAAIA......................................
Q5Z031_NOCFA/140-262.........GKG.--LHV...YVRIAPQW..SFTELRRAALA......................................
Q9ZC15_STRCO/150-270.........SRG.--LHV...VVPLDGRQ..DFDDVREFA..................................RA....
Q98DP8_RHILO/666-787.........GKG.--YHV...LVPLKPSA..DWEAVKTFAHD......................................
Q3J300_RHOS4/693-814.........GKG.--VHV...IVPLKPKA..EWESVKLFS..................................RA....
Q54MM7_DICDI/132-357.........RRG.--LHI...WVSDRAAQ..HLTRENRASILN.HIRVE..LS.....................QN....
A8XA78_CAEBR/105-345.........RRG.--VHC...WVGDKKAR..MLTNNHRSAVAT.RLNLFKKNGQFEATEGKAK...........NT....
PRI1_CAEEL/105-345.........RRG.--VHC...WVGDKKAR..MLNNYQRSAIAT.RLNLFKKNGQCEVTEGRAK...........MT....
Q8SRD5_ENCCU/91-243.........RRG.--VHC...WVFDDEAL..ELSDLERGEIVKYYDSVA........................KKK....
Q6CF04_YARLI/130-364.........RRG.--AHA...WVSDKKAR..DLNDRQRSTVVSYIAAFGDATDKSAAGNSSLR...........RP....
Q6CVI9_KLULA/134-371.........RRG.--AHC...WISDKRAR..VMTDSHRKNMLD.YMNVVRDRNIEKRLNLVRP.................
Q6FKQ9_CANGA/110-346.........RRG.--AHC...WVSDKRAR..ALNDIQRRNVLD.YLNVVRDRNYDKPLSLK.............RP....
Q5AJZ0_CANAL/124-362.........RRG.--AHC...WVSDKRAR..ELDETSRKAIID.YLDVLSSKNQNGSLNIKKP.................
Q6BRU1_DEBHA/140-384.........RRG.--AHC...WVSDNNAR..TLDEITRKSIVEYLDVLGSKQSKIGKKSLNLK...........RP....
PRI1_SCHPO/130-363.........RRG.--IHA...WICDEIAC..SLDDRSRRMIAS.YLQVVVGNPQGGVRLINNLK..........RP....
Q5CQA3_CRYPI/92-326.........RRG.--VHC...WVCDTKAR..LLPSEARTAIID.YLTLV..TG...NENRKKKVNLKTSNNQNGIK....
Q7Q633_ANOGA/117-350.........RRG.--IHC...WVSDKAAR..HLDTAARSAIAM.YLNLL..ISG..GEGTASRVII.......HDE....
PRI1_DROME/126-364.........RRG.--IHC...WVCDYQAR..HLDGRGRYAVAE.YLNII..TYASFAGGNSPRCSM.......GDR....
Q7UJ06_RHOBA/82-191.........SKG.--FHI...GLPTS.....LFDVEPSIEFGS.....................................
Q6MJT8_BDEBA/62-177.........SKG.--FHI...LLNTKAIF...................................................
PRIS_AERPE/96-266.........NRG.--FHV...LADCGWCR..RLGREERREIAR.YFTLE.........................GL....
Q81EV1_BACCR/73-211.........SKG.--FHI...LISSD.....ALGIEPRNDLHKIFKHMA.........................GY....
PRIS_PYRAE/87-245.........NRG.--FHI...HVSSEEVM..KLGSRERRELVNYLKAVG.........................FD....
PRIS_ARCFU/95-273.........GRG.--YHV...HVHDEEFL..SLGSAERREIVD.YLRLNSPK......................IV....
PRIS_METAR/97-336.........GRG.--YHV...HVRDERVR..TLKSPERREIVDYLLGTGLEPDRMFIRTNQRIDTGTTSVAGVWLIR...
PRIS_THEAC/85-256.........NRG.--YHV...HISDDRVY..RLGSDARREITD.....................................

PF03090

Q88BW7_PSESM/60-189---------KSGH..SQL---FYAV.PS..VCTTENARTKPIQ-------------------------------------
W5XWL3_9CORY/13-160---------ISGK..AQF---IWLI.DP..VYAGKNHTSRNME-------------------------------------
A1U7R1_MARHV/39-170---------QGDHRSEHW---YYAI.TP..VAKGPNAREKPLA-------------------------------------
Q8FLI2_COREF/69-215---------VNGK..CQA---IWLI.DP..VYADASGQSRAMT-------------------------------------
W5Y4I6_9CORY/44-175---------LNGH..AHA---VWALAEP..FTRTEYAKRKPLA-------------------------------------
J9E5Q3_WUCBA/41-173---------RNGH..AHL---GYVLASP..VSRTLKARATPQR-------------------------------------
B2VJT7_ERWT9/27-157---------ENGH..AHL---LYALKTS..IRTAPDGKMKPLK-------------------------------------
Q3L8W9_RHOE4/34-165---------.SGR..AHI---GWWL.GPNHVCRTDSARLTPLR-------------------------------------
Q145D4_BURXL/27-156---------ETGN..CHY---LYGLKKP..VSFYKNSRLRPQS-------------------------------------
D5X778_THIK1/26-158---------HNGH..AHL---LWGLEAP..VATGDAARAAPLR-------------------------------------
S6AZ16_PSERE/25-155---------ANGH..AHL---LYGLHTP..IRTAIDGKTAPLR-------------------------------------
W0DSF8_9GAMM/25-153---------KNGS..SHI---FYAI.KP..VCTSDNAHLKPIR-------------------------------------
A5WI41_PSYWF/38-192---------KNGH..AHY---AYRLTTP..VGIGGNSSTKAES-------------------------------------
F5Z415_ALTSS/43-176---------KLQQISAHL---FYAI.QN..VPTSRNSRRKPIN-------------------------------------
H2G1Y5_OCESG/28-158---------DNHH..GHL---IYGLDVP..VRTAPDGKVAPLR-------------------------------------
V9XSH1_9NOCA/31-163---------RNGH..AHA---VWALTEP..FTRTEYARRKPLA-------------------------------------
B2UGA9_RALPJ/26-155---------ENAH..CHM---LYRLVTP..VAFTKNARSGPQD-------------------------------------
C6WSQ5_METML/26-154---------VNKH..CHY---LYHLNTP..VAYHESSRSKPQQ-------------------------------------
Q93MK3_CORJK/102-249---------INGK..CQL---IWLI.DP..VYADSRADSANIR-------------------------------------
D5X745_THIK1/44-173---------QSGH..SHL---YYAI.PP..VCTTEAARSKPIA-------------------------------------

PF01896

VG63_ICHVA/354-534.........EDSFFVYTVTNDGVSTRVCAIDAQP...................FCRNKSCRLPNST---K-ME.......
Q98518_PBCV1/74-236.........FDNIFVTSPTALHVREKVLETLVCEHNPFDN.............TWDSIVDVSVFKG---S-GM.......
PRIPO_HUMAN/113-234.....................................................ILQPALDLLGSED---D-DS.......
PRIM_OSHVF/83-231.....................................................EEKHMMSLAFQKK---G-KN.......
Q8QNM0_ESV1K/68-345MNAWSDVIDRAPYTSGLKMCGSFKRVKCTDCKKADPTFKDKKKALLA......EMAKLRRKIFPRE---P-GFDYTDLSD
VF184_IIV6/68-257.........PHLFLPKKDIKNSFMPVVKTMIDQENVFQD..............FINSMDNQIMPSS---L-ID.......
D5_FOWPN/70-218.........LDTLINMRKKLIVLTKE...........................SNNRLVKAIDTSV---Y-RH.......
B3ENE3_CHLPB/152-266.....................................................LISRTCERTRQLS---M-SS.......
Q30YF6_DESAG/146-260.....................................................LISHTCDRTRQLS---L-TS.......
Q6R7G2_OSHVF/509-680.........LYPDTIGLFAGKKNYDVYDSCIY.....................SIKENDGSISTTN---L-AN.......
Q3IV37_RHOS4/113-247.....................................................LWLGDQGYVRIAS---N-GA.......
Q4QB95_LEIMA/176-313.........LFRFQDR.....................................LPNVDLQIYRPNG---M-LR.......
Q5Z219_NOCFA/139-260.........VATNLEKL....................................RPDLVTATMAKAV---R-RG.......
Q82MG4_STRAW/134-256.....................................................AGRELERRMPDQV---T-TA.......
Q5Z031_NOCFA/140-262.....................................................FAKEVERRAPDDV---T-TT.......
Q9ZC15_STRCO/150-270.........VADVLAAA....................................HPDRLTTAARKKD---R-GD.......
Q98DP8_RHILO/666-787.........FAKALEQG....................................APDRYTATLSKKA---R-TG.......
Q3J300_RHOS4/693-814.........LATHLAQE....................................APDRYTATMAKAG---R-KG.......
Q54MM7_DICDI/132-357.........QIPILKRS.FDQILLPHFEKCIIEEQQIFTNE..........K.QRKNFLSLLPISY---.-KRQDRKITL
A8XA78_CAEBR/105-345.........RVPPIVRDAYNIAMKDGTFGEMVLEQGWLENDDFL.........KDELLLTDKGKKE---L-IE.....NL
PRI1_CAEEL/105-345.........KVPPIVRDAFNVALKDGVFEKMIYDQGWLDKEDFI.........TEYKFMSEVGRDD---L-RS.....LS
Q8SRD5_ENCCU/91-243.........KYPEEYRR....................................ILRKYSSLLGDKD---L-ED.......
Q6CF04_YARLI/130-364.........LHPHLQRC..LDIATTVFNEVVLQTQDPWANEE...........GSKFLLAFIPDEK---L-RR.......
Q6CVI9_KLULA/134-371.........LHPHLSRS..LEILKPHFVEIILREQDTWRDDEL..........AIKSLATSCHDKQ---L-SE.......
Q6FKQ9_CANGA/110-346.........YHPHLSRS..LQILKGHFVDIILEEQDPWRDDQH..........AIKTLLPAFTEKP---V-IE.......
Q5AJZ0_CANAL/124-362.........FHPHVERS..FEIVKKEFLNVILQEQDPWNTTSEETKAWK....QVDELLAFIPNKA---L-QI.......
Q6BRU1_DEBHA/140-384.........FHPHVERS..FNILKQEFVNIILEEQDPWFTSADSSSDSKAWE.KVEELLAFMPDIS---L-QE.......
PRI1_SCHPO/130-363.........LHPHLTRS..LNILKSAFVKIVLEDQDPWASKE...........GAENLLKLLPDKD---L-AS.......
Q5CQA3_CRYPI/92-326.........SHPFIDRC..FNICMQYFDQI.LENQQIFDHNSI..........HIEKVLNHLSEDT---K-VY.......
Q7Q633_ANOGA/117-350.........MHHSVRRA..YRIVAPLFEEICLVDQNMFGKPE...........GVRKLLALVQDAS---V-RA.......
PRI1_DROME/126-364.........PHHSLKRA..LKIVEPMFEEIVLEDQNLFGTPK...........GVTKLLNMVHDDA---A-RG.......
Q7UJ06_RHOBA/82-191.....................................................VVRKLAEGLTASV---R-VV.......
Q6MJT8_BDEBA/62-177.....................................................GFIPDSDLFPPKQ---Q-KD.......
PRIS_AERPE/96-266.........RLELIIPRPGRRGVRPAPPSPDDPGLRGW...............IARAALERGVDLS---A-VH.......
Q81EV1_BACCR/73-211.........LVHRLGLTSLDLVV..............................YTEKRMIRLPNSM---H-QK.......
PRIS_PYRAE/87-245.........PSRFIAKLGRRKVVLYEEE.........................AVGNLLRIKQGVE---D-AR.......
PRIS_ARCFU/95-273.........VEDRFANSNAAKRVLNYLRKKLEEDE..................RLTSKLKIKPADL---K-KE.......
PRIS_METAR/97-336.........GFDSVPGGWDRRVARHIVEKLDQIGRLPDKDAKEALRAFSLESKDVKRILHVARDPA---S-LQKIREKGL
PRIS_THEAC/85-256............YITGNSLDETVVRRAIDMLGIASGGWPAV............VSKELGEASPANQ---R-RE.......

PF03090

Q88BW7_PSESM/60-189-----------------------------------------------------YMKAIYAAFAARL...D.AD-------
W5XWL3_9CORY/13-160-----------------------------------------------------LLKATSHELGELL...D.HD-------
A1U7R1_MARHV/39-170-----------------------------------------------------FLKAVYQGMAARI...RYAD-------
Q8FLI2_COREF/69-215-----------------------------------------------------LLAAATHDLGQWL...G.HD-------
W5Y4I6_9CORY/44-175-----------------------------------------------------YAAAVTEGLRRSV...D.GD-------
J9E5Q3_WUCBA/41-173-----------------------------------------------------FLARIQHGLTMAL...D.AD-------
B2VJT7_ERWT9/27-157-----------------------------------------------------YAAAVENALRKKL...D.AD-------
Q3L8W9_RHOE4/34-165-----------------------------------------------------YAHRIETGLKISV...G.GD-------
Q145D4_BURXL/27-156-----------------------------------------------------YLKQTTLALTHEL...E.AD-------
D5X778_THIK1/26-158-----------------------------------------------------YLAAIEGAMLAKMLPHG.AD-------
S6AZ16_PSERE/25-155-----------------------------------------------------YAGAIDNAMRDLL...N.AD-------
W0DSF8_9GAMM/25-153-----------------------------------------------------YMKAVYKAMAKAL...N.AD-------
A5WI41_PSYWF/38-192-----------------------------------------------------YLRAVKDALCEAL...G.AD-------
F5Z415_ALTSS/43-176-----------------------------------------------------FLNDIKRKMTSEL...M.AD-------
H2G1Y5_OCESG/28-158-----------------------------------------------------YAAAVEAALREKL...D.AD-------
V9XSH1_9NOCA/31-163-----------------------------------------------------YAAAVTEGLRRAV...D.GD-------
B2UGA9_RALPJ/26-155-----------------------------------------------------YFGAIQREMERRL...G.AD-------
C6WSQ5_METML/26-154-----------------------------------------------------YFEAVQDAMTHRL...A.AD-------
Q93MK3_CORJK/102-249-----------------------------------------------------LMKLVTTMLGDHL...G.GD-------
D5X745_THIK1/44-173-----------------------------------------------------YMKAVYEAFAARL...D.AD-------

PF01896

VG63_ICHVA/354-534..............................................................AGEFRGAFEYIKSYNALV
Q98518_PBCV1/74-236......RLPW..................................................SAKHDDPKRVYIPVVDYILD
PRIPO_HUMAN/113-234..........................................................................APETTG
PRIM_OSHVF/83-231...................................................................RSLGRAVFDMSPY
Q8QNM0_ESV1K/68-345IHSDEFKDAVFGDKYGKYLDLTGFNSCKMCLNTGKVMEKRTYMPCLVLDGGGDVDVSLLDVLREDYFEVMKYTSIRCQDG
VF184_IIV6/68-257...DISSKYWLMY............................................GSSKEGLNKPYKISKILDHNQQE
D5_FOWPN/70-218.................................................................KPSLRIVGTKKDSIN
B3ENE3_CHLPB/152-266...................................................................YDRLFPSQDTVPK
Q30YF6_DESAG/146-260...................................................................YDRLFPNQDTMPK
Q6R7G2_OSHVF/509-680..............................................................PNSVKMKYHGLRLPGQVK
Q3IV37_RHOS4/113-247....................................................................RLLRSPIDSTVW
Q4QB95_LEIMA/176-313......................................................................MFSCMKENRT
Q5Z219_NOCFA/139-260...K.VFLDWSQN...................................................................
Q82MG4_STRAW/134-256.............................................................WWKEERGEKIFVDYNQT..
Q5Z031_NOCFA/140-262............................................................WWRRDRDPKLLFVDYNQN..
Q9ZC15_STRCO/150-270.....................................................................RLYLDIQRN..
Q98DP8_RHILO/666-787.....................................................................KIFVDY...LR
Q3J300_RHOS4/693-814.....................................................................RIFIDW...LR
Q54MM7_DICDI/132-357TPSEDIEKKLKEI......QDENLSNSEIWFAVKSYLEDN.................NLKEHLYNLVFHYTMPRIDEPVT
A8XA78_CAEBR/105-345EGYDTPEKRWHAL..RAMFDEDYRRKLGSENEFKDYHPQGR.................DRFALHTFVLQKCYPRLDVNVS
PRI1_CAEEL/105-345ETYKTPQERWNMI..RGLFDDDYRKSLSPKDGLLDFKMQGR.................DRNYLLYFVLQRCYPRLDVNVS
Q8SRD5_ENCCU/91-243................................................................SELFEKMYLRIDKEVT
Q6CF04_YARLI/130-364....ALAEKWKKN.......GDSASSADKWSDIDKVASSGVSANLDTKR.........LVEAKQNVILTVFMPKLDGAVS
Q6CVI9_KLULA/134-371....QLKKLWTNK........PGRSSEEKWKDMDVIASQLISSFPKQRQHDYLQR...LRESKEDIIIQTLYPKLDVEVT
Q6FKQ9_CANGA/110-346....ALRKYWTEN........PNRSSKAKWGDIDTIASNLNITNKRQKEIMNNR....LREAKEDLVLTTLYPKLDVEVT
Q5AJZ0_CANAL/124-362....ELKNKWKGQ.......TFGSTSKEKWDDISTVASNVLKSNSQVAQ.........LTEAKKDIIIYYMYPRLDVQVS
Q6BRU1_DEBHA/140-384....ELRQKWKEQ.......RTLSTSKSKWEDINTIAKKTLKHQNQVNQ.........LNEAKKDIIVYYMYPRLDIEVS
PRI1_SCHPO/130-363....ALRKKWEVD........PERSSKNKWSDIDTVLASGSIASISPSV.........IAIAKQDIVLTYLYPRLDVEVS
Q5CQA3_CRYPI/92-326....QTVQNWIQK.......TSDFTCLEFWDFLSNTLQKSSD.......KS.......HLTLLKEIVFAYSYPRLDINVS
Q7Q633_ANOGA/117-350....ELEKRFKAV......AND...SKGVWKEFVAYFDELRMSGNSNRYRR.......FKFIVEEVTLAFTYPRLDINVT
PRI1_DROME/126-364....ELESYMQKN......LEDGAHSRLVWESFIKYANSMRTSTTSAWSRK.......LKNIVAEIQLGLLYPRLDINVT
Q7UJ06_RHOBA/82-191..........................................................................IDPSVY
Q6MJT8_BDEBA/62-177..........................................................LVKKIFSELVPSMSEYLDDSIF
PRIS_AERPE/96-266.............................................................EAIEDLLDDVRVAIDVKVT
Q81EV1_BACCR/73-211..............................................................TNLFKTEISVNELNKLTL
PRIS_PYRAE/87-245.....................................................................AMKVEIDEVVT
PRIS_ARCFU/95-273....KLTKKVIRA.................................................VEKFDYSALSIYIDAPVT
PRIS_METAR/97-336IELSGNLEGFFRS.............................................ILAGTIDQFKVSLAGKTDEPVT
PRIS_THEAC/85-256...SDLRKAIKRA......................................................RENHSVLIDSPVT

PF03090

Q88BW7_PSESM/60-189-------------------------------------------------------------------VDYHGGPVAKTPG
W5XWL3_9CORY/13-160-------------------------------------------------------------------PHF.AHRFSRSPF
A1U7R1_MARHV/39-170-------------------------------------------------------------------PHYANGPVAKTPG
Q8FLI2_COREF/69-215-------------------------------------------------------------------SHF.SHRFSRSPF
W5Y4I6_9CORY/44-175-------------------------------------------------------------------SGY.SGLITKNPE
J9E5Q3_WUCBA/41-173-------------------------------------------------------------------RAY.THRLTKTPD
B2VJT7_ERWT9/27-157-------------------------------------------------------------------TGY.SGLICKNPN
Q3L8W9_RHOE4/34-165-------------------------------------------------------------------FAY.GGQLTKNPI
Q145D4_BURXL/27-156-------------------------------------------------------------------IAY.AHTIVKNPN
D5X778_THIK1/26-158-------------------------------------------------------------------PGF.AGLIVKNPA
S6AZ16_PSERE/25-155-------------------------------------------------------------------IGY.SGLICKNPL
W0DSF8_9GAMM/25-153-------------------------------------------------------------------PAY.SGPVAKTPF
A5WI41_PSYWF/38-192-------------------------------------------------------------------TSY.SGNLIKNPC
F5Z415_ALTSS/43-176-------------------------------------------------------------------NAY.TGPLCKNPL
H2G1Y5_OCESG/28-158-------------------------------------------------------------------PGY.GGLICKNPL
V9XSH1_9NOCA/31-163-------------------------------------------------------------------AAY.SGLMTKNPT
B2UGA9_RALPJ/26-155-------------------------------------------------------------------TAY.NHTITKNPL
C6WSQ5_METML/26-154-------------------------------------------------------------------TAY.SHTITKNPL
Q93MK3_CORJK/102-249-------------------------------------------------------------------AAF.AHRLSRSPF
D5X745_THIK1/44-173-------------------------------------------------------------------TDFHSGPVAKTPG

PF01896

VG63_ICHVA/354-534KSNRGYSKM.NIGISRSPV------------------AFDRPSLGP
Q98518_PBCV1/74-236SENTGVVEE.PLDNEEIVK------------------.SVSSVRNI
PRIPO_HUMAN/113-234HGFPHFSEA.PA....RQG------------------FSFNKMF..
PRIM_OSHVF/83-231TRDRLFRLM.GQSKMGEPY------------------ENTLRPVKI
Q8QNM0_ESV1K/68-345EKETRGFTI.PKGVPRAPT------------------EENGANMRS
VF184_IIV6/68-257ISISKCFKS.ETCIDGSPI------------------TDTNVEFEL
D5_FOWPN/70-218IHVHKKTKQ.NIHFKN...------------------.YLFTYVDY
B3ENE3_CHLPB/152-266GGFGNLIAL.PLQKPARDK------------------.GFSVFVDD
Q30YF6_DESAG/146-260GGFGNLIAL.PLQKQPREL------------------.GRSIFVDE
Q6R7G2_OSHVF/509-680ADGKKKL....ICVYRSDG------------------LPCDAEI..
Q3IV37_RHOS4/113-247QPSRLVFAAGAICANGLEQ------------------.RRGAPVIV
Q4QB95_LEIMA/176-313SAIIVFDES.KWNIGFPGG------------------.KVSDEQAA
Q5Z219_NOCFA/139-260.NPAKTTIA.PYSLRGRAE------------------PNAAAPRTW
Q82MG4_STRAW/134-256.ARDRTIAS.AYSVRPRPH------------------APVSAPLRW
Q5Z031_NOCFA/140-262.ARDHTIAA.AYSVRGVPQ------------------ATVSTPVRW
Q9ZC15_STRCO/150-270.AYAQTAVA.PLTVRARPG------------------APVATPISW
Q98DP8_RHILO/666-787NGRGSTTVA.PYSSRAKKG------------------ATVSMPVTW
Q3J300_RHOS4/693-814NDRGSTAIA.PYSLRARPG------------------APVATPVDW
Q54MM7_DICDI/132-357IGLDHLLKS.PFCIHPDTK------------------.KLCVPLDI
A8XA78_CAEBR/105-345TGTNHLLKS.PFCIHPKTG------------------.NVAVPLNV
PRI1_CAEEL/105-345TGTNHLLKS.PFCIHPKTG------------------.NVAVPLNV
Q8SRD5_ENCCU/91-243QKTKHLIKM.PFSVHPSTE------------------.MISVPIDV
Q6CF04_YARLI/130-364RGTGHLLKS.PFCIHPKTS------------------.NVCVPMDV
Q6CVI9_KLULA/134-371KQTIHLLKA.PFCIHPSTG------------------.NVCVPITE
Q6FKQ9_CANGA/110-346KQTIHLLKA.PFCIHPATG------------------.NVCVPIVD
Q5AJZ0_CANAL/124-362RQVIHLLKS.PFCIHPGTG------------------.NVCVPFDP
Q6BRU1_DEBHA/140-384KQLIHLLKS.PFCIHPGTG------------------.NVCVPFNP
PRI1_SCHPO/130-363RHLNHLLKS.PFCVHPGTS------------------.RVCVPIDI
Q5CQA3_CRYPI/92-326KDLGHLLKA.PFCIHHSTG------------------.RLCIPIDT
Q7Q633_ANOGA/117-350KGFNHLLKS.PFCVHPKTG------------------.KVCIPFNP
PRI1_DROME/126-364RGFNHLLKA.PFCIHPATG------------------.KVCVPFSV
Q7UJ06_RHOBA/82-191GKVQPL.RA.PNSRHGKTG------------------.RHKRILTF
Q6MJT8_BDEBA/62-177.GTHRMMRA.EYSINNKSG------------------.LYKTPLTL
PRIS_AERPE/96-266QDISRLARI.VGSLNGKAG------------------.LLVARLGL
Q81EV1_BACCR/73-211EEIKDLAKS.PRHADD...------------------....LPYTA
PRIS_PYRAE/87-245QDIHRLIRA.PGSLNGKTG------------------.LVALPISL
PRIS_ARCFU/95-273ADVKRLIRL.PGSLHGKTG------------------.LRVTEVED
PRIS_METAR/97-336ADIKRLIRL.PGSIHGGSS------------------.FRVTPLTR
PRIS_THEAC/85-256YDIHRIIRM.PNTLHGKSG------------------.LIVKEVEI

PF03090

Q88BW7_PSESM/60-189H......PWWETTEFHSHV..................YELGELASA
W5XWL3_9CORY/13-160Y.TGKSPEAYRWYCQHDRV..................IRLQDFL..
A1U7R1_MARHV/39-170H......RFWSTLEIHDHE..................YSLGELAEY
Q8FLI2_COREF/69-215Y.TGDSPTAYRWYRQHHRV..................YRLADL...
W5Y4I6_9CORY/44-175H......TAWDSHWITDKL..................YTLDELRFW
J9E5Q3_WUCBA/41-173H......PTWRTFWERPDP..................YELGELRDY
B2VJT7_ERWT9/27-157H......GHWKIAVWQPEL..................YTLDWLADS
Q3L8W9_RHOE4/34-165H......PDWETIYGPATP..................YTLRQLAT.
Q145D4_BURXL/27-156S......KYWKILENDVY...................YDLEDFEEY
D5X778_THIK1/26-158H......EKWRTHWGPPHL..................YGLGELAEW
S6AZ16_PSERE/25-155N......PHWIVKQWEPEL..................YTLDGLADY
W0DSF8_9GAMM/25-153H......AWWRTAELHTYE..................YELGDLAKS
A5WI41_PSYWF/38-192YIKDNAPTPKKTHWLNNNEDEGDRDEHETYLTGAQPSYTLAELADY
F5Z415_ALTSS/43-176H......PFWKTSFLHDHE..................YNLNELND.
H2G1Y5_OCESG/28-158S......GHWQVQVWEPRP..................YDLAWLSEY
V9XSH1_9NOCA/31-163H......SAWATHWIHPAP..................RSLAELEHG
B2UGA9_RALPJ/26-155N......PRWKVITHPAAK..................YHLGDFLEW
C6WSQ5_METML/26-154H......TRWQVITNNAS...................YDLGDFLEY
Q93MK3_CORJK/102-249Y.NGDDPTAYRWHVQHHRI..................DRLSHLR..
D5X745_THIK1/44-173H......PWWLTHELHAHV..................YELGELADY

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window