Sequence alignment for CL0245

PF02645

Y1149_STRPQ/3-279----------------------------------------------TIKIV--------------------------T--
Y1667_STRPQ/2-283----------------------------------------------TFTIM--------------------------T--
Y1478_STRPQ/2-279----------------------------------------------TWKIV--------------------------T--
Y586_STRPQ/2-281----------------------------------------------KLAVI--------------------------T--
Y1557_STRPN/2-281----------------------------------------------KLAVF--------------------------T--
Y3627_BACHD/3-282----------------------------------------------KIAIV--------------------------T--
Y2509_CLOPE/3-280----------------------------------------------KIAII--------------------------T--
Y1903_DEIRA/1-281----------------------------------------------MIAVT--------------------------T--
Q65EA6_BACLD/2-280----------------------------------------------KTAVV--------------------------T--
Y2514_LISMO/4-283----------------------------------------------KIAVV--------------------------T--
Q9I599_PSEAE/2-314----------------------------------------------RIGLV--------------------------V--
Y500_DEIRA/6-281----------------------------------------------SFAVV--------------------------T--
Y2569_STRCO/4-281----------------------------------------------HVAIV--------------------------T--
Y359_MYCPU/2-276----------------------------------------------KIAIV--------------------------I--
Y326_MYCGE/3-293----------------------------------------------KTAII--------------------------T--
Y1986_DEIRA/2-279----------------------------------------------SIAIV--------------------------T--
Y1468_THEMA/2-284----------------------------------------------KVKIL--------------------------V--
Y472_MYCPN/2-290----------------------------------------------KTAII--------------------------T--
Y3284_CLOAB/2-281----------------------------------------------AVKIL--------------------------T--
Y701_CLOAB/3-278----------------------------------------------KIKIV--------------------------T--
Q8RHS1_FUSNN/563-843----------------------------------------------KIAIL--------------------------T--
YTEA_LACLA/2-285----------------------------------------------TFQIM--------------------------T--
Y026_CLOPE/3-287----------------------------------------------KFVIF--------------------------T--
Q9CHY7_LACLA/316-595----------------------------------------------SIAIV--------------------------T--
Q92E62_LISIN/310-585----------------------------------------------KIAIV--------------------------T--
Y2349_CORGL/2-260----------------------------------------------PVRVI--------------------------V--
Y3382_XANCP/2-308----------------------------------------------RIGIV--------------------------V--
Y1112_STRPN/3-278----------------------------------------------KIKIV--------------------------T--
Y711_STAAW/2-283----------------------------------------------KIAVM--------------------------T--
DEGV_BACSU/2-281----------------------------------------------NIAVV--------------------------T--
YITS_BACSU/2-283----------------------------------------------TVHLI--------------------------A--
Y948_CLOAB/3-281----------------------------------------------KIAII--------------------------T--
Y1310_CLOPE/3-278----------------------------------------------KIKII--------------------------T--
Y742_STRPN/2-279----------------------------------------------TWKII--------------------------A--
O32516_EUBAC/2-280----------------------------------------------DIKII--------------------------S--
Q9RY87_DEIRA/13-293----------------------------------------------SLKVI--------------------------V--
YQAC_LACLA/2-280----------------------------------------------KLAVI--------------------------T--
Y1491_THETN/3-280----------------------------------------------KIAIV--------------------------T--
Y2440_MYCBO/2-275----------------------------------------------TVVVV--------------------------T--
YEJH_LACLA/2-278----------------------------------------------PIKIV--------------------------T--
Y766_MYCPU/3-281----------------------------------------------KLGII--------------------------I--
Y535_UREPA/4-288----------------------------------------------SFLIM--------------------------T--
Y1863_LISMO/3-279----------------------------------------------KIKII--------------------------T--
Y1624_CLOAB/3-280----------------------------------------------KIALI--------------------------T--
Y304_CLOPE/2-282----------------------------------------------AVKVI--------------------------T--

PF13684

C4LJE3_CORK4/314-601ASASQLEVMFFIENT.............DL..EDLRTFLVPL.GD.SLIVGALTDHS..............ARIHIHT--
C6R8U4_9CORY/214-447ETELEVVFFF................AGDI..DTLQAAIEPL.GD.SLVIA..RATED............SANVHIHS--
C0WG06_9CORY/215-450VTELEVVFFF................EGDS..AALKEKIAPL.GT.SLVIA..QASDD............SASIHIHS--
C3PG03_CORA7/246-486LAEIEALFFF................EGSL..SDIEEALAPL.GN.SLVIA..RATET............SASVHIHS--
E0DHT2_9CORY/321-602VDYLEVMFFI...............QNADL..NHVRDQLQPL.GD.SFIIA..PISPH............SASVHIHT--
A4QDT8_CORGB/263-567TGDLEVMFYIACDSA............QTL..DALHNELETL.GD.SLLIA..RETDT............RGTVHIHS--
Q8FPQ3_COREF/261-567VGDLEVMFYLTCAQA............EDF..DALQQEIAGL.GD.SLLIA..RESDT............RGTVHIHS--
B4V5A9_9ACTO/101-401GPAYEVIYLLE.............ATEAAV..TALRARLDGL.GD.SLVVV..GGDG.............LWNVHVHV--
B1VYY9_STRGG/272-575GPAFEVIYLLE.............AGDEQV..ALLRTRLDAL.GD.SLVVV..GGDG.............LWHVHVHV--
D2AVL0_STRRD/223-521GPGYEVMYLLD.............AGEAAV..GALRRELDAL.GD.SLVVV..GGDG.............LWNVHVHV--
A1SLV3_NOCSJ/245-552GPSYEVMYLLD.............ADDAAI..PGLRTALGGL.GD.SLVVV..GGEG.............LWNVHVHV--
D2Q0M6_KRIFD/247-545GPAYEVMYLLD.............AADEAV..GEFRRALTGL.GD.SVVVV..GGDG.............LWNVHVHT--
A3TRA2_9MICO/271-570GPAFEVMFLLD............DSDVGRV..AMMRTALDGL.GD.SLLVV..GGPD.............LWNVHVHV--
D3Q0S3_STANL/231-545EYAYEVQYLLD.............AETDAV..DRLRTILSGL.GD.SLVIV..GAASAEPGSGSAAAELRTWNVHVHV--
C6WF10_ACTMD/229-545DYEYEVMYLIDGLAGAGADRSDRSAEEEAA..AALRTALRAL.GD.CVSVV..GDGDG............LWTVHVHC--
A4FMM0_SACEN/221-521GYAYEVMYLLG............GATDEAT..TWLRDTLCGI.GD.CVSVV..GDGAD............AWAVHVHC--
A8M651_SALAI/236-541TYAYEVQYLLD.............AEPAAV..DRLRAQLVAL.GD.SLTVV..GDGATTGG.........TWNVHVHV--
E8S7R0_MICSL/236-537AYAYEVQYLLD.............ATDEAV..NRLRAELDAL.GD.SVAIV..GDGA...G.........TWNVHVHV--
D2SE35_GEOOG/241-542GPGSEVQYLLA............DSDEAAV..AQLQDRLAAL.GD.SLVVV..GVDTPGGR.........EWNVHVHV--
C1AG90_MYCBT/244-553APQFEVMYLLA............VCDAAAA..DQLRDRLKEL.GE.SVAIAAAPPD..............SYSVHVHT--
Q73VK3_MYCPA/255-575APQFEVMYRLD............DCAPAAA..DALRDRLTEL.GD.SVGIASAPSSAQH...........TYSVHVHT--
A1T719_MYCVP/239-551TPSFEVMYLLA............DCHAEDI..EKLRAALEEL.GD.SIAIAASGFGEAGGAGPG......HYSVHVHA--
A4TE39_MYCGI/238-547TPGFEVMYLLS............DCDAENV..EQLRARLDAL.GD.SVAIAASGFGEAGAG.........HYSVHVHA--
B1MDN6_MYCA9/245-551PPEFEVMYLLC............GCDELQI..ADLRAQLDAM.GD.SIAIA..GDGEM............GHSVHAHV--
Q5YRZ7_NOCFA/256-564TPGFEVMYLVS............DSDDARI..ERLRGALTVL.GD.SVVVV..GDGAG............TWSVHVHC--
Q0S2E8_RHOSR/258-568DQDFEVMYLVA............ESDEDRM..AELRTTLNAL.GD.SIVIV..GDGGG............GWSVHVHC--
D0LC19_GORB4/238-548DMDFEVMYQLH............GAVGERI..ADLRRFLDDV.GD.AVVIV..GDSSSGDGE........RFSVHVHT--
C7M0D2_ACIFD/231-539ELRYEVMFSLE.............APERQV..DALRVVWAGL.GD.SIVIV..GDGT.............VWRCHVHT--
Q72AQ0_DESVH/242-605TYGYCTECLLSGDDI.............DR..ETLRVRLEPM.GD.SLVVA..GTAS.............LVRVHIHT--
B8DJW1_DESVM/304-680TYGYCTECLIRSGAT..........SPVDR..EELRVRLEEL.GD.SIVVA..GAGA.............VTRVHVHT--
C6BSA4_DESAD/241-600DFRFCTEFLLKGQDV.............DR..VAVRDAISEM.GD.SLIVA..GTPT.............SVKIHIHT--
Q5WZX3_LEGPL/229-591EYRYCTEAVLKSASI.............DK..NKLLHFLKEQ.GE.CASVT..GNDR.............ITRFHVHT--
D6XXQ9_BACIE/228-591PFRYCSEYLVELNPH............ESI..DTLRQSMSEY.GD.SIVLV..SDNQ.............LGKVHIHT--
D3USI8_LISSS/226-588LYRYCSEFIIKSPTA.............TK..QTIQTVLATK.GD.SLVIV..GNEG.............QIKLHIHT--
C8JV81_LISMN/227-585KYRYCSEFIIKQATI.............SH..QRLQEVLASK.GD.SLVIA..GNEK.............QIKIHIHT--
Q9CHY7_LACLA/234-596KNRYCSEFIIKEPLK.............QE..KDLKESLRRW.GD.SLVIA..GNKK.............QIKIHIHT--
A9NE55_ACHLI/228-589TYRYCTEVLLQTTT..............DK..QSLTKLLDNF.GD.SLVIG..ETKR.............LKRVHLHT--
B9L468_THERP/241-527PVGYCFNALLRVLSD.............RR..DELLRTLAPY.GE.SIEIV..GDDA.............LLRVHLHT--
A7NGY6_ROSCS/225-516SAGYCTSFVIHHATA.............PP..ETLRRVFAAL.GE.SLVIA..GDRA.............LVKIHLHT--
A5UZ26_ROSS1/225-517AVGYCTSFVIHRVTV.............SL..DTLRRVFATL.GD.SLVVA..GDQA.............LVKIHLHT--
B3T9V4_9ZZZZ/265-569LYGYCTQFVVQGQDL.............DV..DHLRARVGAI.AT.STVVV..GDET.............MARVHAHA--
D3F1F7_CONWI/252-560TYRYCTNFAVIGSGL.............DA..RAFVGALEAL.GD.SVLVV..GDAK.............TLKVHVHT--
D1C518_SPHTD/261-574EFGYCTNFLLTGDNL.............PV..EEVRRRMTEL.GT.SAVVV..GDKT.............MLKIHVHS--
Q1AW96_RUBXD/226-526AWGYCTEFFVNGFSG.............DP..EALERWMHGA.GK.SVLVV..SDDD.............LVKVHLHT--
C9R910_AMMDK/226-518SSTYCTEFVLRGEKL.............DA..EELKRVLAPL.GE.SLLVV..GDQQ.............LLKVHIHT--
A9AU97_HERA2/231-545DFGYCTNFMIQGENI.............PY..EDVRNTIAEM.GT.SVVAV..GDER.............LVKVHLHT--
Q3Z724_DEHE1/240-544AFGYCTEFLLKGENM.............DI..DKIREWLKKK.GV.SLIVV..GDPT.............TVRVHIHT--
C4F8W4_9ACTN/241-554EFRYCNEFLFKAEKP............FDE..DEALKFLGSM.GD.CELLV..GAYP.............DYKVHVHS--
B9CK02_9ACTN/240-557EFRYCNEFLFHANDA...........TFDE..SAALDFLSTM.GD.CELLV..GTNP.............DYKVHVHS--
C8W750_ATOPD/240-554EYRYCNEFLFKADSP...........DFDE..EAALNFLATM.GD.CELLV..GANP.............DYKIHVHS--
F1T5K6_9ACTN/246-577QYRYCTEFLFHADLE...........DFNP..ETHLKFLASQ.GD.CELLV..GSYP.............DYKIHVHT--
C8WGT1_EGGLE/236-544AYRYCTEFLVHSDTV.............DV..DAAKDFLPTM.GD.CDLMV..GMHP.............NFKVHVHS--
D0WE96_9ACTN/235-543AFRYCTEFLVHSDTI.............DV..DAAKDFLPTM.GD.CDLMV..GMHP.............NFKVHVHS--
C7N551_SLAHD/235-543AFRYCTEFLVHSDTV.............DV..DEAKAFLPTM.GD.CDLMV..GMHP.............NFKVHVHS--
C7MMY7_CRYCD/236-543AYRYCNEFLVDSDTL.............DK..NEALDFLATM.GD.CELCV..GDNP.............KFKVHVHS--
Q24U26_DESHY/229-552EFPYCTEFLVKGRNL.............QV..EKIREDLADR.GD.SLLVV..GTEE.............VVKIHVHV--
Q0AYX3_SYNWW/234-546DFQYCTETLIKGKDL.............EP..TEIKEHLAPL.GD.SMLVV..GGDE.............LVKVHIHS--
B1I3R2_DESAP/234-530RFLYCTEFLVRGPDL.............KS..DELRANLRHL.GD.CLMVV..GNGN.............MLKVHIHS--
A4J402_DESRM/236-537HFTYCTEFIVKGTNI.............PL..DLIRHELSPY.GD.CLMVV..GTEQ.............VAKVHIHS--
C0GHJ3_9FIRM/232-538LFSYCTEVMVRGERL.............DA..DKIREQIKNL.GD.SLLAV..GDEA.............VVKVHIHT--
Q67PP7_SYMTH/248-583RFPYDCEFFIRRYRD......GGP...IPM..DHIARELEQW.GD.SIYVV..GSED.............LAKVHVHA--
Q03W26_LEUMM/246-568KYGYCTEIMVQIGKG......TTYDHDFDY..QKFYDYLAEL.GD.SLLVI..NDDE.............IVKVHVHT--
B1MXV1_LEUCK/244-565AYGYCTEVMVQIGKG......TTYDHEFDY..DTFYNHLAEL.GD.SLLVI..NDDE.............IVKVHVHT--
C5RAD4_WEIPA/240-561EYGYCTEIMVDIAKG......TTYDQKFDY..DTFYNHLAGL.GD.SLLVI..NDDD.............VVKVHVHT--
Q04GL7_OENOB/238-554KYGYCTTILFETGKG......STYDREWNY..DKFYSYLSKK.GD.SLLVI..ADDG.............LVKTHVHT--
Q03RT2_LACBA/242-565KYGYCTEIMVRIGRG......KQVDHDFDY..DEFYKYLADL.GD.SLLVV..NDDE.............IVKVHVHT--
C0XM56_LACHI/243-571VYGYCTQIMVRIGKG......KEVDRKFDY..QTFYDYLAKL.GD.SLLVV..NDEE.............IVKVHVHT--
Q03FX4_PEDPA/244-562EFGYCTQMMVRIGKG......LQVTKEFDY..DTFYNYLAKM.GD.SLLVI..NDDE.............VVKVHVHT--
C0X0A9_LACFE/228-551KYGYCTQMMVRIGRG......KTVTKKFDY..DTFYNYLADL.GD.SLLVI..NDDE.............IVKVHVHT--
C8P937_9LACO/251-577KYTYCTQMLVRLGKG......KEVTKKFDY..DTFYNYLAKL.GD.SLLVL..NDDQ.............VVRVHVHT--
C7XUP2_9LACO/252-573KYGYCTQIMVRIGRG......KQVTQKFDY..DTFYNYLAKL.GD.SLLVI..NDDE.............IVKVHVHT--
C5F3T1_LACPA/241-558VYGYCTEMMVELGDG......QNL.KHFDY..EPFRNYLNTL.GD.STLVI..SDEE.............VVKVHVHT--
C2EEW2_9LACO/228-553KYGYCTEIMVKLGAG......RLVDQEFEY..DKFRNHLAEI.GD.SLLVI..ADDE.............VVKVHVHT--
E7FR73_9LACO/242-562KYGYCTEIMVRLGAG......RLVEKKFDY..DEFRGYLAEI.GD.SLLVI..ADDE.............VVKVHVHT--
Q38XS7_LACSS/240-556ENGYCTEIMVALGDG......TTVDREFDY..DEFRNHLNGI.GD.SLLVV..ADDE.............VVKVHVHT--
C4VLE0_9LACO/240-551KNGYCTEIMVDLTKD......VPGKKPFNL..EEFRKHLSTL.GD.SLLAV..SDDT.............IAKVHVHT--
Q1G9J7_LACDA/246-559ANGYCTEIMVDLKAD......VPNKKPFDL..EEFRSYLSEL.GD.SLLAV..SDGE.............IAKVHVHT--
D0DI19_9LACO/242-553KNGYCTEIMVDLDAD......VPNKKKFDL..EEFRKHLSGL.GD.SLLAV..SDGE.............IAKVHVHT--
C8PD64_9LACO/243-554KNGYCTEIMVDLTAS......IADKKKFDL..AEFRAYLSEL.GD.SLLAV..SDGD.............IAKVHIHT--
C5Q8L3_STAEP/236-552VYGYCTEMMVRFGKN.........KKAFDE..QEFRNDMSEF.GD.SLLVI..NDDE.............IVKVHVHT--
D2N6K1_STAA5/236-548IYGYCTEMMVRFGKN.........KKAFDE..QEFRQDMSQF.GD.SLLVI..NDEE.............IVKVHVHT--
D3QDG8_STALH/236-551IYGYCTEMMVRFGKD.........KKPFDE..QEFRSDMSKF.GD.SLLVI..NDDE.............IVKVHVHT--
Y1689_STAHJ/236-552KYGYCTEMMVRFGKD.........KRAFDE..QTFRTDMSQF.GD.SLLVI..NDDE.............IVKVHVHT--
Y1546_STAS1/236-552VYGYCTEMMVRFGKN.........KKTFDE..QNFREDMSQF.GD.SLLVI..NDEE.............IVKVHVHT--
B9DPL0_STACT/236-547VYGYCTEMMVRFGKD.........KKPFDE..KEFREDMAQF.GD.SLLVI..NDDE.............IVKVHVHS--
B9EBA4_MACCJ/235-548VPGFCTEFMVRFKDG.........MKPFNE..DDFREDMSKF.GD.SLLVI..SDEE.............IVKTHVHS--
C5NX21_9BACL/236-549VYGFCTEFTVRLDKE.........KKEFNE..DKFREDMSKF.GD.SLLVI..SDSE.............FVKIHVHT--
C1CCK6_STRZJ/240-555TFGYCTEIMVALKQG......PTYAKDFDY..DEFRNYLDEL.GD.SLLVV..NDDE.............IVKVHVHT--
A4W3T3_STRS2/240-554TFGYCTEIMVALRQG......PTYVKDFDY..EEFRNYLNDL.GD.SLLVV..NDDE.............IVKVHVHT--
Q1J4X6_STRPF/240-554TYGYCTEIMVALKQG......PTYVKEFNY..DEFQGYLSGL.GD.SLLVV..NDDE.............IVKVHVHT--
B1SBP2_9STRE/229-545KYGYCTEIMVALKQG......PTYVKEFNY..DEFQGFLSGL.GD.SLILV..NDDE.............IAKVHVHT--
Q03IJ3_STRTD/240-555TFGYCTEIMIGLKQG......PTYVKDFDY..EEFQNYLSNL.GD.SLLVV..NDDE.............IVKVHVHT--
C6SSR0_STRMN/229-544TFGYCTEIMVALKQG......PTYVKDFNY..ENFRNYLNNL.GD.SLLVV..NDDE.............IVKVHVHT--
D2BME6_LACLK/237-554KFGYCTEIMVELGKG......PTSRESYDH..DNFQAYLAGI.GN.SLLVV..DDEE.............VVKVHVHT--
C7U3H1_ENTFL/242-558KFGYCTEIMVRIGEG......PTVDSAFDY..ETFRNYLNEL.GD.SLLVV..NDDE.............IIKVHVHT--
C9AXQ9_ENTCA/242-560TFGYCTEIMVKIGEG......PTVDSEFDY..ETFRNYLNEL.GD.SLLVV..NDDE.............IIKVHVHT--
C2H915_ENTFC/242-560HFGYCTEIMVKIGEG......PTVDSTFDY..EEFRNYLDGI.GD.SLLVV..NDDE.............IIKVHVHT--
A8U9Q7_9LACT/242-557TFGYCTEIMVEIGKG......ETVDSEFDY..DTFRNHLNEI.GD.SLLVV..SDDD.............IIKVHVHT--
C8NGP5_9LACT/242-561KFGYCTEIMVKIGEG......ETVVDTFDY..DTFRNYLNEL.GD.SLLVV..ADDE.............IIKVHVHT--
C4FT76_9FIRM/239-557TFGYCTEIMVRIGQG......PTVEKAFDY..DAFRSTLNTK.GD.SLLVV..ADDE.............IVKVHIHT--
D7UVI4_LISGR/239-552EFGYCTEMIVQIKDQ......PATKKAFDE..GAFRQDLSEM.GD.SLLVA..ADEE.............IVKVHVHA--
Q4EHP2_LISMN/226-539HFGYCTEIIVKINEN......KPGQKPFDE..EQFRQDLSKL.GD.SLLVA..ADDE.............VVKVHVHV--
C3C6H9_BACTU/240-558KYGYCTEFMVKLEAE......KVKEHNFSE..QKFREDISVY.GD.SLLVV..SDDE.............IVKVHIHA--
B7GGF8_ANOFW/238-552EFGYCTEFMVKFEQD......KVSKHPFQE..EAFRQDLSRF.GD.SLLVI..ADDE.............LVKVHIHA--
C5D8S7_GEOSW/240-558EFGYCTEFMVRFERD......KLQKHPFSE..EAFRQDLSRF.GD.SLLVI..ADDE.............LVKVHIHT--
Q5L0R2_GEOKA/237-554EFGYCTEFMVRFEPE......KLAEHPFSE..ETFRRELSQF.GD.SLLVV..ADEE.............LVKVHIHS--
Q2B7A4_9BACI/240-560EFGYCTEFMVKLEEE......KLNGKNFSE..DLFRQDLSRF.GD.SLLVI..ADEE.............LVKVHIHS--
A6CS65_9BACI/239-558EFGYCTEFMVRFEEG......K...DAFSE..ETFRNDLSAY.GD.SLLVI..SDEE.............LAKVHIHS--
Q62V69_BACLD/240-556EFGYCTEFMVKLDSG......K...RNFNE..VAFRQDLSRF.GD.SLLVV..SDEN.............IAKVHIHA--
A8FD49_BACP2/240-559EFGYCTEFMVKFEED......K...QSFDE..NAFREDLSEF.GD.SLLVV..SDET.............LAKVHIHA--
YLOV_BACSU/239-553EFGFCTEVMVRLDQT......K...REFDE..GTFRQDLSQF.GD.SLLVI..ADES.............LAKVHIHA--
A7Z4K4_BACA2/239-555EFGFCTEVMVRLDQD......K...RTFKE..ETFRNELSRF.GD.SLLVV..ADDT.............LAKVHIHA--
A3I4A9_9BACI/235-549EFGYCTEIMVRLEDG......K...EPFNE..EQFRQELSPL.GD.SLLVI..SDEE.............IAKVHIHS--
C4L5Y6_EXISA/239-559EFGYCTEIMVRFQED......KLKDTPFNE..DAFRNELSEL.GD.SLLVV..ADEE.............LLKVHVHV--
B1YIP1_EXIS2/249-568HYGYCTEIMVRFQDD......KLADTPFSE..EAFRNELAEF.GD.SLLVV..ADEE.............LLKVHVHV--
Q8ER15_OCEIH/240-552IYGYCTEFMVKFEED......KLNKNPFNE..DDFRNELSEL.GD.SLLVV..SDDE.............IVKVHVHS--
Q9K9Z6_BACHD/240-557EFGYCTEVMVRFESD......KLSTYPFDE..PAFRDELSEW.GD.SLLVV..SDED.............LLKVHIHA--
D3FT80_BACPE/239-561EFGYCTEVMVRFEQE......KLAANPFDE..TSFRNELSEH.GD.SLLVV..SDED.............LLKVHIHA--
Q5WFL6_BACSK/240-557EFGYCTELMVRFDRE......KLEKQPFHE..EAFREKLSEY.GD.SLLVV..SDDD.............LLKVHIHA--
E6TTN1_BACCJ/240-559EFGYCTEVMVKFEQD......KVEENPFTE..QGFREELSQY.GD.SLLVV..SDED.............LLKIHIHA--
C0ZFY0_BREBN/244-568TYGYCTEFMVHVAHST.....EPNKKTFSE..ALFRNHLDTM.GD.SLLVV..SDDE.............VVKVHIHA--
D3E5U1_GEOS4/248-586EFLYDMEFFINRQLG......EGTSADFDE..DKFRKALAVN.GD.SIIVI..ADDE.............TIKVHVHS--
C6J2C5_9BACL/251-590EYLYDMEFFINRKIG......EIKDAVFDE..DQFRKALSVN.GD.SIIVI..ADDE.............IIKVHVHS--
C6D4E5_PAESJ/261-606EFLYDMEFFINRKIS......GKPATFFNE..YAFKKALEKD.GD.SILVI..ADDV.............IIKVHVHS--
B7C794_9FIRM/230-541EYGFCTEFILKLSEN........GIRHFSE..TSFKDELATI.GN.SIVCV..QDED.............LVKVHVHT--
A8REK2_9FIRM/228-542EFGYCTEFIIRLSEQ........GLTIFKE..EALKDALARI.GN.SIVCV..QDDD.............IVKVHVHT--
E7FUT6_ERYRH/228-541EFGYCTEFIVRLDEE........SINRYNE..DKFRAQLEAL.GN.SLVVV..TDED.............LVKVHVHT--
B0N2X3_9FIRM/230-551GYGYCTEFIVRLEPS........LVDKFKE..EQLKKELARIPGE.SIVVV..QDED.............IVKVHVHT--
A9NEV2_ACHLI/238-560KFGYCTEFIVQLFDW..........ENFDI..NSVRNPLEQM.GD.SLVVV..TDED.............LLKVHVHT--
A8SBE9_9FIRM/237-564TNGYCTQFLINKYEG............ASA..AKMRAFAESN.GD.SVVCI..EDDD.............VINLHVHT--
D1PLR2_9FIRM/236-561KNGYCTQFLLHKNAD............ASV..TRLRAFLESN.GD.SVVVI..EDDD.............VANCHVHT--
D4JU96_9FIRM/229-544EFTYCTEFIVVKSDV...........NKDA..TKLRAFLESI.GD.CVVVV..DDDS.............IIKVHVHT--
C0E9S3_9CLOT/234-550AFTYCTEFIVNRGSH...........DKGA..LALRAYLESI.GD.SVVVV..EDED.............IIKVHVHT--
B0PDV8_9FIRM/236-554TFTYCTEFLVKKRAR...........DIDP..QPLRAYLETI.GD.CVVVV..DDDD.............IIKCHVHT--
D4L902_9FIRM/231-548RFTYCTEFIVGRNAE..........IETEI..GELRSYLESI.GD.CVVVV..NDDE.............IIKVHVHT--
A7VZD4_9CLOT/242-566TFTYCTEFIVGRNPE..........VTASP..LELRAYLETI.GD.CVVVV..DDDE.............IIKTHVHT--
E6U6Q7_ETHHY/232-536AYAYCTEFIINKRKN.........VATKDS..LALRAFLESL.GD.CVLVA..DDED.............FIKVHCHT--
A6NT49_9FIRM/241-558KFGYCTEFICSRDNK...........KKDP..EALRGFLNAL.GD.SLVLV..EDDD.............IIKVHVHT--
B7ATY7_9FIRM/235-571KFGYCTEFIIMLDKK.........FDKKDE..LGFKAYLESI.GD.SIVCV..ADDE.............IVKVHVHT--
C4Z046_EUBE2/238-567KFGYCTEFIIMLDKE.........FDEKTE..ADFKAFLTSI.GD.SIVCV..ALDD.............IVKVHVHT--
C4G384_ABIDE/245-571KFGYCTEFIIMSEKE.........FTEKDE..TDFKQYLEGL.GD.CIVVV..ADDD.............VVKVHVHT--
A5ZQF2_9FIRM/220-541KFGYCTEFIILLNKP.........MPIEEE..HSFKEFLTSI.GD.SIVLV..ADDE.............IVKVHVHT--
C0CI33_9FIRM/234-555KFGYCTEFIIMLNEP.........MPEEEE..HHFKEFLTSI.GD.SIVLV..ADDE.............IVKIHVHT--
C9L650_RUMHA/223-540KFGYCTEFIIMLEKE.........FSEKEE..RAFKEYLLSI.GD.SLVVV..ADDE.............IVKVHVHT--
C6LER9_9FIRM/221-545KFGYCTEFIIRTRKP.........MDEAEE..LAFKAFLESI.GD.SIVVV..ADED.............IVKVHVHT--
B0G5R1_9FIRM/234-558KFGYCTEFIILLEKE.........FTENDE..HELKAYLSSI.GD.SIVCV..ADDE.............IVKIHVHT--
A7B4K5_RUMGN/233-550KFGYCTEFIIMTDKA.........FTEADE..MEFKSYLESI.GD.SIVCV..ADED.............IVKIHVHT--
C0BWD3_9CLOT/224-547KFGYCTEFIILTEKE.........FTDDDE..TGFKSYLSSI.GD.SIVCV..ADDD.............VVKVHVHT--
B6FRX3_9CLOT/69-388KFGYCTEFIIMAERE.........FTEEDE..KTFKAYLESI.GD.SIVCV..ADDE.............IVKVHVHT--
A9KPH5_CLOPH/237-560KFGYCTEFIIMVEKE.........YNEKKE..HEFKGYLESI.GD.SIVVV..SDDD.............IIKVHVHT--
A5Z3S4_9FIRM/232-549KFGYCTEFIINLDKE.........MPKSEE..KAFKEFLESI.GD.SIVLV..ADDE.............IVKVHVHT--
C4Z9X2_EUBR3/220-552KFGYCTEFIIVLNAP.........MSDNEE..HAYKAFLESI.GD.SIVVV..ADDE.............IVKTHVHT--
C0FY34_9FIRM/239-571TFTYCTQFLIMLEHP.........FTENQE..TEFKSYLESI.GD.SIVVV..ADDE.............IVKVHVHT--
C7G7M6_9FIRM/240-565KFAYCTQFLIMLDTP.........ITLQQE..NEFKSYLETI.GD.SIVVV..ADDE.............IVKVHVHT--
C0EVE2_9FIRM/237-569KFGYCTEFIILLDKP.........LTKEDE..KGLKKFFLSI.GD.SLVLV..ADEE.............ICKVHVHT--
B0M9Z1_9FIRM/232-546TFGYCTEFIVMLDRE.........FGSAQE..QEFKDYLTGM.GD.SIVVV..ADED.............IVKVHVHT--
D4MYY8_9FIRM/239-553KFGYCTEFIVMTKEE.........ISMEEE..QKFKDFLMGI.GD.SIVVV..ADED.............IIKVHVHT--
A8SPK6_9FIRM/236-563KFGYCTEFIINLEKT.........YGEAEE..DDLKSFLESI.GD.SIVCV..SLDD.............IVKIHVHT--
A7VBL4_9CLOT/234-560KFGYCTEFIINLEKP.........YGIKEE..EDLKQFLESI.GD.SIVCV..SDDE.............IVKIHVHT--
D4CER5_9CLOT/251-574KFGYCTEFIINLEGE.........FGEAQE..KDFKQYLESI.GD.SLVVV..ADEE.............LVKVHVHT--
C5EUI7_9FIRM/240-566KFGYCTEFIINLEKD.........YSDQDE..NQLKSYLESI.GD.SLVVV..SDDE.............IVKVHVHT--
C0D0L6_9CLOT/238-564RFGYCTEFIINLEKE.........FGDEDE..QVFKSYLESI.GD.SLVVV..SDDE.............IVKVHVHT--
D4CN13_9FIRM/241-565RFGYCTEFMINGEHE.........FRDEEV..EALRSWLEGV.GD.SIVCF..SDGN.............IIKVHVHT--
C2KWS6_9FIRM/238-567RFGYCTEFMVNGDHP.........FSDEEV..EKLRDYLSGI.GD.SIVCF..SDED.............LIKVHVHT--
B1IIK7_CLOBK/230-541EFGYCTEFFVMAENV.............DV..DKFKGQLESL.GD.SMIVV..AADG.............LVKVHIHT--
Q895P1_CLOTE/232-546KFGYCTEFFIVSKDA.............DV..DKFKKDLETH.GD.SMIVV..GSDD.............LVKVHIHT--
A0Q104_CLONN/236-554KYGYCTEFFVNTNDA.............STKAEDLKKTLTPV.GD.SMIVV..GVED.............IIKVHIHT--
C6PUV3_9CLOT/231-545KFGYCTEFFIRSNNV.............EI..DDFKHTIEKI.GD.SMVIV..NDED.............IVKVHIHT--
A5N7Z4_CLOK5/231-555KYGYCTEFFIHLKSS.............DI..SSFKDKLQAL.GD.SIVVV..KDED.............VLKVHIHS--
B1RQ99_CLOPF/234-548KFGYCTEFIILGDSN.............HA..EEFKSKVINK.GD.SLVVV..GYED.............VIKVHIHT--
C1I7N0_9CLOT/231-556KFGYCTEFIILADAS.............KA..DKFRDEIIPM.GD.SQVVV..GYED.............VIKVHIHT--
C4IJG6_CLOBU/231-551KFGYCTEFIILGDAN.............KA..KEFQDKIEEL.GD.SMIVV..GYDD.............VIKVHIHT--
A6LSK9_CLOB8/231-546KFGYCTEFIILGDAK.............RA..QDFQNEIESL.GD.SMIVV..GYDD.............VIKVHIHT--
B2TJ09_CLOBB/232-548KFGYCTEFIILGDAK.............KA..KEFQNTIEPL.GD.SMIVV..GYED.............VIKVHIHT--
Q97IB5_CLOAB/232-547KFGYCTEFIIHSGTS.............SV..SEFRDDISKL.GD.SMIVV..NVDD.............ITKVHIHT--
D9SLB2_CLOC7/231-546TFGYCTEFFIVSDTL.............NP..ENFRREIEPY.GD.SIIVV..GTDG.............LIKTHIHA--
B6FZ18_9FIRM/234-544KFGYCTEFILESDKI.............DD..AGIRDIMLGY.GD.SLAVV..GDEG.............VIKVHVHT--
C9YPD2_CLODR/235-547KYCYCTEFILESSKV.............ED..TKIRDIMMAY.GD.SLAVV..GDDG.............VIKVHVHT--
B0AAY8_9FIRM/232-545KFQYCTEFILETDKI.............SD..VQMRDKMLKY.GD.SLVVV..GDDG.............IIKVHVHT--
D3MPQ7_9FIRM/235-560KFGYCTEFILESDKV.............EE..DTIRDIMLGY.GD.SLVVV..GYDG.............MIKVHVHT--
A8MH97_ALKOO/232-548EFGYCTEFIIRSGNA.............DI..HKFRDIIEGY.GD.SMLVV..GNDS.............VVKVHIHT--
A6TRV4_ALKMQ/231-542EFGYCTEFIIKSKEV.............DI..EAFKSTIKGY.GD.SMLAV..GNEN.............IVKVHIHT--
B1C9C9_9FIRM/230-550KYGYCTEFLIKVHKE......NLKYESALT..AALKDKLTPI.GD.SLVAV..HDNG.............IIKIHVHT--
D1VSD4_9FIRM/236-553KYGYCTEFVIHTDSE.............DI..ADLRSKLSPI.GD.CLLVVGGGGSG.............IIKVHVHT--
A8SMH4_9FIRM/227-540KFGYCTEFMITSDSE.............EY..GVLRDKLASI.GD.SLIVV..KGDN.............IIKVHVHT--
B0S152_FINM2/230-541KFGYCTEFFIMTDA..............DE..NSYRSKLENL.GD.CLLVV..KGDG.............VIKTHIHT--
Q4A591_MYCS5/234-550EFGYCTELLIDLNDP..........ENFKK..EKFQNKVEKM.AA.SLVLI..QDDN.............LLKIHGHT--
C4XDU6_MYCFE/229-541EFGYCTEFIIELNDE..........KDFDK..ANFEKSLLKK.AN.SLVVV..QDEK.............IVKVHGHT--
D3VQS9_MYCA6/233-548EFGYCTEFIIELNKP..........DEFDK..TAFEKHISKF.AN.SLVIV..QDAE.............LIKVHGHT--
Q6KHN1_MYCMO/228-542EFGYCTEFLLDLEKT..........KKFNK..ENFISHIEKL.GT.SLVVV..QNEA.............LVKVHIHT--
Q98R49_MYCPU/230-545EFGYCSEFILELNDE........KIKKFNR..DKFATKLEKI.AS.SVVII..HDKN.............ILKVHAHV--
D1J8Q5_MYCHP/228-542EFGYCTEFILELYKP..........KKFDK..DYLVRKLEKI.GN.SMVVV..NDDK.............ILKVHIHT--
B3PN92_MYCA5/229-546EFGYCTEFILELKNY..........RKFDK..ESLVKRLEKI.GN.SMVVV..QDEE.............ILKVHIHA--
C5J6D6_MYCCR/231-544EFGYCTEVIVELSNS..........EGFNR..KKLESKLERR.IK.SLVIV..EQDG.............VIKIHGHT--
B2NEH1_UREUR/237-564GFGYCSEIILSLKKK..IVPNSANKSFFEL..EKYKAELAKI.GD.SIVAI..QDED.............LVKVHLHT--
D3FH26_MYCGH/234-574GHGYCTEFLLKLGLKAKD...DQTKIKFNE..EKFKKEISKD.VE.SLVLINDKEEG.............IVKLHAHT--
Y369_MYCGE/238-557EFGYCTEYVLRLGLKINQ...TVEKQKFHQ..KKFESKVNRI.AN.SVVIASDKDNG.............FVKVHAHT--
Y547_MYCPN/239-558EFGYCTEYVLKLGMSVSQ...EVEKQKFNQ..KKFESKVSKI.AT.SVVVASDKDNG.............FVKVHAHT--
Q8EVZ4_MYCPE/248-573GFGYCCEFIIQKDFI..THEKQPLKIKFDL..NKFEKEML.LAGE.SLVVV..DDSD.............IVKVHIHS--
Q14LS2_SPICI/227-539EFGYCTEAIVMLDNK........HINKINI..MQIRQTLEDQGGK.SIVAV..VDND.............ILKVHVHT--
Q2SS00_MYCCT/225-547EFGYCTEAIVMLNSD........WINKLQN..SMIRDQLQIF.GNTSIVVV..IDND.............ILKVHTHS--
Q6F1N7_MESFL/225-548EFGYCTEGIVMLNEE........WINKLQT..SAIRDQLQIY.GNTSIVVV..IDED.............ILKVHTHA--
B1VB30_PHYAS/245-554KYIYCTEYVFELKNN...........DCDT..EELGAYFETK.GD.SLVLV..KDEE.............ILKIHIHT--
Q2NK36_AYWBP/239-571KYTYCTEYIFQIKES........QEKNLDM..KQIKKVLLQI.GD.SLVLV..KDQE.............ILKIHIHT--
B0K1Y0_THEPX/233-533RFLYCTEILVKTKKS............YAE..AILKEKFGRF.GD.SLVLV..SEED.............ILKVHVHT--
Q8R9U3_THETN/225-525KYLYCTEILVKTNKK............YSE..ALFKERFKNF.GD.SLVVV..AEDD.............LLKVHVHT--
C9N026_9FUSO/239-542HFQYCTEYIILNGDF.............DT..EEYKKRVLEL.GD.SAVFA..QTSK.............KFKTHIHT--
D0GPN7_9FUSO/239-542KFQYCTEYIILNGDF.............DV..EEYKRRVLEL.GD.SAVFA..QTSK.............KFKTHIHT--
D1AJX8_SEBTE/238-542KFQYCTEFIIGSSSF.............DT..DKFKAEILEL.GD.SAVFA..QSSK.............KFKVHVHT--
D1AVV3_STRM9/236-535KFKYCTEFIIRNADF.............NI..DKFKEDILKL.GD.SAVFA..QTSK.............KFKIHVHT--
Q7P8L0_FUSNV/238-555KFKYCTEFIIESGDF.............DL..EEYKAKIQNL.GD.SMVVA..QTRK.............KTKTHIHT--
C6JQ39_FUSVA/240-546KFKYCTEFIIESGDF.............DL..NEYKAKISPL.GD.SLVCA..QTAK.............KTKTHIHT--
C3WC47_FUSMR/240-543KFRYCTEFIIEEGTF.............DL..EGYKKEISSL.GD.SMVCA..QTTH.............KTKTHIHT--
B5YEA3_DICT6/236-544TYQYCTEFIINSYEN............VDF..TNFKKWLETQ.GD.SIVTS..EAPG.............LLKVHIHT--
B5Y797_COPPD/228-524EYKFCTEAYFKSDNM.............DF..EYAKNFLSSQ.GD.SIVLG..QEGG.............LWHFHVHT--
A5ILK4_THEP1/226-528TNRYCTEVAVRRNQV............VEK..IELEAFLNEI.GD.SVVLV..EQDD.............LIKLHVHT--
A7HN75_FERNB/228-537KFQYCTELILQSRKK.........INEDDK..QKMESYLNEI.GD.SVVFF..VQDD.............IIKLHVHT--
B7IFW1_THEAB/228-537KFQYCTELIIKSYET.........LESDKE..EELRNFLYEI.GD.SVVFF..VQDS.............AIKLHVHT--
A6LJM3_THEM4/228-537KFQYCTELIVRTFES.........LSSNEE..NEIRSFLHEI.GD.SVVFF..IQDN.............IVKLHVHT--
A8F8T1_THELT/233-540VYQYCTELMIKCYDD.........FQSGKV..GDLKLFLEGI.GD.SAVVV..CDEN.............VLKTHVHT--
A9BG53_PETMO/231-555TYQYCTEAIVKFQKQ........PIQKKTL..EEIRSFLEGL.GD.SIVLV..NQDD.............ILKTHIHT--
C5CI85_KOSOT/233-554KYTYCTELIIALDDQ......NNEEQHEIC..DSLKSYLEEM.GD.SIVIV..NQDN.............IIKIHIHT--
A4XKD8_CALS8/229-545KFTYCTEFFITGLKK............NIE..DEFKQYLQTV.GD.SIIVI..QDGE.............ILKTHVHT--
B9MRL9_ANATD/229-545KFTYCTEFFITGLKK............NIE..KEFKEYLETI.GD.SIIVI..QDGD.............ILKTHVHT--
B2A2L3_NATTJ/236-554VYKFCTEFILSGVNQ..........PEETE..KTLKQELMAY.GD.SLLVV..GETD.............IVKVHVHT--
B8CWU7_HALOH/238-549KYAYCTQALINLQKD..........TTKSI..EEIRNDLQHY.GD.SLMVV..GSDR.............TVKIHIHT--
Q3ABX4_CARHZ/233-531DYIYCTEFIIKGEKL.............FL..EKIRQELMEI.GG.SLIVA..GDEN.............VVKVHIHT--
C9LL18_9FIRM/236-538EYPYCTEFIISPCKL.............AA..KEIRQKLGTW.GE.SMIVA..EGDN.............LIKVHIHA--

PF02733

DHAK_ECOLI/16-356LAGLAKAHPS.LTLHQDPVYVTRADA....PVAG------------KVALLSGGGSGHEPMHCGYIG.QGMLSGACPGEI
DAK1_SCHPO/17-344LKSLADMNKT.LTVHEEGKFIYFHDY.....NKK------------NVSVISGGGAGHEPTHSSFVG.KGMLTAAVSGSI
DAK_PICAN/17-355LKGLCHANPD.LQFIESERVVINKHS.....KPD------------KVMILSGGGSGHEPLHAGFVG.EGCLDVGVAGFV
Q9RJR0_STRCO/16-335LEGFTAAHRRWVRPVTGGVVRATAT......PAG------------QVAVVIGGGSGHYPAFSGLVG.RGLAHGAAVGNV
DHBK_SOLLC/22-345GLIENYPGLQYLDGFPEVKVVLRADVS..GAKYD------------KVAIISGGGSGHEPAHAGFVG.EGMLTAAICGDV
DAK2_YEAST/17-345LLGLARSNPG.LTVIKHDRVVFRTASAPNSGNPP------------KVSLVSGGGSGHEPTHAGFVG.EGALDAIAAGAI
DAK1_YEAST/16-344LKGFALANPS.ITLVPEEKILFRKT......DSD------------KIALISGGGSGHEPTHAGFIG.KGMLSGAVVGEI
DAK_PICPA/17-357LAGLCQSNPH.VRLIESERVVISAEN.....QED------------KITLISGGGSGHEPLHAGFVTKDGLLDAAVAGFI
DAK2_SCHPO/17-345LLGLARSNPG.LTVIEHDRVIYRTASAPGSGDLP------------KVTLVSGGGSGHEPTHAGFVG.DGALDAVACGDI

PF03610

C4ZTN9_ECOBW/4-122----------------------------------------------NLVIVSHSS-------------------------
PTNAB_SHIFL/4-119----------------------------------------------AIVIGTHG.-------------------------
Q48519_LACCU/3-117----------------------------------------------KIIISGHG.-------------------------
Q98CM1_RHILO/3-116----------------------------------------------GLVLVTHG.-------------------------
Q97QN0_STRPN/5-114----------------------------------------------GLVIVSHSK-------------------------
Q9CMJ0_PASMU/4-120----------------------------------------------AIMIATHG.-------------------------
PTFA_BACSU/3-117----------------------------------------------SVIISGHG.-------------------------
Q9K7G6_BACHD/7-116----------------------------------------------GIVISSHVP-------------------------
Q9CEX8_LACLA/4-123----------------------------------------------GIVIASHG.-------------------------
Q99VW9_STAAM/3-113----------------------------------------------KIILVSHSK-------------------------
Q97SL1_STRPN/2-115----------------------------------------------KIVLVGHG.-------------------------
YADI_ECOLI/3-117----------------------------------------------GWVITCHD.-------------------------
Q8R8K1_THETN/8-123----------------------------------------------GIVLVSHSR-------------------------
Q8XH56_CLOPE/3-118----------------------------------------------GVLVATHG.-------------------------
Q97N91_STRPN/5-123----------------------------------------------GILVASHG.-------------------------
Q9RZR3_DEIRA/4-120----------------------------------------------TLVIVSHSA-------------------------
Q8R5U5_THETN/552-666----------------------------------------------GIIVAMHGE-------------------------
Q8YA15_LISMO/3-118----------------------------------------------SIVLVSHSQ-------------------------
Q9KIQ1_ECOLX/3-117----------------------------------------------SIILTGHG.-------------------------
Q9JXH6_NEIMB/10-123----------------------------------------------GLLIITHE.-------------------------
Q9ABI7_CAUCR/15-129----------------------------------------------GLVIVTHG.-------------------------
Q9S4L5_STRSL/4-123----------------------------------------------GIIIASHG.-------------------------
Q8VP39_ECOLX/3-120----------------------------------------------AIVIVSHSL-------------------------
Q97T86_STRPN/4-118----------------------------------------------SLILVSHG.-------------------------
PTRA_KLEPN/3-115----------------------------------------------HAIFCAHG.-------------------------
Q9FC13_STRCO/2-118----------------------------------------------GIVLVSHSA-------------------------
Q98C52_RHILO/5-120----------------------------------------------GIVIVSHSP-------------------------
Q927E4_LISIN/6-115----------------------------------------------GVVIISHSK-------------------------
P96165_VIBFU/3-117----------------------------------------------AVILSGHG.-------------------------
Q9A0T2_STRP1/3-117----------------------------------------------AIIVMGHG.-------------------------
Q8P225_STRP8/5-114----------------------------------------------GIIIVSHSK-------------------------
Q8RHZ6_FUSNN/5-122----------------------------------------------GFVVVSHSK-------------------------
Q97TN2_CLOAB/3-119----------------------------------------------GIILASHG.-------------------------
Q9RGG5_LACCA/2-115----------------------------------------------EIILVGHA.-------------------------
Q97J29_CLOAB/3-121----------------------------------------------YVILVSHG.-------------------------
DHAM_LACLA/4-113----------------------------------------------GIVIVSHSP-------------------------

PF02645

Y1149_STRPQ/3-279-----------------DSSITI.E..PEL-IKALDITVVPLSVMIDS.K------------------------------
Y1667_STRPQ/2-283-----------------DSTADL.N..QTW-AEDHDIVLIGLTILCDG.E------------------------------
Y1478_STRPQ/2-279-----------------DSGCDL.RSLTRQ-SKELRFERVPLTLQIGT.E------------------------------
Y586_STRPQ/2-281-----------------DSTATL.P..IDL-KQDKAIFSLDIPVIIDD.E------------------------------
Y1557_STRPN/2-281-----------------DSSAYL.S..AEI-LQREDLFVLDIPVNIDG.E------------------------------
Y3627_BACHD/3-282-----------------DSTAYL.G..PKR-AKELGVIVVPLSVVFGE.E------------------------------
Y2509_CLOPE/3-280-----------------DSSCDL.T..IDE-IKDYNLNILPLKIIYKD.R------------------------------
Y1903_DEIRA/1-281-----------------ESTADI.L..PLQ-LGYSGIHLLPVPLGHQG.Q------------------------------
Q65EA6_BACLD/2-280-----------------DSTAYI.P..KDL-RDRYNIHMIPLNVIFGE.T------------------------------
Y2514_LISMO/4-283-----------------DSTTYL.P..DEV-KEQLRINVVPLSVIIDG.K------------------------------
Q9I599_PSEAE/2-314-----------------DATCDL.P..PEF-LAAHGIRVMPIGIRLGE.Q------------------------------
Y500_DEIRA/6-281-----------------DGGLDA.Y..PTL-LN..DVPVAPFSVAFGE.R------------------------------
Y2569_STRCO/4-281-----------------DSTAYL.P..ARA-MERHGITAVPLTVVLGD.R------------------------------
Y359_MYCPU/2-276-----------------DSSSGL.T..KEQ-ANKRGWYFLPLNIDIDE.K------------------------------
Y326_MYCGE/3-293-----------------DSTASI.....KP-GEINGVYILPLQVIVDGEK------------------------------
Y1986_DEIRA/2-279-----------------DSTSDL.T..PEH-LAALGVTGVPLYVLFEG.Q------------------------------
Y1468_THEMA/2-284-----------------DSTADV.P..FSW-MEKYDIDSIPLYVVWEDGR------------------------------
Y472_MYCPN/2-290-----------------DSTASI.....KE-GEIQDVYVLPLQVIINGQD------------------------------
Y3284_CLOAB/2-281-----------------DSTSCM.N..NDL-INKFHINLVSLSVSFDD.E------------------------------
Y701_CLOAB/3-278-----------------DSTCDL.P..EYI-ISKFDIEVLPLMVNVKG.K------------------------------
Q8RHS1_FUSNN/563-843-----------------DSASDL.T..PDM-IEGLDVTVIPIRLKIGE.N------------------------------
YTEA_LACLA/2-285-----------------DSTADL.S..PYY-IKKHHLTVLGMTVTVGE.E------------------------------
Y026_CLOPE/3-287-----------------DSAADL.P..KSM-VKDLDINYLGLICNIDN.T------------------------------
Q9CHY7_LACLA/316-595-----------------DSVADL.S..ADF-ILENQIFVLPLNVSVGE.Q------------------------------
Q92E62_LISIN/310-585-----------------DSIADL.P..EDF-LLEHQVHVLPMNILAGE.E------------------------------
Y2349_CORGL/2-260-----------------DSSACL.P..THV-AEDLDITVINLHVMNNG..------------------------------
Y3382_XANCP/2-308-----------------DSACDL.P..QDF-IQRNNVIVLPISVRIGE.A------------------------------
Y1112_STRPN/3-278-----------------DSSVTI.E..PEL-VKQLDITIVPLSVMIDN.V------------------------------
Y711_STAAW/2-283-----------------DSTSYL.S..QDL-IDKYNIQIAPLSVTFDDGK------------------------------
DEGV_BACSU/2-281-----------------DSTAYI.P..KEM-REQHQIHMIPLQVVFRE.E------------------------------
YITS_BACSU/2-283-----------------DSATDL.P..RSY-FEEKGIGFIPLRVSLGD.K------------------------------
Y948_CLOAB/3-281-----------------DTTADL.T..EEF-IKENDINVLSFRIIYKD.K------------------------------
Y1310_CLOPE/3-278-----------------DSTCDL.S..KEI-IEKYDIDVMPMLINFGE.E------------------------------
Y742_STRPN/2-279-----------------DSGCDYRQ.LPTP-AINTTFVSVPLTIQVAD.Q------------------------------
O32516_EUBAC/2-280-----------------DSLADI.P..QET-ARALDIEVMPLTIIFDD.A------------------------------
Q9RY87_DEIRA/13-293-----------------DATADL.S..EAD-LARSGVWQLASVVRVGG.Q------------------------------
YQAC_LACLA/2-280-----------------DSSADF.A..EKY-KTYENLFVLDIPISIDG.V------------------------------
Y1491_THETN/3-280-----------------DSLSDI.P..EDL-IKTYGIFVVPLTINIDG.K------------------------------
Y2440_MYCBO/2-275-----------------DTSCRL.P..ADL-REQWSIRQVPLHILLDG.L------------------------------
YEJH_LACLA/2-278-----------------DSSITI.E..PGI-ARELDITIVPLSVTIDG.T------------------------------
Y766_MYCPU/3-281-----------------DSFTSITE..DEF-KKLEDFYFLPLQLILDG.T------------------------------
Y535_UREPA/4-288-----------------DSSTTL.D..REW-AKNNDVMILPLSILRSDHT------------------------------
Y1863_LISMO/3-279-----------------DSTAGL.T..LEE-AAKWNIDVLYLTVEIDG.K------------------------------
Y1624_CLOAB/3-280-----------------DSTSDV.D..KDM-IEKYDIKVLPLRIIYKD.K------------------------------
Y304_CLOPE/2-282-----------------DSTSCI.P..KDL-AEKYGVEIVSLSVIMNG.E------------------------------

PF13684

C4LJE3_CORK4/314-601-----------------NRAGDVISGAYER.GDVSKLTVETLHQVSADRP..............................
C6R8U4_9CORY/214-447-----------------RQAGKVIETAFGT.GKVTNLHLEVLPPHTEPAS..............................
C0WG06_9CORY/215-450-----------------TQAGKVIETAIAA.GSVSNLHLEALPESSAPRG..............................
C3PG03_CORA7/246-486-----------------AEAGAVIEKAYAL.GKVSNLRLEALPQAGQAAS..............................
E0DHT2_9CORY/321-602-----------------HQAGTVIETAHHL.GKITNLHIEALPEA...................................
A4QDT8_CORGB/263-567-----------------RRAGEVIQKAFAA.GDVSELRLEILPHTS..................................
Q8FPQ3_COREF/261-567-----------------RRAGEVIEAAFRA.GEVTHLRLEILPEAH..................................
B4V5A9_9ACTO/101-401-----------------DDPGAAVEAGVVA.GRPYRIRITHFGDER..................................
B1VYY9_STRGG/272-575-----------------DDAGAAVEAGVEA.GRPYRIRITHFATES..................................
D2AVL0_STRRD/223-521-----------------DDAGAAIEAAMRA.GRPHRIRVTYLVG....................................
A1SLV3_NOCSJ/245-552-----------------DDVGAAIEAGIAA.GRPHRVRVTHFAEQI..................................
D2Q0M6_KRIFD/247-545-----------------DDVGAAVELGIGI.GRPYRIRVTHFADLA..................................
A3TRA2_9MICO/271-570-----------------DDVGAAVEAGILA.GRPHRIKVTHFATQI..................................
D3Q0S3_STANL/231-545-----------------NDIGAAIEAGIES.GRVYRLSVTRFADQV..................................
C6WF10_ACTMD/229-545-----------------TDIGAAVEAGVEA.GRPHRITVSRFADQVA.................................
A4FMM0_SACEN/221-521-----------------DDIGAAIESGIEA.GRVHRIQVTRFADQH..................................
A8M651_SALAI/236-541-----------------NDVGAAIEAGVAA.GRPHRITVTRFADPP..................................
E8S7R0_MICSL/236-537-----------------NDIGAAVEAGVVA.GRPHRIGVTRFADQ...................................
D2SE35_GEOOG/241-542-----------------SDVGAAIEAGIEA.GRPYRISVTPLAP....................................
C1AG90_MYCBT/244-553-----------------DDAGAAVEAGLAV.GRVSRIVISALGSGT..................................
Q73VK3_MYCPA/255-575-----------------DDAGAAVEAGLAA.GRLSRIVISALSSGG..................................
A1T719_MYCVP/239-551-----------------DDAGAAVEAGLAV.GSLSRIQITSLSGGG..................................
A4TE39_MYCGI/238-547-----------------DDAGAAVEAGLAV.GTLSRIQITSLHGGA..................................
B1MDN6_MYCA9/245-551-----------------NDAGAAIEAGMKF.GTPQSIQISSLRGGL..................................
Q5YRZ7_NOCFA/256-564-----------------ADAGAAVEAGLAA.GTPRGIRIESFDIDGVGPD..............................
Q0S2E8_RHOSR/258-568-----------------TDAGAAVEAGLSA.GRIHGIRVSSFLVDARDQG..............................
D0LC19_GORB4/238-548-----------------CDPGAAVEAGVTL.GRVSDIRISCFALDAIRAH..............................
C7M0D2_ACIFD/231-539-----------------NDIAAAIQGGIDA.GRVRDLSVTDLREQTGEVA..............................
Q72AQ0_DESVH/242-605-----------------DEPDTVFGIAAEY.GEVRHRKVEDMLRQHRDLL.................GLTT........Q
B8DJW1_DESVM/304-680-----------------DTPDTVFAIAAEY.GEVSHHKAEDMLRQHRDLL.................AAMAGGHPQAAPA
C6BSA4_DESAD/241-600-----------------NDPDAVEKIVSNY.GEVVKRKVDDMLVQHKRLL.................ADERT........
Q5WZX3_LEGPL/229-591-----------------NNPREIFTSLYKD.YTIQYPKVDDMQRQHELQF.................GKKYK........
D6XXQ9_BACIE/228-591-----------------NDPADIADMLVQK.GKVVYQKVEDMRRQYESIY.................RRKSP........
D3USI8_LISSS/226-588-----------------NEPKEVLNLLAKY.GTMTYQKVDDMRLQYDVTK.................KPRAK........
C8JV81_LISMN/227-585-----------------NEPQKVLGTLAGY.GMMTYQKVDDMRLQYEVTK.................KPRAK........
Q9CHY7_LACLA/234-596-----------------NHPENILALLEKT.GTIIYQKVDDMQLQYEISQ.................NRKSS........
A9NE55_ACHLI/228-589-----------------NQPEVIVEKLSGL.GQILESKVDDMRKQYQATQ.................AKDNE........
B9L468_THERP/241-527-----------------QQPDLVIACLRAY.GRLDSLAVEPLSADGQETI..............................
A7NGY6_ROSCS/225-516-----------------PRPGDALNQALAY.GILDQIEVVNMDLQRMAHH..............................
A5UZ26_ROSS1/225-517-----------------LRPGDALNQALEY.GALDQVEVVNMDLQRAALH..............................
B3T9V4_9ZZZZ/265-569-----------------ADPGPLLSLGAEI.GSLDRIKIENMDTMHKEFM..............................
D3F1F7_CONWI/252-560-----------------DDPDAATGVFAAA.GEISHLDVADMHAQVEERA..............................
D1C518_SPHTD/261-574-----------------EHPGTILEIALGY.GELHQVRIDNMTAQTRALL..............................
Q1AW96_RUBXD/226-526-----------------QDPGAALSYASRY.GRLSGVKVEDMEAQVRSRG..............................
C9R910_AMMDK/226-518-----------------DHPGLVLEEALKR.GSLYDIKIDNMRQQVEKRT..............................
A9AU97_HERA2/231-545-----------------LRPGDALNYAVQW.GSLGAIEITNMDKQRSDLH..............................
Q3Z724_DEHE1/240-544-----------------LKPGSVMNYVCDL.GTMHKVSVRNMDEQHEDFL..............................
C4F8W4_9ACTN/241-554-----------------NTPNLVLEHMLQF.GQVYEVFIHNMDLEVAERT..............................
B9CK02_9ACTN/240-557-----------------NTPDKVLHYMLQY.GQIFEVFIHNMDLEAKERT..............................
C8W750_ATOPD/240-554-----------------NTPNKVLEYMLQY.GQIFEVFIHNMDLEAKERT..............................
F1T5K6_9ACTN/246-577-----------------NRPDYVLRHMLHR.GQIYNVFVHNMDLEAHERT.................DAIRDDKVLVHGD
C8WGT1_EGGLE/236-544-----------------NRPDQVLGWFLTHDAQISEVHIHNMQQQSAART..............................
D0WE96_9ACTN/235-543-----------------NRPDQVLGWFLTHDAQISEVHVHNMGLQSEERE..............................
C7N551_SLAHD/235-543-----------------NRPDQVLGWFLDHDSQISEVHVHNMGLQSEERT..............................
C7MMY7_CRYCD/236-543-----------------NHPDQVLAYFLER.GQIFEVFIHNMQLQAADRT..............................
Q24U26_DESHY/229-552-----------------KNPGKILDYAIQW.GSLHEVAIHNMLAQNEAMAHAQKMEDIPEGSRSKAGQEQE.........
Q0AYX3_SYNWW/234-546-----------------NHPGKVLESCLQW.GSLSDIKINNMLDEVHEHR..........ENWPRLNEELA.........
B1I3R2_DESAP/234-530-----------------NNPGRVLEEGLRH.GTLHEVHINNMADQTAELK..............................
A4J402_DESRM/236-537-----------------NHPGMVLENCLNY.GSIHEVAIHNMREQSKQIL..............................
C0GHJ3_9FIRM/232-538-----------------NNPGQVLEACLSY.GTLHNIKIDNMKEQHQELL..............................
Q67PP7_SYMTH/248-583-----------------SNPGPVLSLAIQY.GDLIDIVIHNMREQHADLL................RNAQPAPEGVDAPQ
Q03W26_LEUMM/246-568-----------------ENPGKVISWGTHF.GSLVKVKVDNMRDQQQTVI................DAQRA.........
B1MXV1_LEUCK/244-565-----------------ENPGEVISWGTHF.GSLVKVKVDNMRDQQQAVI................DAQRA.........
C5RAD4_WEIPA/240-561-----------------EDPGDVINWGTHF.GSLRKVKVDNMRDQQAEAA................SVAAE.........
Q04GL7_OENOB/238-554-----------------EDPGAILTEATHY.GSIKWVKIDNMRDQQQAVI................DRVAK.........
Q03RT2_LACBA/242-565-----------------EHPGKVIAWGQEF.GDLAKVKVDNMRMQQETIM................EHDEE.........
C0XM56_LACHI/243-571-----------------EHPGKVLAWGQEF.GDLATVKVDNMRLQQETII................ENDDE......KDI
Q03FX4_PEDPA/244-562-----------------EHPGEVLAWGQQF.GDITKIKVDNMRWQQEEIM................EQDET.........
C0X0A9_LACFE/228-551-----------------EQPDKVLGWGLQF.GDLQTIKIDNMRWQQESIM................EHDQE.........
C8P937_9LACO/251-577-----------------EHPGQVLSWGQEF.GDLQTIEIHNMVWQQEEIM................EHDDE........G
C7XUP2_9LACO/252-573-----------------EHPGKVLSWGQQF.GDLQTVKVDNMRWQQEQIM................DEDEP.........
C5F3T1_LACPA/241-558-----------------EHPGTVFRYGQQF.GSLMKIKVDNMRLQQESII................EREGA.........
C2EEW2_9LACO/228-553-----------------EHPGKVLSYGQEF.GSLIKVKVDNMRLQHETIL................EKDED.........
E7FR73_9LACO/242-562-----------------EHPGMVLSYGQKF.GSLIKVKVDNMRLQHETIL................EKDEE.........
Q38XS7_LACSS/240-556-----------------EHPGTVMAYGQHF.GSLMKIKVDNMRLQHDTIV................ENDQQ.........
C4VLE0_9LACO/240-551-----------------EHPGEVFTYGQQF.GELGKIKIDNMRIQHETIV................DEAAK.........
Q1G9J7_LACDA/246-559-----------------EYPGKVFLYGSQF.GQLGKIKIDNMRIQHETIV................DNEQE.........
D0DI19_9LACO/242-553-----------------EHPGDVFQYGSQF.GQLGKIKIDNMRIQHESIV................DQDEE.........
C8PD64_9LACO/243-554-----------------EYPAKIFAYGKQF.GKLGKIKIDNMRIQHETIV................ENSKE.........
C5Q8L3_STAEP/236-552-----------------EHPGDVFNYGQKY.GELIKLKVENMREQHREVI................RKEQD.........
D2N6K1_STAA5/236-548-----------------EYPGKVFNYGQQY.GELIKLKVENMREQHREVI................RKEQH.........
D3QDG8_STALH/236-551-----------------ETPGDVFNYGQQY.GELIKLKVENMREQHREVI................RKEAS.........
Y1689_STAHJ/236-552-----------------ETPGEVFNYGQEY.GELIKLKVENMREQHREVI................RKEKL.........
Y1546_STAS1/236-552-----------------EKPGDVFNYGQQY.GELIKLKVENMREQHREVV................KKEHD.........
B9DPL0_STACT/236-547-----------------EHPGDVFNYGQQY.GELIKLKVENMREQHRNVV................NKEKA.........
B9EBA4_MACCJ/235-548-----------------ETPGEALTYGSQY.GEIIKIKIENMREQHREVL................RKRGI.........
C5NX21_9BACL/236-549-----------------ETPGDVFNYGQQY.GELIKIKSDNMREQHREVL................RKQEA.........
C1CCK6_STRZJ/240-555-----------------EDPGLVMQEGLKY.GSLVKVKVDNMRNQHEAQV................EKEAT.........
A4W3T3_STRS2/240-554-----------------EDPGLVMQAGLQY.GSLVKVKVDNMREQHEAQV................EKVE..........
Q1J4X6_STRPF/240-554-----------------EDPGLVMQEGLKY.GSLIKIKVDNMRNQHEAQV................QKTD..........
B1SBP2_9STRE/229-545-----------------EDPGLVLQEGLKY.GALKKVKVDNMRNQHDAVL................EKDQA.........
Q03IJ3_STRTD/240-555-----------------EDPGLVMQEGLKY.GALVKVKVENMRNQHDAQV................QKAAA.........
C6SSR0_STRMN/229-544-----------------EDPGLVMQEGLKY.GALVKVKVDNMRNQHDAQV................QKENT.........
D2BME6_LACLK/237-554-----------------EDPGLVMQEGLKY.GRLVKVKVDNMRLQNEGVA................EKEAK.........
C7U3H1_ENTFL/242-558-----------------EHPGEVMNYGQKF.GSLVKIKVDNMRLQHETLV................ERDAQ.........
C9AXQ9_ENTCA/242-560-----------------EHPGEVMNYGQKF.GSLVKIKVDNMRLQHETIL................EHDQQ.........
C2H915_ENTFC/242-560-----------------ENPGEVLNYGQKF.GSLVKIKVDNMRLQHETIL................EHDEE.........
A8U9Q7_9LACT/242-557-----------------EHPGEVMNYGQKF.GSLLKIKVDNMRVQHETIL................ENESQ.........
C8NGP5_9LACT/242-561-----------------ERPGEVMNYGQRF.GSLMKVKVDNMRLQHEEVL................KTDYT.........
C4FT76_9FIRM/239-557-----------------ENPGEIMQLGQEF.GELIKIKVDNMREQVRGLE................AEEHA.........
D7UVI4_LISGR/239-552-----------------EHPGEVLNYGEQY.GTLLKIKIENMREQHQAIV..............................
Q4EHP2_LISMN/226-539-----------------EHPGEVLNYGQQY.GSLLKMKVENMREQHTEIV..............................
C3C6H9_BACTU/240-558-----------------EHPGDAMNYGQRY.GSLIKIKVENMREQHTALL................DEPAM.........
B7GGF8_ANOFW/238-552-----------------EQPGEVLTYAQRY.GSLINIKIENMREQHANIV................HQEME.........
C5D8S7_GEOSW/240-558-----------------EQPGEVLTYGQKY.GSLINIKIENMRQQHANIV................NQERN.........
Q5L0R2_GEOKA/237-554-----------------ETPGEVLTYGQRY.GSLINIKIENMREQHANIV................GKEAK.........
Q2B7A4_9BACI/240-560-----------------EQPGDVLSYGQKY.GSLVNMKIENMRQQHTNIV................GETHT.........
A6CS65_9BACI/239-558-----------------EQPGQVLSYGQKY.GSLINMKIENMRQQHSTIM................NETSH.........
Q62V69_BACLD/240-556-----------------EYPGEVMTYAQKY.GSLINMKIENMREQHSAIL................SQNKQ.........
A8FD49_BACP2/240-559-----------------EQPGDVLSYAQRY.GSLINMKIENMREQHSSIV................NEEKE.........
YLOV_BACSU/239-553-----------------EEPGNVLNYAQHY.GELIKIKIENMREQHTSII................SQESK.........
A7Z4K4_BACA2/239-555-----------------EEPGNVLNLAQRY.GDLIKIKIENMREQHTSII................SQEHD.........
A3I4A9_9BACI/235-549-----------------EQPGSVLSIGQKY.GSLMKIKVDNMREQHSAIV................GEEHK.........
C4L5Y6_EXISA/239-559-----------------ETPGEVITKGQRF.GELVAVKIENMRQQHSTIL................EEEHG.........
B1YIP1_EXIS2/249-568-----------------ETPGEVITKGQRF.GELVAVKIENMRQQHSTIL................EEEGV.........
Q8ER15_OCEIH/240-552-----------------ETPGTCMNLGQRY.GSLINMKIENMREQHTAIV................GDKKK.........
Q9K9Z6_BACHD/240-557-----------------EFPGEVLTRAQRY.GSLIHTKIENMREQHTHLL................EESKQ.........
D3FT80_BACPE/239-561-----------------EEPGAVLSKAQRF.GDLINIKIENMREQHTHLL................DETKA.........
Q5WFL6_BACSK/240-557-----------------EYPGEVLTEAQAY.GPLMQVKIENMREQHARLT................NDSHG.........
E6TTN1_BACCJ/240-559-----------------EYPGNVISAAQKF.GALVNVKIENMREQHTSIL................ANEPI.........
C0ZFY0_BREBN/244-568-----------------EHPGSVLQYAQQF.GSLHRLKIENMREQHANIL................KAEES.........
D3E5U1_GEOS4/248-586-----------------KAPGEVLNLALMY.GEITQIHILNMREQHRDLL..............TTGMDIAPMPELFADI
C6J2C5_9BACL/251-590-----------------KTPGDVLNLALRY.GEITQIHILNMREQHRDLL.............IAGMDAAPPMPELFAEI
C6D4E5_PAESJ/261-606-----------------RKPGDVLNLAMAY.GELTDFHILNMREQHRDLL........EHEAAAEPFAPVPEYALTGDIS
B7C794_9FIRM/230-541-----------------LEPFTAIKMGRRQ.GRFIKLKVENMQEQHDNII................EKEEE.........
A8REK2_9FIRM/228-542-----------------LTPGEALNLGQRY.GEFVKLKIENMQEQHENIL................TNAPV.........
E7FUT6_ERYRH/228-541-----------------LKPGNALNLAQRY.GEFVKLKIENMSEQHNTIL................DAESN.........
B0N2X3_9FIRM/230-551-----------------LKPGNALNIAQRF.GEFVKLKIENMQEQADTIQ................SNAGT.........
A9NEV2_ACHLI/238-560-----------------NQPGVALTLAQKF.GELKTIKVDNMRTQHGNIT.........GQDHSGHDHSQA.........
A8SBE9_9FIRM/237-564-----------------ADPGKILSEAIKY.GYLTNFKIENMHEQFLARQKQGKSLEKQASAEKAPSQASE.........
D1PLR2_9FIRM/236-561-----------------SDPGMMLSEAIKY.GYLTDFKIENMHEQFLARQKQGKGLEKQAQAEE..NKESE.........
D4JU96_9FIRM/229-544-----------------EHPGKALEEGILY.GSLINLKIENMKEQHKGAA..........AKAEMQKKQKL.........
C0E9S3_9CLOT/234-550-----------------DNPGNAIQEGLKF.GYLTNMKIDNMRDQHESKA.........HQARQSKKQEEY.........
B0PDV8_9FIRM/236-554-----------------DHPGLALEKAGED.GQLTNLKIENMREQYEAQK.........ASVVEPVSDQGF.........
D4L902_9FIRM/231-548-----------------EQPGNALSKGLEF.GQLLTVKVENMKEQHKNVK..........STKKKAEKEKF.........
A7VZD4_9CLOT/242-566-----------------ENPGQALQEALKF.GQLLTVKVENMKEQHRIAA.........EQNEQAKAKAAM.........
E6U6Q7_ETHHY/232-536-----------------DHPGKAIEEALTF.GFLTDLKIDNMHEQHREKA..............................
A6NT49_9FIRM/241-558-----------------NHPGKVLEEALTY.GALQTVKIENMRNQHSEIL........EEAAQTAPAQEEH.........
B7ATY7_9FIRM/235-571-----------------NDPGLAIQKALTF.GQLTRMKIDNMREEHNQKV......IEAAEAKKAAEAVDT......ASQ
C4Z046_EUBE2/238-567-----------------NHPGQAFEKALEY.GQLTKMKVDNMREEHNQKV......VAQSELQAAAAKQAM.........
C4G384_ABIDE/245-571-----------------NDPGLAIQKALTY.GQLTSMKIDNMREEHHERV......IENATQKAREQKEAE.........
A5ZQF2_9FIRM/220-541-----------------NHPGQAIERALTY.GSLSRMKIDNMREEHQEKL......IKDAEKLAKQQAEEE.........
C0CI33_9FIRM/234-555-----------------NHPGQAIEKALTY.GALSRMKIDNMREEHQEKL......IKDAQKLAAIQAEED.........
C9L650_RUMHA/223-540-----------------NAPGDAIQRALTY.GQLSNMKIDNMRLEHHERL......IKDAEKVAAQQAKAE.........
C6LER9_9FIRM/221-545-----------------NEPGVAITKALTY.GELSRMKIDNMREEHQEKL......IKDASKHAQEEAKAE.........
B0G5R1_9FIRM/234-558-----------------NDPGLAIQKALTY.GQLSRMKIDNMREEHREKL......IRDSEKLAKEQAEAE.........
A7B4K5_RUMGN/233-550-----------------NHPGLAFEKGLTY.GQLSRMKVDNMREEHQEKL......IRDAEKVAAEQA............
C0BWD3_9CLOT/224-547-----------------NDPGLAIQRALTY.GQLSRMKIDNMREEHQEKL......IRDAQKLAAQQKAEE.........
B6FRX3_9CLOT/69-388-----------------NDPGLAIQKALTY.GQLSRMKIDNMREEHEEKL......IRDAQKLAKEQKE...........
A9KPH5_CLOPH/237-560-----------------NDPGLAIQRALTY.GSLTRMKIDNMREEHNERL......IADASAQAAKNIEMA.........
A5Z3S4_9FIRM/232-549-----------------NEPGVAITKALTY.GSLSRMKIDNMREEHQERL......IKNAEKMAEQQKADE.........
C4Z9X2_EUBR3/220-552-----------------NDPGLALQKALTF.GSLSKIKIDNMREEHQEKL......IKDSQKLAAQQKAEE.........
C0FY34_9FIRM/239-571-----------------NDPGMAMQRGLTY.GSLTTIIIENMRLERDEKI......SAMKEKEMQNTANAE.........
C7G7M6_9FIRM/240-565-----------------NDPGLAMQRGLTY.GSLTTIIIENMKLERDEKI......SALKEKEMQSAGIPE.........
C0EVE2_9FIRM/237-569-----------------NHPGEAFEKALTF.GALSNMKIDNMRLEHQEKL......IKDAENEAARQRQQE.........
B0M9Z1_9FIRM/232-546-----------------NHPGKAIEKGLSY.GALTSMKIDNMREEHEERL.............NLSRQAEE.........
D4MYY8_9FIRM/239-553-----------------NHPGKAIEKGLTY.GELTNMKIDNMREEHRERL.............NLTQAEES.........
A8SPK6_9FIRM/236-563-----------------NHPGQAFEKGLTL.GYLTNMKIDNMRIEHHERV......ISQSERDEAEKQEEE.........
A7VBL4_9CLOT/234-560-----------------NHPGQAFEKGLTL.GYLSNMKVDNMRLEHHEKV......IKQAEREEAARQEAA.........
D4CER5_9CLOT/251-574-----------------NDPGLAVQKGLSF.GSLSRIKIDNMREEHEERL......IRDAERLTKEQKERE.........
C5EUI7_9FIRM/240-566-----------------NHPGLAFEKALTY.GSLSRMKVDNMREEHQERI......IKDSERLAREQAAGN.........
C0D0L6_9CLOT/238-564-----------------NHPGLAFEKALTF.GSLSRMKVDNMREEHEERL......IKDAEKLAREQKAQA.........
D4CN13_9FIRM/241-565-----------------NHPGNAFEKGLSM.GYLSKMKVDNMRLEHNERL......IRDASRIAAMQSLER.........
C2KWS6_9FIRM/238-567-----------------NHPGDAFEKGLSL.GYLSKMKVDNMRLEHHEVL......IEDASRIAAMEKLEE.........
B1IIK7_CLOBK/230-541-----------------NDPGDILSKAIKL.GPLSKIKIDNMREQHKHII..........DMNSEENKVE..........
Q895P1_CLOTE/232-546-----------------NDPGKVLSKAIKL.GPLSKIKIDNMREQHRHIL.......EDEDLKDVSTVET..........
A0Q104_CLONN/236-554-----------------NDPGWVLSNALKL.GELSKIKIDNMREEHRQIL.....ELEYATTEEEEESSK..........
C6PUV3_9CLOT/231-545-----------------NDPGKVLSEAVKL.GELSKIKIDNMREQHRNVL........DIHNEASIEKDEE.........
A5N7Z4_CLOK5/231-555-----------------NDPGEILSEAIKL.GELSKIKIDNMRQQHRSILNADGGKTPLEDINNDSEGEGY.........
B1RQ99_CLOPF/234-548-----------------NNPGKVLEEAVKF.GELSKIKIDNMREEHREML........EGMYEEAAETEES.........
C1I7N0_9CLOT/231-556-----------------NDPGAVLAKAVKL.GELSKIKIDNMREEHREVL......LSKEEYKEANVNDSN.........
C4IJG6_CLOBU/231-551-----------------NDPGKVLSHAVQL.GELSKIKIDNMREEHRELL......MESKDYEEAKNNNHD.........
A6LSK9_CLOB8/231-546-----------------NDPGLVLSKAVAI.GELSKIKIDNMREEHRELL......INTKELTETSSEDE..........
B2TJ09_CLOBB/232-548-----------------NDPGLVLSHAVKI.GELSKIKIDNMREEHRELL.........TELQSNENAPMD.........
Q97IB5_CLOAB/232-547-----------------NDPGLVLSKAVKL.GELSKIKIDNMREEHREVL......GLKTEGSSSETTEE..........
D9SLB2_CLOC7/231-546-----------------EDPGKVLSLARAH.GQLSKIKVENMREQHTQLL............ESKEEASKE.........
B6FZ18_9FIRM/234-544-----------------NEPGNVLQEALKY.GQLLTIKIENMRMQHENIL............EGVAENAEY.........
C9YPD2_CLODR/235-547-----------------NDPGNVLQEALKY.GQLLTIKIENMKLQHENTL.........LDVEEKKENDS..........
B0AAY8_9FIRM/232-545-----------------NTPGDVLQEALAF.GQLLTIKIENMKLQHENKV.........IQDAKESEVEEQ.........
D3MPQ7_9FIRM/235-560-----------------NNPGNALQEALKF.GQLVTIKIENMRLQHNNTI.........IPDEEQEQAIEG.........
A8MH97_ALKOO/232-548-----------------NHPGKVLEHALEL.GGLSDIKIDNMRLQHRHEV......FNQAEYKEDAKKEPV.........
A6TRV4_ALKMQ/231-542-----------------NHPGEVMEHALKL.GQLSDIKIDNMRLQHRHQL...........MEQDTDTNKV.........
B1C9C9_9FIRM/230-550-----------------NVPWNAMKMAATC.GDLSKIKIENMREQHNEII.........VKSEEENKKEEE.........
D1VSD4_9FIRM/236-553-----------------NHPGKALEYACEL.GLLQDIKIDNMRYQHREIL......FDDSEVKKAKEREE..........
A8SMH4_9FIRM/227-540-----------------NHPGQAIEWALEF.GPLHDLKIDNMRRQHNHLH......HTDKEVEDAKHSEEV.........
B0S152_FINM2/230-541-----------------NNPGKVLEIALEL.GALKDIKIDNMRLQHQNLY..........STEEEINQASS.........
Q4A591_MYCS5/234-550-----------------EKPGSLISYCHKY.GELIKIKSENMSLQAKESK..............................
C4XDU6_MYCFE/229-541-----------------LKPGDMLNFGQKY.GEFIKIKSENMTRQASESR..............................
D3VQS9_MYCA6/233-548-----------------LKPGDMLNFGQKH.GEFIKIKSENMTLQAENSR..............................
Q6KHN1_MYCMO/228-542-----------------LKPGKVFNYAQKY.GEFLKLKSENMTEQTKENR..............................
Q98R49_MYCPU/230-545-----------------EEPGVFLNMAQRF.GEFTKIKIENMTAQANESK..............................
D1J8Q5_MYCHP/228-542-----------------PKPGDVLNSVNSL.GQFVKIKIDNMTLQANNSK..............................
B3PN92_MYCA5/229-546-----------------KKPGDVLNAVNSL.GQFLKIKIDNMTVQASSSK.............................E
C5J6D6_MYCCR/231-544-----------------DKPGNMLNYLQKF.GEFAKIKIESMDKQADQII..............................
B2NEH1_UREUR/237-564-----------------LTPYKFLQISQKY.GEFDKVKIDNMTNQFYENL..............................
D3FH26_MYCGH/234-574-----------------LTPDLVLKHAQPY.GEFLKVKIENMNKQVTERK.................QDDSNLGQLANKP
Y369_MYCGE/238-557-----------------LKPHLLLEMGLNY.GEFEFVKIDNMNLQVNNKN..............................
Y547_MYCPN/239-558-----------------EKPNLLLELGLNY.GEFELVKIENMNLQVAKQK..............................
Q8EVZ4_MYCPE/248-573-----------------ITPSLVFEIGQKY.GEFLKLKVENMTLQYIESH..............................
Q14LS2_SPICI/227-539-----------------LLPGYIVTFLQQH.GEFKNIKIENMNLQAAKHV..............................
Q2SS00_MYCCT/225-547-----------------LSPGQVLQFLQQY.GDFQTLKIENMNLQANKQV............................KN
Q6F1N7_MESFL/225-548-----------------LSPGQVLMFLQQY.GDFKTIKVDNMNLQADKQV...........................KGN
B1VB30_PHYAS/245-554-----------------NCPGTILEKLLNY.GNLKISKIDNMKEQHQKII..............................
Q2NK36_AYWBP/239-571-----------------NKPEKVLEKLLTY.GTLKVRKIENMKEQCQSIL...................DKKHDKFTPEK
B0K1Y0_THEPX/233-533-----------------NNPGLVLEEGLKI.GELIKVKIDNMKIQHESLV..............................
Q8R9U3_THETN/225-525-----------------NNPGLVLEEGVKI.GELIKVKIDNMKLQHETII..............................
C9N026_9FUSO/239-542-----------------NHPGKAMEIALEY.GPLEKMKIENMRLQHDNLQ...............IFSERD.........
D0GPN7_9FUSO/239-542-----------------NHPGKAFEIALEY.GPLEKMKVENMKLQHDNLQ...............IFSEKD.........
D1AJX8_SEBTE/238-542-----------------NNPGQALELALKN.GDLEKVKIENMKLQHENLY...............VKQPDE.........
D1AVV3_STRM9/236-535-----------------NNPGQALELAVTH.GDLEKIKIENMKLQNEGL................LSSEKE.........
Q7P8L0_FUSNV/238-555-----------------NHPGQVLEIAGAL.GDLNNMKIENMEIQHSHVL...............VKEEELNKVDIRGIV
C6JQ39_FUSVA/240-546-----------------NHPGQVLEIAGTL.GNLNNIKIENMEIQHQNLL...............ISENANYQVE.....
C3WC47_FUSMR/240-543-----------------NNPGQVLEIAIKY.GQLNNIKIENMAFQHKNLL...............VSEK...EIK.....
B5YEA3_DICT6/236-544-----------------NHPGLVLERALEL.GSLSRIKIDNMAEQHEERL................KEEIS.........
B5Y797_COPPD/228-524-----------------NEPFLVLQEMGKF.GELIQVKIDNMAAQVEGRF..............................
A5ILK4_THEP1/226-528-----------------NHPGQVLEKVIEF.GEIVKVKIDNMKLQHEHVI..............................
A7HN75_FERNB/228-537-----------------NNPGSVIEKFLEY.GDLVKVKIDNMKMQHEHVV..............................
B7IFW1_THEAB/228-537-----------------NNPGSVIEKFLTV.GELMKVKIDNMKMQHEHFV..............................
A6LJM3_THEM4/228-537-----------------NNPGNVIEKLLTK.GELLKVKIDNMKEQHEHFI..............................
A8F8T1_THELT/233-540-----------------NNPGVVIEEALKY.GEILKVKIDNMKLQHEHLV..............................
A9BG53_PETMO/231-555-----------------NHPGLVFEKFLEH.GELIKTKIDNMKSQHEHII................EKQKE........G
C5CI85_KOSOT/233-554-----------------DHPGEVIEKFISY.GQLQKVKIDNMKLQHEHVI................EVQEA.........
A4XKD8_CALS8/229-545-----------------NSPGKVIERALKY.GELINIKIDNMKYQHQEFV................KAETD.........
B9MRL9_ANATD/229-545-----------------NSPGKVIEKALKY.GELINIKIDNMKYQHQEFI................SKREN.........
B2A2L3_NATTJ/236-554-----------------NRPGKVLEDSMKF.GELTDIKIDNMKKQHDTEI........IKNEEPGDSKEDE.........
B8CWU7_HALOH/238-549-----------------NHPGIILEYGLKL.GSLIDINIDNMKIQSAEKV................RQTEE.........
Q3ABX4_CARHZ/233-531-----------------NHPGEALELGLRW.GLIYNIKIDNMLEQSQEKQ..............................
C9LL18_9FIRM/236-538-----------------QRPGHVLDMAASW.GTLHDIKCDNMVDQFHKNK..............................

PF02733

DHAK_ECOLI/16-356FTSPTPDKIFECAMQV.DGGEGVLLIIKNYTGDILNFETATELLHDSGVK------------------------------
DAK1_SCHPO/17-344FASPSSKQIYTGIKQV.ESEAGTLVICKNYTGDILHFGMALEKQRTAGKK------------------------------
DAK_PICAN/17-355FASPSTKQIVSGLKAK.PSDKGTLIVVKNYTGDILHFGLAAERAKAEGVP------------------------------
Q9RJR0_STRCO/16-335FASPSARQIHSVATAA.HGGGGVLLMYGNYAGDVLHFGQAAERLAADGIE------------------------------
DHBK_SOLLC/22-345FASPNVDSILAGIRAV.TGPMGCLLIVKNYTGDRLNFGLAAEQAKSEGYK------------------------------
DAK2_YEAST/17-345FASPSTKQIYSAIKAV.ESPKGTLIIVKNYTGDIIHFGLAAERAKAAGMK------------------------------
DAK1_YEAST/16-344FASPSTKQILNAIRLVNENASGVLLIVKNYTGDVLHFGLSAERARALGIN------------------------------
DAK_PICPA/17-357FASPSTKQIFSAIKAK.PSKKGTLIIVKNYTGDILHFGLAAEKAKAEGLN------------------------------
DAK2_SCHPO/17-345FASPSTKQIYSALKAV.ASPKGTLIIVKNYTGDIIHFGLAAERAKAAGMN------------------------------

PF03610

C4ZTN9_ECOBW/4-122-----------------RLGEGVGELARQMLMS.DSCKIAI---------------------------------------
PTNAB_SHIFL/4-119-----------------WAAEQLLKTAEMLLGE..QENVGW---------------------------------------
Q48519_LACCU/3-117-----------------QYSIGLLNAFHMIFGE..NNGYCA---------------------------------------
Q98CM1_RHILO/3-116-----------------QLATEFRHAVEHVVGP..QDNFET---------------------------------------
Q97QN0_STRPN/5-114-----------------HIAEGVVELISKVAKD.V..PITY---------------------------------------
Q9CMJ0_PASMU/4-120-----------------VAAEQLLKTTEMLIGE..QDNVAT---------------------------------------
PTFA_BACSU/3-117-----------------DFPIALKESSGMIFGE..ENNLIA---------------------------------------
Q9K7G6_BACHD/7-116-----------------ALAEGIVTLLKEAAKD.V..SITY---------------------------------------
Q9CEX8_LACLA/4-123-----------------EFAAGIKQSGSMIFGE..QEKVQV---------------------------------------
Q99VW9_STAAM/3-113-----------------EIASGTKSLLKQMAGD.V..DIIP---------------------------------------
Q97SL1_STRPN/2-115-----------------HFATGIYSSLQLIAGN..QENVEA---------------------------------------
YADI_ECOLI/3-117-----------------DRAQEILDALEKKHGA..LLQCRA---------------------------------------
Q8R8K1_THETN/8-123-----------------KIVEGVFELVNQMTRG.KV.PIGI---------------------------------------
Q8XH56_CLOPE/3-118-----------------EMAKGLFDAIDMICGT..QEKFSI---------------------------------------
Q97N91_STRPN/5-123-----------------NFASGALMTAEMFVGETTNDRVRT---------------------------------------
Q9RZR3_DEIRA/4-120-----------------KLAEGVAEFVGQMNAG.QV.ELEA---------------------------------------
Q8R5U5_THETN/552-666-----------------AAATSIAEVANRLLGE.N..YVIG---------------------------------------
Q8YA15_LISMO/3-118-----------------KITEGLQEMIVEMVGD.TV.HIIS---------------------------------------
Q9KIQ1_ECOLX/3-117-----------------GFASGMEKAMKQILGE..QSQFIA---------------------------------------
Q9JXH6_NEIMB/10-123-----------------TIGEAYRKLAHHFFPGGLPENVRI---------------------------------------
Q9ABI7_CAUCR/15-129-----------------RLAEEFVSAMEHVVGP..QAAVKA---------------------------------------
Q9S4L5_STRSL/4-123-----------------KFAEGIHQSGSMIFGD..QEKVQV---------------------------------------
Q8VP39_ECOLX/3-120-----------------RLAQGVEELALQMSGG.DV.PLAI---------------------------------------
Q97T86_STRPN/4-118-----------------RFCEELRGSTEMIMGP..QDNIYT---------------------------------------
PTRA_KLEPN/3-115-----------------QLAGAMLDSVCMVYGE...VNVSA---------------------------------------
Q9FC13_STRCO/2-118-----------------EVAASVAELAKALSGGAGAVAVAP---------------------------------------
Q98C52_RHILO/5-120-----------------LVAEGTADMVRQMVGD.EV.PLAW---------------------------------------
Q927E4_LISIN/6-115-----------------DVAKGVHDIIKEIAPD.V..SITH---------------------------------------
P96165_VIBFU/3-117-----------------AFASGMAQAVHQVIGE..QDQFRF---------------------------------------
Q9A0T2_STRP1/3-117-----------------HFASGIVSALELIAGK..QEKVTA---------------------------------------
Q8P225_STRP8/5-114-----------------NIAQGVVDLISEVATD.V..AITY---------------------------------------
Q8RHZ6_FUSNN/5-122-----------------ELAEAAIHLANEMKRY.DF.PLIN---------------------------------------
Q97TN2_CLOAB/3-119-----------------EFAKGILQSGAMIFGD..QENVQA---------------------------------------
Q9RGG5_LACCA/2-115-----------------HTAKAFKEAVEMIYGE..VPNFHP---------------------------------------
Q97J29_CLOAB/3-121-----------------QFASGLYNALSMLAGK.DRNDVIF---------------------------------------
DHAM_LACLA/4-113-----------------EIASGLKKLIREVAKN.I..SLTA---------------------------------------

PF02645

Y1149_STRPQ/3-279--------------------------LY-------------SDN...DLKEEGHFLSLMKASKSLPK.TSQPPVGLFAET
Y1667_STRPQ/2-283--------------------------VY-------------ETVGPNRI.SSDYLLKKM.KAGSHPQ.TSQINVGEFEKV
Y1478_STRPQ/2-279--------------------------IF-------------RDDD..GL.DIDNMMTTMYQSSKATT.SSCPSPEAFLQA
Y586_STRPQ/2-281--------------------------TY-------------FEGR..NL.SIDDFYQKMADSKNLPK.TSQPSLSELDNL
Y1557_STRPN/2-281--------------------------EY-------------VEGI..NL.SAEEFYQKMAQASELPK.TSQPSIAKLDEI
Y3627_BACHD/3-282--------------------------AY-------------QEEV..EL.SSADFYEKLKHEEKLPT.TSQPAVGLFVET
Y2509_CLOPE/3-280--------------------------EY-------------NDIF..DI.KPIDVYENL..HNEVPT.TSLCSPDYINSV
Y1903_DEIRA/1-281--------------------------VY-------------SER...EL.PPDQLVNLIRTTGEPAR.TLAIDDEVVART
Q65EA6_BACLD/2-280--------------------------SY-------------REEI..DM.SWKDYYKEVKAHENLPT.TSQPAYGELISL
Y2514_LISMO/4-283--------------------------SY-------------REGE..EL.SATDFYRKVKEAENFPT.SSQPAPGEFIHL
Q9I599_PSEAE/2-314--------------------------RL-------------IDRRDPDT.TLSFYRDHLPKVGSKDG.SQPLSAAELQQW
Y500_DEIRA/6-281--------------------------SY-------------PMN...EV.SRQWLYDELGRNPAHPT.SSQPSPQQWLDA
Y2569_STRCO/4-281--------------------------AL-------------EEGT..EI.STRSLAQALQKRRPV.T.TSRPNPELFAET
Y359_MYCPU/2-276--------------------------TY-------------KDGI..DL.DNKNFFEIFKKNSKTS..TSASSRGEIISL
Y326_MYCGE/3-293--------------------------SF-------------RDGIEIDY.DHVHKLLKENPHGLNIS.TSLPRQSDLLKI
Y1986_DEIRA/2-279--------------------------LY-------------QDGV..QL.SARQLVEGVRAGKAIPS.TSQPSPAEFAQA
Y1468_THEMA/2-284--------------------------SE-------------PDER..EPEEIMNFYKRIREAGSVPK.TSQPSVEDFKKR
Y472_MYCPN/2-290--------------------------TY-------------RDGKDIDY.DRVYQLLKEHPQGLNIS.TSLPRQADLIEL
Y3284_CLOAB/2-281--------------------------SF-------------KEK...DI.SNEVFYEKM.NEKGIPK.SSQPSIEDLCSV
Y701_CLOAB/3-278--------------------------SY-------------FDIV..DI.NFKQLSKIMDEENIFPT.TSQVTPKRFNDC
Q8RHS1_FUSNN/563-843--------------------------NY-------------KDGV..NL.SKKEFWHKLMTEKVVPK.TAQPSPAEFRDY
YTEA_LACLA/2-285--------------------------TY-------------ETIGEAAL.DNSTLLAAI.KKGATVH.TSQINSGQFLEV
Y026_CLOPE/3-287--------------------------EY-------------IDNIDSEL.TPKAFYNKL.REGIMPS.TSQVNSFRFVEA
Q9CHY7_LACLA/316-595--------------------------AF-------------LDKL..TI.NPQIFSEKYNKNLKMT..TSQPSIQSVDSL
Q92E62_LISIN/310-585--------------------------NF-------------LDKL..TV.GPTLIQQKLTQQHKMS..TAQPTIRTVDAL
Y2349_CORGL/2-260--------------------------..-------------.........EERS..............TSGLSSLELAAS
Y3382_XANCP/2-308--------------------------VL-------------ADHRDEEA.TLSFLHAHVAERGHEAE.TTPFSVNQIRDL
Y1112_STRPN/3-278--------------------------VY-------------SDA...DLKEEGKFLQLMQESKNLPK.TSQPPVGVFAEI
Y711_STAAW/2-283--------------------------NF-------------TESN..EI.AIEEFYNKMASSQTIPT.TSQPAIGEWITK
DEGV_BACSU/2-281--------------------------TY-------------REEI..EL.DWKSFYEEVKKHNELPT.TSQPPIGELVAL
YITS_BACSU/2-283--------------------------EF-------------EDAV..TI.HADQIFEAM.QNGETPK.TSQASPQTIKNV
Y948_CLOAB/3-281--------------------------EY-------------KDKV..DI.TSEEVYRNF..EIEVPK.SSMPSLQDMEDL
Y1310_CLOPE/3-278--------------------------SY-------------LDGV..EI.KVDSMMERIEREDTLPT.TAQIVPTRFIEK
Y742_STRPN/2-279--------------------------VF-------------VDDA..SL.DIDQMMETMYATAEASK.SACPSPDDYLRA
O32516_EUBAC/2-280--------------------------QY-------------EDGV..EI.TPAEMYKKIGSIRQAAHFILKLTPQKFEEA
Q9RY87_DEIRA/13-293--------------------------SY-------------SST...EL.SPERLLALIEAQGAAPV.IEPPSVDAYEQV
YQAC_LACLA/2-280--------------------------DY-------------.DLQ..KI.SHEEWYDLMAEAQEVPK.TSQPRVAELDRL
Y1491_THETN/3-280--------------------------SY-------------KDGV..DI.KKEEFYKLL.REGKMPT.TTQASPVEFMEV
Y2440_MYCBO/2-275--------------------------DL-------------RDGV..DE.IPDDIHKRH......AT.TAGATPVELSAA
YEJH_LACLA/2-278--------------------------MY-------------SDD...DL.KFEDFMVKMAASKNLPK.TSQPPVGVFAEV
Y766_MYCPU/3-281--------------------------SY-------------EDNP..SN.DRQKLFDKIIQASDI.K.TSLPISSTIEKA
Y535_UREPA/4-288--------------------------LI-------------VDDGIES..KPERIYEDIDNGYTFQ..TSCTPYGVLIEA
Y1863_LISMO/3-279--------------------------VY-------------NPKT..DI.TPEEFMVRMAETKELPK.SSQPAIGSFVEA
Y1624_CLOAB/3-280--------------------------EY-------------IDRV..TI.SPREVYDNL..HIEVPS.TSLPSMGDMESL
Y304_CLOPE/2-282--------------------------SY-------------KEV...DI.DSEAFYDELAKCDKLPT.SSQPPMDEFYNA

PF13684

C4LJE3_CORK4/314-601........SSLQTARPRLR............SVLAVVP...SEDA.AAFF.GRAGADTVVIEADE....NVADQDQYGVV
C6R8U4_9CORY/214-447.............EEPISR............RVFAAAP...AGPI.SDLL.ASAGVSVV...........SPDDPIA...
C0WG06_9CORY/215-450...........DTGAGHTR............TVYAAVP...AGPM.AELV.QSAGVTVV...........EPGETIH...
C3PG03_CORA7/246-486.......CEDSAGGGGTHR............RIFAAVP...EGAA.RELF.EKAGADVV...........KPGEELQS..
E0DHT2_9CORY/321-602............TTT............NHR.IILALTP...TGLI.THLY.QSAG.ALTI..........NPGDDIVLDI
A4QDT8_CORGB/263-567.........GSFTEE............PRR.VLVAVAP...DGLV.AELY.RSAG.VKVVARNIAQ....SKSDDVVAKI
Q8FPQ3_COREF/261-567.........S..TEV............PRR.VLIAVTP...HGSL.ADLY.RSAG.ATVVTRDTAELTEAEPSNEIVSEI
B4V5A9_9ACTO/101-401................RRGRG....ERAQR.AVVAVVP...GEGL.AGLC.AEAG.ATTVLTRPG....EEPT.AA..AL
B1VYY9_STRGG/272-575.........GH....DLRVQA....EPAQR.AVVVVVP...GDGL.AGLC.TEAG.ATTVIARPG....EPPA.SG..EL
D2AVL0_STRRD/223-521...............SGRTHP....AARGR.GVVAVAA...GPAL.GAVF.EQSG.AVVVRREPG....SSPP.LA..AV
A1SLV3_NOCSJ/245-552.........AA....VRGRTA....ARDGR.RVVAVAA...GPGL.AALF.EEAG.AVVVPGGPG....RRPS.TG..QL
D2Q0M6_KRIFD/247-545.........PH.........P....PAPGR.AVIAVAA...GDGL.ARLF.GEAG.AVVIRGGPG....RRCS.TG..EI
A3TRA2_9MICO/271-570.........SA.........R....EPQQF.AVVACAA...GPGM.ASIL.TQAG.ATVVSSAPG....ARAS.AG..QL
D3Q0S3_STANL/231-545.........AAGGEVAVES.......PSGQRGVVVIAE...GSGL.AQVL.RGEG.ALPVSG.......GRPSTQ...EV
C6WF10_ACTMD/229-545.........AQAGRFTRDR............AVVALVR...GDGV.AELF.EGEG.AVVLRVAGA....LDPA.....DL
A4FMM0_SACEN/221-521............RGYERDA............AVLACVR...GGAL.AELF.EAEG.ADVLRLADL......PESAGADEL
A8M651_SALAI/236-541.........TSPAAARPDP......APEGR.AAVVVAT...GAGI.VELF.TAAE.ATVVP........GSPAPN...EL
E8S7R0_MICSL/236-537.........TAPAPGPQVA......LPDGR.AAVVVAT...GAGI.AELF.AAEG.AVVVP........ANPSTG...EL
D2SE35_GEOOG/241-542...............VRAPAP....DPGAR.AVVAIVP...DGGL.AELF.TDEG.ATVVPCGPG....GV.A.ED..DV
C1AG90_MYCBT/244-553.........SGLPAGGWTR.......GR...AVLAVVD...GDGA.AELF.AGEG.ACVLRPGPDAVTPAADISAH..QL
Q73VK3_MYCPA/255-575.........PGLPAGGWTR.......ER...AVLAVVD...GDGA.AGLF.SGEG.ACVLQRDPAAADPVTTISAH..QL
A1T719_MYCVP/239-551.........DRHPAGGWSR.......QR...AVLAVVD...GDGA.ESLF.TGEG.AEILRPQSD.....VPVSAQ..QL
A4TE39_MYCGI/238-547.........DRSSAGSWGR.......ER...AVLAVVD...GEGA.EELF.VGEG.AAVLRTEPG.....VEISAQ..QL
B1MDN6_MYCA9/245-551.........DVPGGGHHDG.......RHRHRRVLALAE...GDGA.ATLF.SSEG.AQVLRVDEP......PASAK..RL
Q5YRZ7_NOCFA/256-564....GGHADDEPEDGPADR............GVLAVAT...GADA.AALF.EAAG.AVVLD........DHPVTSA..GL
Q0S2E8_RHOSR/258-568....LLVPPVRTRPDQGER............GIVAVVA...GDGA.AELF.ASEG.ATVLRCDDA......PVTRA..QL
D0LC19_GORB4/238-548.......VDSVEPPPRYKR............AVVAVVT...GDGA.AELF.AEAG.ATVLRADDG.......LTAE..QL
C7M0D2_ACIFD/231-539...WVRDAPPAAEPSPPAT............AVVAVGT...GSGI.ARLF.RSFGVASIVAGGQG....ANPSIA...EL
Q72AQ0_DESVH/242-605PVG..IVTDSTCDLPRDLL.......DEYGIATVPLRLFLDDEEYADKVDITAEEFNRRLPTSRSARTS.QPAPADFATA
B8DJW1_DESVM/304-680PTGTAVVTDSTCDLPRELL.......DQYSIRTVPLRLFLDDEEFVDKVSISADEFNRRLPSSRSARTS.QPAPADFRTV
C6BSA4_DESAD/241-600.VG..ILTDSTCDLPDEVL.......EEYDIRVVPMRLSIDENDYIDRVTLSSSEFYKILPSAKRALSS.QPTPGDMKRA
Q5WZX3_LEGPL/229-591.IG..LVTDSSADLPQDLI.......DEYQIHQIPLNIHVDEHHLLDKYCFEANYFYTQLNSFRTYPKTSCMNPNLIEEK
D6XXQ9_BACIE/228-591.IA..FVVDSACDLPKELF.......DHHQIHMIPLNLEVESSNYLDKVTLDAERFYEILDAGTTQPKSSQPSLLSVETL
D3USI8_LISSS/226-588.TA..IVTDSIADLPEEFL.......LTHQIHVLPMNILAEDESFLDKLTVGPTMIKEKMMQQVKMSTA.QPTIRSVDAL
C8JV81_LISMN/227-585.IA..IVTDSIADLPEAFL.......LEHQVHVLPMNILAGDENFLDKLTVGPDMMQEKLRKQTKMSTA.QPTIRTVDAL
Q9CHY7_LACLA/234-596.IA..IVTDSVADLSADFI.......LENQIFVLPLNVSVGEQAFLDKLTINPQIFSEKYNKNLKMTTS.QPSIQSVDSL
A9NE55_ACHLI/228-589.IC..ILTDSIADLPKIFV.......DSHPIHVHPIGINFNDIVYYDKLTINNHQLFHYIDKHEKFPTSFTPSIKSIDAQ
B9L468_THERP/241-527............LTEARGS............ALLVLSP...APTI.RAWA.RRSGALALA.........PSPTLTEPERL
A7NGY6_ROSCS/225-516.SGAALSDTQPDTPANPAP............GIIALAP...GAGY.AAIL.RDLRADLVWETNTP......PTID...EW
A5UZ26_ROSS1/225-517SSAPVPVEQADIAAAPEAV............GIIALAP...GAGF.AAIL.RDLGASLVEETVAT......PTVD...EW
B3T9V4_9ZZZZ/265-569.......AQQGYTPAGVSV............AVVAVAS...GDGL.ERVF.RELGAAVVVRGGQT....INPSAG...EL
D3F1F7_CONWI/252-560..ERIASASASVETSPAAA.......PAARCGVLAVAS...GTGI.QRLY.EGLGV.HVLDGGAT....LNPSTY...DL
D1C518_SPHTD/261-574EDRHAAHPTAVAPSTADTT.......DI...ALVAVAS...GDGL.TDAL.RGMGATAVVPGGPT....VNPSTE...EI
Q1AW96_RUBXD/226-526............EGAAPEK.......NL...AAVAVSR...GEGN.REMF.EAMGA.LVVEGGQG....ANPSAA...DL
C9R910_AMMDK/226-518..........................KT...GVVAVVQ...GDGF.ATLF.RQLGA.VLVEGGAT....MNPSAN...DL
A9AU97_HERA2/231-545.......AAQAQQASQPAR..VKLDEPVSDVGVVAVAP...GQGF.RVLF.ESLNVGEVVTGGQT....MNPSIQ...DL
Q3Z724_DEHE1/240-544.........ALQKERMPAV.......DT...AIVAVVA...GDGL.KEVF.KSLGAQSIISGGQT....INPSTK...DI
C4F8W4_9ACTN/241-554....AKIHADQEASTEPAK.......PL...GFVAVAA...GSGE.AEIL.ESLGVDVVVSGGQT....MNPSTA...DL
B9CK02_9ACTN/240-557.EKIAEDKKAASTPKAPHK.......SL...GFVAVCS...GSGS.ESIL.KSLGVDVVVSGGQT....MNPSTA...DI
C8W750_ATOPD/240-554....EKIAEDKKAAAVPKK.......EL...GFVAVTA...GSGA.ASIL.KSLGVDVVVSGGQT....MNPSTA...DI
F1T5K6_9ACTN/246-577DFVAGATTSAAAASNAPLK.......DV...GFVAVAA...GSGQ.AEIL.TSLGVDQIISGGQT....MNPSTA...DI
C8WGT1_EGGLE/236-544.......DALAAEQGEAPK.......PL...GFVAVAA...GEGN.AKIL.KSLGVDVVVSGGQT....MNPSTK...DL
D0WE96_9ACTN/235-543.......AKIEADAAAARK.......PL...GVVAVAP...GAGN.AKIL.ESLGVDKVVSGGQT....MNPSTA...DL
C7N551_SLAHD/235-543.......EKIEAERAAEHK.......TV...GIVAVAP...GSGN.AKIL.ESLGVDVVVSGGQT....MNPSTA...DL
C7MMY7_CRYCD/236-543.......AKLAEEQQREHK.......PL...GFVAVAA...GAGN.ARIL.ESLGVDYVVSGGQT....MNPSTK...DL
Q24U26_DESHY/229-552............SGPVEEK.......EH...GIVAVAM...GEGI.AEVF.KSLGVDEVIFGGQT....MNPSTE...NL
Q0AYX3_SYNWW/234-546............AASKNLK.......NI...GLVAVGA...GSGV.VQIL.QNLGVDVVVEGGQT....MNPSIE...DL
B1I3R2_DESAP/234-530...............QPKK.......PL...GLVAVVS...GEGL.AKIF.ESLGTDTIVSGQQT....MNPSTE...EI
A4J402_DESRM/236-537............KESEPEK.......EI...GIVTVGT...GEGI.IDIM.NSLGADAVVVGGQT....MNPSTE...EI
C0GHJ3_9FIRM/232-538..........IEEAPAEPV.......VVDGKAVVAVAA...GDGI.AKIF.ESLGVAKVVLGGQT....MNPSTE...DL
Q67PP7_SYMTH/248-583AAVAGVAPAAQAEAPAPEE.......ELPT.AVVAVAA...GDGM.AQIF.RSLGVSQVIEGGQT....MNPSTQ...DL
Q03W26_LEUMM/246-568...EEARVEKIAAMQVPVS.......DT...AVIAIAA...GDGI.AELF.KSLGVHTVISGGQT....MNPSTA...DI
B1MXV1_LEUCK/244-565...EEAQVAKIAMTQKQV........DT...AVITIAA...GDGI.AALF.KSLGVQTVISGGQT....MNPATS...DL
C5RAD4_WEIPA/240-561........QKAHAVDEENE.......AGPDLAVITTAA...GKGI.QEIF.ASAGATVIIDSKQA......PSTQ...DL
Q04GL7_OENOB/238-554.........EQASQPKKPI.......ET...AVITVAS...GHGV.SELF.KSVGVTDVITGGQT....MNPSTK...DL
Q03RT2_LACBA/242-565..AAADAGVVTATADEAPA.......DT...AIIAIAA...GDGL.ATLF.KSLGVTHVVNGGQT....MNPSTQ...DI
C0XM56_LACHI/243-571SSPIQKAESIDAKADQPAS.......DT...AIISISS...GKGL.NDLF.KSLGVNYIVNGGQT....MNPSTA...DI
Q03FX4_PEDPA/244-562.......PTASSASKEAAP.......ET...AVIAISS...GAGI.SKLF.TSLGVTHIISGGQT....MNPSTA...DI
C0X0A9_LACFE/228-551..PAQQSAPAAKPADQPQF.......ET...AVIAVAS...GNGI.QELF.KSLGVTHVISGGQT....MNPSIE...DL
C8P937_9LACO/251-577DAAASDEQASQPAETEPAP.......ET...AVIAVAS...GDGV.IKLL.KSLGVTHIIGGGQT....MNPSTQ...DI
C7XUP2_9LACO/252-573....SVAENADADGEKEAP.......GT...AVIAVAA...GQGI.SELL.KSLGVTHIISGGQT....MNPSIQ...DI
C5F3T1_LACPA/241-558........LDQQVAQKPLA.......EM...GVVAIAA...GQGL.GELF.KSLGVTHVLNGGQT....MNPSTN...DI
C2EEW2_9LACO/228-553NNKDDVEAKKLADARKNAG.......DY...GILTVVS...GKGL.KDLF.ISLGATDILDGGQT....MNPSTQ...DF
E7FR73_9LACO/242-562.....EEREEEISENEISG.......DY...GIIAIAS...GEGV.AEIF.KNLGATYVLSGGQT....MNPSTQ...DI
Q38XS7_LACSS/240-556.........ATAPVQAEPV.......DT...GIIAISA...GAGV.AELF.RSLGATYILSGGQT....MNPSTQ...DI
C4VLE0_9LACO/240-551..............EEEKV.......DF...AVIAVCS...GNGV.RQLF.ESGGVNRIISGGQT....MNPSTQ...DI
Q1G9J7_LACDA/246-559..............QQESV.......DF...AVIAVAS...GNGV.RKLF.ESEGVNRIISGGQT....MNPSTQ...DI
D0DI19_9LACO/242-553..............QQEAV.......DF...AVIAVAS...GNGI.RKLF.ESEGVNRIISGGQT....MNPSTQ...DF
C8PD64_9LACO/243-554..............QEESV.......DF...AVIAVAS...GHGI.RDIF.KSEGVNRIISGGQT....MNPSTQ...DI
C5Q8L3_STAEP/236-552......GLQNKEANESKTV.......ET...AIVTISV...GDGI.AELF.KSMGATHIISGGQT....MNPSTE...DI
D2N6K1_STAA5/236-548..........TAKPKMETV.......ET...AIITISM...GEGI.SEIF.KSMGATHIISGGQT....MNPSTE...DI
D3QDG8_STALH/236-551.......GNQKKQDKHETV.......ET...AIITISM...GEGI.SELF.KSMGATHIISGGQT....MNPSTE...DI
Y1689_STAHJ/236-552......NHHSDEQEESKTV.......ET...AIIAISM...GDGI.SELF.TSMGATHIISGGQT....MNPSTE...DI
Y1546_STAS1/236-552......GGKAISTEETQAV.......DT...AVIAISM...GEGI.SEIF.KSMGATHMISGGQT....MNPSTE...DI
B9DPL0_STACT/236-547...........NEGKAEPV.......ET...AIIAISM...GDGI.SEIF.KSMGATSIINGGQT....MNPSTN...DI
B9EBA4_MACCJ/235-548.........KEAKNEIEKV.......EK...ALITISM...GEGI.TDLF.RSIGATHVISGGQT....MNPSTE...DI
C5NX21_9BACL/236-549.........KQATAPKELK.......EQ...AMISISM...GAGL.SKVL.TSMGVDYIVEGGQT....MNPSTE...DI
C1CCK6_STRZJ/240-555..........QVIKSAEEK.......EY...ALIAVVA...GKGL.ADIF.CSQGVDYVIEGGQT....MNPSTE...DF
A4W3T3_STRS2/240-554..........SFQKPAEQK.......EY...AIIAVAA...GEGL.TEIF.KSQGVDYVISGGQT....MNPSTE...DF
Q1J4X6_STRPF/240-554..........VEKNKAEVK.......DF...GLIAVVA...GEGL.SEIF.KAQGVDYVISGGQT....MNPSTE...DI
B1SBP2_9STRE/229-545.........QSTAASQEAK.......DF...AIVAVCA...GDGL.ADIF.KSQGVDYVISGGQT....MNPSTE...DI
Q03IJ3_STRTD/240-555..........IQASPSAPK.......DF...AFIAVVA...GDGL.ADIF.KSQGVDYVISGGQT....MNPSTE...DI
C6SSR0_STRMN/229-544..........TADLPREAK.......KF...GIIAVVA...GEGL.AKIF.KSQGVDYIISGGQT....MNPSTE...DI
D2BME6_LACLK/237-554........STNVSTSTSKK.......DW...GLIAIAA...GEGL.ADIF.REMGVNHVVSGGQT....MNPSTE...DI
C7U3H1_ENTFL/242-558.........QEALTEKVRV.......PF...AVIAIAA...GEGV.QELF.RSLGASYIISGGQT....MNPSTE...DI
C9AXQ9_ENTCA/242-560.......GAKPAPVKRPRT.......PF...AIIAIAA...GEGL.KELF.TSLGASYVISGGQT....MNPSTE...DI
C2H915_ENTFC/242-560.......VNEFAKKETPRI.......PY...GIVAIAA...GKGV.QELF.ESLGANYVISGGQT....MNPSTE...DI
A8U9Q7_9LACT/242-557..........QPVVKAAKT.......PY...GIIAVAA...GEGV.QNLF.KSLGVDYVISGGQT....MNPSTE...DI
C8NGP5_9LACT/242-561.......AKVKEAAQKQKA.......EY...GIVAVAA...GEGV.QELF.KSMGVTTIINGGQT....MNPSTE...DI
C4FT76_9FIRM/239-557.......MKEAPAAAAPKV.......PY...AIIAVAA...GEGV.GQLF.TDLGVAKVLAGGQT....MNPSTE...DF
D7UVI4_LISGR/239-552........GEEAASATPTV.......KY...GIISISA...GSGI.EELF.KSMGTTYVLSGGQT....MNPSTA...DI
Q4EHP2_LISMN/226-539........GDDKVPAKEKA.......AY...GIVTVSA...GEGL.KKLF.ESMGVSVVLSGGQT....MNPSTE...DI
C3C6H9_BACTU/240-558.......MPEPTSQSKEKQ.......PY...GIVTVAM...GSGI.KTLF.ESIGATKVIEGGQT....MNPSTE...DI
B7GGF8_ANOFW/238-552...........PPKKQERI.......PY...GIVAVAM...GDGI.AELF.KSIGAHAVIEGGQT....MNPSTE...DI
C5D8S7_GEOSW/240-558.......AASSASTAKQKE.......KY...GIVTIAM...GSGV.AELF.KSIGAHVVIEGGQT....MNPSTE...DI
Q5L0R2_GEOKA/237-554........TLPGVAKEEAK.......PY...GIVAVAM...GAGV.AELF.RSIGAHAIIEGGQT....MNPSTE...EI
Q2B7A4_9BACI/240-560.....PLRTGEPAKTNEKL.......EY...GIVAVSM...GSGI.ADLF.RSIGAHVVIEGGQT....MNPSTE...DI
A6CS65_9BACI/239-558...QLNSENGEAEKPKEKK.......EY...GIVTVSM...GEGI.AELF.RSIGATYVIEGGQT....MNPSTE...DI
Q62V69_BACLD/240-556......ETAPAEKAPADKQ.......PY...GIVTVAM...GEGI.AELF.ESIGATKVIEGGQT....MNPSTE...DI
A8FD49_BACP2/240-559...HAPAATPKASAAAEKQ.......RF...GVVSVAM...GEGI.ADLF.KSIGASVVIEGGQT....MNPSTE...DI
YLOV_BACSU/239-553........PADNETPPAKQ.......PY...GIVTVAM...GEGI.ADLF.KSIGASVVIEGGQT....MNPSTE...DI
A7Z4K4_BACA2/239-555......EKKPAGVMKEARK.......PF...GIVTVAM...GEGI.SELF.TSIGASHVIEGGQT....MNPSTE...DI
A3I4A9_9BACI/235-549........APTTTKKLEKH.......PY...AIVTIAM...GEGV.AGLL.RSIGASYVIEGGQT....MNPSTE...DI
C4L5Y6_EXISA/239-559.....ANQHGIQQAEKPKA.......PF...AIVTVAM...GEGV.SELF.RSLGAAHVIEGGQT....MNPSTE...DI
B1YIP1_EXIS2/249-568......NQMAAPVATKAKA.......QS...ALVTVAM...GEGI.SELF.KSLGVSIVIEGGQT....MNPSTE...DI
Q8ER15_OCEIH/240-552............DIPKEKT.......EF...AIVTVAM...GSGL.KTLF.ESLGVSVVIEGGQT....MNPSTQ...DI
Q9K9Z6_BACHD/240-557...........AFPDQEKK.......PLSELGIVTVSM...GDGI.AKLF.QSLGAGVVIPGGQT....MNPSTE...DI
D3FT80_BACPE/239-561...VYGGEEASAATPKEKS.......EY...GIVTVSM...GDGI.AKLF.EGLGASAVIQGGQT....MNPSTE...DI
Q5WFL6_BACSK/240-557........GHAPASARPKA.......EF...AIVTVAM...GSGI.EKLF.KGLGADQVIAGGQT....MNPSTE...DI
E6TTN1_BACCJ/240-559......GNAPVSKEKDKRT.......EY...AIVTVAM...GQGI.ADLF.KGLGAKKVIEGGQT....MNPSTE...DF
C0ZFY0_BREBN/244-568.....KGQAKPETAAQPVA.......DLLPYGLVAVAA...GEGI.ATIL.RSMGVHVVVEGGQT....MNPSTE...DF
D3E5U1_GEOS4/248-586PAETVTPEAPAVPPADEIA.......PY...GFIAVSS...GEGI.SDIF.KSLGVDVVLSGGQT....MNPSTE...DF
C6J2C5_9BACL/251-590PAEPAQPVDPAGIPADELA.......PY...GFIAVAS...GQGI.SEIF.KSLGVDVVLSGGQT....MNPSTE...DF
C6D4E5_PAESJ/261-606STELLAGPAAQVVAPEQLH.......ELAPFGIIAVAL...GEGI.ANIF.LSNEVDIVLSGGQT....MNPSTE...DF
B7C794_9FIRM/230-541............EKMAEHK.......KY...AIITVAP...GDGI.KKMF.TELRADIVVGGGQT....MNPSTE...DF
A8REK2_9FIRM/228-542.........EKKEEQAPKQ.......KY...AIITVAA...GDGL.RDMF.KELRADIVISGGQT....MNPSTE...DF
E7FUT6_ERYRH/228-541..........ATKAQKQHS.......KY...AIVAVAA...GTGV.VDMF.KELRAEYIISGGQT....MNPSTE...DF
B0N2X3_9FIRM/230-551....IVGVDDNAKPKREAK.......ET...AVISVCA...GDGL.KDAF.LELHCDYVVSGGQT....MNPSAE...DM
A9NEV2_ACHLI/238-560.......VPELAPVKKPRS.......KY...GLIAVGQ...GEGV.KTAF.KELGVDMIIDGGQT....MNPPTE...DF
A8SBE9_9FIRM/237-564.........FIYAAVDPSR.......DY...GFVAVAA...GEGL.KAVF.TDLAADAVVSGGQT....MNPSTE...DI
D1PLR2_9FIRM/236-561.........FTYAAVDPER.......EY...GFVAVAA...GEGL.KNVF.TDLGVDAVVSGGQT....MNPSTE...DI
D4JU96_9FIRM/229-544............APAEPVK.......DF...GFVSVTS...GAGL.EDLF.KDLGVDVIVRGGQT....MNPSTE...DI
C0E9S3_9CLOT/234-550............VAVDESI.......EF...GFVAVAA...GQGI.QTLF.GDLGVNKVVSGGQT....MNPSTD...DI
B0PDV8_9FIRM/236-554..........AYAPVDPSR.......TY...GFVAVAA...GDGV.KKLF.EDLGVDNIVNGGQT....MNPSTD...DI
D4L902_9FIRM/231-548............VPAEPEN.......DF...GFVAVAA...GNGL.KDLF.KDLGCDNVVSGGQS....MNPSTD...DI
A7VZD4_9CLOT/242-566......ETANQFEPAEPTE.......EI...GFVSVAA...GDGL.QALF.QDLGCSTVVSGGQT....MNPSTQ...NI
E6U6Q7_ETHHY/232-536.............DSEPLK.......AI...GFVAVAS...GKGV.AAVF.RDLGVDAVVEGGQT....MNPSTE...DI
A6NT49_9FIRM/241-558............KVAAPEK.......PY...GFVAVCA...GEGV.AAVF.RDLGADGIISGGQT....MNPSTE...DI
B7ATY7_9FIRM/235-571AKEAAVEEVSEPKKDEPRK.......EV...GFVTVVA...GDGL.AEIF.GGLGVDYVIEGGQT....MNPSTE...DI
C4Z046_EUBE2/238-567....EKNSEAEQKKAEPAK.......DF...GFITIAP...GSGI.AEIF.KGLGVDEVIEGGQT....MNPSTE...DI
C4G384_ABIDE/245-571.......KNTPQVSNEPRK.......KD...GFIAVSA...GAGL.SEIF.KGLGVDFVLEGGQT....MNPSTD...DI
A5ZQF2_9FIRM/220-541............KQQTPPK.......ET...GFIAVSA...GAGL.TDIF.RELGVDYLIEGGQT....MNPSTE...DM
C0CI33_9FIRM/234-555............RHRTPRK.......DV...GFISVST...GDGI.KAIF.QDLGVDYLIEGGQT....MNPSTE...DM
C9L650_RUMHA/223-540................PEK.......EV...GFISVSV...GDGM.GEIF.RELGADYLIEGGQT....MNPSTE...DV
C6LER9_9FIRM/221-545.........KPEKPAMPHK.......EN...GFISVSI...GEGI.GEIF.KGLGVDYLIEGGQT....MNPSTE...DM
B0G5R1_9FIRM/234-558.........EAKKTAEPKK.......PM...GFIAVSI...GDGM.NEIF.RELGADYIIEGGQT....MNPSTD...DM
A7B4K5_RUMGN/233-550.............KKAPRK.......PV...GFIAVSI...GEGM.NEIF.RELGVDYLIEGGQT....MNPSTE...DM
C0BWD3_9CLOT/224-547..........TKKPSEPRK.......AM...GFIAVSI...GEGL.NEIF.TELGVDYIIEGGQT....MNPSTE...DM
B6FRX3_9CLOT/69-388............KKKEAQK.......EF...GFIAVSI...GEGL.NEIF.KELGVDYIIEGGQT....MNPSTD...DM
A9KPH5_CLOPH/237-560..........EVKKKEPRK.......PV...GFVAVSI...GEGI.NDIF.SGLGVDYLIEGGQT....MNPSTE...DM
A5Z3S4_9FIRM/232-549................PRK.......KY...GFVAVSV...GEGL.DEIF.KGLNVDHIISGGQT....MNPSTE...DI
C4Z9X2_EUBR3/220-552.EAYEAAQADEKISNMPVK.......EM...GFVSVSI...GEGM.NEVF.RGLGVDYLIEGGQT....MNPSTE...DM
C0FY34_9FIRM/239-571.NEIKAAEKNEPEVPAEEK.......EM...GFISVSI...GEGI.NEIF.RGLGVDYIIEGGQT....MNPSTE...DM
C7G7M6_9FIRM/240-565........EKEEKPAEPPK.......EM...GFISVSI...GEGI.NEIF.KGLGVDYIIEGGQT....MNPSTE...DM
C0EVE2_9FIRM/237-569.AEEEKLAAKEAAAEKPAK.......EV...GFIAVSV...GEGL.TDIF.KGLGVDYLIEGGQT....MNPSTE...DM
B0M9Z1_9FIRM/232-546............KEPAPRK.......DM...GFVAVSI...GSGL.NDIF.RELGADYLIEGGQT....MNPSTE...DM
D4MYY8_9FIRM/239-553............KPEEPRK.......DF...GFVAVSI...GQGM.NDIF.RELGVDYLIEGGQT....MNPSTE...DM
A8SPK6_9FIRM/236-563......RQQRKTAHAEPRK.......KY...GFITVSM...GDGL.KKLF.EELGADYVIEGGQT....MNPSTE...DM
A7VBL4_9CLOT/234-560.......RQAEKEKQQPKK.......QY...GFIAVSM...GDGL.KEFF.TELGVDYVIEGGQT....MNPSTE...DM
D4CER5_9CLOT/251-574..........EKEKTEPRR.......PA...GFVAVCA...GEGL.TEIF.RGIGADWVIEGGQT....MNPSTE...DI
C5EUI7_9FIRM/240-566.......DGDVGQPSNERK.......TY...GFIAVSS...GDGL.SEIF.KGIGADYLIEGGQT....MNPSTE...DM
C0D0L6_9CLOT/238-564.......KAVEPEPAAEHK.......KY...GFIAVSC...GEGL.SEIF.KGIGADYLIEGGQT....MNPSTE...DM
D4CN13_9FIRM/241-565.........EKAEEEAEEK.......DF...AFLAVCA...GEGL.AEVF.KGIGADRIISGGQT....MNPSTE...DI
C2KWS6_9FIRM/238-567..QPKSAEAPGESEPVEEK.......DF...GFVAVCS...GDGL.RDIF.LDLGVDQVVSGGQS....MNPSTE...DL
B1IIK7_CLOBK/230-541............KEESELK.......KY...GFISVAL...GEGI.TEIF.KDLGVDEVIEGGQT....MNPSTE...DI
Q895P1_CLOTE/232-546............IENSEKK.......EY...AFISVAL...GEGI.RDIF.NDLGVDFIIEGGQT....MNPSTE...DI
A0Q104_CLONN/236-554............ETVEDMK.......EY...GFVSVTM...GNGL.KRIF.EDLGVDSVIEGGQT....MNPSTQ...DI
C6PUV3_9CLOT/231-545............QENIQLK.......KY...AFVSVAM...GEGI.KNIF.EDLGVDFVIEGGQT....MNPSTQ...DI
A5N7Z4_CLOK5/231-555..........ISQESVQDK.......EY...AFITVAA...GKGI.KRIF.QDLGVDYVIEGGQT....MNPSTE...DI
B1RQ99_CLOPF/234-548............VAAGEFK.......KY...AFISVAM...GEGM.KNIF.KDLGVDYVIEGGQT....MNPSTQ...DM
C1I7N0_9CLOT/231-556...HFEGEAAIEEVEQEKK.......KY...AFVAVAM...GEGI.TNIF.KDLGVDYVIEGGQT....MNPSTQ...DI
C4IJG6_CLOBU/231-551........EEVATSSEEMK.......SY...GFVTVAM...GDGI.SNIF.KELGVDYVIEGGQT....MNPSTQ...DM
A6LSK9_CLOB8/231-546............VGDGEKK.......KY...GFITVAM...GDGI.SNIF.KDLGIDYVIEGGQT....MNPSTQ...DI
B2TJ09_CLOBB/232-548.........EVSSDEVDHK.......KY...AFITVAM...GDGI.VKIF.KDSGVDYVIEGGQT....MNPSTQ...DI
Q97IB5_CLOAB/232-547............ANEDQEK.......DF...GFISVAS...GEGI.AKIF.KDLGVDFVIEGGQT....MNPSTQ...DI
D9SLB2_CLOC7/231-546........VITDIETKENK.......PY...GFISVST...GEGI.KNLFSEELGVDVVIEGGQT....MNPSTQ...DF
B6FZ18_9FIRM/234-544............EEPVEEK.......EF...AFISTSM...GEGL.ASIF.KDFGVDHVIEGGQT....MNPSTE...DF
C9YPD2_CLODR/235-547............EPLEEEK.......EF...GFIATSM...GEGL.ANIF.KDFGVDHIIEGGQT....MNPSTE...DF
B0AAY8_9FIRM/232-545............AVSEEPK.......EF...GFIATSM...GDGL.AKIF.KDFGVDHIIEGGQT....MNPSTE...DF
D3MPQ7_9FIRM/235-560VRIEQASSVKEAAGQQEKK.......KY...GFITTTM...GRGL.AEIF.EEFGVDIVIEGGQT....MNPSTE...DF
A8MH97_ALKOO/232-548............NNKEETK.......KY...GFITVTM...GDGL.TKIF.KDFNVDYVIEGGQT....MNPSTE...DF
A6TRV4_ALKMQ/231-542............DAKSRLK.......PY...GFITVAM...GEGL.SKIF.KDFQVDHVIEGGQT....MNPSTQ...DF
B1C9C9_9FIRM/230-550............KYSSEEK.......DY...IFIGVAA...GSGM.SKIL.KDLGMDYVIEGGQT....MNPSTQ...DF
D1VSD4_9FIRM/236-553............KISKKPK.......AN...GFLAVSM...GNGI.SELF.KSLGIDFIVSGGQT....MNPSTE...DI
A8SMH4_9FIRM/227-540...............KEHK.......KY...GFISIST...GDGI.DEIF.KSMGVDEIITGGQT....MNPSTE...DI
B0S152_FINM2/230-541............KPSEPEK.......DF...GFVVVSS...GKGF.SKVF.EMLNVDEVITGGQT....MNPSTE...DI
Q4A591_MYCS5/234-550KTAQSAQSNFAANKSSEEE.......LC...GLVSCNF...GSGI.IKKM.KEYGCHNIVEGGNT....QNPSAS...DI
C4XDU6_MYCFE/229-541....NKNVIINQNDEQSNK.......KC...AIISCNL...GSGI.IARM.KEFGVDAIIESGQT....QNPSAQ...DI
D3VQS9_MYCA6/233-548.ANRNNSVVINDVVSQGNK.......KC...GIVSCNL...GSGF.IDKM.KELGADAIIECGQT....QNPSVT...DI
Q6KHN1_MYCMO/228-542...ENQKQHQIANSSLVKN.......PS...GLISCNT...GQGL.IHIM.KENGCDFIIEAGQS....SNPSAG...DF
Q98R49_MYCPU/230-545...KLTNQEVTSLISKVNQ.......VS...GIVSCNL...GQGF.IDEM.KELGCNFVIESGQS....QNPSAK...EI
D1J8Q5_MYCHP/228-542..KTAKKKQAEAPNNVELK.......NS...AIVSCNT...GQGI.VTLM.KENGVSYVVDGGQT....NNPSIQ...DI
B3PN92_MYCA5/229-546VASKLASPDATTPKKTYSK.......KC...ALISCNV...GQGI.IELV.KQNGVSYVIEGGQT....NNPSTQ...DI
C5J6D6_MYCCR/231-544...........EKKQQMPK.......KLAMSALISCNN...GQGF.YEIM.KERHTSEVILFDKE....KKPSFK...DF
B2NEH1_UREUR/237-564.ERKGLSTKKE.NKATLNM.......EQ...KIIATVP...SEKF.KKMFIEEHGIENVIVTETE....GAPSIQ...RF
D3FH26_MYCGH/234-574IDLLMDIDLSKIKDFKTET............AIIATVP...SRVL.GKMIVQNYDVDQFIDTSAT....GNPTIK...DF
Y369_MYCGE/238-557...........NSPTKRVL.......KP...AIVATVP...TEAF.AERIREDHDINAILCTDDT....GAPSVF...SL
Y547_MYCPN/239-558...........PAPVKRNI.......KP...AIVVTVP...TEAF.ADRIREDYDIQAILCTDDT....GAPSVF...SL
Q8EVZ4_MYCPE/248-573...PGVSPSDLFNKFSLTD.......DV...QIVATCP...SRKI.ADYLKNEFGINNVIVTEET....GNPSTN...EI
Q14LS2_SPICI/227-539........KTIKVDRQLKN.......SA...AIIAVTP...SNGI.ANFFKTDLNIQFTVNGGAS....MNPSTD...DY
Q2SS00_MYCCT/225-547ADQKWKENSNIKAERKLVN.......EV...AIISVVS...SEKQ.KRYFEDELGIGFAINAGSK....MNPSTE...DF
Q6F1N7_MESFL/225-548EASGWQETTSIKLERKLNN.......DY...ATIAVVS...SPEM.KKYFEKELGIDIAIDGGSK....MNPSTN...DF
B1VB30_PHYAS/245-554........DEKPTSEKKQH............SLIVFVK...DAKM.EKLL.SDFEINYIIPQ.......KDFTKE...AL
Q2NK36_AYWBP/239-571EPNPDHKQPSNLPKTNKDQ.......KY...FFIAFVN...DTKS.QKVF.ADLKVNHIIKQS.......TFKPT...NF
B0K1Y0_THEPX/233-533...........SEERKPEK.......KY...GVLVVAN...GQGV.KNLF.SELGCDVIINGGQT....MNPSTN...DI
Q8R9U3_THETN/225-525...........GENKKPKK.......KY...GILVVAT...GEGV.KEIF.ENLGCDVIVDGGQT....MNPSTN...EI
C9N026_9FUSO/239-542.....E.AKIFVNSKIDKT.......KS...AFVILAD...SENL.KDEF.LKIGADVVILGGQS....KNPSVQ...EI
D0GPN7_9FUSO/239-542.....E.AKIFKNNKINKT.......EN...AYIILAD...SENL.KDEF.LKEGADVVILGGQS....KNPSVQ...EI
D1AJX8_SEBTE/238-542.....EGAKIFVSDKVTLS.......EK...GHIIVAD...TENL.KNEF.LKNGADVVILGGQS....KNPSVQ...DI
D1AVV3_STRM9/236-535.....Q.TKIFVNSKPNLS.......RY...SYVILAD...SLNL.KEEF.LTLGASVVLLGGQS....QNPSVQ...DI
Q7P8L0_FUSNV/238-555KETALEEPKLLFNEKNIEN.......NV...AIYAVVD...NKNI.ANLF.LKDGASAILIGGQT....KNPSVS...DI
C6JQ39_FUSVA/240-546.....STEKIFIRSEN.AT.......PI...AYYAIVD...NKEL.GSLF.LDDGATAVLIGGQT....QNPSVA...DI
C3WC47_FUSMR/240-543.....SDNRYIIKNEN.SG.......EM...AYFAIVD...NRKL.GEYY.LEAGATGILVGGQT....QNPSVH...DI
B5YEA3_DICT6/236-544...........QDVKTPLK.......EI...GFVAVSW...GKGI.NEIF.KSLGVDMIVNGGQT....LNPSVE...SL
B5Y797_COPPD/228-524..............QVEEK.......PF...AVVAVAP...SPKW.AELF.RSIKVDFVVMGGQT....MNPSVG...QI
A5ILK4_THEP1/226-528.............SSQIAK.......EI...GVVAVSP...GKGI.SDIL.KSLGVDVIVPGGQT....MNPSFA...DL
A7HN75_FERNB/228-537..........GEYTKKERK.......KI...GFVSVSP...GNGL.SKVL.KDLGVDEIISGGQS....MNPSMA...DI
B7IFW1_THEAB/228-537..........SKEVEQEKK.......KI...GIVAVSP...GEGI.SRIL.KDLGVDQIVLGGQT....MNPSTT...DL
A6LJM3_THEM4/228-537..........EKEKEIEKK.......KN...GVVAVSP...SDGI.SKIL.RDLGVDEVVIGGQT....MNPSTA...DL
A8F8T1_THELT/233-540...........GQNSEPPR.......KY...GFVAVSP...GHGI.SEIL.KNLGVDQVVRGGQT....MNPSTA...DL
A9BG53_PETMO/231-555KIADIEQAKVAVNNNLNNK.......NW...GVIAVSP...GKGI.SDIF.ISLGVDQVIFGGQT....TNPSVK...DF
C5CI85_KOSOT/233-554...........QQNFGEGK.......VH...GIVAVSP...GEGL.SEIM.KSLGADILVKGGQT....MNPSMK...DI
A4XKD8_CALS8/229-545.....QRNNENIEDEIITK.......EY...GFVAVSQ...GEGF.NEIL.KGLGVDYIIEGGQT....MNPSAD...DF
B9MRL9_ANATD/229-545.....HETELQTQAEVIIK.......EY...GFVAVSQ...GEGF.NEIL.KGLGVDFVIEGGQT....MNPSAE...DF
B2A2L3_NATTJ/236-554............FNEEQID.......KV...GVITVVN...GAGF.DEIF.QSLGASHVVTGGQT....MNPSTE...DL
B8CWU7_HALOH/238-549.........QQRQEFMPAK.......KK...GIIAVGK...GDGI.KEIF.KDLGIDVVIDGGQS....MNPSTN...DF
Q3ABX4_CARHZ/233-531...............KPAK.......KL...GMVAVSP...GKGF.SEIF.QKLGIDEIVDGGQT....ANPPVS...AI
C9LL18_9FIRM/236-538..........EKQQDEPKR.......PL...GVLAVVS...GDGW.TELY.QKLGCD.VVSGGQS....MNPSVQ...EL

PF02733

DHAK_ECOLI/16-356--------------------------VTTVVIDDDVAV---KDSLYT.AGRRGVANTVLIEKLVGAAAERG...DSLDAC
DAK1_SCHPO/17-344--------------------------AELIAVADDVSV---GRKKSGKVGRRGLSGTVLVHKIAGAAAARG...LPLEAV
DAK_PICAN/17-355--------------------------VELLIVQDDVSV---GRTKNGMVGRRGLAGTSLVHKIVGAKAAKDSNKASLSEV
Q9RJR0_STRCO/16-335--------------------------TRTFAVADDISS---AGPDES.AKRRGIAGDLPVFKAAAAAAEQG...LPLEEV
DHBK_SOLLC/22-345--------------------------VEMVIVGDDCAL---PPPRGI.AGRRGLAGTLLVHKVAGAAAACG...LPLADV
DAK2_YEAST/17-345--------------------------VELVAVGDDVSV---GKKKGSLVGRRGLGATVLVHKIAGAAASHG...LELAEV
DAK1_YEAST/16-344--------------------------CRVAVIGDDVAV---GREKGGMVGRRALAGTVLVHKIVGAFAEEYSSKYGLDGT
DAK_PICPA/17-357--------------------------AELLIVQDDVSV---GKAKNGLVGRRGLAGTSLVHKILGAKAYLQKDNLELHQL
DAK2_SCHPO/17-345--------------------------VELVAVGDDVSV---GKKRGALVGRRGLGATVLVHKIAGSAAALG...LDLHQV

PF03610

C4ZTN9_ECOBW/4-122--------------------------------------------------------------------------------
PTNAB_SHIFL/4-119--------------------------------------------------------------------------------
Q48519_LACCU/3-117--------------------------------------------------------------------------------
Q98CM1_RHILO/3-116--------------------------------------------------------------------------------
Q97QN0_STRPN/5-114--------------------------------------------------------------------------------
Q9CMJ0_PASMU/4-120--------------------------------------------------------------------------------
PTFA_BACSU/3-117--------------------------------------------------------------------------------
Q9K7G6_BACHD/7-116--------------------------------------------------------------------------------
Q9CEX8_LACLA/4-123--------------------------------------------------------------------------------
Q99VW9_STAAM/3-113--------------------------------------------------------------------------------
Q97SL1_STRPN/2-115--------------------------------------------------------------------------------
YADI_ECOLI/3-117--------------------------------------------------------------------------------
Q8R8K1_THETN/8-123--------------------------------------------------------------------------------
Q8XH56_CLOPE/3-118--------------------------------------------------------------------------------
Q97N91_STRPN/5-123--------------------------------------------------------------------------------
Q9RZR3_DEIRA/4-120--------------------------------------------------------------------------------
Q8R5U5_THETN/552-666--------------------------------------------------------------------------------
Q8YA15_LISMO/3-118--------------------------------------------------------------------------------
Q9KIQ1_ECOLX/3-117--------------------------------------------------------------------------------
Q9JXH6_NEIMB/10-123--------------------------------------------------------------------------------
Q9ABI7_CAUCR/15-129--------------------------------------------------------------------------------
Q9S4L5_STRSL/4-123--------------------------------------------------------------------------------
Q8VP39_ECOLX/3-120--------------------------------------------------------------------------------
Q97T86_STRPN/4-118--------------------------------------------------------------------------------
PTRA_KLEPN/3-115--------------------------------------------------------------------------------
Q9FC13_STRCO/2-118--------------------------------------------------------------------------------
Q98C52_RHILO/5-120--------------------------------------------------------------------------------
Q927E4_LISIN/6-115--------------------------------------------------------------------------------
P96165_VIBFU/3-117--------------------------------------------------------------------------------
Q9A0T2_STRP1/3-117--------------------------------------------------------------------------------
Q8P225_STRP8/5-114--------------------------------------------------------------------------------
Q8RHZ6_FUSNN/5-122--------------------------------------------------------------------------------
Q97TN2_CLOAB/3-119--------------------------------------------------------------------------------
Q9RGG5_LACCA/2-115--------------------------------------------------------------------------------
Q97J29_CLOAB/3-121--------------------------------------------------------------------------------
DHAM_LACLA/4-113--------------------------------------------------------------------------------

PF02645

Y1149_STRPQ/3-279YEN.LVKKGVTDIVAIHLSPALSGTIEASRQGAEIA.....ETP..........VTVLDSGFTDQAMKFQ-VVEAAK--M
Y1667_STRPQ/2-283FRE.HARNNKA.LLYLAFSSVLSGTYQSALMACDLVREDYPDAV..........IEIVDTLAAAGGEGYL-TILAAE--A
Y1478_STRPQ/2-279YR......GADNVIVMTITGTLSGSHNSARLAKNELLEENPNVN..........IHLIDSLSAGGEMDLL-VLELER--L
Y586_STRPQ/2-281LGL.LSSKGYTHVIGLFLAGGISGFWQNIQFLAEEH....PEIE..........MAFPDSKITSAPLGSM-VKNVLD--W
Y1557_STRPN/2-281LTS.LKEQGYTHALGLFLSSGISGFYQNIQYMVDDY....EGLT..........IAFPDTLITSAPLGIM-VESVFN--W
Y3627_BACHD/3-282FER.LAKEGFEVVISIHLSSKISGTYQSALTAGSMV....EGIE..........VIGYDSGISCEPQANF-VAEAAK--L
Y2509_CLOPE/3-280LDK.LEAEGYTHLIGIFISSSLSGTFNAARLVIEER....SSFK..........YYLFDSKIIGYPLGSI-VIKAAE--F
Y1903_DEIRA/1-281FEAALQGSKSGRLVHVASGSRFTPHFEVAARVAGQF.....GVR..........VQVIDGGTVSYALGVQ-ALHAAH--L
Q65EA6_BACLD/2-280YEK..LGETYDAVISIHLSSGISGTFNSAVSASGML....EGIK..........VYPFDSEISCMAQGFY-AIEAAE--M
Y2514_LISMO/4-283FEN.LKEQGFDTVISIHLSSGISGTFQNAASAGELI....EGLN..........VVAYDSELSCMAQGMF-AVKAAE--M
Q9I599_PSEAE/2-314FLD.ELVTDFDYVVCLTVDSLRSPIFEHATQASFGLLQHYHERRHAAGIAGPFTLRVLDSHSVFAGIACL-AAEGTR--L
Y500_DEIRA/6-281YAA..VPSGTD.ILAVTISSGLSGSRNAAAQARDLA.....GRQ..........VTLHDSMTLSAAQAFQ-VHAANV--A
Y2569_STRCO/4-281YRR.IAESGADGIVSLHLSAELSGTHDAAVVAAREA.....PVP..........VRVVDTGMIAMALGFC-ALAAAE--T
Y359_MYCPU/2-276FDD..ITSKYDKVVVFPISYKLSSQYQNLDLIAREY......KN..........IHIVKSKHLSFLTIVQ-LIKFEK--A
Y326_MYCGE/3-293FEE..IKTKYDRFIFLPLSKGLSGTYDMLVQLAKELSEQNKDKE..........FLVFETSDIAISLKWL-VEDIKA--L
Y1986_DEIRA/2-279YAQ..ALEHADEVLSLHISGQLSGTVGSARLAAQEF.....GGR..........VTVVDTHTVTLGLGLQ-VLRAAE--L
Y1468_THEMA/2-284YLK.YKEEDYDVVLVLTLSSKLSGTYNSAVLASKEV.....DIP..........VYVVDTLLASGAIPLP-ARVARE--M
Y472_MYCPN/2-290IEA..IKDKYDRFVFLPLSKGLSGTYDMIVQAVKPLS..TPKKE..........FVVLETSDIAISLKWL-VQEVKA--L
Y3284_CLOAB/2-281MEE.VVSVG.DELLCIFISSDMSGTYSTAHIARDMVIEKYKDAK..........IEILDSRSNCMQLGFA-AISAAR--A
Y701_CLOAB/3-278FAK.YLKEGYK.IICINMSSKMSGTYQSACIAKDML....ESED..........VVVIDSLNVTSGLGVL-VLKACR--L
Q8RHS1_FUSNN/563-843YEE.LFNKGYEKIISIHISSKMSGTQQVAKVAREMLK.RE..KD..........IIIVDSKSVTFGQAYQ-VLEAAK--M
YTEA_LACLA/2-285FKK.FASADEE.LLYLAFSSGLSGTYQSALIAQDMVLEEFPSAK..........ITVVDTLAAASGEGFL-VEETVK--L
Y026_CLOPE/3-287FEE.YVKQGIS.ILYLAFSSALSGTYNSSLIAREELLEKYPDAD..........IKIVDTRAACLGQGLL-VYYAAQ--M
Q9CHY7_LACLA/316-595FSF..LEGKYEHIIVISVSSKLSGTYQLLNQRITAKK..SLENR..........VHLIDSKLNSVAQGLL-VKQVAK--L
Q92E62_LISIN/310-585LSF..LENKYQHVLVIAVSAKLSGTYQLIKQRIKARD..LSPEW..........IRVIDSKLNSVAQGLL-VKQAVE--L
Y2349_CORGL/2-260YARQLERGGDDGVLALHISKELSSTWSAAVTAAAVF....DDDS..........VRVVDTSSLGMAVGAA-AMAAAR--M
Y3382_XANCP/2-308FLQ.RLVIDYDHVFCLTISKLRSQIFDNATQASFAILNDYKPVRQAAGHTSPFALRVIDTLNLFAGQGIT-AVEAVR--L
Y1112_STRPN/3-278FED..LCKDGGQILAIHMSHALSGTVEAARQGASLS.....TAD..........VTVVDSSFTDQALKFQ-VVEAAK--L
Y711_STAAW/2-283YEM.LRDQGYTDIIVICLSSGISGSYQSSYQAGEMV....EGVN..........VHAFDSKLAAMIEGCY-VLRAIE--M
DEGV_BACSU/2-281YEE..LGKSYDAVISIHLSSGISGTFSSAAAADSMV....DNID..........VYPFDSEISCLAQGFY-ALKAAE--L
YITS_BACSU/2-283FLQ.YAETG.DPALYIAFSSGLSGTYQTAVMIANEVKEEFPDFD..........LRVIDSKCASLGYGLA-VRHAAD--L
Y948_CLOAB/3-281YKK.LEEEGYTHAIGITLSSGLSGIFNGLKMIADEH....SKIK..........SFIYDSKLISLGEGAL-VEECSK--M
Y1310_CLOPE/3-278YKG.YLEEGYK.VISIHISSNMSGTYQSACLAKTEL....ESDD..........IVVIDSRNVTVGLGLI-ILKAAR--L
Y742_STRPN/2-279FE......GAKNIFLVTITGTLSGSHNSAQLAKNIYLEDHPDTK..........IHVIDSLSAGGEVDLL-VEKLND--L
O32516_EUBAC/2-280FRK.YVNEGYT.VIYIGSSSRASGTFQSALVAKNAV....GSEE..........VHVFDTYLLSYASGMI-AVEAAR--M
Q9RY87_DEIRA/13-293FRQ..ALAQSDEVLSLHLSSRLSVSFACGQEAARAF.....GSR..........VRVLDSPAGSYALGLQ-ALRAAR--L
YQAC_LACLA/2-280LKD.LEKQGYTHVLGLFLPAAISGFYQNIFYLQSEY....EQMK..........VVFPETFITSSPLGYM-VETVLD--L
Y1491_THETN/3-280FED..LLKSFDYVIAIILTSKFSGTYQSAVIARDMV....DKNR..........IEVIDSRHFTLGNGML-VLKAAR--M
Y2440_MYCBO/2-275YQRALADSGGDGVVAVHISSALSGTFRAAELTAAEL.....GPA..........VRVIDSRSAAMGVGFA-ALAAGR--A
YEJH_LACLA/2-278YEK..IAAEDDEIISIHLTEALSGTVEAARQGGMLS.....GRN..........VTVIDSDFTDQAQKFQ-VVEAAR--L
Y766_MYCPU/3-281VNE..SSQKYNDVLVLPIASFLSGTISVINVYAQKH......KN..........VHIFDNHFVANTIVEI-GLQAKK--M
Y535_UREPA/4-288IEQ..KLQEYEKIIFIGISSGFSSQFNNAKNLEKEY.....QDK..........LFVVDTEDFGYSLEHL-VYKIKA--M
Y1863_LISMO/3-279YEK.YTAEGYE.ILSIHLTEKLSGTVNAARQAADMV.....EGN..........ITVVDCDYTARGQAFQ-VLKAAE--M
Y1624_CLOAB/3-280YEK.LEAEGYTHVIGVTISSNLSGTYNSLKLVSEGH....ENIK..........SFIFDSRSITMGEGAI-IKECGE--M
Y304_CLOPE/2-282FEK.FAKDGHD.IVAAFISSKLSGTYTTSHIIKDMILEKYPDVK..........IDLIDSQTSVMALGIG-VLEGAK--A

PF13684

C4LJE3_CORK4/314-601RKAIEKE.DVDEVVLVTNG..IVDPNEVDGRLAN..........----------VVVVPASSLCAGLAAM.AVHDPS--Q
C6R8U4_9CORY/214-447........AKDEDIVLATGVSSQTAA..................----------GRVVPAQSLAAALAAI.SVYEPD--N
C0WG06_9CORY/215-450........APGEDIVLSSGLEEHATA..................----------AHTVDISSLAAGLAAI.SVYEPD--N
C3PG03_CORA7/246-486........AGEEDLFLPNGCGGDPGK..................----------ATVIPTDSLVAGLAAL.SVYAPS--S
E0DHT2_9CORY/321-602AAAARAS.GATEIILLPNGMLTTHQLASIERSSH..AF...EQA----------LTIVPTGTIIRGLAAL.AACNNT--Q
A4QDT8_CORGB/263-567VSIARKS.GADEVILLPNGLLTKRELVSIERSSH..AF...EQS----------VVILPTATLVAGLAAV.SVHEPA--Q
Q8FPQ3_COREF/261-567VAAARAT.RADEVILLPNGLLTKRELVSIERSSH..AF...EQA----------VTILPTSTLVAGIAAL.SLHDPS--Q
B4V5A9_9ACTO/101-401ADAIARA.HAREVVLLPGGPDGRAAAGAAAEQAR..AD...GVR----------VAVIPTRSAVQALAAL.AVHDPE--G
B1VYY9_STRGG/272-575VDAIRRA.HAREVVLLPNDAALRHTAAAAAEQAR..SE...GVR----------VALVPTRAAVQGIAAL.AVHEPD--R
D2AVL0_STRRD/223-521LAAIREA.GA.EVVVLPNDSGTREVAAAAAEIAR..EE...GLM----------VSVLPTRASVQGLAAL.AVHDPL--R
A1SLV3_NOCSJ/245-552LEAITAC.GASEVIVLPNDHDSVRVAQIAASTAE..ADADGAVR----------VAVIPTQAQVTGLAAV.AVHEPG--R
D2Q0M6_KRIFD/247-545LAAIERS.KAPEIVLLPNDKDSIAVAEAAAAAAR..QD...GVR----------VAVIPTRAQVQGLAAI.AVHDPE--R
A3TRA2_9MICO/271-570LDAIRRT.GAASVVVLPNDKDTLMAAEVACRAAT..DD...GID----------TAIIPARTAVQGLAAL.AVVDFD--K
D3Q0S3_STANL/231-545LGACRSS.GGSDVIVLA.DESSHAVAESAAALAR..AD...GFR----------VAVIPTRSPVQALAAL.AVRDPG--R
C6WF10_ACTMD/229-545LAVLTGT.RARHVVVLPGVPDLRSEVDDAVSQAV..AA...GQD----------AVVVPMTSPVQALAAL.AVHDAS--R
A4FMM0_SACEN/221-521SAALART.GAAHVVLLPNDEAATAIAEEAAGRAV..EA...GQD----------VVVVPTVSPVQGLAAL.AVHDPS--R
A8M651_SALAI/236-541LNAVRAT.GAASVVVLPNDTLTQAMASDAVEEAH..RF...GVK----------VSVVPTQSPVQALAAL.AVRDPG--R
E8S7R0_MICSL/236-537LDAIRAT.GAARVVVLPNDPNTQSVASAAAKEAH..GL...GIK----------VSVVPTRSPVQALAAL.AVRDPK--R
D2SE35_GEOOG/241-542LAAVLGS.GAAGVVVLPNDPAFTALASRAAERAR..EE...GRD----------VAVVPTRSPVQGLAAL.AVADPS--R
C1AG90_MYCBT/244-553VRAVVDT.GAAHVMVLPNGYVAAEELVAGCTAAI..GW...GVD----------VVPVPTGSMVQGLAAL.AVHDAA--R
Q73VK3_MYCPA/255-575MRAVVDT.GAAQVMVLPNGYVAAEELVAGCTAAI..GW...GID----------VVPIPTESMVQGLAAL.AVHDTG--R
A1T719_MYCVP/239-551LHALVNT.GAAQVMVLPNGYVAAEEIVAGCAVAS..DW...GID----------MVPVPTGSMVQGLAAL.AVHDPE--R
A4TE39_MYCGI/238-547LHALVKT.GAAQVMVLPNGYVAAEEIVAGCAVAA..DW...GID----------LVPIPTGSMVQGLAAL.AVHDPG--H
B1MDN6_MYCA9/245-551LDAVVDS.GAHQIMVLPNGLMAAEELVAVCAAAR..GW...GIT----------VIPLPSASMAQGLAAL.AVHDPE--R
Q5YRZ7_NOCFA/256-564LSAIRQM.PHREVLVLPNGALPAHELVAVGVAAR..GE...HRD----------VLLLPSGSMVQGLAAL.AVHDRA--R
Q0S2E8_RHOSR/258-568LGIIRQM.GRTEVLVLPNGALTAQELVAVSAAAR..DA...RHE----------VLLLATSAMVQGLASL.AVHDPE--R
D0LC19_GORB4/238-548ADTIRGT.DSAHVVVMANGALASQELVTVATEVR..SP...QRS----------IVTLPTSSMVQCLAAL.AVHDPG--E
C7M0D2_ACIFD/231-539VDAVRST.HAKQVIVLPNNANILAAASAMIGLVD........AE----------VAIVPTVHLVQGFAAL.MAYDPE--S
Q72AQ0_DESVH/242-605YRGQLA..RHRDIVSLHVMAMYSGTCQ...SATA..VGRTFDGH----------VHVLDTRTLSCGLGLV.VLEAAR--R
B8DJW1_DESVM/304-680YEEVLA..THAQVASLHVTAMYSGTHQ...SAAT..VARMVSPH----------IAAVDCRTLTVGLGLV.VLEAAR--R
C6BSA4_DESAD/241-600YAKVSS..DYEDVVSLHVAKVLSGTFQ...NALT..VSSPFD.N----------VSAIDSKMLTIGLGLP.VLEAAR--A
Q5WZX3_LEGPL/229-591LAKIAS..HYNHVLVLSISSKMSGTYDAFLTATK..KY....AN----------ITVLDTKTNSGAHGLL.LHYAGQ--L
D6XXQ9_BACIE/228-591YKSLLQ..QYDSVISLHVSQKLSGTFDVCKKAAE..QVD..PSR----------IHVVNSRTLSGAFGLL.AYETAA--D
D3USI8_LISSS/226-588LSFLEN..KYEQVLIITVSAQLSGTYQLIKQRIK..QKNLASDW----------IHVIDSRLNSVAEGLL.VKQAVE--L
C8JV81_LISMN/227-585LSFLEN..KYEHVLVISVAAKLSGTYQLIKQRIK..VRELSSDW----------IRVIDSKLNSVAQGIL.VKQAVE--L
Q9CHY7_LACLA/234-596FSFLEG..KYEHIIVISVSSKLSGTYQLLNQRIT..AKKSLENR----------VHLIDSKLNSVAQGLL.VKQVAK--L
A9NE55_ACHLI/228-589INFLLK..HYKKLIILTVSSKMSGIHNLFTKALE..GYK..DKD----------VLLVDTKQNSVSEGLI.VYEVAK--M
B9L468_THERP/241-527AARLATL.PVDRLLVLPARQEDAALVREAARQL...KQ....PT----------LVVLPAHSLAAQLTAL.LVYEPG--Q
A7NGY6_ROSCS/225-516RAAFERL.PQQEIIVLPNDPQAAETAQATAPLFA..RR......----------IAIVPATSPPQGIAAL.LALNFQ--A
A5UZ26_ROSS1/225-517LALFERV.AERSMIVLPNDPQALETARSAAQQVN..RR......----------IDVVPAMSSPQGIAAL.LALNFQ--A
B3T9V4_9ZZZZ/265-569LEAVKRT.SAPHVVLLPNNSNILMAARQAAELSP..VQ......----------CTVVTSRSVPEGIASL.LALSPD--L
D3F1F7_CONWI/252-560LAGIHAV.GADEVVVLPNSANVFMAAERAAELSE........KR----------AVVVRSRSQQAGLAAA.VALDPQ--R
D1C518_SPHTD/261-574LRVIAAL.PQRQVILLPNDSNVIPTARQVERLTD..RT......----------IRVVPSRSVPQGISAL.AAFNFD--S
Q1AW96_RUBXD/226-526LRAVERS.GAREVVLLPNNKNVVPTAEQVAGMAE..AR......----------VHVLPTTTIAAGLSAM.VGYDPE--G
C9R910_AMMDK/226-518VKAISAT.EAAGVLLLPNHPNVVLTAELAKELA...DR....E.----------VRVIPTASQPQGLRAL.LAFDQN--K
A9AU97_HERA2/231-545VTAIDKL.PQPEVIVLPNNSNVILAAQQAQQVTN..KV......----------VHVIPTKTVPQGMAAM.FAFNYA--V
Q3Z724_DEHE1/240-544LQAVEAA.PSDKVIILPNNKNIILTAIQVENLTK..KK......----------IKVIPSITIPQGVAAL.LAFDYE--A
C4F8W4_9ACTN/241-554LEAVSRV.NAESVIILPNNGNIRMAAEAAASACE..DK....H.----------VYVVPTKTVPQAFSAL.FAVMPD--M
B9CK02_9ACTN/240-557LSAIEEA.NADSVIVMPNNSNIRMAAEAAASACT..DV....K.----------VAVIPTKSVLQAFSAM.FVVDTE--A
C8W750_ATOPD/240-554LAAIEGA.NAEQVIVMPNNSNIRMAAEAAASACE..NI....K.----------VAVIPTKSVLQAFAAM.FVVADG--V
F1T5K6_9ACTN/246-577LKAIEAT.HARQVVVLPNNSNIRMAAEAAVQAVT..SC....V.----------AKVVPTKSVLQAFSCM.FCVDLS--K
C8WGT1_EGGLE/236-544LDAAGQV.NADAVIILPNNKNIIMAAQSACELAE........TP----------CAVVPTRSVPEAFAAL.FGFDEG--A
D0WE96_9ACTN/235-543LEAVKGV.NADAVIILPNNKNIIMAAQACCDVSE........KP----------CGLVPTTSVPQAFSAM.FGFDAD--A
C7N551_SLAHD/235-543LEAANKV.NADQVIIMPNNSNIVMAAQAACQVSE........KP----------CIVVPTKTVPQSFSAM.FGFNPE--A
C7MMY7_CRYCD/236-543LDAVNSV.NADAVIVLPNNKNIIMAAQSCAEVSN........IP----------CEVVPTTSVPQAFSAL.IACNPT--G
Q24U26_DESHY/229-552VEAVRKV.AAKNVYILPNNGNIVMAARQVKDIVT..DR....N.----------VFIIPTKSIPQGISAL.VNYNPY--G
Q0AYX3_SYNWW/234-546LNACKEV.PAPSVIILPNNSNIIMAAEQAKQLS...DK....P.----------VAVVPSRSVMQAITAL.IAFNPE--L
B1I3R2_DESAP/234-530LRAVERV.PADRVLILPNNSNIILAAQQAQALSK..KE......----------VRVVPSRTVPQGLAAM.LAFAPD--A
A4J402_DESRM/236-537VRSIQGV.NAKGILILPNNKNIILAAEQAAKLVS..NK....V.----------VKVIPTRTIPQGLSAL.LAQDPT--G
C0GHJ3_9FIRM/232-538LQAVVDV.PQKEIILLPNNKNIVLAAKQVGELV...DK....D.----------VRVVETRTVPQGITSM.LSFNEE--E
Q67PP7_SYMTH/248-583LDAVERC.PSRQVFLLPNNKNIILAAEQVVALTD..KK......----------VYVVPTRSVPEGISAM.VAWMPD--E
Q03W26_LEUMM/246-568VKVIEDS.GAKRAIILPNNSNIFMAAEQAVTLA...EI....P.----------VEVVKTRTIQQGLTAM.MGYNPD--A
B1MXV1_LEUCK/244-565VDAINAS.DAKQVIILPNNSNIFMAAEQAVDLV...DI....P.----------AQVVKTRTIQQGLTAM.MGYNPE--A
C5RAD4_WEIPA/240-561LQAIKDS.HAAAAIILPNDGNIFMAAEQAVSLA...DV....P.----------VKVVKTKTIQQGLTALVLGYDQL--K
Q04GL7_OENOB/238-554LNAITSS.KAKNAIIIPNNANIFMAASQAADMS...KI....P.----------VEIVKSKTIQQGLTAM.LGFNPD--A
Q03RT2_LACBA/242-565VDAINQS.QAKRAIVLPNNKNIFLAAEQAAKVA...DI....P.----------SVIVHSKTVSQGMTAM.LGYNPD--A
C0XM56_LACHI/243-571VNAIQET.HAKQVIVLPNNKNIFLAAEQAAEVV...DI....P.----------TAIVHSKTISQGITAM.LGFNPE--N
Q03FX4_PEDPA/244-562VAMINDS.GAKKAIVLPNNKNIFLAAEQAVEVA...DI....P.----------TKIIHSRTISQGMAAM.LEFNPD--V
C0X0A9_LACFE/228-551VKAVNES.GAKQAIILPNNGNIFMAADQAAQVA...NI....P.----------TKVVHAKTIAQGMSSL.LEYNPE--A
C8P937_9LACO/251-577VDAINQS.GAKQALVLPDNGNIFMTAEQAAEVA...EI....P.----------TRVVHAKTIAQAMAAL.LDYNPE--E
C7XUP2_9LACO/252-573ADAINNS.GAKQALVLPDNGNIFMAADQAKDIA...EI....P.----------TAVVHTKTIPQAMTAL.LEFNPD--S
C5F3T1_LACPA/241-558LDAVKAA.HAKHVIVLPNNGNIFMAAEAAAKAAT..DV....E.----------VAVVKSKTINQGMTAM.LGYSPD--A
C2EEW2_9LACO/228-553VDIISAS.SAKKFIIFPNNKNIFLAAKQATELV...DI....P.----------VKVVQSRSVLEGLSGI.FAFNPD--M
E7FR73_9LACO/242-562VDAIAKT.KKDKVIILPNNKNIFLAADQAAEVC...DV....D.----------AVVVPSKTIAQGMAAM.LGFSKD--A
Q38XS7_LACSS/240-556LDAIQAA.NAKKVILLPNNKNIFLAAEQAAEVA...EI....P.----------VEIVQSRTIAQGMTAL.LSFDPS--A
C4VLE0_9LACO/240-551IDTIKKS.GASKAIILPNNGNIIMAAKQAAEVC...DI....P.----------VGIVQTKTISQGLTAM.LAFNPD--A
Q1G9J7_LACDA/246-559MDAITKS.GAKQAIILPNNGNIIMSAKQAAEVA...EI....P.----------VGIVPSKTIQQGLTAM.LAFNPE--A
D0DI19_9LACO/242-553IDAIKKS.GAKKAIVLPNNGNIVMAAKQAAEVS...DI....P.----------VGIVPTKTISQGLTAM.LSFNPD--A
C8PD64_9LACO/243-554IDAINKS.GASKAIILPNNGNIIMAAKQAAEVA...NI....P.----------VGIVPTKTISQGLTAM.LAFDPE--V
C5Q8L3_STAEP/236-552VKVIEQS.QCKRAIILPNNKNIMMASEQAASIV...EA....E.----------TVVIPTKSIPQGISAL.FQYDLE--S
D2N6K1_STAA5/236-548VKVIEQS.KCKRAIILPNNKNILMASEQAASIV...DA....E.----------AVVIPTKSIPQGISAL.FQYDVD--A
D3QDG8_STALH/236-551VKVIEQS.QCKRAIILPNNKNILMASEQAASIV...DA....E.----------AIVIPTKSIPQGIAAL.FQYDEG--S
Y1689_STAHJ/236-552VKVIEQS.QCKRAIILPNNKNIRMSSDQAATLV...EA....D.----------TVVIPTTSIPKGIAAL.FQYDPS--S
Y1546_STAS1/236-552VKIIEQS.QCKRAIILPNNKNILMASEQAAEIV...EA....D.----------TIVIPTKSIPQGIAAL.FNYDET--D
B9DPL0_STACT/236-547VKAIEES.GVKKAIILPNNKNIQMASDQAAEIV...EA....E.----------TVVIPTKWIPQGIGAL.FQYLPD--A
B9EBA4_MACCJ/235-548VKIIEAS.GCKEAVVLPNNKNIIMAAEQAAQVV...DI....P.----------VAVVPSKTIPQGLGAM.LAYNPE--A
C5NX21_9BACL/236-549MKAIKEV.NAKNIFIFPNNKNIQLAAKQAAELA...EE....N.----------VFVVESKTAPQGLAAV.MVYNPQ--A
C1CCK6_STRZJ/240-555IKAVEQV.NARNIIFLPNNKNIFMAAQSAAEVL...EQ....P.----------AVVVEARTLPQGMTSL.LAFDPS--K
A4W3T3_STRS2/240-554VNAIELV.NARNVILLPNNKNILMAAQTAAEVA...EV....A.----------VKVVETKTLPQGFTSL.LAFDPS--R
Q1J4X6_STRPF/240-554VKAIEAV.NAKQVIILPNNKNIFMAAQSAAEVV...DI....P.----------AAVVATRTVPQGFTSL.LAFDPS--K
B1SBP2_9STRE/229-545LKAIDAV.NAKNVIILPNNKNIFMAAQSAAEVS...EV....P.----------AAVVETRTVPQGFTSL.LAFNPT--Q
Q03IJ3_STRTD/240-555VKAIEQV.NAKNVIILPNNKNIFMAAQSATEVV...DV....N.----------AAVVETRTVPQGFRSL.LAFDPN--Q
C6SSR0_STRMN/229-544VKAIESV.KAESIIILPNNKNIFMAAQSAADVV...DV....P.----------AAVVETRTIPQGLTSL.LAFNAA--N
D2BME6_LACLK/237-554LTAIEAV.NAEKVIILPNNKNIFMAAKSAAEVA...EI....P.----------VEVIESATVPQGFTAL.LSFDPT--R
C7U3H1_ENTFL/242-558LKAVKEV.NAEQVIILPNNKNIFMAADQAAEVA...DV....P.----------VAVVPSKTISQGMTAM.LAFNDQ--Q
C9AXQ9_ENTCA/242-560LLAINEV.NADQVIVLPNNKNIFMAAQQAAEVS...EI....P.----------VAVVETRTISQGMTAM.LAFHEQ--S
C2H915_ENTFC/242-560VKAIQEV.NADKVIVLPNNKNIFMAADQAAEVA...DI....P.----------VAVVPSRTISQGLTAM.LSFNDQ--A
A8U9Q7_9LACT/242-557LKAIEEV.NAEKVIILPNNKNIFMAADQAAEVS...DL....S.----------VVVIPSKTVSQGMTAM.LAFNEL--N
C8NGP5_9LACT/242-561LQAVKEA.HAEKVIVLPNNKNIQMAANQAAEVSE..DA....A.----------VAVVATRTISEGLASL.LAFNPE--A
C4FT76_9FIRM/239-557VKAIEAV.NAEQIILLPNNKNIIMAAEQAAQVA...EV....P.----------TVVVPTTTIPQGITAM.MAFDAS--L
D7UVI4_LISGR/239-552TKAIEQV.NAEYVFVLPNNKNIQMAAEQAAEVAG..ND....K.----------VKVIPTRSIPQGLAAL.LAFQED--E
Q4EHP2_LISMN/226-539VKAIESA.NAEQVFVLPNNKNIQMAAEQAAQILG..DD....K.----------VQIIPTKTIPQGLTAV.LSFQAD--Q
C3C6H9_BACTU/240-558VKAIEEA.NAEKIIILPNNGNIVMAAEQAASVV...DQ....E.----------VIVVRSKTVPQGMAAM.LAFNPV--G
B7GGF8_ANOFW/238-552VKAIEEV.NAQTVFVLPNNKNIILAAQQAASVA...SC....D.----------VVVIPSKTVPQGMTAL.LSFNPS--V
C5D8S7_GEOSW/240-558VKAIESI.NAETVFVLPNNKNIIMTAQQAATVV...NQ....K.----------VIVIPSKTVPQGMSAL.LAFNPS--L
Q5L0R2_GEOKA/237-554ADAIRLA.NAETVFVLPNNKNIVMAAKQAAELS...EQ....R.----------VIVIPSKTVPQGLAAL.LAFNPA--Q
Q2B7A4_9BACI/240-560VKAIKDA.NAKKIIILPNNKNIIMAAQQAAEVA...EE....D.----------VVVIPSKTVPQGMAAL.LAFNPG--A
A6CS65_9BACI/239-558VKAVEEV.NAEKVIILPNNKNIIMAANQAAEVI...SG....D.----------VVVVPTKTVPQGMAAL.LAFNPS--V
Q62V69_BACLD/240-556VQAIKDA.NADTVVILPNNSNIVMAANQAADVA...GQ....H.----------VIVIPTKTVPQGMAAL.LAFNPA--L
A8FD49_BACP2/240-559VTAIESV.HAETVFILPNNSNIVMAAKQAATVS...NR....E.----------VVVIPTKTVPQGMSAL.LSLNEA--A
YLOV_BACSU/239-553VDAVKSV.NADTVFILPNNSNIIMAANQAASVV...DE....Q.----------VFVIPAKTVPQGMSAL.LAFNPD--Q
A7Z4K4_BACA2/239-555VEAIQSV.NAETVFILPNNSNIVMAANQAASVA...EE....N.----------VIVIPAKTVPQGMTAL.LAFNPD--Q
A3I4A9_9BACI/235-549VKAVQEI.GAEKVLILPNNKNIVMAAEQAVELL...EI....E.----------AAVVPTKTIPQGMAAI.LAFNPE--A
C4L5Y6_EXISA/239-559VKAIESA.HAEHVFIFPNNSNIIMAAEQAASVA...PC....G.----------VSVIPTKTVPQGLAAA.IAFNPE--A
B1YIP1_EXIS2/249-568VKAIEDA.HAEHVYVYPNNSNIIMAAEQAASVA...SC....G.----------VTVVKSKTVPQGLAAT.IVYNPE--A
Q8ER15_OCEIH/240-552NEAINQT.NAKNVIVLPNNKNILMAAEQAAEIA...DV....N.----------VRVVPTKTIPQGISAV.LSFHPD--V
Q9K9Z6_BACHD/240-557VKAIEEV.HAKNVLVLPNNGNIILVAQQAADVA...DV....N.----------VKVVPSKTVPQGLAAL.LSFNPS--S
D3FT80_BACPE/239-561VRAIEEV.NAEKVIILPNNGNIIMAAEQAAQVV...DA....K.----------AVVIPSKTVPQGLAAL.LAFNPS--D
Q5WFL6_BACSK/240-557VQAIQKA.NAKQVIILPNNGNIVMAAKQAAEVS...EA....D.----------VEVVATKTVPQGLAAL.LAFNPS--N
E6TTN1_BACCJ/240-559VKAIEEA.NADKIILLPNNSNIIMAAEQAASVS...DL....D.----------VVVVPSKSVPQGLGAL.LAFNPV--D
C0ZFY0_BREBN/244-568MKAVAGL.NAQHIIILPNNSNIIMAAQQASELA...EV....P.----------VSVIPTKSIPQGLAAL.ISFRVD--V
D3E5U1_GEOS4/248-586VNAISSI.SAQQIYILPNNSNIVLAAQQARELLEGERS......----------VTVIPSKTIPQGIAAA.FAFQED--E
C6J2C5_9BACL/251-590VKAIRSI.SAQHVFVLPNNSNIILAAQQARDLLEGERN......----------VTVIPSKSIPQGIAAA.FAFQEE--E
C6D4E5_PAESJ/261-606VNAIESL.PAEHIYLLPNNSNIILAAEQAAELSG..RE......----------VTVIPTKTIPQGLAAI.LSFKEE--E
B7C794_9FIRM/230-541VSAVEKL.NADHIFILPNNSNIVLAASQAAQVCS..NQ....D.----------IHVLPSKTIPQGLSAC.VMFNPD--V
A8REK2_9FIRM/228-542VEAIKKV.NAENIFLLPNNSNIVMAAQQAAIVCE..DE....N.----------VHVIPSKTIPQGLCAC.INFNPD--I
E7FUT6_ERYRH/228-541VALINSI.DADHIFILPNNSNIIMAAKQAQDICE..DK....D.----------IHVIETKTIPQGLSAC.VMFNPD--V
B0N2X3_9FIRM/230-551VQAVRDV.NAKNVIILPNNSNIVMTAQQTATILE..DE...VN.----------VIVIPTKTIPQGLSAC.IMFNPD--A
A9NEV2_ACHLI/238-560IKAIEAV.NADNVIILPNNSNIILTAEQAASLTE..NQ....N.----------VSVLKTKTVAQGYSAM.ISFDPT--A
A8SBE9_9FIRM/237-564LAAIQSV.PAKTVFVLPNNKNIIMAAEQAQKLA...DR....Q.----------VVVLPTRTVPMGITAL.LNFDPS--V
D1PLR2_9FIRM/236-561LAAIQSV.PAKTVLVLPNNKNIIMASEQAQKLA...DR....K.----------VIVLPTRTVPQGMTAM.LNFDPE--V
D4JU96_9FIRM/229-544LEAINAT.PARNIFVLPNNKNIIMAAEQAVKLT...DR....N.----------VIVLQTRTIPQGITAM.LAFDES--S
C0E9S3_9CLOT/234-550LSAIHSV.PAKTVFVLPNNKNIIMAAEQAEKLA...DR....K.----------VCVLQTRTIPQGISAM.LAFDPD--R
B0PDV8_9FIRM/236-554LSAVHAT.PAKTVFVLPNNKNIIMAAEQATKLA...DR....R.----------VIVLQTRTIPQGLSAM.LAFDAD--A
D4L902_9FIRM/231-548YEAIMAT.PAKNVLVLPNNKNIILAAEQTIPMVK..DR....N.----------VIIVPTRTIPQGMTAM.LNFDPE--I
A7VZD4_9CLOT/242-566LAAVMAT.PAKKVYVLPNNKNIILAAEQAAELAK..DR....T.----------VVVVPTRTIPQGIAAM.LAFDPD--L
E6U6Q7_ETHHY/232-536LKAVEGV.AAQTVFILPNNKNILMAAEQAAALSA..GK......----------ARVLHTKTIPQGMTAM.LAYLPD--A
A6NT49_9FIRM/241-558MREIDKT.PAEVVFVLPNNKNIIMAAEQCIRLVE..GK....K.----------VVVLPSKTVPQGISAL.LAFDPD--S
B7ATY7_9FIRM/235-571LNAVDKV.NADTVFVLPNNKNIILAAQQAASIVE..DK....K.----------IVVIPSKTVPQGITAM.FNYEIA--R
C4Z046_EUBE2/238-567LNAADKI.NAKTIYVLPNNSNIILAANQAASIVE..DK....E.----------LIVIPTKTVPQGITAM.INFETT--R
C4G384_ABIDE/245-571LNAIDKV.NADNIFILPNNKNIILAANQAKELTE..DK....N.----------VIVIPSKTVPQGISAV.INYIHD--G
A5ZQF2_9FIRM/220-541LNAIDKV.NAKTIYILPNNKNIILAANQARDLTE..DK....E.----------IIVIPTKTIPQGVTAL.ISFVPE--K
C0CI33_9FIRM/234-555LNAIDRV.NADTIYIFPNNKNIILAANQARDLTE..DK....K.----------IVVIPTKTIPQGISAM.ISYVPE--K
C9L650_RUMHA/223-540LQAISHV.NAKNIFIFPNNKNIILAANQARDLTE..DK....N.----------IIVIPTKTIPQGITAL.ISYVPD--K
C6LER9_9FIRM/221-545LNAIDQV.NADTIYILPNNKNIILAANQAQALTK..DK....Q.----------IVVIPTRTVPQGISAI.INFAPD--K
B0G5R1_9FIRM/234-558LKAIDQV.NAETIFILPNNKNIILAANQAKDLVE..DK....E.----------IIVIPTKTVPQGITAI.INFVPD--A
A7B4K5_RUMGN/233-550LTAIDAV.NADHIFILPNNKNIVLAANQAKDLTK..DK....D.----------IIVIPTKTVPQGITAI.INYMPE--E
C0BWD3_9CLOT/224-547LNAIEQV.NADTVFILPNNKNIVLAANQAKALVE..DK....D.----------IIVIPTKTVPQGITAV.INFMPE--A
B6FRX3_9CLOT/69-388LNAIDEV.NAKHVFIFPNNKNITLAANQAKSLVK..DK....E.----------VIVIPTKTVPQGITAI.INFVPD--L
A9KPH5_CLOPH/237-560LNAIDNV.NADTIFILPNNSNIILAAEQAKALTE..DK....E.----------IVVIPSKTVPQGITAI.INYVYD--K
A5Z3S4_9FIRM/232-549LNAIDKI.NADNIYVLPNNKNIILAAQQAESLVE..DK....N.----------IIVIPSKTIPQGISAM.IGFIPD--N
C4Z9X2_EUBR3/220-552LNAIEHV.NAKTVFILPNNKNIIMAANQAVDLVE..DK....Q.----------IIVIPTKTIPQGITAL.VNYIPD--H
C0FY34_9FIRM/239-571LNAIEKV.NAKNIFILPNNKNIIMAANQAASLTE..DK....N.----------IIVIPTKTIPQGITAL.VNYIPD--S
C7G7M6_9FIRM/240-565LNAIEKV.NAKTVFILPNNKNIILAANQAASLVE..DK....K.----------IIVIPTKTIPQGITAL.INYIPD--S
C0EVE2_9FIRM/237-569LNAIEQV.NAKNIFILPNNKNIILAAEQARDLTE..DK....K.----------IIVLPTKTIPQGISAM.IGYMPE--A
B0M9Z1_9FIRM/232-546LNAIAQV.NADHVFILPNNKNIILAAQQAKALVE..EK....E.----------IIIIPTKTVPQGISAL.IAFEAE--S
D4MYY8_9FIRM/239-553LNAIEQV.NAETVFILPNNKNIILAATQAQSLVE..DK....N.----------VVIIPTTTVPQGISAI.IGFDPE--A
A8SPK6_9FIRM/236-563LNAIDVV.NAENIFILPNNKNVVLAANQAATLCE..DK....N.----------IIVVPTANAPQGISAM.IAFDST--V
A7VBL4_9CLOT/234-560LNAIEKV.HAENIFIFPNNKNVVLAANQAAGLCE..DK....N.----------IIVLATANAPQGISAM.IAFDST--M
D4CER5_9CLOT/251-574QKAVEQV.NAENVYILPNNKNIILAAEQAAGLVS..DR....K.----------AVVVPSKTVPQGITAL.INFAPD--L
C5EUI7_9FIRM/240-566LNAIDKV.NADNIFILPNNKNIIMAAQQARDLTE..DK....N.----------IIVIPSKTVPQGITAL.VNFMPD--L
C0D0L6_9CLOT/238-564LNAIDKV.SADNIFILPNNKNIILAAQQASSLVE..DK....N.----------IIVIPSKTVPQGITAL.VNFMPD--L
D4CN13_9FIRM/241-565LKAAEGL.RAKHIFILPNNKNIVLAANQAAALSE..GG....E.----------LHVIPSLTIPQGISAM.IAFSPD--M
C2KWS6_9FIRM/238-567CAAVEKI.HAKHVFILPNNKNILLAAQQVKDILE..DR....S.----------VSVVPSKTIPQGISAM.ISFQPE--G
B1IIK7_CLOBK/230-541VKAINKI.NAENIFILPNNKNIIMAATQAAELS...EK....N.----------IIVIPTKTIPQGITSI.TMFNPE--A
Q895P1_CLOTE/232-546IKAIDKI.NAENIFILPNNKNIIMAAKQAKELS...DK....N.----------IHVIETKTIPQGVTAL.TMFNFE--G
A0Q104_CLONN/236-554IERINKI.NAKNIFILPNNKNIIMAAEQAAELS...DK....N.----------VIVIKTKTIPQGITAV.TVFDSS--E
C6PUV3_9CLOT/231-545LECINKI.NAENILVFPNNKNIIMAANQAAEIS...DK....N.----------VKVVETKTIPQGITAI.TSFNQE--L
A5N7Z4_CLOK5/231-555LNCINKL.NAENIFVLPNNKNIIMAANQAAELS...DK....V.----------VKVIPTKTIPQGITAI.TVFNPG--E
B1RQ99_CLOPF/234-548LEAIEKL.NAEHIFILPNNKNIIMAANQAAEIS...DK....D.----------IRVIPTKTIPQGITCI.TMFNPE--A
C1I7N0_9CLOT/231-556MECISKL.NADHIFVLPNNKNIIMSANQAAEIS...DK....D.----------VKVIPTTTIPQGITCI.TMFNPE--V
C4IJG6_CLOBU/231-551LEAINKI.NAEHIFILPNNKNIIMAANQASEIS...DK....D.----------IRVIPTTSIPQGIACV.TMFNPD--S
A6LSK9_CLOB8/231-546LDAVEKI.NAEHIFIMPNNKNIIMAANQAAEIS...SK....N.----------ILVVPTTTIPQGIACA.TMFNHD--S
B2TJ09_CLOBB/232-548LDCIEKL.NADHIFVMPNNKNIIMAANQAAEIS...DK....H.----------IIVIPTTTIPQGIACI.TMFNPE--C
Q97IB5_CLOAB/232-547LSSINSI.NAKNIFVFPNNKNIIMAANQASELS...DK....N.----------VVVIPTKTIPQGITCM.TEFEYD--G
D9SLB2_CLOC7/231-546LSNIEKL.NADVIYILPNNKNIIMAANQAAEIT...DK....K.----------VYVIPTKTIPQGVTAL.TTFNPE--A
B6FZ18_9FIRM/234-544MKAIDKI.HAKNIFILPNNSNIIMAANQAKELS...DK....N.----------IIVIPTKNIPQAVSAL.VGFNPE--A
C9YPD2_CLODR/235-547MNAIKHI.NAKNIFIFPNNSNIIMAANQAKELS...DK....N.----------IIVIPTKNTPQGFAAL.VTFNGE--L
B0AAY8_9FIRM/232-545MNAIDKM.NANNIIILPNNSNIIMAANQAKDLS...DK....N.----------IIVIPTKNVSQAFAAL.VNFDAD--L
D3MPQ7_9FIRM/235-560MNAVGAV.NAEHIFILPNNSNVIMAANQAKELS...DK....D.----------VYVVPTKNIPQGISSL.INFEPD--A
A8MH97_ALKOO/232-548IKAIENI.NAETIFILPNNSNVLMAANQAKSIS...DK....N.----------IIVIPSKSVPQGLSAL.LAVNLD--A
A6TRV4_ALKMQ/231-542VEAIENI.NAETVFIMPNNSNIIMAANQAKDLS...AK....N.----------ILVIPTKTIPQGISAL.LAFNNE--S
B1C9C9_9FIRM/230-550LDIIDNT.NGKNYILMPNNKNIIMAATQAKEIS...EK....N.----------IEVVKTRTIPECIAAL.MVFEPD--S
D1VSD4_9FIRM/236-553LKGIEEI.NADRIYILPNNSNIILAAETARDIS...TK....D.----------IVVIPSKSIPQGVAAM.LAFNEL--K
A8SMH4_9FIRM/227-540LNAVEKI.NADDIFVFPNNSNIILVSEQAAKIS...KK....R.----------LHVIKTKQIPQAFSSL.FNFDES--L
B0S152_FINM2/230-541VNSIEKV.NAKTVYVFPNNKNIILSANQAKQIV...DK....Q.----------VYVVETKAVPQSISAL.LAFNEE--A
Q4A591_MYCS5/234-550IAAINEV.NAKNVFVLPNNSNIILAAQQAAQMIK..NK....N.----------VIIIPSKTQVQGISAA.LNFNAE--L
C4XDU6_MYCFE/229-541IDAINSV.NSKNVFILPNNSNIFLAAEQAAQAIT..NK....K.----------VFIIQTRSQIQGLTAL.MNFNSE--S
D3VQS9_MYCA6/233-548LEAIKSV.DAKDVFVLPNNPNIFLAAEQAASGIF..DK....N.----------VHIIPTRTQIQGINAI.IAFNSN--S
Q6KHN1_MYCMO/228-542IEAIKQV.NSDNIFILPNNSNIILAAQQAAQIVT..DK....N.----------VYVVPTKTQMEGISAI.FNFNKE--L
Q98R49_MYCPU/230-545MEAIESV.GAPNVFVLPNNSNIFLAAQQAAQTVK..DK....N.----------VYVMQTKSQVEGIVAM.EYFNHE--A
D1J8Q5_MYCHP/228-542VNAINAV.NAKTVFVLPNNSNIILSAQQAGTIIR..DK....N.----------VIIIPTRSQVQGLNVA.LNYSSE--N
B3PN92_MYCA5/229-546VKAADAV.DSKTVFILTNNSNIILSAQQASTIVT..DK....K.----------IITIPTKSQAQCLSVA.MNFNED--A
C5J6D6_MYCCR/231-544SDAIEKI.EAKSFFILPNEKNFLLVANQVAKWYKKDNR...AKK----------IIIMPSNNQLMGQYLA.EHFHPD--T
B2NEH1_UREUR/237-564VDEINTT.NAAQVFIVTDDSNIVLAAEQASKIAAENNV....L.----------VSVIGAYNVFEALLAI.SHFEQQ--N
D3FH26_MYCGH/234-574VKNIYSV.KSKNVIIVVDDTNLLLSAKEAIALLKKHIN......----------CELISCQNFIEALSAI.SGYMRS--D
Y369_MYCGE/238-557LEAVKLT.NSSNVIFLLHDKNYFLSANETIKQLKHQKI....N.----------ADYVITANPVESIAAL.TVFNSD--L
Y547_MYCPN/239-558LEAVKLT.HSSNIIFLLHDKNYFLSANEALKQLKHQKI....S.----------ADCVMTTNPIESLAAL.TVFNSD--L
Q8EVZ4_MYCPE/248-573MNQIINC.KSRNILVLTDDSNIILSAEQAATFMKERYD......----------VVVLKSKNIIEVINAC.LVFSSE--K
Q14LS2_SPICI/227-539LNAIEAV.DAVDVFILPNNSNAILAAQQAAKVE...RK....SN----------VYIVPTTSIQEGMVAA.LSFEPG--E
Q2SS00_MYCCT/225-547LQAIEAV.DAKTVFLLPNSGNVYLTAKQAEKLE...TK....SK----------IYVIQTKSIQQGMVAI.LSFDPS--L
Q6F1N7_MESFL/225-548LKAIEEV.DAKAVYLMPNNGNVLLAAKQAEKEE...TK....SK----------IIVIPTKTIQQGMTAA.LSFDPS--A
B1VB30_PHYAS/245-554LKVINQI.DSPYIFIFPNNLETLNELKKNTILSQKDQK......----------IIIAPSKNIAQTYSAL.LAFDPS--L
Q2NK36_AYWBP/239-571AKLLQKN.TAQNIIILPNDTSLLEKLTTQLKQFKKNNQ....E.----------IVILQTKNIAQGYSAL.LAFDKS--L
B0K1Y0_THEPX/233-533LEGIKKI.NAENILVFPNNKNIIMACEQAKALS...NK....K.----------VEIIPTNNFNEAITAI.VNIDTE--K
Q8R9U3_THETN/225-525LQGIEKI.NAEYIFVFPNNKNIVMACEQAKKLT...DK....K.----------VKVISTRNFNEAVTAI.LALDLE--K
C9N026_9FUSO/239-542LNAIDKA.EKENVYVLPNNKNVITTAKMAAEKS...QK....T.----------VMVLDTKTMLDGYYFL.......--K
D0GPN7_9FUSO/239-542LSAIDKV.EKTNVYVLPNNKNVITTAKMAAEKS...GK....N.----------TIVYETKTMLEGYYCL.......--K
D1AJX8_SEBTE/238-542LNALEKL.DKKIIYIYPNNKNIISTAKLACGKS...DK....N.----------AVVMETRTMLEGNFYI.......--K
D1AVV3_STRM9/236-535LNAIAKINNNKQIVILPNNKNVISTANIAAEKT...EK....N.----------VLVVPTKTMMEGYYYL.......--N
Q7P8L0_FUSNV/238-555EEGLKKI.HAKTIYILPNNKNIIASAKLAAKRD...KR....D.----------IIVIDTKTMLEGYYFT.......--K
C6JQ39_FUSVA/240-546EEGLKRI.NAEEIVILPNNKNIISAAKMAAERS...NK....K.----------IMVLETKSMLEGHYII.......--K
C3WC47_FUSMR/240-543EEGIKKI.QSNKIILLPNNKNIISTAKIVAERS...KK....D.----------ILVLETKSMLEGYYLV.......--K
B5YEA3_DICT6/236-544SNAVEKV.RARKVFILPNNKNVILAAKQLESIHK..DR......----------VVIIPTKHVLEGIRVL.YEYNPK--D
B5Y797_COPPD/228-524LDGVKHV.HSNKVYILPNNPNIILSAEQVRELT...DK....E.----------VVVIPTKNPAQAAVGLSLYFGVE--D
A5ILK4_THEP1/226-528KAAVERT.HARNVFLFPNNANVLLTAKQIAEAFD..DR....R.----------VIVIPTSFVQECVAAM.VEYDPD--A
A7HN75_FERNB/228-537LNGIRRV.NAENVIVFPNNANIILAAEQASKVAESEGI....K.----------VYVIKSRNVQENIMAM..IYRTG--E
B7IFW1_THEAB/228-537KAAVESV.NAENVFVFPNNSNIILAAKQVAETVK..DK....A.----------VYVVESKNVQECIAAL.IRNIPD--E
A6LJM3_THEM4/228-537KVAVESV.NAENIFVFPNNSNIILAAKQVAETVK..DK....N.----------VYVVETKNVQECIASM.IKNNPE--E
A8F8T1_THELT/233-540KFAIDRV.NAEIIFLFPNNPNIFLAAKQAAENTK..GK....N.----------VIVIPTQTVQECISSM.MSFDPN--E
A9BG53_PETMO/231-555SDAINKV.PQKKVIILPNNPNIILAAEKAAELTD..KE......----------ILILPTKHIQEGISAL.LGFDDN--M
C5CI85_KOSOT/233-554YDSIERL.EPNVVILLPNNPNIILTAKEAANAVM..EKNPAKK.----------VYIIPTRSVQEGISAL.AVYDDS--M
A4XKD8_CALS8/229-545ISAIKNV.PAKNIFVFPNNKNVIMSAELSLQLIN..TK...KN.----------IKVVKTNNIPECIAAL.IRFDIN--S
B9MRL9_ANATD/229-545VNAIKNV.PAKNVFIFPNNKNVIMSAELSLQLIN..TN...KN.----------IVIMKTTNIPECITAM.IKFDLN--K
B2A2L3_NATTJ/236-554INAINQI.PESSVILLPNNKNIIMACEQAKEIS...DK....Q.----------VEVIPTKTIPQGISSM.MAFDPE--A
B8CWU7_HALOH/238-549LEAINNL.NSSEIIILPNNKNIISAAEQAASLS...DK....D.----------VVVIPTKTIPQAVSSM.MVFNDE--A
Q3ABX4_CARHZ/233-531VEAINRV.PATKVIVFPNNKNIILAAEQAKNLTN..KS......----------VTIVNTKNPAQTVAVS.LYFDEN--A
C9LL18_9FIRM/236-538NAGIENG.RYDKYILLPNNKNIILAAQQLQKMLG..EK......----------IHIVPSVNPMEGLAAA.MAFMDN--I

PF02733

DHAK_ECOLI/16-356AELGRKLNNQGHSIGIALGACTVPAAGKPSFT......----------------.....LADNEMEFGVG-IHGEPG--I
DAK1_SCHPO/17-344TTIAKAAIDNLVSIGASLAHVHVPGHEPIAKE......----------------...DEMKHDEMELGMG-IHNEPG--C
DAK_PICAN/17-355YQLGEAVVANLVTIGASLDHCTIPGNRHHESESDDE.D----------------EQKHLLKEDEIEVGMG-IHNESG--I
Q9RJR0_STRCO/16-335LRVAERAGVRTRSFGIAFSGCTLPGADHPLFT......----------------.....VPEARMAVGLG-IHGEPG--I
DHBK_SOLLC/22-345AAEAKRASEMVGTMGVALSVCTSPGQVTSDR.......----------------.....LGPGKMELGLG-IHGEPG--A
DAK2_YEAST/17-345AEVAQSVVDNSVTIAASLDHCTVPGHKPEAI.......----------------.....LGENEYEIGMG-IHNESG--T
DAK1_YEAST/16-344AKVAKIINDNLVTIGSSLDHCKVPGRKFESE.......----------------.....LNEKQMELGMG-IHNEPG--V
DAK_PICPA/17-357VTFGEKVVANLVTIGASLDHVTIPARANKQEEDDSDDE----------------HGYEVLKHDEFEIGMG-IHNEPG--I
DAK2_SCHPO/17-345AQVAQSVIDNAATIAASLDHCAVPGRKFETN.......----------------.....LGPDEYEIGMG-IHNEPG--T

PF03610

C4ZTN9_ECOBW/4-122-----------------------------------------------------------------------AAGIDDPQN
PTNAB_SHIFL/4-119-----------------------------------------------------------------------IDFVPG..E
Q48519_LACCU/3-117-----------------------------------------------------------------------VPFLKG..E
Q98CM1_RHILO/3-116-----------------------------------------------------------------------VAIGAD..D
Q97QN0_STRPN/5-114-----------------------------------------------------------------------VRGTEG..G
Q9CMJ0_PASMU/4-120-----------------------------------------------------------------------IDFVPG..E
PTFA_BACSU/3-117-----------------------------------------------------------------------VPFFKG..E
Q9K7G6_BACHD/7-116-----------------------------------------------------------------------AGGTDD..D
Q9CEX8_LACLA/4-123-----------------------------------------------------------------------VTFMPS..E
Q99VW9_STAAM/3-113-----------------------------------------------------------------------IGGLPD..G
Q97SL1_STRPN/2-115-----------------------------------------------------------------------IDFVEG..M
YADI_ECOLI/3-117-----------------------------------------------------------------------VNFWRG..L
Q8R8K1_THETN/8-123-----------------------------------------------------------------------AGGTPD..G
Q8XH56_CLOPE/3-118-----------------------------------------------------------------------VSLKRG..Q
Q97N91_STRPN/5-123-----------------------------------------------------------------------LGLMPG..E
Q9RZR3_DEIRA/4-120-----------------------------------------------------------------------VGGTDD..G
Q8R5U5_THETN/552-666-----------------------------------------------------------------------YNMPLD..Q
Q8YA15_LISMO/3-118-----------------------------------------------------------------------SGGTGD..G
Q9KIQ1_ECOLX/3-117-----------------------------------------------------------------------IDVPET..S
Q9JXH6_NEIMB/10-123-----------------------------------------------------------------------LGVQPT..E
Q9ABI7_CAUCR/15-129-----------------------------------------------------------------------ICIGPE..D
Q9S4L5_STRSL/4-123-----------------------------------------------------------------------VTFMPS..E
Q8VP39_ECOLX/3-120-----------------------------------------------------------------------AAGIDDPQN
Q97T86_STRPN/4-118-----------------------------------------------------------------------VALLPE..D
PTRA_KLEPN/3-115-----------------------------------------------------------------------VAFVPG..E
Q9FC13_STRCO/2-118-----------------------------------------------------------------------AGGTAS..G
Q98C52_RHILO/5-120-----------------------------------------------------------------------CGGNGH..G
Q927E4_LISIN/6-115-----------------------------------------------------------------------AGGTED..G
P96165_VIBFU/3-117-----------------------------------------------------------------------IDFPEQ..M
Q9A0T2_STRP1/3-117-----------------------------------------------------------------------IDFTTE..M
Q8P225_STRP8/5-114-----------------------------------------------------------------------VGGTED..G
Q8RHZ6_FUSNN/5-122-----------------------------------------------------------------------GSGTDG..N
Q97TN2_CLOAB/3-119-----------------------------------------------------------------------VTLMPS..E
Q9RGG5_LACCA/2-115-----------------------------------------------------------------------IDFTPK..E
Q97J29_CLOAB/3-121-----------------------------------------------------------------------QGLEDG..M
DHAM_LACLA/4-113-----------------------------------------------------------------------IGGLEN..G

PF02645

Y1149_STRPQ/3-279AKAGA.SLN-EILAAVQAIKSKT..ELYIGVSTLENL-VKGG...........RIG---RVTGVLSSLLNVKVVMAL---
Y1667_STRPQ/2-283RDSGK.NLL-ETKDIVEAVIPRL..RTYFLVDDLFHL-MRGG...........RLS---KGSAFLGSLASIKPLLWI---
Y1478_STRPQ/2-279INLGL.SFE-EVVKQITAYQQKT..RLIFVLAKVDNL-VKNG...........RLS---KLVGKVIGLLNIRMVGKA---
Y586_STRPQ/2-281SRQGM.TFQ-AILNKLQEQIDGT..TAFIMVDDLNHL-VKGG...........RLS---NGSALLGNLLSIKPILRF---
Y1557_STRPN/2-281RDQGD.DFA-SIQDKLAIQISRT..SAFIMVDDLDHL-VKGG...........RLS---NGAAILGNLLSIKPILYF---
Y3627_BACHD/3-282VKEGA.DPQ-TIIDHLDEVKKRT..NALFVVHDLSHL-HRGG...........RLN---AAQLVVGSLLKIKPILHF---
Y2509_CLOPE/3-280VKEGK.SFE-EIIEALSIIREAT..TGFYTLNTLEYL-RRGG...........RIG---KVAGTVGDLLHLKPIISV---
Y1903_DEIRA/1-281ADQGA.DFG-QIARALAELRERT..LLTFAVESLDFL-RVNG...........RIG---NVAAFIGNWLGLRPLLAV---
Q65EA6_BACLD/2-280AEKGA.APE-EIIRHLDHMKTSM..RAYFMVDDLSHL-QRGG...........RLS---GAQAFVGSLLKVKPILHF---
Y2514_LISMO/4-283ALANE.PLD-QIIQKLDKIKQAQ..DAYFMVDDLNNL-QRGG...........RLN---GAQALVGSLLQIKPILHF---
Q9I599_PSEAE/2-314LAQGS.HPN-ALRTRLEQLSQQT..CTYLVADDLGHL-RRRGFQKGDRSGFVDRVK---GAALGLGSLLDVKPVFSL---
Y500_DEIRA/6-281AQRGE.SME-TAIAWMNAVQAET..ELQFTIETLEYL-RRGG...........RIG---TVAAALGGLLNLKPVVMV---
Y2569_STRCO/4-281AEAGG.TVD-EAVTAAEKRAAGT..SAYFYVDTLDYL-RRGG...........RIG---AAQALFGSALAVKPLLQL---
Y359_MYCPU/2-276IGQNQ.SFD-EELKKLSHWDESQ..KVLLIPEYNDAL-VAGG...........RLS---PKAAALAKVLKVVPIIKF---
Y326_MYCGE/3-293VDKGC.DNQ-TIKAKVESHKQNI..LSAVTLKNLVQM-RKGG...........RIS---GLKKFITTLLRVKPIILF---
Y1986_DEIRA/2-279VRAGQ.SVP-QIVQTLERVYPQA..DLRFTVDTLDFL-RLNG...........RIG---GASALLGGLLNIKPLLVV---
Y1468_THEMA/2-284LENGA.TIE-EVLKKLDERMKNKDFKAIFYVSNFDYL-VKGG...........RVS---KFQGFVGNLLKIRVCLHI---
Y472_MYCPN/2-290TDTNC.PTK-AIAEVVDQHKQSI..FTAVTVKNLVQL-RKGG...........RIS---GLKKIIATLLRVKPIIFF---
Y3284_CLOAB/2-281AMDGK.SLE-EVKLAAEENMKKS..RFLFIPDNLVYL-KKGG...........RIG---GAGALIGNLLKIIPILTV---
Y701_CLOAB/3-278REEGK.SFE-EIKNEIIETIPHV..KSALAFERLDNL-IKGG...........RLS---KTAGTIGNLLGIKLILEV---
Q8RHS1_FUSNN/563-843IKSGV.KLD-DILTRLYEIADKM..KVYFAVSDLTYL-EKGG...........RIG---RASSVIGNLLKLRPVLKL---
YTEA_LACLA/2-285RDSGK.SLT-ETLEVLSDIIPRL..QSRFMVDDLNHL-ARGG...........RIP---KAVALVGTMANIKPLLDV---
Y026_CLOPE/3-287KKDGK.SID-EIYSWVEENKNKL..CHYFTVDSLDHL-KRGG...........RIS---STAAAIGSLLSIKPMLYV---
Q9CHY7_LACLA/316-595ISEER.SIE-SVLNETEKITDRI..FIYVVVEDLSPM-INSG...........RIP---KILGETAQKLSMHP